4JUTA

Crystal structure of a mutant fragment of human hspb6
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
84
Chain Sequence
b'ALPVAQPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHAARPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein beta-6
publication title Molecular structure and dynamics of the dimeric human small heat shock protein HSPB6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 12
structure length 84
sequence length 88
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jutA01
5DS2A 4PCKA 4I88A 1SHSA 2WJ5A 3L1GA 3GLAA 3VQLA 4ELDA 2Y22A 2KMWA 3Q9QA 2JKIS 2RH0A 3J07A 3QORD 4JUTA 4MJHA 4YL9A 2Y1ZA 3AABA 3EUDA 3AACA 3QORA 4YDZA 1RL1A 1EJFA 1X5MA 4JUSA 4ZJ9A 1WH0A 3N3EA 4YE0A 3VQMA 3L1EA 4YLBA 3Q9PA 3W1ZA 2CG9X 4M5SA 2N0KA 2KLRA 2CR0A 3QORB 4M5TA 3IGFA 2WJ7A 2Y1YA 2XCMC 3GUFA 1WFIA 5LUMA 4PBDA 5DS1A 2BOLA 4FEIA 4RZKA 4YLCA 3GT6A 2K8QA 1GMEA 2O30A 1WGVA 2N3JA 3L1FA 2MNWA 3QORC
chains in the Genus database with same CATH superfamily
1HYSC 3MOQA 3QEQD 1Q72H 5INDB 3O6FC 1DBBH 3NEEA 4IRJA 4FLHA 2BMKA 4F9PC 1G7IA 1FG9C 1G4MA 3M1OA 4DQOL 4E9TA 4M02A 4EVNA 2H1XA 3NA9L 5LQBH 5FO8A 2APFA 2WD0A 5H94A 3T2LA 3OF6D 4LSTH 4HIHA 2HFGL 2WUCL 4PY7B 5A7EA 4NM8H 3HAEG 4RAVA 5DJ8A 1KF9B 3ARVA 4DN3L 1RZGA 3O8XB 3HAEH 4G80A 4GW4B 4YDVA 2GY5A 1ZAGA 3RNKB 4JL1A 3V0VB 5KSAB 1D2OA 1RSYA 3SYQA 4UM8A 1ORQB 2CKBL 3ISRA 1T89A 2VMJA 4L3EA 5GS2H 3LVEA 5LB1A 1G9ML 1JOIA 2PO6D 3VGHA 4JBSA 2VXVH 2WLYA 3P40A 5JDSB 4IHOA 5GGRB 2KLRA 1WO2A 5EBWA 3VXTA 2BHFA 3VXUD 2E8ZA 3QI9C 3L7FA 3VYNA 2WN2A 4G43B 2FIRT 5BJTB 2FWOA 2VSKB 4Y4KB 4YHLH 4PS8A 1B3JA 3F2LA 4ZMNA 5IOPA 4JNXA 1HS6A 1Y6NR 4NPYA 4YC2B 3JTBA 2PCPA 4M62H 3UYRH 1D7DA 3E2HC 4LLUA 5CEZH 1H15B 4YK4B 2AMUA 3ZSSA 1BX2B 1U42A 4XMXA 3MROA 1IO4C 2J21A 4YE4L 3IXAA 3RWHB 2OMZB 4CMHC 1AD9A 5HGBB 4ENEC 2LW3A 5F6IB 2YS4A 2VDPL 1AY1L 1N6UA 3CVHB 5F7NC 5HY9B 4XAWH 2HZHA 3IBEA 3E9UA 1PY9A 3OKDB 3L9RA 4FNTA 4LT7A 1FWXA 4Q9BA 3SOBL 2Z8VC 2OMYA 2NY6D 4L2LA 3VGEA 5GGRY 5DFAA 1UJ3C 2Y6SD 2WHVA 1SDDA 1NCBH 3UJJL 3QCTL 4EN3D 3RZCB 4BCXA 1YC8A 1IM3D 3IDGA 3I6GB 3I6KA 4FG6D 1I31A 1Q1JL 4UBDD 5FR3A 5JIKA 3K5RA 3F00A 5GZND 4IKJA 4BDVA 2WOYA 4FYSA 2I5YL 1RP9A 4HLJA 2J6EH 4IOIA 4QIRA 5DUBA 4JN1L 3EUUA 4UV7H 1FRGH 2BCMA 1O6SA 2COQA 1D6VL 4ZS7L 3CDFA 5F70A 1DN0B 1QG3A 1NEZA 5BZDB 4X0KB 5C2BL 5ISZE 1E28B 2FQEA 3O2VH 1ZV2A 1YY8A 4HJIA 2Z0BA 1KJMA 4AXWA 2OX5B 2ARJB 1YEEL 3RWJA 3GRGA 2PP7A 3C60A 1CICA 1QFWH 4XNMB 3SGDH 4MAYD 3HE6B 3N43F 1ZJBA 3IFLL 3WN5B 4FQIH 1G1YA 5DZAA 5CJQL 4RDQG 3EYSL 4TTDD 3CMOH 4YBQC 5JPMB 1GA2A 5MEOA 4AIZA 3B2DC 3PNRB 5DFVC 3V8OA 2EIZB 4HH9B 3ULSA 5IMKB 2WTRB 3OVUB 1JWUA 4TVSa 5DQDH 3WY4A 4CVXB 1N7MH 1OGAE 1NGZA 2EO9A 1BWMA 4WI2A 4MJIE 4HETA 4PJ9D 5C0CA 3U4KA 2VQUA 2R1YA 1RZKH 4HJUA 3REWB 2WIIB 4P46C 4X83A 2WZ0A 2HH0H 2JK5B 1WT5A 4FC3E 4X5LA 3GS7A 2EDOA 1E2ZA 2X6CA 3AB0B 2CR6A 3WE6B 2O61B 1I1FA 2Z93A 4A6YL 4N0YL 5KSBE 1KN4H 2UZIH 4JO8A 1JDAA 5DHVH 5AW8B 1F86A 1SJHA 3PWPD 1EX0A 4HKXB 4YLQT 3GMPA 4L3FA 2JCCB 2AEQL 4LQFH 4XOAA 2BC4A 5IMOA 1GZPB 1QEXA 3L1FA 4I77L 1GXEA 2K8MA 2Q20A 3T4AC 4XAKD 3KPOB 2RQ8A 1S78C 1FSKC 4WIQA 1KPUA 1BQLL 3KNBA 5JQ6H 3RVWD 1K2DA 3CLEL 4IJTA 4ODUA 3MYJA 5DJ0A 3E8UH 3S5ZA 3U9PH 4DWHA 3F62A 5C08D 3K8LA 2A4CA 2Z7ZA 1I1AD 2WXOA 1GCFA 1W0YT 3G9VA 1J5HA 1Z6JT 3D30A 2JB5L 3R4DA 4PRPD 5DD6A 1RIHL 4DW2H 1KWGA 5IHBA 4UAHA 1W6WA 2XBZA 3OAUL 2BS8A 4KITB 1TYEB 2G75A 4MCNA 2CIIB 2ICCA 3DTUB 4Z7VB 3NSFA 2AQ2A 4PCSA 3S3SA 2AXFA 2RACA 4IKLA 5EOCH 3GIZH 3OC5A 5AVVB 4APQC 4DKFL 3VXPB 2JKIS 3E38A 1I7TA 1IAIL 3HFML 5FGBA 4BK4A 2Y1ZA 2NSXA 4OI9A 3TN0B 5C97A 4NWTH 3N41B 4HPHA 3FTVA 5CFAA 5EIVA 5LVEA 5SV4A 2H0FA 3HZKB 3P11L 2CRIA 1JK8B 2R23A 4RRPM 1A4JB 3NABL 4Y2DB 1WICA 3QUMA 4P2RD 1NGPH 1NCOA 4XRCB 3VQ2C 4CN6A 4ZMYA 2D7PA 1SLUA 2QR0A 4XVUC 2CCWA 3H9SE 2NY1D 2WXGA 2YEZA 4I2XA 1X9QA 1PG7L 4O02B 1WV7T 1XF2B 2E27L 43CAB 2Q3XA 2MIZA 4G8FA 3EFDL 4NN5C 2WKOA 5LDUA 1JXFA 4XGZA 1UOVA 2VR5A 5CZVL 1EERB 4WTXA 2VZUA 3NQIA 4R97B 1UCBL 2WQRA 3BISA 2ZOKB 2FEJA 4GQ9L 3S9DB 2LHAA 1S7XB 4JFEB 3CZFB 5EUOA 3CSYB 3VXME 3QHZH 3HKZA 3R7RA 3VG0L 2FX9H 2WLMA 5EZPA 4UQ3B 3IJEA 3S4SA 1ROWA 3IB4A 5JQHC 2HG5B 4ZUUA 2Q7YA 1OSEA 2JKSA 4ORGB 1YMMB 3O4LB 3TONA 3F83A 2VKXA 4AV4A 4HGWB 2IMNA 4H8HA 4WU5A 2YK1H 2WQ8A 2VH5L 4PJXA 2AJUL 5KTEH 2HT4D 2YAHA 3EO0B 4FQHA 4G7YH 4AIOA 2EE3A 1T03L 2Y7OA 4FNQA 4NUPA 1SDAB 4X5XA 4F9PA 3PIQB 2I26N 4JFZL 4PB9L 3V4VH 3A23A 3IWVA 3QQ9D 4RX4D 7PAZA 3O3BA 4YUEH 5M95B 4U6TA 1KCRH 3HZYB 1UYWL 1A6TB 1ZS2A 4KK9D 1KV3A 1FJ1B 2XPZA 3PG2A 2C3WA 3II2A 2WLJA 1W72A 3CGTA 3TO4C 2X12A 3WL9B 1PLAA 1NLDL 1KEGL 2VLJA 3SE4A 2COVD 1C12B 3QXVA 3TA3D 3QJQB 2NT0A 5LAXA 4MD0A 4F2FA 1RZKC 1DE4B 1KLFB 1FO0H 1SNRA 3HVDA 1JPFB 3Q6GH 3VCLB 1CQKA 5I8KL 1G5AA 2ITFA 3CZEA 3NP3A 2E74C 4PGCB 1S3KL 2VLLB 3ZE0B 3LNGA 2A38A 2OMWA 5F8QC 4RAUB 3IFPA 3ARRA 4MAUH 1HH9B 3GD1C 2CJTA 1A3QA 4JFXA 3RL1A 2ADYA 3FAWA 4YHNB 3BIKB 2BY0A 3VXSB 5CN3A 2YUXA 3R7QA 3BDYH 4HU8A 2O6DA 1U21A 5INCB 1YQ2A 3IU3B 2UYLA 4RGNB 1DQDH 1KTBA 2Y1YA 