4JUTA

Crystal structure of a mutant fragment of human hspb6
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
84
Chain Sequence
ALPVAQPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHAARPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure and dynamics of the dimeric human small heat shock protein HSPB6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock protein beta-6
total genus 12
structure length 84
sequence length 88
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jutA01
4YE0A 1WFIA 4RZKA 4YDZA 4JUSA 3GLAA 3L1GA 2Y1ZA 3QORC 3QORA 3GUFA 3L1FA 3QORD 4YLBA 4PCKA 3Q9PA 3N3EA 5DS1A 2KLRA 2KMWA 3W1ZA 3VQMA 1EJFA 3EUDA 3L1EA 2Y1YA 2MNWA 4M5TA 2RH0A 4YL9A 2CR0A 2BOLA 1RL1A 2Y22A 5DS2A 4YLCA 2N3JA 4MJHA 4ELDA 2CG9X 1SHSA 2JKIS 3IGFA 3J07A 4FEIA 5LUMA 1X5MA 3Q9QA 2XCMC 4ZJ9A 3AACA 1GMEA 1WGVA 2WJ5A 3GT6A 3AABA 4JUTA 4M5SA 2O30A 4PBDA 2K8QA 3QORB 1WH0A 2WJ7A 2N0KA 3VQLA 4I88A
chains in the Genus database with same CATH superfamily
1P5VA 1CDJA 3VGBA 1AKJD 1HDMB 2R29A 2FT6A 4GSXA 3WFDH 3BWUC 3LDBB 4OJAA 4ZXBA 1OM3L 3FB8B 2BNQA 4L1DA 2PABA 1S7VA 4NO0D 1SOKA 1QSZA 4HBCL 4E42A 4PP2B 1FYTA 1A1OB 3VD1A 5AG8A 1IGIH 4JE0A 3KBHE 1G0YR 1LNUA 4FI7A 3T4YA 1N6UA 2XFXB 5LGHL 2ICWI 1UADC 2D3VA 2EJ1A 1MFMA 2JE8A 1OQOA 3F62A 3L4XA 5C07D 2CHDA 4CMMB 3MRPA 5BUGA 3HCVB 3MR9A 4FULA 5IQOA 5FPIA 1QMUA 1A1MA 1S9VA 4BRVA 3U7YL 1A7PH 4OF7A 3U4KA 1QWNA 5IROA 2PKDA 4V33A 4KGLA 1ZS8B 4DP4X 1K4CB 2MQCA 5GJSH 3FONB 2XZAH 4JKWA 5F6HJ 1KN4L 4LCCC 1DBBH 3CX5J 1LDSA 1D9KB 1I9IL 5KYNA 5BO0D 1EWHA 1UB5A 2SEBB 4L0PB 1BFVH 4NQXB 3ARZA 4JEGB 3EDJA 1JWSB 4TVPD 4YIQA 2ETWA 4NNPH 5F96H 1A6UH 1SY6H 3QXDA 5JHDA 1GSKA 3EADA 3DYOA 5KAQG 2WQRA 5ERWA 3CZKA 1LJMA 1LWHA 3AJ7A 3O6FD 1E6JH 4FFTA 1B0RB 5DZJA 4WKZB 3VCLA 3EO0B 5C71A 3CAFA 3O6MH 4L4VE 1LK3H 4TSCH 4KTYA 1K9TA 3BP5B 