The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
161
|
structure length |
161
|
Chain Sequence |
MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSGADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCHLLNDPDNGPFVPEVGTLWILP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Insights into the cross-immunity mechanism within effector families of bacteria type VI secretion system from the structure of StTae4-EcTai4 complex
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Salmonella typhimurium
|
molecule keywords |
Putative cytoplasmic protein
|
total genus |
36
|
structure length |
161
|
sequence length |
161
|
chains with identical sequence |
B, C, D, E, F, G, H
|
ec nomenclature |
ec
3.5.1.4: Amidase. |
pdb deposition date | 2013-03-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF14113 | Tae4 | Type VI secretion system (T6SS), amidase effector protein 4 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | endopeptidase fold (from Nostoc punctiforme) | endopeptidase fold (from Nostoc punctiforme) |
#chains in the Genus database with same CATH superfamily 4HFF A; 4HFL A; 4J30 A; 4JUR A; 4HFK A; 4J32 A; #chains in the Genus database with same CATH topology 4HFF A; 4Q4N A; 4FGD A; 2IOB A; 2WP7 A; 4HFL A; 2IF6 A; 4HPE A; 4HZB A; 3A2Z A; 4J30 A; 2EVR A; 4LJ1 A; 2IO7 A; 4FQB A; 3NE0 A; 3GT2 A; 3M1U A; 2IO8 A; 3PBC A; 4OLK A; 4CT3 A; 2VPS A; 2IO9 A; 3O98 A; 2IOA A; 2VPM A; 4CGK A; 4FGI A; 3H41 A; 2K3A A; 4FGE A; 3VPI A; 4FQA A; 2K1G A; 3PBI A; 3EBQ A; 4FDY A; 3I86 A; 3A30 A; 4F0V A; 3NPF A; 4F4M A; 2FG0 A; 4Q4T A; 4HZ9 A; 2XIV A; 2HBW A; 3PVQ A; 4J32 A; 3S0Q A; 2LRJ A; 4EQ8 A; 4R0K A; 3KW0 A; 4CSH A; 4EOB A; 4F0W A; 4JUR A; 3A2Y A; 2VOB A; 4JXB A; 3VPJ A; 4Q4G X; 4EQA A; 4HFK A; #chains in the Genus database with same CATH homology 4HFF A; 4HFL A; 2WP7 A; 3EBQ A; 4J30 A; 4JUR A; 4HFK A; 4J32 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...