5CP3H 2FR4B 3PHQB 2CBQA 2EUVA 3K6OA 4X9IA 3CXFA 4ZAKA 3OX8B 4HK3N 1PF3A 1S7VA 3SDAB 2I07B 4C58B 4WO4C 3W11C 5IJBC 1CG9B 1E5YA 4N9GB 2A9MH 5HHOA 4DZBB 3WKPA 4JO4L 3KH4A 3T08A 3O9WA 3MRIA 1ZTMA 3KWWB 3QUZA 1TDQA 4TNVF 4E5XG 4ZX6A 2BIPA 1YEGH 4PJIA 5I1KH 3CN2A 5BZWB 1FDLH 5HHQB 1L5GA 3NCFB 1MF2L 3SDXA 4TVPD 1HOEA 4L8SB 4JDTL 5I1CH 3FCUB 3TH4T 4JFTA 1U30A 4M9PA 3MNVB 3ARBB 5FYKE 2DQUL 4MS6A 1T5XA 4J12A 3TEZA 4Y16D 1P4LB 3BKYL 3JYCA 2YAMA 1KEML 3IKCA 4NQDB 5IHLB 1BQHA 1J88A 4J3OD 1I7RA 3VI3B 5MP6H 2YRLA 4D0BB 1QZ1A 4F91B 4WUUD 1V27A 3F7LA 4M7KH 2P5ED 1JDCA 4P57B 5DT1H 1WBYA 12E8H 4TRPL 1BVKB 3MLZH 1A2YA 5CMAA 2AEIT 3B7YA 4P4KC 1WCBB 1AIZA 1WC7B 4FLQA 5ENWA 4GY4A 4HFUH 3DMMA 1HHHB 3QFJE 5DJZA 3G5YA 3KPSA 4PV8A 5ESQA 4B96A 3W2DL 4AYMC 1BJ1J 4CNIA 1XH3A 2DQIL 4NAMA 1YJDH 1IC4L 2CO7A 2JCCF 2VZ3A 4TUJA 5E8OB 5E6RB 2YGNA 2B1AH 2CRYA 2EE2A 4KROD 2QQLL 3FMGH 4QRTA 1OSZA 2HJKB 1GC1L 3D18A 5E56A 3E6HA 4XP5H 1HNYA 4LSRL 2ZWZA 2VW6A 5HI3D 4JGUA 4FD0A 4P46A 4R84A 3MX0B 4LASH 1VADA 3VDCA 4AMKL 4EE2A 1OKEA 2DQJL 2BRQA 4KNUA 5C0FA 4NUGH 3QS2A 3PWUA 3C2AH 4IHBA 3VX1A 4UOZA 4PJ8C 4E0RB 2QSTA 3OAZH 1PFCA 1Z5LA 4J3TA 5I0YA 5BOZG 2X70A 1CLOH 2PTUA 2FX8H 3DHJA 4BSVA 1MQKH 1MW0A 4PYHA 3G5ZB 3ARFA 3RY6C 4U1MB 1HNFA 3WNMA 4Z7VF 3KPRB 3T4AA 3QCUH 2IALA 4DPBX 1SOQA 3PAZA 3A67H 3K6FA 4RFOL 3F7VA 2X42A 3NSYA 3LKRB 1MW3A 3N41F 1HXMA 1FYTD 2H1PL 3SGEH 3EYOA 3FFCA 2GK0B 3QDJB 3WS6A 4G72B 5E1QA 5A6IA 1RZ8A 4FQQA 4NO5B 1Z5HA 3G5VA 4L8DA 4G7SB 4NQSA 4NQCE 4LSDA 2AFNA 3QT2A 4KU1A 4LMQI 4QHNB 3AXIA 3P4MA 2H2SD 1J0YA 3FCBA 5AAWC 2AANA 3H3PL 5A2LH 3MLUL 4WW2B 3G6DH 4X7CC 4KGJA 1T66C 1T5WB 3HS9A 4PJAF 1Q0EA 3LNFA 3LZOA 5D2NC 5B3JE 4F7CA 4APQA 3FO9A 3DYOA 1CDBA 2WNWA 4MD5B 4HBCL 3VE0B 2R0LL 3SKMB 3CZJA 3Q44A 1Q0YL 4HULB 1KTKE 4AE0A 1NOAA 2B14A 2Y2YA 3NA4A 5M7QA 5I19H 4K9EH 3SDYH 3N40P 3RBGA 3B9KC 1URZA 2DWDB 5AW7B 3SO3C 1G0YR 5FHAH 4HIXL 4L37B 4W9DC 3RE0A 4PRHB 1P6WA 1TZGL 3TH2T 1OTUC 5I6OA 1HQRB 3DSFH 2ERJB 3DPBB 3LZRA 4PJCF 2V2XB 1KIPB 1KYUA 4OVUA 3AZUA 3VSQA 4Z7AA 5I15L 5E95B 4LFHD 5IROA 2L4OA 3B9EA 2XFXA 4LEOA 4Y5YC 4QWWC 5I1AB 4RGMC 1LMIA 4FABH 4N6RA 1O7SA 4WFED 4V1DD 1AC6A 4OCXH 4JJ5B 1F00I 1L9QA 1RHHA 2KH2B 2ZKMX 3QA3B 4XBEH 5ALBL 1M7IA 4NHUA 3V2AR 5HI4D 5D1QC 2VSMB 2YD3A 3CIAA 4MXWL 4CKQA 3QK0A 1Q8MA 3PHSA 2V9RA 4WWKA 1VFUA 3II3A 1N2RA 3HS8A 1DQJA 1LK3H 3BUIA 3IETB 1S5HA 3EOAB 3I75B 5JLZB 3HNTH 5D1XA 4GKLA 4KZDL 1N59A 1ZT1A 1ADQH 3TBCA 1J0JA 2WN3A 4XP6H 5AENA 2CDEB 1Q4NX 4GI9A 2Q10A 4WI8A 2E8YA 1FORL 4DGVL 5LBSH 4J3UA 1KTDA 3D85D 4FJYA 1J1OH 4M7ZB 5GSRA 4N22A 3T0EE 1L0XA 3KLKA 1HI6A 4WTWA 3QQDA 3KGUA 5ICUA 4Y1AE 3VMPA 4R0LA 2NUPA 3GXPA 3DJSA 4JANA 1ACYL 4XI5C 3CZSA 1YJDC 1ERNA 1B2WL 4FP8L 4HZ1A 4RCAA 4XCEA 4A39A 1MREL 1U8OB 4RNRB 1WZKA 4GBXB 1OQXA 1PD6A 3KXFE 3ARED 3QIUB 3ZDZB 3EF7A 1MPAH 3T1FB 1M7DB 2C3HA 5I18H 1HESA 3A6BH 5FCUH 3EFFB 4NRZB 5IB1A 4ISVA 5KANG 3PDOB 2AXHA 3IBOA 3WNKA 1ZEAH 3UOAB 2A9DA 1MH5A 2W88A 3DARA 3NJVA 4NBYB 3WUZA 3QORA 2VDNH 3UBFA 1LEIA 2XBDA 1D5BA 2JKRM 2VZTA 5EF2A 3D34A 3GMMA 3H42L 3N55A 1UA6H 2F18A 2Z9TA 3G6JA 3HMWH 5K9KB 5IKCB 2ICEB 3ILPB 4LPCA 3MBEA 4XMPH 3RIFK 4QF1B 2EDLA 4K7PH 5E8EB 1JPTH 3NJXA 1U3JA 1OM3L 1A8JH 2DBJA 4JFDE 4I48A 5G5DA 4LRIC 1AD0A 4BCZA 5FWQA 2YXVA 5DA0B 5F71A 1LEKB 2F54D 4UTAA 5IJKC 1IILE 3D48R 3O6LH 4P2OA 1EZUA 2FTAA 3O3DB 1AP2B 4P5TA 2CM6A 5ALCH 3C5ZD 5LJYH 1D9KD 4KO5A 5KYWB 2XZZA 3VXQB 1V3LA 2UZYA 3VI3F 1DZBA 1JPST 2NY4D 4A7VA 3LKSB 4PRIE 5FYLL 4CDHA 4WO4A 1G7PA 3Q7JA 4JG1L 1H5BA 1PNCA 3BVUA 2P49B 1IBDA 3EIFA 4N2KA 5BZXA 3ZHLA 1D5XB 1EFXA 3DUHA 4M93C 4P9HH 2IH8A 2JB6A 4DTGH 2M26A 1JVLA 2AI0H 2HRHA 1MQ8A 2E7BA 2YKLL 3CCHA 4PWKA 4OUUA 1AQDB 2WIMA 1CGSH 2YHGA 2YO3A 3D7PA 4FTVB 3SOTA 5KBNC 4X9GA 3NJGA 4HZAA 5E5RB 5CBAB 2VW7A 4GI8A 4K9EC 5CILL 4HJJL 4GLRH 1F4HA 1WS8A 4XN9A 4D9QE 2P9RA 5DU7A 2YQ2A 3PQYD 1H0DB 1QSFD 2XPGB 4YDIL 4P2QB 4MMZC 4OLXH 4UDUA 1ILUA 2HA1A 1QAWA 2VN3A 5BVJA 2QGCA 1ZXKA 3BPLB 3NPSC 2NY6C 4C59B 1VA9A 2VXQH 4H8PA 4P4KA 2RCSH 3C9NB 3N0AA 3SQOH 2Y6SC 3DSNA 1ZGLB 3UAJD 3I9AA 4MMYB 4EN3C 3D9AH 3FTWA 1FCGA 3HC3L 3FO2B 5FYKL 5IB5A 4FG6C 2DDQH 4UBDC 4OGZA 1JWMB 4UMGA 1EWHA 4MHHI 4WFHD 4PI0A 5GZNC 5KSVB 2MPVA 5CP7A 1GOGA 4B60A 3MUJA 3RNQB 4F7EB 1IGFL 2WLHA 3ESVF 5J3HD 1DDHB 4B41A 1ZJAA 3CDGB 3T2QA 3O2WL 4PJ7B 4Y2OB 2FYYA 4M7LL 4XPHH 1KV7A 5CIPH 5AVZB 3UABA 4HCRA 5J6GB 4DAGH 5KBLA 2UX7A 4BH8A 1DBAH 3BJ91 1TZOA 3TA4D 1KJ2H 2PCPB 1CFQB 1VGKB 4RZCA 5DVMA 1VENA 2GK2A 4PJ8A 4MAYC 4G9DB 5E6UB 2R83A 1Z9LA 1JHKH 2PYEB 2QKIC 3V4VA 1BF5A 4TTDC 2ATPA 2X2JA 3MROB 5JYMA 4JFPB 2G2RA 1U8HA 5AZEL 5ICYA 1KLGA 4YXKL 3IGUA 2D31B 2V8LA 3ZIMA 3SGJC 2YMOA 3C09B 1RUML 4WI5A 8FABA 1WDAA 3FSZA 4JY4B 2XY2A 1GMEA 4Y8DC 1QBLL 2FLBT 4PJ9C 4X4ME 5G4NA 4I9WE 1DBJL 2YPVH 1IARB 5IK3A 5BVPL 1X5AA 4GP8B 4HIJA 3IDMA 3L4WA 2K7QA 1J05B 2BY3A 3MRDB 2Q9OA 3QIBB 5GZOD 4EQ3A 5KAQF 5E2VH 2QMKA 1QR4A 4Q9RL 1ZHKB 4S1RH 1QKZL 1F13A 2WYHA 5D2LA 2XWTA 4LKCB 5CGBA 3EYUH 2CKNA 5BS0B 1XHHA 3WFBH 5JHBA 1A9BA 1IBFA 1THCA 5D2NA 3WGVB 1MCFA 3SDDD 1IQWH 1LVEA 1ZA3B 