1HJBC 3DX7B 5IB3B 3BFQG 3II1A 3QA3B 4AK1A 4C4KT 1Z0NA 4FLOA 4K3JL 2R56H 3BAWA 3ARGC 3V0FA 4GQ9H 4B9JA 1UT1A 4UBDC 3HG1D 3MSPA 5DSCA 4JN1H 2H8PA 2Y69B 3HMWL 3HI6H 3P4MB 3PWPB 4WCYL 4ZD3H 5C7XH 1XGQA 2ZKYA 3OAYK 2EVGA 4ALAL 4J2QA 3B43A 2V9QA 1T1XB 4ZUTA 1DVYA 3OR6B 3VSTA 2WWMD 4RMSA 3T4AA 1WD8A 2OMXB 4XO5A 1RIHH 4PRPA 1ZWIB 3D0VA 5AW4B 5B8CA 1INEL 1MFNA 5HVHB 1CZ8L 2F8XC 3TV8A 3QPXH 4U1MB 3BZEB 1G7PB 1Z5LB 1U3ZA 4X4MA 2WQVA 4OQTL 4LLMB 5MEOB 1YEKH 3ULUE 5GHWH 1ROWA 3KW8A 4NB7A 2GTQA 2KPWA 2ATPB 3NJMA 5L2KD 1OAYL 3S5LB 2PTTA 2V5TA 3SIKA 2AJUH 3L16A 4ZOCA 4EI6B 3TNMB 3LVTA 1X5HA 4IGBB 3ZW3A 3MGAA 2NSQA 3V4PA 4QRBA 1Y7VA 3L17A 4LBEB 5GGRY 5F7YC 3NJLA 3LQAH 3QWOB 2EINB 3OHXB 5AD0A 5FIEA 7PAZA 3LQZA 2W9LA 4HJIA 4DERA 4QWWC 3DDFA 2LFEA 5J1AB 2QT6A 1CDHA 3AXIA 3UACA 4F7TA 3Q05A 1JF1B 1R5IA 2J8OA 3HBQA 4J8RA 2VLKB 4AGOA 4KXCA 4J39A 2FEEI 4PJ6A 3QI9A 4TLKA 5IREA 3KYOA 4UNVA 1A3LH 3GTVA 5FHBL 1F4WH 1J8HB 5DUPH 4BKLB 2VC2L 1MWAH 1GYCA 3CFJB 3H9HB 2HG5B 2P7TA 1GC1C 3E9UA 3D05A 4XVSH 4Y1AA 4XMZA 4AYBA 2OMYA 1JHKL 3U2SB 1AYRA 1LO2H 3PQYB 3WTVA 5D1ZC 1MUJA 4NQUA 4B60A 3E80A 3Q8FA 6FABL 2F53A 3VI3A 1V3KA 2DI7A 5EZLB 5BO1L 4PWIA 3PP4L 1IAOA 3VB8A 1CDIA 1L9TA 1TITA 4LCVA 4OW6A 4D9LL 2CCLA 4JO4L 1NM4A 4PD4K 1EXUA 3ZL4L 5FM8A 3RL1A 5EU4A 1RLBA 3ILQD 3CHOA 3QDJD 3MC0A 3QUZB 5DD1H 2CBOA 2VYRE 4IRJD 2DLHA 2EDWA 4OFYA 1OZUA 3GPEA 4LGRB 5C6TL 3IMUA 4TUKL 4BQ8A 2WTRA 1RUQL 5JORB 4HULB 4P2YA 3DUUB 3S88H 2BCKB 1IJNA 2IOIA 5CLWA 5DHVB 3H9SE 4XH2A 1SJHA 3TNNA 1QFHA 4LPYA 1BQUA 1NWOA 4Y5VB 3LPGA 2DQUL 3QDGB 5ELIA 1PY0A 2DQHH 2XWXA 1ZLDA 2Y23A 5J9PB 3QFJB 2EH8L 3QUKA 1X5XA 2B20A 1UCBL 3QP3A 4WI2A 3WIHL 2H0JA 1CICB 5T1MA 4CKQA 3GSOB 2DI8A 4LNRA 5FDWB 4P46A 3IFOB 2BIQA 3PREA 3CUPB 4GUQA 3B9KD 3WG7B 4YGVB 3MLYH 4E41E 1PKQE 4G43A 1J5OH 3MLXL 1KBGH 4WEBL 1D9KD 3VG9C 3IETA 3REVB 3TBSA 