4FFZL 3EJPA 3MCG1 1KY7A 2V37A 4PBXA 4LARL 3RVWC 1UB6A 1SHSA 4GO9A 3OLEA 3FUFA 5DQJB 3GSNH 4YDKH 1C16A 3QUKB 4MGXA 3HI6L 4NC0B 1E6JL 3U46B 2P5PA 3P3TA 4QGYA 2DMKA 5E8PA 5I8EA 3S3JA 3EDFA 3TNNA 2BHUA 3KBEA 1JRHL 2DKMA 4J39A 2FJUB 2AKRB 4Z18A 2WQSA 3BAKA 3E3QE 3RU8L 4BFRA 3EOTL 3FOLA 1E4KA 3MV7A 2Y2TA 4NM4H 2HN7B 1CLCA 2GJPA 5JHAA 4DGYL 4OQTL 4GW1A 3K2UL 1AKPA 3S36X 3FU7A 4Y5YA 3RWIB 5E7FA 1LEGB 4P9HC 3AMLA 3DGGA 5DRNA 2I9LA 1EJOH 2J88L 2VJ8A 1N64H 1NDMA 2Q87A 3WTWA 4G7QB 4N85A 5AB0A 2EUWA 1HEHC 1AO7E 1DUZA 5KVGH 4XNZB 3TL5A 5DI8B 4LSSH 1Z9NA 5EOQL 1IVTA 3EJZD 2VLKA 4TSCL 3UPCA 3QZWB 4HXAL 4ZUWB 3HUJE 3MFGB 1T2JA 2NY1C 3DC0A 3AM8A 3L17A 5C6TH 1NPJA 3ZW3A 2R56L 4P05A 1YO4A 2AV7A 1OCOB 3ARYA 4PY8I 4TSBH 3ZDZF 3D52A 4HC1H 2AJVH 3EGXA 3BH8A 1IFRA 2ZWNA 5LNEA 3KDMB 1EAJA 3MRCA 3Q2WA 2MCAA 2WCSA 2F74B 1RZIB 3KNBB 3D4GA 4DP8X 3B83A 2G3MA 3QJTB 1PTZA 3IJ8A 1XV8A 1K2DB 4PUBH 3TTSA 4J27A 2EVJA 3BIBX 4TF4A 3DX7B 5JIDA 3WELA 1E3FA 4MYWB 4ZMLA 1ETZA 1X4ZA 1KCBA 5D96B 2NX5D 4OCMC 1K6QH 5CS7A 1IZJA 1S9VA 3G5WA 3NBNA 4D9RD 1MCSA 2X10A 1XB3A 5DHDA 1ZXQA 1UHVA 4AQ8A 3PWNA 5HP5A 2YRZA 1EZVY 1KB9K 5EA0H 4N0FB 1OAUL 4YIQA 2HT4C 3GJFK 3DOHA 3M8OL 3TX4A 3ZTNL 1NCDL 4AC4A 3DTXB 1QBBA 4TPRH 3UFIA 4HA1A 1SMAA 3AU0A 2B08A 2UXFA 4AT6B 3B2PA 4GSRA 1SXCA 4LVOB 3ATDA 3QQ9C 3W9DB 4ZX5A 4F37K 1J0ZA 1CU4H 3ATAA 4KK9C 4NKIH 1ZT4A 3EYQD 4NN6C 2IO5A 3VVWA 1I53A 2BNRD 3GT6A 3KPPB 5ESVA 1FNLA 5KBPA 1UWYA 4OB5H 5FEBA 2ADFH 1W0WB 2V7HB 4R2GD 5PCYA 1EGJL 3PJSB 4C83B 2WO3B 4FHJA 4LO9A 3DROB 4MQSB 1X5XA 1UD3A 3OZ9H 4LRIA 4Z7WA 1H6UA 3TA3C 3GIVA 4OZHA 1D6EA 1NBCA 1JK9B 2VWEC 4WENB 1UC6A 5IJKA 2WSKA 2H47C 4HPOL 2PO6A 4H8QA 4ONFH 2H32H 2XXMB 4ODTH 3KGSA 4QOKD 4LNRB 2DZEA 5EV7A 2IWEA 1QQDB 5E94A 2AC0A 4LPYA 1GZQA 1KB9J 1HSBB 4WNSA 4HJEA 1CGUA 1UOWA 1QR1A 5DRXA 1I82A 1CYWA 3QZPA 2E7LA 1NLBH 3F7QA 2QTVA 5LG1A 2IADA 2QFRA 3L3OA 1BD2D 1F6AB 3NIGE 2YGVA 3FQXA 3MGTB 4PR5B 3GI9H 4IU3B 3MOBH 1BP3B 1T1ZB 5GGQL 3NT0A 2GITB 2NSQA 2Y5QA 3Q6FB 1XSJA 4XODA 4UNTA 2XWJB 4KQ4H 4BUGA 3O6FB 3HR5B 4AZ8B 3EGDA 4V2BA 1NAKL 1W16A 5B38A 1TQTA 3VFVA 4PV1C 1FAIH 3UZEC 1IGTB 4MNQD 1N6VA 4LP4A 4PJ7F 5DFWH 2W9EL 4DGUA 3K4DA 1IIIA 5JOPD 4MZIA 4QHUA 3MLXL 5MERB 5IEHA 5T3ZH 1LNUA 3FTGA 4HKZB 4OZFH 4EN3A 3DO3A 5FM5M 2ZE0A 2WB7A 1P53A 3BEWA 4ZFFA 3QIWA 4IW4C 1T1WA 4JQIL 3VXRD 3ZL4H 2IBGA 5F96H 4Y16C 1ZIAA 2GC4C 1TYJA 4J3OC 1KXVC 1ES0A 1FLRH 5EZJB 3SBPA 4P5RA 5DEZA 1CDJA 2WWKO 3ZZLA 1INDH 1XGYH 2ZJSL 3MRLA 4L5FL 3UPAA 4XXWC 3RWCB 3QI9B 1T1YB 2V17L 3N44F 2OMWB 4MKTA 1C1EL 3B43A 3ZDXB 1A3ZA 1AZVA 2VIRB 5D72H 3RL1B 3LKNB 4Q58C 1AXSA 1AS8A 4LHUA 2WYTA 4HJGA 1UXWA 5E6ID 3JV4B 1D5ZB 1HHGB 3BP4B 2AK4D 5TH2A 2H0JA 3E2HB 3J8F7 3TEWA 5AVTB 2QKIA 2UYLB 3C6LD 4Y4HD 3MUY1 5LXGL 1D5MB 2CHZA 2Q3ZA 4ZSOA 4ZUVB 5IFHH 4AWJC 4KHTH 1QYGL 4CMHB 1RJYA 2GHWB 3FULA 4KROC 2ESVD 1S7VB 1U3HD 2BVQA 3CPLA 5T33L 1BBDL 4PJ9A 4X6DB 4JEGB 5K9QI 1C5DB 2DS4A 2YD8A 1GOHA 4H88L 3BXNB 3IE9A 1IKOP 4HWBL 4JHAH 5HI3C 4P5KB 1NBQA 5C9JA 5I8OH 3UBXI 2F53B 2XETA 2W81C 3O11A 2VM9A 5CWSA 3QG7L 3RGVD 1JV2B 4ZRGA 1JFQH 2XXCB 4TNGA 3KYOA 1UJ3B 1FNFA 5GS3A 3AXLB 1GPOL 3ZT6A 3M1BA 3VQ1C 2GAZB 5ACZA 3FT2B 2DMGA 1FFTB 3MO1A 1YNLL 2NCMA 4AYFB 3TF4A 4M6ML 1HL5A 2R4RL 5FUCC 3V10A 1ET5A 1HAUA 4LB8A 4QTFA 1ND0A 3VFPB 1TQBC 4YO0A 1PL3A 1EEYB 2J2ZB 2VDOB 4KJYA 2I69A 3KYMB 3QO1B 5H2BB 3QZMA 3NZ8A 1YAZA 4EZJA 4PW9A 3ECBB 5IHHA 1TCRB 1BVLB 1I1AA 5JOFA 2K4WA 4LLQA 2VZ1A 4LE8A 5MENE 5CMAB 1XCWA 3Q2NA 1OARL 5AAMA 1KTRL 2BIIA 2HRPH 5EU4B 5FC9A 5GJTH 2OAAA 3T6WA 4N68A 4B0MM 1KCKA 3MBWB 2H2SC 4OGXH 3RFRA 5C0AB 2P44B 2EEFA 2OXHA 2WJ5A 2VDQH 4WQOA 5JIHA 3S4SG 3EJYD 1S5IL 4D7BA 3QJXA 3V0IA 4UINL 3WEBA 1QFUH 4YXLH 3F65A 2Z64C 1OE2A 5IB4A 5AWNL 2QPEB 2R0WH 3OBAA 1X3DA 3HC2A 4QRRD 3IDXL 3TT3L 2VMDA 5AG9A 3V8CA 1PKQE 3FONA 1KG0B 4PJGA 3ZDYF 1P5VA 4JY5H 1NFKA 1NICA 1UM6H 2G4EA 4N1CA 3SBWA 5T3XE 2V9TA 1G0XA 3LQZA 4P46B 4FHBD 2CO4A 3RURA 3RL2B 2UWEA 3KWTA 1QSEA 3CFTA 1YA5A 3TIEA 3DURB 5IQ7L 1AGCB 1HTYA 3FTUA 1Z5LB 1H8SA 1UA7A 1BMZA 2F58H 4IKIA 5ERWA 5TDNA 2X70B 2Q76A 4GEJA 4X7EC 1TKWA 4XNYL 1JYVA 1S7WA 4IIQA 4KKNA 4TOYL 4TULH 3W1ZA 4QRPD 1HQ4B 1DJGA 4FXKA 3T4AB 3FYEB 3D2UB 4K0OA 5A2BA 2P24B 1YNKL 1FSKB 5I76B 4D0DB 2IDSA 1DVFD 1R3JB 3HAEB 3P9WB 4OT1L 2Y23A 5HI4C 4WJG3 2MQ0A 1A02N 3TWYA 2C9AA 2ZXGA 4NRYB 1WIOA 5EZIL 1XCQB 4IS6A 4WKZB 5IQ9B 2RJMA 1QVOA 2VRKA 3G5VB 3RIFF 5HDBB 1LD9B 1E9OA 1UOLA 1T2QH 3LAFA 1HCZA 1CD8A 2YA1A 5JNYA 2L7EA 1A7OH 5BV7L 3OXRB 4FGMA 5I17A 1XEUA 1B4JH 4ZFOL 2K6ZA 1JP5A 3WCYA 3P4NB 1BAFH 1I1YA 2EE6A 3G7TA 4LEXL 4KZ0A 2AJZB 5F9AC 2K9FB 4NHCL 4OFVA 3CXHJ 3FCGA 4NQVB 2R27A 3B34A 5HYJB 2VDMH 5C0EA 1OCWL 2FX7H 4RX4A 2HJFA 1T20A 2WP3T 4QRQA 1XL4A 1F58L 1DBMH 1FPTL 5SWQB 1HKLL 4JG0H 4LQ1A 3MU3A 5FV1L 1A6UL 2IPTH 4GT7A 4X80H 4XNDA 5CU9A 4ZMPA 4QT5A 4AQ1C 3CHQA 1JNLL 1NM4A 2E7DA 4U1SA 4YE0A 3BVTA 5IJVA 4QRUA 3S96B 2DQTH 3AREC 1N4XL 2ZUWA 3G5XB 4U4IA 5T1KB 2G0LA 1HHJB 2XQYA 3W37A 4OD3H 4B9CA 5K93A 1DQQB 2DM2A 2ZYHA 2RTTA 4NN5B 3PGDA 5AOZA 1CZ8L 4Z8FL 3N1FC 5CN1A 3VB8A 3LXAA 4R26L 4W4NA 2BWDA 2BWIA 1ZV5A 4N2AA 4QLRA 1T83C 2XXGA 1JGIA 4N1HB 2D4DA 2HFFA 5I0DA 4O9HH 1NGQH 3JTSA 2NNAA 4PRDA 4D7PA 2CLRB 3QNZA 2NDFA 1BQHG 2O1AA 1H8LA 4BFEA 4ZMVA 3WKQA 4FERA 5FKPA 4UWQB 5C0BE 2EYRB 1FAKT 3QE5A 4UTBL 3FO0L 4KJWD 5HGHB 3MZTA 1S5HB 3G04A 3NFPA 4RIRB 1WEJH 3KYNA 1K4CB 4XPTL 2B7DT 4FZ8L 4BFGA 1O7DE 2G5RA 3S35L 5CBEB 5L2KD 2MFNA 5EBGA 4EJ1C 3FQTA 3C5ZC 3MKGA 1D9KC 5F21B 3VUAA 1MJJA 2NOYA 2J5LC 2Q3AA 5DC2A 3X1BA 4I1RA 1QHOA 2BCKB 2NY4C 1A3RH 4YDNA 3QQDB 2DV6A 4PTUA 3QPXL 5F1OB 1G7LB 2C1OA 1CT8A 4Q2ZA 2IPKA 4LKXA 4OLWH 4X7TA 1M2VB 4X2UA 3ZDXF 5DC9B 3C5XA 4WW1A 2GJ6B 3TO4B 5L8LB 1FFOB 2WW8A 2Y25A 3VXNB 4D94A 3FUIA 3FFDA 3U2IA 5AVSB 5D7KE 5B1JA 4E42A 2D7TL 4O5LH 1E5AA 3BIAX 3GSRB 5FO9A 3MREB 4KVCH 4FZEH 1NGWB 2MCPH 5D5MB 4NJ9L 4C57C 4WUUA 3MLYH 1DSYA 4YHOH 3T3PE 2H8PB 2P5EA 2UXVA 1SJVA 3IMRA 4P3DA 1MH5B 5C07B 1JNJA 2A5UA 4CC4A 2YA2A 1NIEA 2QMJA 3MQIA 3L1OL 5F88B 5J1TC 4X6DF 2X89A 3MRKB 5DHVB 3D39E 3X11B 4JVUA 4FJ6A 3WEAA 2IPUG 3UAJC 3H7LA 4N90D 3E1F1 2J8UA 3MRNB 4JVPA 4ZZFA 3WY3A 1NCNA 3L4XA 4PV9B 4AMWA 2NTFB 4JQVC 2AEOA 4G59C 5GIRB 4FJZA 3CFEA 5C09D 1JIBA 4HH8A 2P52A 4LCYA 4NBZB 4S1SL 5AW5B 3T3PF 2B8OT 3K4AA 4R4BA 3CWGA 5I1LB 3K6SB 1JI2A 4DETA 3MNZB 4Q52A 5J3HC 3T4YB 1N3NB 5HGDB 4A2MA 1FNSH 4WO4B 4OCYL 1OB0A 5GSVB 1A1NB 2GCYB 4KV5F 2IANE 5CGYD 3MGOA 2PCFB 2X0UA 3MLTA 1GJUA 2YR3A 1DQVA 2PPDA 2JB6B 4AY0A 4DPCX 4CMMB 4DK5A 1QPXA 4OD1H 3V5DA 3DJRA 1ZOXA 1CS6A 5SWSB 1J8HB 1YEIL 1CXLA 2QGBA 2WZ6A 4KMQA 3VGGA 1UT2A 4Q6KA 5JORA 3HNVH 5KN5A 3TEUA 3L9EA 1YN6A 2L0DA 5D7LD 3BOVA 2VLRA 1HZHL 2W0FB 1TJGL 4W9EC 1FYTA 4TTGA 2YMXH 4FLRA 4P4RA 4C8XA 1AJ7H 3FU6A 3BAJA 1UXSA 4QYOA 2FR4A 2ZP8A 4HGMA 1RK1B 3T71A 3U7YL 4HFWA 4P4KB 5LG6A 1LWRA 2Y22A 3A0OA 5D8JL 3R8BB 5C7ZA 3FB8A 1V3JA 1WTLA 3LEYH 4YNYB 3K6NA 5IVOA 5IB5B 1OW0C 1QZNA 3FJTA 2NY7H 3B2UD 3C6SB 3GK8L 5H35B 5K39B 5C8JA 5ES4B 1JERA 3U0WH 1CFNA 3DYPA 4U7KA 1CF8H 3SDDC 1TLMA 4PGEB 1JWSA 5C6WH 2AW2A 4YPJA 5CFHA 2CU9A 5J06A 1M3IA 2E76C 1PU0A 1IAIM 3WTYA 1RJLA 2WTPA 2ZKHL 4RFNC 3JZ7A 3UX9B 3V5KA 1TFHA 2YOCA 5E4EC 3FQNA 1NCAL 1KC5H 2X3BA 3HHMA 5T5FA 1JV5B 4NGHH 4PMEA 5FUZH 2ED7A 3LRKA 4AEFA 1ZHBB 1TNNA 2YD7A 4QXTA 4X7SL 2CJSA 4ZFQA 5B39B 3Q8EA 4K94L 4G9FE 4BA0A 5C7XL 4Y19E 1A47A 1SY6H 3DECA 4R7XA 2GTWA 4CN1A 2AITA 4WHYG 4LCCC 3ENEA 1ZLVH 1QX1A 2FCBA 3V4VB 3TFKD 5BRZD 3U1SL 4DKEH 5JIMA 1DANU 4HK0B 4K3DL 5C86A 4G6JL 4J2QA 3MRFB 4BGLA 4LCIL 4XPAH 3KJ6L 1KBGH 4JVWA 3RGBA 4S1DC 4V1DA 5FWRA 3BSZL 1KELL 2IDFA 3CZLA 3FBQA 4N2EA 1YEDA 1TQSA 5CHNB 4OM0L 4RSVA 5T3XL 2EH8H 3KPLB 4M6OL 4I0PA 2F19H 3JWDH 1GYVA 3TXAA 1G6RL 3EJZC 4AQAB 4E9SA 3P2TA 4PJBB 4JB9L 4XC3L 2X4RA 2K0RA 3CDCA 1DFXA 3SKJL 1IGML 3LMJL 2R7EB 3IDUA 4JFHE 1FBIH 4ADJA 5HSFA 1FO0B 1SVCP 1U91B 2AQ3A 5IHUL 3LH2H 1BIIA 5EWIL 3V0JA 3DVFA 1EHKB 1YEKL 4MXVE 5JQIB 1G84A 4UQ9A 4UIKH 5TFSL 1YYLL 5D2NB 1ED3A 4AX3A 1AZRA 3IXTA 3OM3B 4HCGA 5JHLL 1S7TB 3GBNL 1D7BA 2A9CA 2XG5A 4ODVL 2N7BA 3G6AA 1X7TA 4PHXA 3D06A 3NCBB 3MV8E 3C12A 1I7ZA 4LHJB 3B9KB 1N6QH 1R24A 4NO3B 4HK3J 3SO3B 3V52H 4YHML 5LN4A 3ALXA 2WLIB 3DVNB 4GRWH 2FH6A 3FOLB 3PV6A 1MZYA 4FQXD 5FM5O 3UTTD 4EUPH 5DLML 4K55A 2FO1A 5TQ0H 5DZVA 3TWCL 4GSDL 1RXLA 3LVTA 4ODSL 4PP1D 4RMVA 4WWNA 2J6WA 2WXIA 4ZNCD 5EO1B 2ZF8A 1F8TL 3FU7B 4Y5YB 1XAKA 4RGMB 1BIHA 4JO3H 2QDWA 5F7EL 1IBHA 3EYQC 1TU2B 1DUZB 2OZ4H 5D1QB 1FFPA 2B59A 1RU9L 1G7HA 4Z7NF 1ZE3H 3PP4L 4PWJA 1C7SA 4AH2A 4OKDA 4R2GC 2M1KA 2GJJA 4L4VB 2ZZUT 1NTDA 1JVOA 1Y6MR 4OF0A 4AEIL 1MFCL 4OF7A 5HDRA 2IH1B 2OMXA 4PP2B 5A2FA 4PJHB 4M5YH 1BMGA 2X4UA 4LCWB 1BXUA 5KJRL 5IFJB 1XF3A 2EYSA 2NLJB 5DK2B 3UDWA 4DP0X 1XGUA 1Q94B 1EXGA 4M5SA 2DM4A 3S3PA 2CUMA 4O2FB 5A2KH 1RZPA 1RZFH 1J86A 1SJEA 1SLWA 4JPVL 4AIEA 4I4WB 1OE1A 4JAMA 3QQXA 5HJBA 2MCG1 2QVTA 5E7BA 3WLWC 2HXAA 1XF4A 3NJHA 4FQCH 3HG1A 4L23A 1KTJA 2DI8A 3SY0B 4GXVL 1KPRB 5KVEH 5D7JD 3TV3L 4D8PA 2VRAA 1FNGB 5TD4A 4FCAA 4S1QL 5DS8A 1OD7A 1KIQA 1IZKA 2DD8L 4PBWD 4PSPA 3C5SA 1KB3A 3INUH 3QEQB 1S7RA 1Z5YD 4A2LA 3WTXA 1CXHA 1G94A 5E2UL 1Y18B 3IDIB 1S4IA 2H0EA 3U30C 3DRQB 3FB5A 3X13B 2OL3L 2ZX6A 1AI1H 1HHKA 1T3FA 4JY6A 2RFXB 5FHBL 1B90A 3APDA 4F9LC 5D1ZD 1ZT4B 2K4AA 2XRAH 4BBWA 4AW4A 4Q89A 5ESVB 2XZQL 4NI6A 2HYMA 4AZUA 5F1IA 2WAQA 4JRYA 4HAKA 1KBVA 4OZHB 4L29B 5FDYA 4XXDA 3JWDC 2W38A 2VM4A 2C7FA 4RAHA 4ZODA 4DQOH 5AKTA 3DXAE 2G9HB 5AB1A 1P5UC 2W0KA 3NA9H 4KO9A 4KRMB 4U4BA 2D4FA 4PJ5E 4F7MB 4K8RL 4KKLC 2HFGH 2WUCH 4NKDB 3VXUB 4M1DL 1IGIL 3VFMA 5JDJA 4DN3H 2VR3A 4Z77B 1U58B 1OGAD 2X9ZA 5DO8A 5EFIB 4FYTA 2KZ1B 4KOCA 4M93B 4MJID 5E6IC 3N2JA 2IDTA 3PWVA 1B88A 2FAUA 4IBLT 2CKBH 2P8MB 4XHQA 3C6LC 5DJCA 4Y4HC 4BZ2L 3LZFL 2BP0A 4FS0A 1G9MH 1DO6A 2XIDA 4MLSA 1PYWA 4B9FA 2P8PA 1U3HC 5B38B 1YLBB 4CVZB 1MY7A 3AJ7A 1BAGA 4FTDA 4MMZB 5TQ2L 3NPSB 2ITDA 2NY6B 3RGVC 2EZ0D 3ET9F 5FDWA 1MHHB 2H26B 4ABVA 4TVUA 4OZIA 1F3DH 2PTTB 5GZOA 1H9DA 3WFHB 5IW1B 4EN3B 2MH4A 2QQKL 3V6OE 1IM3B 4ZFFB 1P1ZB 4YE4H 1FZOB 3WHE1 2SEBB 3GLZA 3JWOL 3HZVA 3SE3A 4EZKA 4XH2B 3I02A 1GYAA 2VDPH 2ODIA 3KXFA 4JFUA 3UP1A 3FN3A 1ZE3C 2L7QA 4JLRA 4NNYB 1X7SA 