3F83A 4FTDA 3VI4B 4AEEA 5ID1A 4A37A 4IIZA 1Q9KB 4N8CH 5KSBE 4U05A 3INOA 3OGCA 4BZ2H 3JTSA 2FJGB 4OF6A 3KPNA 4DCQB 1X4ZA 2GTWB 4EF3A 3C5XA 2NDFA 2P46B 2YK1H 3FU6A 1SVBA 1DDHA 4QHLA 1MRCL 2FZ3A 5F89B 5LG1A 4UNIA 4EZKA 2VXTL 2RR3A 1AJ7L 5HYJA 3KPMB 1BXAA 3MKKA 1DBKH 4R3SB 4X5RA 2QQQA 2WUCL 2EIDA 1KGXA 4NKDB 2X1WL 3RGBA 4AJVA 2EDHA 4M7ZB 3TGXA 4QRPD 2JCCA 4IK7A 4K3DL 3PFQA 4LVOC 5E9DA 5AUMA 3MRQA 4Y16D 2O6CA 2PTTB 1ZTMA 5F0JB 1P4IL 4OF5A 5HJGA 1NOLA 5IEKA 3NYKA 3AY2A 5F0PB 3ZY7A 3KD4A 2K8QA 5E6IC 1JTOA 5HD8C 1M71B 4O2FB 3ILDA 3LKSB 4UM8B 3U4AA 3V4PB 3KLKA 2P80D 4A6YL 2W0PA 3ZHLA 2YS4A 3IT8D 3ZHDA 3W0WE 2A74A 3JT0A 2E9BA 4JO8A 3IWUA 1FL5A 3NFNA 35C8H 1CWVA 3UO1L 4RQQA 4FXGB 2H9GA 3CG8A 4HHWA 1IE5A 2Z4QA 2F5BL 3E6FA 4NZTL 1P69B 2OXHB 1JHKH 1JVLA 4GXVH 3BSZH 1UB6B 1C8PA 2X9WA 5E94B 1QSFD 3HZYB 4GLRI 4D9RE 4KJQD 4FL4B 4OM1H 1J8HA 3NAAH 1YN7A 1AI1L 2MQ0A 3QJZA 4A7QA 3ABKB 4IOSD 5D71H 1FO0B 2NY2C 1YPZE 3KS0J 4JFFB 4HCIA 3S96A 5TD4A 5IQMA 2YAFA 4KRMB 1ES0A 1ECYA 1QO3A 2GSMB 5CIPB 3UTSD 4AQOA 5CN3A 4KNQA 5C0AD 1NCNA 1PX4A 1PFCA 4XN5A 3O3AB 2VSKB 5E51A 2KL6A 2V5YA 2CLVA 3MLZH 4P2RB 1E4XH 2BDNL 2YBGA 4B9CA 4PJBE 5IBLD 1QI5A 2CIIB 5KZCD 1WPCA 2WUBL 1KBWA 2Y06H 3WIAA 5I8KL 3RUGB 2ENJA 3SZKC 1N4XH 1RU9H 3BKJL 5IMLB 4B7IA 4UT9A 2VDKB 5I1LA 2APTA 4Z76A 2ODIA 3FSZA 4LSRH 4O5LH 1J05B 1KPUB 3D50A 1I7RB 2JIXD 2VZVA 3QDMB 3LRGA 1SYSA 1NAML 2K6WA 4JJ5A 5FWRA 3I85A 4Z7WB 5DQDH 2PWHA 3H7LA 4I9XA 4YSRA 3TIDB 4XH2B 4AUYA 1ZEAH 3BWAA 3NPSC 4NI3A 1WT5A 3CDFA 5SWQB 4QIRA 1IAMA 1MCOH 1T66C 3KYMB 3VXMD 2CLRA 3SGKA 2FIKB 1U8PA 2IGFH 5KVEE 1GYVA 2NY1C 5IVXB 2FLBT 4KRPB 4O02H 4HS3A 3FQXA 5F7MC 3JVFC 2C9VA 2B9AA 1DO5A 4PW4A 3IFOA 4F33A 1JRHH 4N85A 2ZYSA 1KG0A 3ZKQD 4KJPD 5FYJL 2UX7A 4IM8A 3T65B 1E7UA 3IETB 4M4RA 4HZLA 2JK5B 2BK8A 5ID1B 1QLEB 3CN0A 2WUCH 3BD3A 1UZ8B 3EFOB 4X6CE 3RGHA 