4JS7A 2Z4QB 3FKUS 4NFCA 3SOBH 3IGAA 4H1LA 3OWRA 2CMRL 2WTOA 2IJ0C 4BFFA 5I2IA 4FLOA 1G9HA 1GJWA 3QG6B 3UJJH 3QCTH 2WBJA 4PJBF 3MJ9A 3UJTL 3QXWA 3OQRA 3RYMA 4NZRL 4PG2A 4NOBA 1Q1JH 3R0MA 3GHPA 3X2QB 1KNOA 4MAYB 1T0NA 3FOMB 2I5YH 3EJYC 1ZHNA 5LBGA 3OKKA 2ZXBA 3EOBB 2D7QA 5DVOA 1D6VH 5IIEB 1HWHB 3BEVB 4ZS7H 1V54B 2LU7A 3TPKA 1J0KA 4BKTC 3QZBA 1J0HA 3ZKSD 3CPLB 3DOSA 3IJSA 5D70L 4PJ9B 5C2BH 1E9PB 4HJ1A 4PIRF 4UQIM 2OI9C 5KSAD 2JF1A 4OIFA 4JDVB 4KKQA 2XCMC 3BP7A 2VAAA 4PCYA 1YEEH 1LO3L 3O11B 1OCZB 5I75C 1AGBA 1XIWD 3VXMD 5EIQA 3IFLH 4F1ZA 2EC9U 5CJQH 3EYSH 1I3UA 5FA3B 2EDYA 2WZ5A 4YQXL 5LCVA 2ITCB 3MLVL 3PWPB 2H9GB 5CJBA 2DLGA 2VDNB 2YBRB 3RKDD 4AYBA 5DQ9A 1TQCC 3SO5A 5I1DB 1B6DA 3DV6A 3U36A 4MA7L 3TO2A 1DVFC 2FBJL 4F33B 5TDOB 3O0LA 1MCNA 5C08B 4JHVA 3BSHA 5JMOC 4HEPA 1YSOA 5JOFB 4LLQB 1LO2L 4BSJA 2NX5A 5ECGA 4A6YH 4N0YH 2G60L 4PRPB 5H37A 1BVNT 3D2TA 1XH2A 1F18A 1G9EA 4PVMA 2AEQH 4JW3A 4XZUB 3QRFM 1Z0MA 4I77H 3VRLF 3IJHB 2X88A 4PJHF 1WFUA 1TJHL 3TT1L 4LDCA 4QHLB 3G08B 5EN2B 3CLEH 2FJFA 1S9YB 4Y2LA 1CUOA 2O72A 32C2A 1XGPA 3BGFC 1NAML 4GAGL 2FO4B 4M1CD 1ZDSA 1YPZB 4F15C 3LN4B 3S5LA 4OCRL 2JB5H 1G9MC 3J2PA 5GGSA 1RIHH 3W56A 3WDJA 4P2RB 4EDXB 4IQHA 3OAUH 2UWEB 3ROOB 4FDWA 5E8NA 5I1JL 2NY1B 2AQ1A 5FYLD 3QEHB 3U2SA 2D0GA 3SQBA 4DKFH 2Q0ZX 2IDQA 4H0IA 3HFMH 4Y5VC 1IAIH 4LCUB 4AENA 4UB0L 3T04D 1S7WB 5F3BB 1PMYA 4CBZA 4FG2A 2XBTA 5I1HL 5DF0A 4F2MA 1AH1A 3BWSA 3P11H 4P5MB 2R29A 1IMHC 1A6WL 3NABH 5HYSA 1E8ZA 1J8SA 3EO1B 4A2DA 4MQ7B 5DA4A 5F0PB 4JL2A 5AFAA 3LN5A 5TF1L 1PG7H 2EILB 4KJWC 4PJFB 5IF0B 2E27H 1E9OB 2BW4A 3EDJA 3ZE0E 3EFDH 4KY1L 1KJ3L 4Z7OB 2AABL 2VLME 4LPVA 5ICXA 5DHYA 2IAMD 4QCIB 1BM7A 4HOWA 4O2CA 4QHMA 5CIPB 4LHUG 5CZVH 4ZPTA 1UCBH 1I1YB 5EHFA 2ZWSA 4GQ9H 3RTQD 4E9YA 2XWXA 4XXCA 2YXMA 3VG0H 4U6XA 4RGNE 1OALA 1QWUA 2X41A 1KJ2B 3WFZA 4OLZL 2FWUA 2WLLA 1C08B 2OJEB 1MCWW 1RZJL 1SY6A 4K7PX 4MJ6A 1JUFB 4KUCF 3WNJA 4NN6B 4IGBB 4OFPA 4NO2A 4HIPA 1FF5A 5JHDB 4X6FA 3NESA 3I50L 2NZ9D 4K3GA 3RI5K 2GY7B 4EQ2A 2VH5H 1GGIL 2AJUH 1QNIA 1I4FA 2HPOA 2BRRL 4YFLF 5E1IA 1Q9KB 2ZOWA 3TA3B 4MMXC 1W8EA 3GSXA 4XN8A 3MN8A 4X6CB 4JKMA 4ZPVB 3MV9E 4BFKA 3ZRFC 5DZNA 4JFZH 4PB9H 2EIBA 1J5CA 1U8KA 1OHZA 3CC5A 4FXTA 1CFTA 5AVRB 1UYWH 2V2WB 2HFFB 3FB6B 4J4PA 2WLKA 3MV11 2JJUA 2Y5TA 3IDNB 3CVHL 4XMUA 4KKRA 5I6NA 2P26A 3FHAA 3CSTA 4ODWA 2CR0A 3OGCB 4L4TD 2O5YL 4OZGF 1V8HA 1NLDH 1KEGH 2XI9A 2OMUA 5T1LD 3ZO0A 1UJTA 1FL5B 1RZ7L 3V0EA 3IU4L 3L3IA 3HG5A 3KBPA 1PQZB 3GSNB 2IWFA 1YEHL 5FM8A 1A3LL 4JFFD 4OVVA 3Q8AA 4XMTA 5JW5A 4YPGA 3HLAB 5I8KH 3HZMA 4Y2DD 3FQTB 3MRRB 3HC0B 3ZXAC 4ZUSA 3KH3A 1S3KH 2ESVA 2ICES 4Z5RB 3SE9L 4LDOB 3QRLA 3C75A 5IB3B 1T0MA 3SQRA 1FFNA 3LDBC 5CGYC 1SXBA 2IPKB 1B9ZA 5CCJA 2FNBA 1ID5I 5FGRA 1DZ0A 3S34L 2JV6A 4M8QA 3DO7B 1LO0L 3V9CA 2QHLA 4GG6B 3VQLA 2OSWA 4ZZKA 5K1JA 2AMGA 4HLZH 4OZ4B 1UA3A 4Y16B 4Y88A 3OPUA 4ONGL 3Q1SL 4LLDB 3IDJB 2AXWA 4WUUB 1RMFL 5AYUL 4PGDB 4LK4A 4C4KT 4JO4H 4HUXA 4W9CC 3VI4F 4J8RA 4F7KA 3BP6B 4PRBB 5IVXE 4YSQA 1A8ZA 3GNML 5IQNA 3KPRE 1EDYA 4L8CB 2ROYA 1LO5A 1MF2H 1INQB 1UB5A 4Y4FD 4JDTH 4RMTA 5LDSA 1BFTA 4JHZA 3QZNA 1XB6A 4WJ5A 2DQUH 2CGYA 2JI1A 3VM7A 4YAQA 3B2UC 2CQVA 2EC9T 3ARSA 4GKSB 3BKYH 4OD2A 1HEZB 3AS2A 3ZKMC 3VFRA 1KEMH 2D9QB 2XN9D 5C0RL 2YBGA 1CR9L 1IAKA 1I9EA 2X4TB 4R4BB 4TRPH 8CGTA 4I1NB 2EJ1A 4KROB 4LLAA 3DIDA 2C9SA 2KC0A 3P0GB 1A7BA 2P3YA 2E9IA 1EFQA 3BP5A 4HIEA 2W60A 1CFSA 2JKXA 3NCMA 3QDGE 1E7UA 1MWAA 1K8DB 2DIJA 2XZAL 1QO3A 2D2OA 4R5TA 1F3JA 4X5WB 4ZK8A 3WS3A 4KXCA 3TV8A 3W2DH 4YX2L 3D3VA 2KUTA 3N40F 3V4PA 5E6SB 1U8CA 2PLTA 1ZLEA 2DQIH 2EEDA 5GS0L 1C8PA 4MCZB 4M4PA 1IC4H 4U1KA 4YN3A 2D3VA 5LXVA 4KQ3L 3QS3A 4PYGA 3TFKC 1RLWA 4NUJA 1JS4A 4N2NA 4HUCA 4IJ3C 1S9WA 2UX6A 1MJ7L 2QQLH 1ORSA 3CVDA 2VABB 2P7TB 4OGYL 3BRDA 2RAMA 1GC1H 1TQBB 2VT0A 4BZ1A 1IE4A 2JKJA 1Z9SB 2XQYG 2EVFA 1FCCA 5JR1L 2X1WL 4LSRH 4MDIA 4BELD 3K91A 5D7EA 1OSPL 4HSAC 4AMKH 1ONQA 5CSGA 2DQJH 2QQQA 3HMXL 1K3ZA 1F4XL 5E2WL 2PPAA 4YGVA 1OAXL 4LLWA 4QYAA 4A67A 3UPRA 4C56E 4Y1AD 1A1MA 1YYCA 4GSQA 4NC1C 2H32B 2UUDK 1AHWA 1WAAF 2LU4A 5EC1A 1B4LA 3KCPA 1TMCB 1CFNB 5T1MA 5I1GL 3H9ZA 4M6AA 4RFOH 1CVSC 1G9NL 1T4KA 3K1DA 3L54A 1E9QB 2YPKB 2H1PH 2K9UA 1GY2A 2MOQA 4JJOA 4PAZA 1JZ3A 2GSGA 3OR6B 5HHME 4AL8L 4DPRA 5K9QG 3OAWA 5CUSL 2CKBA 3HBGA 3FQNB 3NP4A 2XDHA 5SWZD 1U4EA 5EIIB 4OBRA 2CXKA 4YHZL 4BK5A 2GG1A 1JD9A 4Z78A 4DIXA 4RQQB 3H3PH 3UBHA 4K7FB 3MLUH 4U1GC 2DQMA 4PJFF 2XN0A 3OGOE 1L0PA 1U3NA 3DBSA 2F7RA 3QWRD 3DUUB 4FQXC 3HRZC 4WAFA 4ZTPL 3RUGE 4HHAB 3C8HA 4FRWA 1R9FA 1CQYA 4Z7OF 5KJ7E 3AUVA 5GPRA 4PP1C 3H9HA 2YZ1A 3VFUA 4HBCH 3CBKB 2R0LH 3KLQA 3OKMA 5F2FA 3L1GA 4J28A 3E9TA 4F8PA 1NFIB 1O7VA 5CJXC 3TJPA 2C1PA 5GRUL 2PW2A 4OZFB 4GIAA 4X42A 1MKFA 4Y9EA 1NFDE 4HIXH 2J3SA 1G6VK 4FLSA 4O51A 3UJIL 4CSSA 1AQKL 2P45B 1TZGH 3GBEA 3RUGF 4PS7A 2G30A 4DPAX 1P9MC 5I15H 3GLEA 4M8RA 3BZFB 4YDJA 1F41A 3BZ4A 3FT4B 2BFVL 4AGPA 4JFWA 1MLBA 3L9BA 3SJVE 3WEXA 3X14B 4X6CF 3GHBL 3GM8A 1XR8B 5ALBH 3MRGA 3D85B 4X0NA 3VAEA 4MXWH 3KJ4C 1QRKA 2G5BA 5HHXL 3STZA 3KS0J 1X6LA 2IPUK 4WEMB 4D9QD 2BP8A 1DLHA 3MFFB 1SMDA 2DF3A 4KZDH 1ZSDA 1DSFL 1I7ZB 3FRPA 3HTLX 1QI3A 4AQ1B 5E51A 1FVCB 2ZSWB 3OJMB 3QH3A 4LLMA 3SDCD 1A0QL 1U8QA 3AREB 1MW1A 1FORH 4GG8A 2CLZA 2VO5A 3FTXA 5DJYB 4DGVH 2GBUA 4MMXA 3B1UA 1VIWA 4JN2A 1UXLA 3STLA 5SX5H 4FTVE 1JGUH 3IT8D 4N8UA 2W91A 5JO5B 4PGBA 2KI6A 4IMKC 4W93A 3ML8A 1ACYH 3FCSB 5TF0A 2FSEB 1B2WH 4FP8H 2NYYC 1MREH 4Z7QF 2WO4A 3UTSD 2B59B 4M4RA 2GIMA 3HBPA 2LAAA 1M9WA 3HW7A 2R51A 3WDIA 1E4HA 1GC1C 3GSQB 4LOFA 3MRPB 2CBPA 4KUZL 3QEUB 3OZKA 2EP6A 1NKGA 5I73C 4GG6F 5BQDA 3L13A 1A6AB 4LPTA 4WGVB 2AJYL 3AUWB 2F54B 5LO7A 1GS7A 1TENA 5AD0A 4AV5A 2I85A 3HC4L 3C5ZB 1D9KB 3UC2A 1YYML 4XMKL 1UWGL 2J5LB 4WFFD 1B0RA 3VNZA 4LEEA 1KACB 2NY4B 3H42H 3F64A 2O93L 4IBVA 3OTTA 2X40A 4L3EE 2G5UA 4JMNA 1DVTA 5HD8D 2X4SB 3QO0A 2VDQB 4JM4L 2OMTA 1IBGL 1M7UA 4NNPL 1OM3H 5JIPA 4X4YB 4I9WD 3ARQA 2DQHL 4WK2B 4PJDB 2BWQA 3ZYJA 4D8PB 5FKAA 5K5YA 2Q1EA 2WUBL 2VERA 1HDMA 3LS4L 4KX7A 2BLFA 1PZCA 3D0VB 4IRZL 5SX4I 4ELMA 4Z7UB 3RTLA 2JJVA 3U6XS 1TFPA 4POZD 1B4RA 3RILA 5FYLH 4HT1L 5D7LA 2ITEA 3O2DL 2PYEE 4JG1H 3BVNB 3PQYB 4G1EB 1K8IA 2R1WA 2L3BA 5EN3A 4GUPB 1QSFB 1FYHB 3VWKD 5MHSD 4ZTEA 1QLRA 2EZ0C 2YKLH 5HI5D 3JV6B 2A4ZA 5DEFA 2MQ3A 4GEIA 4U33A 1KJVA 5HDQL 1DJXA 1RCYA 1J8KA 2BVOA 3B9AA 2WZAA 2GABA 4YEFA 4GFTB 3IGLA 3CVCA 5CILH 1R3HA 4HJJH 2H7WA 1FZMA 1JHLL 1NGXB 1BYOA 3JTTA 2Z7WA 1JGLL 3KLSA 4I0CC 1CE1L 2KS0A 2OZNA 5GGUB 4XO5A 4YDIH 4BUQA 5DSCB 2Y3AA 3HKFA 2W9LA 5E5MB 3FO1B 4X7FC 4CADB 3GZQA 4GBXD 1R3IL 1DEEA 4G42A 3QNXB 3QIUD 2WZPD 2ZD0A 2HLEB 1M1SA 4Z76A 1NC4D 3HG2A 2PF6A 2DQGL 1EAPA 3E1ZA 3ETSA 3HC3H 1RUKL 2HPTA 5FYKH 3IMWA 3B37A 4RLDA 3B5HA 4M61B 1NCIA 5GJSL 3VH8A 4GYBA 1AO7D 1BYNA 4WKXA 3S0PA 1MUJB 3S6CA 4NP4L 3TPUB 5FOJA 1SXSA 1SHMA 2VDMB 4NO0D 2YGQA 2I9TA 3H9YA 1XBRA 3B4NA 3JWNE 1T0PB 1ZA6B 4HX1B 3HS0C 4PCKA 5KYXA 1IGFH 1UZ6E 4RMSA 1WAPA 3O2WH 1NFAA 3GC3A 4M7LH 4M8VA 4WI9A 5GGVY 1KXHA 4PMFA 5DD0L 3GINA 2IFFL 1S7QB 1GS6X 2QPDB 5EO0B 2IXQB 4P23D 5KSAC 2HRLA 3LKPA 3VDAA 2OCFD 2ZSVA 1HOCB 4B9YA 4KKCD 1ZANL 3LSOB 1XIWC 2DOCA 3RPBA 1I3RB 4ZYKB 4I18A 4MDJA 3CUPA 5C0CE 3ARGA 3D05A 2PXYA 4Z0XA 1SM3L 2VZSA 1AQHA 1ROCA 5AZEH 4YXKH 2OA9A 4QNPE 4XC1L 5FW7A 1T5KA 3LRHA 4JDEB 4L3CB 3ZKND 3VGFA 3RKDC 4AEEA 5E9NA 1Q38A 4QO1B 2J5WA 1RUMH 3SDDB 1QBLH 4ZUTB 1FC2D 2B1OA 1DBJH 4GH7B 3GS4A 1OP9A 1WF5A 4OLVL 1OP5H 5BVPH 2Z91A 3W38A 4RFNB 1JF1A 1QSVA 1R5VA 1G1CA 2GHZA 5K9JL 5E4EB 4JKLA 5D7IB 4IK6A 5EO9A 4DP1X 2J25A 3TZVA 1I7UB 3V79C 4YGAB 4A7TA 2V33A 1UASA 4AQZA 2X4PA 1K85A 4Q9RH 4M29A 3I74A 1CDCA 1QKZH 1MI5A 1BDYA 4LU5L 4NQEA 3PLYA 3RGHA 1E4XL 3OR7B 4YSPA 3UG4A 4P2QD 4GJTB 4LCCB 1L9TA 2OXGA 1MIEL 4FFZH 5DMGD 2UZPA 1CIDA 4LARH 2Y9RT 2EVGA 3AU1B 3HI6H 1KLUB 4HDIB 4B53A 5FFOA 3CQQA 4BA8A 3TIDB 3DVGA 4M1CC 3VU1A 3DOSB 2EDHA 1NC2D 2NZIA 3IJSB 4E9QA 4NYLA 5IOKA 1JRHH 2CPCA 4A68A 4APXA 3HHSB 2H3NB 3K1KC 3MR9A 3RU8H 3C2SA 3EOTH 5GRYA 4D0CA 1K9TA 2BO0A 4G8EA 2VN5A 5AUMB 2DYPD 4CN4A 4X98A 3WHXA 2IANA 2A6IA 4N8CL 2B2XL 4MXQD 4DGYH 4OQTH 1KXTA 1GJIA 5DUML 3K2UH 2WXLA 4N24A 1R33A 2G2PA 1M6OB 3PNWA 4WLCA 3TYFB 4E41A 2WC7A 4FYQA 5BNXD 1JL8A 4TNFA 4I2XE 2J88H 5DQ9B 5TK4A 3UL4A 3CFBA 4BJLA 5LGHL 5JPNA 5FPIA 3MODL 3MJWA 1JPGA 5I5JA 4WV1A 3DRTA 5EOQH 4JHUA 4KTYA 3BD3A 4TSCH 3CFJA 4HXAH 3F12B 5EOTA 1PS3A 2X2IA 2YSSA 4KMTL 3QRGL 2NX5B 1LHZA 1R47A 5E2TL 5D7JA 2DH2A 5EUOE 1HHIA 2R56H 5F97E 4R4FL 2NZ1A 1F42A 4AJVA 2DQDL 2IAMC 4FI7A 2BDNL 4HS6A 3CFIC 4G3YL 3EYVB 2XHNA 1JGEA 2H6PB 5AW6B 3RTQC 4JCMA 3KGTA 2WKOF 3ZE1F 4HCFA 5BO1L 2Y72A 5E9DA 4YDMA 4IMKA 1TETL 1PCXA 3FT9A 4N0UA 2E7HA 1AZCA 1JI1A 2UY7B 4K71C 2R69L 5GGTA 5LWYL 5D1ZA 2BNRB 2VE6A 5CJ8A 5L4MA 2NZ9C 2WK2A 1TNMA 4R2GB 5EBLB 3ZQXA 5DD3L 4CSPA 4NDMA 3FT3A 3M8OH 3V5HA 3UTPE 3ZTNH 1NCDH 4U1JA 3QUYA 4G9FA 4OSUL 4YSAA 4L0YA 1FFQA 3QULB 2H6UA 3ZR6A 3GSOA 3D0LA 4PJXF 3H54A 1MFDL 5EMYA 2FNWA 2VLJE 4QOKB 3EOYG 4ETYA 2NQDA 4G2AA 2EO7A 2P47B 5EEYA 4TKWA 3R06A 1BVNP 3RPKA 2XA8L 1I85A 4GRLA 4E9WA 4PGJA 1EGJH 2DB8A 4FF9A 2NNRA 2ZUTA 4H1LG 3EG9B 4TQPA 4WEUD 3BO8A 3W0WD 1BD2B 1OIOA 1D7CA 2OSLA 3A4AA 3FQRB 5FX3A 1OOAA 3MRBB 1ACXA 3TGXA 1A4CA 3O0RL 2WV3A 1DFBL 4HPOH 3LHPL 4L8BA 2WCGA 4ZQKA 4HIIB 3ARZA 1WIUA 4Y2DC 2VNCA 4NWUL 3S36L 2A6KB 5HHNA 1SEQL 2LGNA 3U30B 5C92A 4MNQB 2IBBA 1IIKA 1GHFL 2QADD 4X7DC 2J8HA 2C7UB 5EUKB 3QXDA 4XN2A 5DVKA 1CE6B 4RVBA 1IC7L 4G1MA 3PP3K 4Q6IC 5HHOE 1PJ9A 4S10A 3MV8A 3LIZA 5GGQH 5KG9A 1N68A 3FHEA 4JM2D 3TLRA 5MEND 4ZJ9A 2F53E 4PH8A 1SEBA 1GAFL 3VXRB 2BIMA 4PJIE 1XH1A 1LE9A 2P5WD 1NAKH 1GKEA 1FG2A 1JNHA 3B3IB 4M48L 4BFNA 3SDXE 3ULVF 4TLKA 3PYCA 1N18A 5K9OA 3BVVA 4JFYB 1P5UB 3CC5B 1R5WB 3ZSTA 2W9EH 3CDZA 1U3ZA 1QI4A 2NSMA 3K72A 2Y5TB 3LV3A 5B4MD 3MLXH 1HXYA 4ZXBD 2BJML 4W9IC 4Y4FC 5INDA 5AKSA 5D71L 4NBXB 5K59F 5HYQB 4JQIH 2Y2WA 5E6IB 2AK4B 4HEPG 4K9JA 5T3XD 5BOJA 3BKJH 4PTTB 2WANA 3SDXF 3C6LB 7TAAA 4Y4HB 4NS0A 5JW5B 5H37G 3VG9C 3BGMB 4YPGB 4PY7A 4F7TB 1WD9A 3HZMB 2ZJSH 4L5FH 1HWWA 4AKQA 3KPSE 1TSHA 2FEDD 4U49A 3AT0A 3O8XA 1U3HB 2V17H 4R8WL 4GW4A 1IUZA 1C1EH 1T0MB 3ARPA 3RNKA 4GRWB 5IW3A 3V0VA 5KSAA 1RQ5A 4EUPB 