2BIIA 1A1NB 3QJRB 4DCQA 5KS9F 1VGKA 3PQYE 2LU4A 3WFCH 4M3JA 1CD1B 2EDXA 4WFGD 3KPSA 3GXNA 2DAVA 1YEDA 5IG7A 3ZTJG 2AP2A 3SDAD 4MAUL 3QYNA 5B38G 1E5CA 2XSKA 3E0GA 4L8BA 4JO4H 1BMGA 2TRYA 5HJ3B 5CJOL 1U8HA 2QV4A 4WW1B 4OVVA 2C3HA 2VDPB 5I17B 1TQTA 2W9DH 5CN1A 3RX7A 1JL8A 4MJIB 3FRUB 5HGBB 1C1EH 1PX3A 3GRBA 4XPHH 4Y4KD 3GF8A 3GQFA 4LVHB 2IDFA 2QQKL 2WTOA 3VGAB 3B7SA 2LVCA 4L8DB 3N9GH 3IS0X 4OZFA 1TJHH 2B15A 4AIZA 1MJ7L 2F8OA 1HAUA 1UWEH 4RAHA 1UEYA 2AEIT 2XPYA 2ZG2A 2R2HA 4OCSL 1BDYA 2YC1B 4Z7QE 1ILUA 1KTRL 2FJUB 2X09A 5D7LA 1DQVA 5DRNA 3VFVB 3MLSL 1FNGA 3NCMA 4U1SA 4Q9RH 3ECWA 1CIUA 3NZUA 3DO4A 1IIIA 5LG6A 3V4VA 3A4EA 1TMQA 1J9SA 4S0TD 1BD2D 2JB6B 2ZIDA 2XV6B 1HQRA 5JMRA 2RCSH 5JOFA 4KZCA 2GIXA 2P5ED 3OX8B 4Y5VC 1CU4L 2N0MA 1BFOA 5KS9B 1YSOA 4HH9B 2WAHA 2Q2EB 4JUSA 1YN7B 2OMWA 4DWHA 4GBXD 1JV5A 3WD5H 3ZKXC 3VI4F 4AVJA 2V3FA 3QORD 1P4BL 3K6SA 1WVZA 2X4OB 2Y5TB 4UMGA 5FAAA 4G6FB 2A1WL 3GIVB 1FO0A 1YQVL 4PLNC 4JFFA 4WUUE 1RZ7L 2YKLH 2XWTB 4WHTA 3V9EA 5CZXC 3LB6C 2WUBH 2Y06L 1QW9A 2EDTA 2FBRA 1FYHB 2JKIS 3E1F1 4PCTA 4NRZA 4XNQB 5EHFA 1U4FA 2Z34A 2UYLA 3RPIA 2HYMA 1NBZA 4PRPD 2Q6WA 4FNRA 2GITB 3UPRA 4FMKA 3QXWA 1C7SA 1NL0L 4A39A 3S8FB 2CIIA 3PQYD 1LO5A 1A4JA 3FHQA 3ENEA 2ZCLH 3SDCB 5KOVC 3SYPA 1FCCA 4R7XA 3O2DH 2DMCA 2AQ1A 4D3CL 1EAJA 1J05A 1KPUA 4WU5B 5ITFA 1DCEA 4JQVC 5DJ2B 3LHPL 1BXVA 4FI6A 4WJ5A 4LVNB 1DLFH 3I9GL 2F8VA 1A5FL 2CHZA 4X9YA 4LSSL 4BSVA 5KYXA 1J9RA 3MI6A 2YPKB 2QZ5A 3W0WB 1T89C 1YUHA 3BMWA 4IJ3B 5ICXB 4ES8A 5ISZD 2C9PA 1TJGL 2H2PD 4PRBA 3ZTEA 2CBTA 5I66A 4R90L 3SE3C 1NCAH 1ZKAA 3LS5L 4G72B 1AS8A 1RUPL 3RNKB 4KKNA 2O4EA 2XN9B 4RAUB 5MEQA 3TEYA 2W07B 1N7MH 1U3JA 4XNUH 1E9QB 2HUEA 2YEZA 4MWFA 5L4JA 3U7WL 2FJHA 3T3PB 2A4EA 5DUML 3KPOB 1YVLA 2E46A 2VR3A 4U1HA 1OAUL 5DVPA 1N5YH 4GY4A 3ZKMC 2X2JA 3IWVA 1QKZL 1BBDL 3CZSA 4O58H 2E59A 3DGGB 3U0WH 