1BQSA 5D7IF 2ZOOA 2P80A 4X9BA 3LEVL 3CU1A 3SKOB 4ODXA 4GI6A 1JMZA 3RGVB 1JZEA 5KJ4A 2NR6D 5ETUB 1CTMA 2M83A 4JRXB 4J6IA 3I2CL 2RH0A 4H20L 3S5LG 5GXBB 5JDSA 5LXGH 2QJDA 4X4XB 5GGRA 4DCQB 1LP9B 1QYGH 3CG8A 4ZX4A 3T2NL 4AYGA 4G43A 4B0MB 5BJTA 1QLEL 4Y4KA 5HYEA 4DUVA 2IH3B 5T33H 1P6FA 1BBDH 2X87A 4DO5A 2NY0D 3NJMA 4ZOCA 3MLRL 1GYCA 4H88H 4HWBH 4Z6AT 3FQWA 3SZ6A 2AP2A 1TPXC 1H15A 5GRVK 3QG7H 1BX2A 5T8IA 4ZW3A 3RWHA 4ENZA 1RJZB 4A2EA 2OMZA 3T6VA 1GPOH 4EOWL 3OG4B 5HGBA 3UZVB 3FU5A 5HYSG 5IM7B 5DUPL 5FCSH 3ZE2E 3OSKA 4N2MA 4URKA 1XO8A 2ZXWB 3FFCE 5HY9A 1YNLH 4M6MH 1GVIA 2R4RH 4MS8D 4NUQA 3EJRA 3OKDA 5F9JB 2WMPB 4QRSB 5HDBE 2ICWB 3IPFA 4QMEA 3A4EA 5CCGE 3K4ZA 1UURA 3UIYA 2GUYA 4ERSL 4Z23A 2CDFB 1NOLA 1UD2A 4QRRB 2QEJA 3K71B 1OARH 3I6GA 5FXCH 3VVVA 2OI9B 2W60B 3PPSA 4NQTA 1CFSB 1BJMA 3B8YA 2C9QA 4XNUL 3KYAA 4P0DA 5BMFL 5CNHA 5DJDB 3BQUD 4HJSA 1EUUA 5I75B 2JI2A 1S5IH 5D4IA 5J56B 3WU1A 2O5ZL 4UINH 2C3VB 4CU8A 2IC2A 3UMNA 1DN0A 1WA1X 2GI7A 4XO8A 2AS5M 5BZDA 2FQDA 5AWNH 4X0KA 4OFKA 3CHSA 5DRZB 5J13C 5FB8B 2DH3A 4QRPB 1TQCB 4UT9A 1E28A 5AW3B 2LVEA 3IDXH 3TT3H 3R19A 1V10A 2OX5A 2ARJA 3FCTB 5IB2B 1G5GA 1U6AL 1DVFB 3VYPA 1WSST 1CWVA 4XNMA 3B2XA 4XPBL 3HE6A 3WN5A 3WJMB 1DHKA 2P1YA 5JPMA 2E86A 1BM3L 4LLYB 5A2AA 1NMCC 5BQ7B 5IQ7H 3BMVA 2EIZA 4HH9A 5IMKA 4N2HA 2WTRA 3BE1L 3ZUNC 1PZSA 4G6ML 3QUML 4XNYH 5ITFB 3SN6N 4CVXA 2X53A 5C0JB 2YJLA 1CJYA 4TOYH 1EHLL 3DJ9A 1MXDA 4JE4B 5EC1B 3UBGA 4NZ8A 2CRZA 3REWA 1SMOA 2WIIA 1AC0A 1YNKH 3V6OA 4AUJA 5D1XE 3ZTEA 2JK5A 3BZDA 4AG4L 2GJZB 3NRPA 1T4KB 2F9BT 4URTB 1UD8A 4OT1H 3VD9A 2ADJB 2B9BA 4BRJA 3WJLA 2APVA 5FA4A 4ILDA 3WE6A 2O61A 3BGFB 5EZIH 4AYEC 4MJJA 1JDDA 1S3RA 5E1AB 2CKBB 2IDUA 4F15B 3OKOA 3L5IA 1BZ9B 4HKXA 4HWNA 2JCCA 2LV4A 3QPQD 2FEEI 2LFGA 4CA4A 1GZPA 3GRWA 2BSTB 2R4SL 3KPOA 5BV7H 3SDCC 1HE8A 4K8RD 1M53A 3JVGC 2NDGA 3D39D 5TPWL 4N86A 1VFOA 4LEXH 4RGOL 3AQXA 4NHCH 1CBJA 4Y5VB 2ZG2A 1BF8A 3NQKA 2ZX8A 1RFDL 2RHEA 3JV5A 1OCWH 2CHDA 2ZKXA 1BJ1H 4X9YA 1F58H 1FPTH 4UT6A 1BBJB 3H6AA 3TASA 4GQZA 4PPTA 1FIEA 5J1AB 2JQZA 1A6UH 1BFOB 2WXQA 5D5ME 1SXZA 2CIIA 1JNLH 5TTRA 1Z9MA 4L4TA 4Z7VA 3KLHD 4NRXB 2VDPB 4YBQD 1N4XH 3DIFB 3DA0A 5T1LA 4EI5D 3CQPA 4Y1SA 5C2UB 1FNEB 2CDGB 3CLFL 3TN0A 5A2JH 2AGJL 2NTSP 3KVPA 5D6CB 4Z8FH 1CZ8H 1QUNB 4ZFZB 4B3VA 1W72L 1USZA 3HZKA 4R26H 1JK8A 4YDZA 3U82B 5L2KB 3IN2A 4Y2DA 3PXHA 5GGVL 1SRDA 4XRCA 3O4OC 4Q4IA 1TVHB 2XOTA 4O02A 1XF2A 1II4E 5A6MA 5HD8C 43CAA 5F9WC 4UTBH 3FO0H 4DP7X 1VSCA 2E6JA 4HOZA 1ET7A 3WN6A 3G6JF 5J6HB 4XPTH 2DWXA 2Z34A 4FZ8H 4UOW0 5KANI 3QH3B 3S35H 3WGUB 2XG4B 2ZOKA 2I7SA 3RFZC 3AACA 1S7XA 4JFEA 3CZFA 5HHPB 3CSYA 3L45A 3P3RA 4H0LC 2DQCL 2BFGA 4MMXB 3CHXA 4POZC 4QAMB 4UQ3A 1S7SB 2VERN 4JGJA 3ULVL 1ZHLA 2HG5A 4ORGA 4AGOA 3N1PC 1YMMA 4QRAA 4WJKB 1J8HE 1Z9PA 3O4LA 3C08L 3QPXH 2IBZY 5IVZB 3VWKC 1DO5A 4HUWA 1JF5A 4B97A 2O30A 4HGWA 2VXUL 2FD6L 3I6SA 4GRWF 5HI5C 1WHPA 4J3VA 3EO0A 1CD9B 4OTXL 3O3UN 4WSGA 4OLUL 1ILSA 2EXSA 4HUUB 5IBTL 3T1WA 1HSAB 1R19A 2D7TH 4FL4C 3PIQA 1QRND 3S37X 2J1ZA 1UKTA 5CEZD 2V2TB 1AQMA 1LP9F 3HZYA 4FNLL 1A6TA 4NJ9H 5HJDA 5C09B 5IBLD 5ID1B 1FJ1A 2XQYK 4X99B 4Y19D 4U7MA 1HN1A 2DJUA 5CD5D 1RPUA 1MG3C 3L1OH 5C3TA 4A6YB 4GBXC 3L6FB 3B7UX 4NXKA 4WVRA 2VITB 1NCCL 1CDIA 4XVUD 1HYRC 2Y69B 3QIUC 4YBLC 5IV2B 1C12A 2ADGB 1BJ8A 2OK0L 1MCDA 1DE4A 3LDBB 1KLFA 2V4LA 1EJ6A 1ACZA 4KRPD 1WZLA 1TOXA 1JPFA 3ARDD 3VCLA 3ABMB 4OFYD 4S1SH 4PGCA 3ARXA 3NIFB 3QUGA 5JW4N 4UYPA 3RQ3A 2VLLA 3RX9A 2H4EA 4RAUA 1UADC 2IG2L 4QKTA 4X8JB 3E80A 1HH9A 4TMPA 5DRWB 5EB9A 5BO0D 1L6ZA 3H2PA 2B1HL 2W80C 4QI3A 4YHNA 5D7LB 2APTA 3BIKA 5BV7C 4OCYH 1TTFA 3VXSA 3PAVA 1KB5L 3T5WA 2YD9A 4P23C 1HVXA 1MAML 1MFAL 2L04A 3N5AA 1CD0A 2D0HA 3IU3A 5INCA 1CCZA 1KN2L 1A5FL 1HAWA 1RPQA 2VR4A 3OPZL 4KKCC 5DD1L 2BPBA 3FUKA 3MCKA 2C9UA 3T8XB 1QLRB 2R2CA 1E4XI 1HU8A 3PY9A 5KVFE 1B0GB 3PHQA 5KS9B 2VDLL 3LNHA 3VA2C 4MJ5A 2R2BB 1I75A 3BUPA 3OX8A 2GC7C 1YEIH 3MNWB 2HTLD 4LLVA 4Z3TA 2I07A 1VZIA 4WK0B 5F7YC 3CQFA 2KDGA 2X28A 1CG9A 2K8QA 2P4AB 1IB5A 4N9GA 3ZKNC 1AS7A 3DX1A 4DZBA 3LRLA 2DWTA 4AKPA 2OJZL 1TZIB 1RZQA 3KWWA 1HZHH 4PWFA 1TJGH 5BZWA 3FQUB 3P9LB 5D2LE 5HHQA 3UH8A 4F8QA 1RL1A 2GJ6D 4L8SA 4PJEF 3TO4D 2EDMA 3U7YH 2LLNA 3H55A 3KCWA 6CGTA 3MNVA 3ARBA 5D2NE 3VNYA 2KPNA 5D8JH 5KYYB 1ODUA 5TE4L 1J87A 1P4LA 2ZNWA 4X8XA 2X5PA 3ASOB 1GOFA 4NQDA 3GK8H 4LAJH 3VI3A 4D0BA 3QWRA 5IR1B 4AUYA 3NJJA 1UD6A 4YEEA 4DSYA 1GZHC 4P57A 2MNWA 1IU1A 1BVKA 3FRPG 3H0TB 5DMGC 3GLAA 1A7NL 3CH1B 3EZJB 4IJ3B 4K3HA 5BRZB 3AS1A 1M05B 1WCBA 3WYRA 2ZKHH 1RURL 3MV7E 1WC7A 2PPCA 2HKFL 2YSTA 1NCAH 1PDKB 2O5NA 4R9HA 4LVNC 1HHHA 3OKNB 3WTVA 2R8SL 2BVPB 4FI6A 1U33A 1DSWA 4X7SH 3LKPB 1VACB 2OM5A 3BLKA 2YAQA 4K94H 4EKJA 3VMOA 1PPIA 5C7XH 4A1RA 5E8OA 3SB3A 2MEJB 3MZGB 2C4FT 1KGCE 1LWHA 5SX5K 3SCMD 4WO0A 3VB9A 4CAGA 4DESA 3U1SH 4DFIA 2HJKA 2WXMA 2JIXB 2VLKE 4K3DH 2HTKD 4G6JH 4FMFA 4NAQA 4LCIH 3KJ6H 2EDXA 4X8GA 2WXJA 2WXRA 2DLTA 4JKWA 4MWFA 3MX0A 3BSZH 1KELH 1W6LA 4WNQB 5FIEA 1U9KA 3S7GA 4DEWA 2BZDA 4OM0H 5T3XH 3RIKA 4M6OH 5KOMC 2D3JA 1G6RH 4E0RA 1GL4B 2EE0A 