1I9RL 2CR3A 5KVEL 5BJTA 1OTSD 5I71C 2D2CC 1A9EB 4OV5B 5T1DH 5BS0E 2RAMA 4LDCA 4DH2A 4E68A 1VLXA 2NX5A 1GOGA 4P2RE 1QUNB 3WEXB 2OMTB 3RAJH 4AMWA 4BK5A 4BRJA 3B2MA 3UERA 4LLYB 4ZS7H 4E41A 2CU9A 1PD0A 5DS8A 1QTPA 4UIKL 3BVNB 2LTQB 2F54A 4UT6L 3ARYA 3LN5A 4ODXA 1C8QA 4U1NB 2X41A 1OGAE 4L8DA 1QRNE 3B3IA 1YRKA 4QLWA 2X4NB 2CWRA 4B9GA 1DJYA 4HFWA 1K4DA 3SE8L 1AYOA 4QKTA 3VH8G 1IBGL 4RGMB 4FS0A 2OR8A 2ZD0A 2DYPA 3EH5B 1P7QB 1FNGB 2GJ6D 3SDDA 4HCGA 4ODUA 1XWVA 4N2DA 3TA3B 4DOHB 5DJYB 4Y1TA 1K85A 2JB6A 4AQEB 4EI5A 3GO1H 5FF6A 4KBPA 1WG3A 3QCUH 3H2QA 1MRFH 4HXAH 1YQVH 3MOBL 4X0KB 4CILA 2P24A 2A0LC 2R69A 1Q0YH 3MNVA 4ANWA 1P2CA 2WYTA 4S1SH 3VJ6A 1TJIH 3AU1A 3WKYA 1I1YA 2OMWB 1CYWA 1UA6L 1L0YA 1UWXH 4LU5L 5TDPB 4BGLA 3ESVF 3PUCA 4X5XB 4Y4KB 2F2HA 1EEUA 2BVPA 2QQNH 3ILPA 2F19L 3GMRB 1YYMH 3MRCB 5M94B 1IV8A 1R9FA 4GRLC 2K7PA 2DWDA 4YPGB 4DP9X 1BW8A 2BS8A 2YWYA 4Y89A 1I7TA 4PJGA 3V0JA 2C3VB 3FRPA 1I1RA 4ZNEA 2Z93A 5FC9A 2DMKA 3OMAB 5EZOL 1I1AA 1TPXC 3DX9A 1NLBH 4MJID 4BFJA 2IAMA 3C2SA 3FO9B 5LQBL 2CKNA 4IBWA 3DX4A 4NENB 2FQGA 3S5YA 3T8VA 5ACZB 1U0QA 4WJ5B 5ADOH 1DQJB 1UHVA 2WTPA 2Z0UA 2JI2A 3K0WA 5JW4R 4XR8C 4JCWA 4K55A 3VWJA 3L9EA 3QFDA 5DT1L 4CADA 4KAQH 1TVHB 1E5BA 3LQMA 1M6UA 1MCHA 3B9DA 3D30A 5GGQL 2YHGA 3HC4H 3KHOA 2IO5A 2YGQA 4QRRD 3MRBA 4U6TA 4JFHD 5C2BH 3N0AA 5JXEC 3L2NA 1IVTA 2Y7SA 3MRMA 1E3ZA 4W9FC 4YDMA 1AQDB 3L1EA 2BXYA 5FECB 3RNKA 3V0AC 3WIFB 4AENB 4DGYH 3KS0H 2ZXQA 2W07A 3GHEH 4PUBH 3DBXA 3K4DA 2AJXH 4U1LA 5IVXE 5JHBA 5FFGA 5FA4B 4M02A 4QRQB 5IKCA 1YY8B 2AHIA 4NM4H 4ZMXA 2KZKA 1KFGA 2YOAA 2XWBA 4KRPD 4MA8H 1AKPA 4MNQB 1N3NA 4PJDF 3JV4B 4B9ZA 3RG1C 4N2BA 2YXFA 2NDGA 1NMAH 2D7MA 3L5JA 4GLRH 2EICA 4PJEA 5JIPA 1IGMH 5IJKC 1GAFL 1CXFA 2J7LA 3D39D 2Z92A 4YLBA 5JIIA 2JELL 2HFGL 4P3CL 2Q1EA 4AQ1C 5F1SA 3OZ9H 1G6RA 3GTTA 1N18A 3QB7C 3R19A 2DTSA 1YEJL 1E9OB 5AW2B 4YXHH 1J8SA 4JFDA 5FYKH 3UYPB 2HT2C 5BUAA 4HWZB 2W80C 2B0SH 1T0NB 4OFIA 4LLWB 4DO6A 4YZFF 4OZGB 1CS6A 3OB8A 4JHBA 1AP2B 4W9LC 4KOCA 4PJ7F 3PIQB 1D5XB 4AGNA 4HEPG 5E5UB 1NKRA 3IVKA 3B56A 3UOAB 2O5XL 4GG6E 1P7KB 5C97A 2ICES 3QXTA 2VMDA 1IC4L 2QSCL 1LK2A 1XAKA 4G8FB 4MLIA 1BVNP 4JO5A 2NCEA 5C3LD 4LDEB 3ZYIA 4Z5RB 1VFOA 1X5AA 2XQBL 3RWFB 3T8XB 3VW3H 4ODUB 2FB4L 1CGSH 5I1HL 3UTPE 1LQSR 2GJJA 2XG5B 1QEWA 4UB0L 4KKZA 4Z7QB 2BCMA 2P5WB 1X7SA 2DS4A 2WQSA 4XVTH 3PABB 2VKWA 3FDWA 2DYRB 5GS2D 3WEBA 1JGVL 3N41F 4CBPA 2F53E 1SXSA 4HS6A 2BERA 4FQXA 5FKAA 4NUPA 1ZT4B 5FUZH 5ID0B 2NW2B 1MREH 3FUIA 4K23H 3DUSB 1WC7A 2AMUA 5F1NA 3V2AR 1JMZA 4FFZL 4TNGA 5DRZB 3GMRA 5HGDA 3UPAA 4JM2C 4DP6X 5MENE 3SSGA 1KB5B 3ECQA 3S35H 5JPMB 2ZTBA 1TU2A 5JOPE 1FG2B 4HDIB 5EWIL 2IBBA 3MV7A 1ZTXE 4JM0A 1UOLA 3SDAA 3U6RA 5IJBC 3BZFB 3NIDB 3QHZL 2I24N 3S5ZA 2R4SL 2NUPB 3D3VE 3Q2CA 3CFKB 4KHXL 1PSKH 3CX5K 5ICYA 3CTTA 4PGEB 2CAKA 3BAKA 3FU7A 2FAUA 2JXMA 5FO2A 4UU9A 4Y4FC 5EEUA 1FZMB 3AREC 3Q6GH 2M2DA 3F2LA 1BF2A 1IBGH 1QZ1A 2DEXX 4W6WB 5EU3A 2MTPA 1CLOH 4NO5B 2YPVL 4C56D 1IGIL 1K8IB 1JPST 1P7BA 5E2VH 1UYWH 4QNPF 1CUOA 3OSVA 4Q2ZB 2V7NB 5D4IA 3FU5A 5EU6D 3AB0B 3VXRE 2AF2A 3MLUL 4FXGC 3K71A 3AS3A 3LH2L 1RH8A 4JVPA 5DUBB 5JPMC 1QWUA 3F6IA 3FSAA 4G83A 3AWGA 1U3NA 4AW4A 2YD5A 5K9QG 4F5CA 4M1CC 1NMAL 2XRAL 2WKOF 3KL3A 1QFUH 4J6RL 5SWSB 1G7MB 4BUHA 1RJLB 5KG9A 4BFIB 3GSUB 3SZ6A 1CR9L 2X70A 3BVWA 2XC8A 4JY5L 2CALA 2WOBA 5IW6B 1GHFH 1LWRA 3ZGIA 1HILB 5HHOE 5I28A 1IKFH 1J0HA 2D7TL 3O3BB 5F21B 2HP4A 5TTRA 1G7JB 5B3JE 3US0A 1S46A 4K2UL 5EZJA 5JIDA 6FABH 2XOTA 3ISYA 3VFGH 5MHSD 2AERT 2DKSA 2IFFL 2CPCA 3F7LA 2OS7A 2BIPA 4LP5A 4F8PA 1B2WH 1TQCC 1OB0A 1C12A 3Q44A 4J3OH 2GT9B 2RJMA 2ADGA 1A9BA 3BH8A 5DK0A 4WGKA 3SKOB 1T0NA 1JZ8A 5JQ6H 3X17A 3BGAA 2MEJB 1OSZB 1QUPA 3EAKA 1YDPA 4ENZA 2QFPA 2XXGA 1BX2A 