2FHBA 3CBRA 2LVCA 5BUPA 1R3LB 4JB9H 1ANUA 4XC3H 4ZOBA 3SKJH 1IGMH 5SWSD 3LMJH 2GTZB 2OMNA 5F1KC 1QUPA 3G5ZA 4JZNB 2FECI 5IHUH 5EWIH 2WY3B 3KPRA 1NL0L 5HHVL 2CRMA 1YEKH 3D0AA 1ZTXL 4MAZA 4U1GB 5AOIA 4HISA 4QXUL 4FQXB 1OAKL 3UTTB 1NQBA 3HRZB 3LKRA 3SHSA 5D4HA 5TFSH 3W39B 3B7TA 4F8OA 1XQ4A 5E08L 3N9GL 4FXGC 5JHLH 2GK0A 3QDJA 1NIAA 3LRGA 3GBNH 4NO5A 1SOSA 1TZHB 2A74C 4ODVH 3SBRA 1HIML 4QHNA 1G4RA 3GYRA 5J8OA 2X4QB 3CSBA 2BX5A 3AADB 1T5WA 4APXB 3UTSA 3DXAD 2ATKB 4GQQA 1QMUA 3ABZA 4YHMH 3CN0A 4PJ5D 1Z1WA 3WFEL 3OB0H 5LNGA 2E9WA 1QFWL 5AALA 3NIDE 3MOAL 4ZOAA 5DLMH 3TWCH 4MD5A 4GSDH 3WHXB 3ECWA 3GTTA 3VE0A 3SKMA 4ODSH 1PSKL 4KKAD 3EGSB 3RWDB 1F8TH 3BH9B 4YJZL 1F4AA 1EMTL 4BWTA 4FHKA 1RAMA 4K5PA 4EIUA 2DWDA 4OJYA 4C4BA 4Z7WE 5F7EH 2N7AA 4OZHE 4PRHA 1RU9H 3KJ4B 3MJ6A 1HQRA 2XWEA 3D4YA 3DPBA 3PP4H 5F3HB 3T0VA 4ETQB 2V2XA 1KIPA 3IFOB 3WXVL 3UAAA 3BI9X 3GMNB 5AVUB 4NZDA 4R7NB 4AEIH 2YSSB 2E46A 1MFCH 5B8CC 5I1AA 4W4OC 5IHZB 4OIIL 1UWXK 1HHIB 5KJRH 4JJ5A 3QA3A 4KNQA 1B4TA 2LLGA 1O9VA 4KRLB 2D9CA 1TTGA 4QPEA 2NY5L 1K4DB 4CJ0A 1MEXL 2O4EA 4JPVH 4KDTA 1ITBB 3EOAA 3I75A 5JLZA 4UTAL 3QJVB 2D73A 2PR4L 2QADC 1FL3B 2KDYA 1AGFA 2N0MA 4IBZA 4P3CL 3H4FA 4XN1A 5GRZA 4JUSA 2CDEA 4DNLA 5JMRA 4GXVH 1W0VB 4G71B 3TV3H 2Y7SA 4LGPB 5C71A 4LPXA 5I0XA 2BP5M 4YS4A 3KDPB 4S1QH 2VQTA 4DQAA 1U8IA 4JM2C 2DD8H 4XE0A 4O2EB 4XB7A 4HXBL 4KPHL 3QXAB 1RD6A 2DWSA 1FVDB 4B9IA 3MJ8B 4U1JB 2DTSA 5E2UH 5DWUL 1IQDB 2EE9A 1LQBC 3D4CA 4K94C 4XX5A 4M3JA 1JPSL 3DDGA 1U8OA 2OL3H 4RNRA 5FHBH 3MGAA 4GBXA 3S8GB 1SYVB 5B4MC 4ZX3A 3QIUA 2XZQH 3DDFA 4ZXBC 4OU3A 3BPCB 1M7DA 1NWPA 2DKUA 1YEFL 4K23L 1OGAB 4AK2A 3EFFA 3D87B 4MJIB 4NRZA 1X4XA 5EZLB 3J7HA 3PDOA 2NXYD 1L6XA 4PIBA 3O3AB 3B7SA 3TBSB 5BZZA 3SPVA 1T6BX 1YG9A 2ODHA 1OP5K 1B3IA 1ASQA 4L8BB 5IKCA 5K9KA 5D1QD 5F44A 2ICEA 3ILPA 5EG6C 5KSBB 1F11B 2CBTA 2FEDC 4K8RH 1KENL 4JJHA 4QF1A 3T6QC 4M1DH 2APBA 5E8EA 1IGIH 3UBXB 2CO3A 5L7XL 1JZHA 3QJSB 4KXZI 1JZGA 4ZSOE 4LSUL 3IGFA 3ULUE 4R7DB 4CW1B 1Q9LB 1LEKA 4G83A 2NR6C 1AP2A 3O3DA 5I0WA 4JZJC 4HCRL 5KYWA 4BZ2H 4NN7C 3LZFH 3VXQA 2X3AA 1I8IB 3GDCA 3LKSA 1CL7L 3F04A 3OKLB 3BPNC 1NKOA 4E68A 1SEBB 5JA9A 1BLIA 4BFJA 3S8FB 3KPTA 3EFOB 4NXSA 4KKPA 1WRFA 3IJ7A 4KGLA 3CV5A 1D5XA 2VQ1B 4JO5A 2NY0C 4XPFL 3VX0A 5K9OB 5TQ2H 3PWPE 1WCQA 4R96B 1G7MB 3QYMA 2C9RA 3QJRB 4FTVA 2FT6A 4PWIA 4AYID 2WNGA 3VD1A 5KVFL 4XOBA 5CBAA 3TFBA 2GI0A 3FQ4A 2LE9A 4ELKB 5HJ3B 1M42A 1IAOB 3V6FB 2QQKH 5D7SL 4JK0D 5C08E 4WF7A 3JWOH 2VISB 5JW3L 1YN7B 1I1RA 2LOEA 1H0DA 4MS8C 2XPGA 3ILDA 4P2QA 4J3BA 4GAJL 4NUMA 4XWGL 3TCXA 4JKKA 1EANA 4PRPE 3H9SB 4U3SB 3HS0B 5HBBA 1CK0L 5F7HA 2CMRH 1BPLB 4A04A 3C9NA 4GQRA 4BHUA 1ZGLA 1GW6A 4MMYA 4R7LA 3L08A 3Q2VA 3TJHD 3FO2A 5TGBB 4KNSA 1UCTA 2XN1A 4BFOA 1JWMA 2ZPKL 2X6MA 4RFEB 3UJTH 5C0GB 5KSVA 3BKCL 3D8MA 4MCMA 1NDTA 4NZRH 2DM7A 1I9RL 3BQUC 4L0ZA 2ZCHL 4ODXB 3F7RA 1H8OA 2DIBA 1XIWB 3ETTA 3VXMB 3EJQA 1N12A 1YPZE 4ZMOA 1CBVL 1AAJA 3FN0L 3RNQA 2WM0A 4PJGE 4W6YB 4F7EA 3LHAA 3CHPA 1EDQA 5EU6D 3GJFH 1DDHA 2EIDA 3CDGA 4P2RE 1J7VR 4KUCD 4PJ7A 4Y2OA 1KBWA 3HG0A 2UWEE 4NENB 1TTAA 4HF5L 3AG1B 5J6GA 3QJFB 5JW4Q 2F61A 1QSEE 5E4OA 5ANHA 2UY6B 2VLMD 1A9VA 1O7DC 1SFHA 1XGZA 4IRSD 2GYSA 3RWFB 2TRHA 3QDMD 1CFQA 1VGKA 2LAGB 1OEZW 2DYRB 4FX5A 5I1IL 1MHEA 3FQWB 4G9DA 3K6DA 4PG9B 1LO3H 2PYEA 1IEAB 4D3CL 2CGRL 2VXTL 3GPSA 4JFPA 2F8VA 3CLWA 2FJGB 1ZY9A 3H2WA 2J44A 2WVSA 2D31A 4YQXH 1BZ7B 3MLVH 4DHLA 3MTXA 4JY4A 3VA6A 3AW5A 4YHIB 3BW9B 2EUXA 2OKMA 4EPSA 1KGIA 1PZAA 2AF2A 3WY1A 3CSPA 1BEXA 4N20A 1DTUA 2KKQA 4FXGA 4MA7H 2MSPA 5TJWK 2FBJH 3LQMA 1IEBB 4XCCL 3U7WL 1J05A 5E1HB 3S8WA 3MRDA 3QIBA 1FI8C 2V9UA 2WNXA 2EDWA 2YGOA 5GS1C 1ZHKA 2PCXA 4IYKA 5LN8A 1LO2H 3KVDD 2EABA 3MV9D 2I60L 2DLIA 4LKCA 3NEXA 5BS0A 2G60H 1UUSA 3MXWL 3QPQC 2BNQD 5EBMB 4CC1A 4LL1A 2IQAB 3FK3A 4K8RC 1DQIA 1ZA3A 3QPKA 1OLZA 2BIHA 3L3GB 1TJHH 2V9QA 5DQJA 3TT1H 3QUKA 2ENJA 3MRMA 2QDVA 5CCKL 3KL3A 1BREA 3U46A 3PHOB 3QJHB 1O0VA 1NAMH 4IMLA 5IWLA 2P8LA 1HL8A 4GAGH 4QXGL 1AACA 4XWOD 2AKRA 1OF2B 1I9JL 3DWTA 1D2PA 4OCRH 4AVIA 1MCBA 1YY9D 1ZRUA 3HZ3A 4RWHA 2HN7A 2VSCA 3KLHC 3UEZA 4WEBL 4DO6A 5I1JH 2WGXA 4AOFA 2B20A 1W15A 3QGVA 3RWIA 1WYJA 1UH2A 4EI5C 1XVSA 1LEGA 5DD5L 2ZOTA 4OJEH 1ZLSL 3WD5L 4POYA 5L88L 3SSGA 2ZQKA 4OI8A 3BHBB 2F7PA 4HWZB 1P0SE 4UB0H 3VACA 2IAMB 4MCYA 3NCCB 5I1HH 1AIFB 3DHPA 3A67L 5DI8A 3F6JA 2G3ZA 1BZ8A 3WUWA 5DYOB 2X9WA 3RTQB 3QZWA 1B0IA 1A6WH 4ZUWA 1AS6A 3ETBF 1HILB 5FA4B 3BWZA 3H3BC 3FAXA 3T2OA 3WG7B 4K71B 4JRWA 3LQAL 5TF1H 2BSED 4MKMA 3OKOB 1MFEL 3U4EB 3MYZA 1PD1A 5CLTA 1OVZA 4KY1H 1KJ3H 1CVRA 2AABH 3KDMA 3S2CA 2ZKYA 5CSZB 2F74A 4MRCA 1RZIA 3NN8B 1U93B 2ATAA 15C8L 4G82A 4GXUN 1XZ0B 2FWSA 3DX7A 3QFJB 4TVPE 2QLVB 4OLZH 2Z3FA 1Q9OB 3BSGA 4G8GD 5KSBF 1RZJH 1QW9A 5LHDA 1IM9D 2YQGA 1ZK9A 3VJ6B 1EDHA 3P9MB 4N0FA 5GRVL 2VDKB 3I50H 3BDBA 1MRFL 4WUUE 4L4TB 2P5EE 3DTXA 1GGIH 4UOQA 2JJTA 2B0SL 2BRRH 2EINB 1QBML 5T1LB 6TAAA 1KYOJ 3QCVL 3QW9A 2RMNA 1EIBA 3PXLA 4N6QA 4AT6A 2O5XL 3QDGD 4JKNA 4O4YL 2WSDA 2HVJB 3W9DA 2EECA 1DP0A 5IBLC 4JFFB 2AVGA 3KPPA 2TRYA 3UCQA 1PIGA