1IKNA 2DL2A 2JJVA 3QQDB 3COOA 1LK3L 1JFHA 4TSCL 3NCXA 1CQYA 4YN3A 3F7YA 4AKPA 1J88A 3MA7B 3NZSA 5LBVA 4EJ1C 3FU9A 1BVNT 1NMBL 4QHKJ 5EN2A 2AXFA 4RISL 4E5XB 4L8CA 5LHDA 4MB5A 4ZTPL 2YMXL 4OD1H 1RUKH 4J8QA 1U3HA 4HJJL 3CVCA 4D2NA 2ZOLB 3LXCA 3U4EB 3KYNA 4X9BA 1T1WB 4OIIL 4AKQA 3FN3A 2VKXA 1A6TA 5DHDA 1BQLL 2CK0H 4UMSA 3F85A 4G42A 4XMKH 4YOKA 5LBSH 1IO4C 1A6WH 4LE8A 5ISZA 2PCYA 5HXMA 2P5WA 3ARFD 4OCYL 3KR3L 4WI4A 3IXAB 1XR8B 2C7UA 1ZHBA 4PSRA 1GTFA 1NDTA 2M8XA 4XB8A 5HGHB 5I73C 4QXTB 4HWBL 4NDMA 1S7RB 1KELL 2WM0A 4FZ8L 2XPGB 2ERJB 4XT1C 1P6AB 4YO0B 4AMKL 4GOSA 1NSNH 3HZKB 2GG1A 1AR2A 1XD1A 2LE9A 4KMTH 3ZRSA 4H8PA 2CE6A 3EJCA 2B1HH 4HEMA 2WINA 4JHZA 1L7IL 4XMLL 3FTUA 4FGMA 1ZV5A 5AWNH 1JF6A 3IDXL 4LOFA 4GMTH 5A3IC 4K5LA 3MV7B 1PNCA 2ROYA 2ZPKH 5GZOC 1FZJB 2DPKA 3G5XA 4ONFH 3CN1A 4S2SB 4NAJA 1RP8A 2XBDA 2MOQA 1NFDA 3DRQB 3WFDL 5KYWA 5D7IF 2YXWA 5LGHH 5L4MA 4ACPA 4X7CC 5FYLD 3A67L 4PTTB 5CWSB 2ADIA 4RGNE 1N5AB 4P5KA 2WZ5A 3TT1L 5F9OH 2FGZA 4HJTA 3RGVC 3VQ2C 3JWDC 1NBYA 1NM9A 2WQWA 3LKQB 1A7PL 2XX0A 3I2CH 3PAZA 4U6XB 1IAIM 4UZSA 1QPXA 4MHHG 5DO2C 1ZVHA 4AQZA 3ML8A 1F4WL 2AJZB 2ADJB 2JKNA 1RJYB 1K8IA 4G6JL 4YC2C 1XH3B 3ZT7A 4NPJA 5GJSL 1QFOA 5HDBF 3G7TA 4LSQH 2XXFA 2VXSL 4B9KC 4MTMA 1W9XA 1KDIA 4GS7B 1SHXA 4HIIB 1SHMA 4JZNB 3ABMB 4P5TB 3X13B 2APFA 5HVWA 4LPXA 3P69A 4ZJ9A 1L9NA 3QO1A 4Z3HA 4NUJB 4YEFA 5JUEH 2CXKA 2J8UB 3QRGH 5EBLA 1FNHA 2R0ZH 2OTPA 1MREL 4NRXA 2X05A 3TF7C 5GPRA 5D7SL 4QRTB 2A3TA 2Z7ZA 2BSEA 4NKMA 4AT6A 5DEFA 1B2WL 4U1KB 1UT9A 2IV9A 1REIA 1CDUA 3QUMA 2V33A 3FB8A 1IGYB 2MNWA 1OM9A 4JPIA 1NBVL 3FT4A 1TQUA 1E30A 2Y3NA 2YXVA 5D2NE 4ZMWA 4L5FH 5F96L 2OXGA 1AQKL 4LRNL 2XICA 1VDGA 4HW6A 4XPGH 3O9WC 4WV1C 2MHAB 2VRAA 3DMMC 5DMGD 4AGLA 4ES9A 5FV1L 2X1OA 2PCFB 3N42B 4PY8J 5L7XL 5H35B 2CSPA 4QT5B 5GIRB 3HMWH 3B5HA 1F3RB 3WYRA 4TQ8A 2K6YA 5BS0D 8CGTA 5LCVA 1K5NA 2DLFH 1JK8B 2J8HA 4IW4C 5C0ND 5D7KE 1TQSA 4N28A 1BIIB 3CSFA 4PU2A 3RVTC 4L3CA 5BV7C 5DJXB 3KPRE 4XMKL 4E9XA 2XACC 2F0CA 4JN1L 3QIWD 4H5SA 5E2VL 2FHCA 1A65A 2Q76B 4HBQA 4FYSA 1DLHA 3KYNB 1W0WA 5AW6B 2BINA 1WTGT 3ASNB 2G9HA 4HUXB 1KXTA 4WWID 3U30C 1S8DB 2V2XB 4P9ML 3WIHA 4H25A 3F65A 1THCA 1JI1A 4MFHA 1HT6A 4XBEH 1PW3A 3WNOA 5C1MB 2N01B 3TIEB 4ZQKB 2A38A 5JDSA 1N64H 2AQQA 2ZCHH 2CCVA 4GKLA 5JHDB 3MNWA 5DWPA 3CC5B 5JIQA 1P53A 5IV2A 1ZLWK 3IDXH 4PP1C 1JN6B 2CRIA 4YVUA 1YYLL 4Z6AT 2C9UA 4UQ3A 4E5XG 1MVUA 3G6JF 3DX7A 5F7FA 2YZ1A 5CHNB 5ENWA 3OV6A 2HG0A 5A6IA 1CTNA 1E50A 1RMFL 5IBTL 2P52A 5CN2A 3ZTDC 3HW7A 4HK3N 1XL6A 4XWOD 4PCKA 4ZUSB 1AGEB 2XYCA 3RVXD 4ZYKA 2ZXEB 1Y6KR 5DVNA 3CK0L 1CURA 1NEPA 4Y2DD 4Y5XC 3WFEL 3DA0A 1NGXA 3O4OB 1KCRL 4H7VA 3ZQXA 2JKJA 4L2LA 1W2KT 2ZXGA 3Q13A 2X0VA 2J73A 2WMPB 2LU7A 4QRPB 4XMPL 2FX7L 1R19A 5F0MB 3NTCH 4GQ9L 3V6ZB 1NMBH 4UIMA 1KYDA 3LS4H 5L88H 2EIZA 1I75A 3UBXA 3ZU8A 3P0VH 5ANMA 1CLYH 4OM1L 2XN0A 4PJIE 2ZX5A 4D9QD 1HOEA 1O9ZA 3FSOA 4JHVA 4XC1H 5FOJA 4DZ8B 3H3KA 2IWKA 1DSWA 5C0BE 5ABDE 2DRUA 2AK4E 2V5MA 3K6OA 5AVUB 3UXFA 3IJYB 3BKMH 4P5TA 3X13A 5CGYD 5KTEL 2I7SA 4KNTA 3RFRA 3QO1B 4D9LH 2NR6C 5EFIB 1A47A 1SNRA 5T5NF 4NP4H 5E1AB 1G7LA 3MN8A 2D7PA 3RWCA 1UM6L 4GAGL 4N2OA 4HLEA 4ATWA 1RVFL 4XNMA 4XCCL 5GGUB 1D2PA 1IGFL 2BRQA 1NSNL 4QTHA 1P0SE 2J1YA 4DQOH 5DD1L 3T2PA 3W57A 4HMEA 4GFTB 4L2YA 2ZOUA 2DQUH 5JW4N 1A7RH 4FFZA 4F9PC 1IGYA 3CD4A 1VACA 1JHTB 5F1KC 1U36A 5INCB 1J18A 2CDGA 2CRYA 3JZ7A 4IMLB 3KMDA 4WNQA 3BJLA 5JPNB 3V7AE 3SDYH 5SX5K 3KYOB 1TIUA 4IBTA 4KDTC 2MOVA 5ESVB 4OLZL 3FAXA 3IE4A 1F58H 3UL4A 4CVZB 4ANXA 5IF0A 1KXHA 2NT1A 3BSZL 5AW7B 2ENQA 5B1KA 2PCFA 3OC8A 1LO3L 5E8OB 3QR0A 4UT7L 3RFZB 4PB9L 3RZCD 5JHLA 4YDIH 1GVIA 3MRIB 43CAA 3A67H 3GSWA 3Q9PA 3RNQA 4QEGA 1J8HE 3QFJD 5D1QC 5DUPL 5FO7A 1SMOA 1I8KA 2PR4H 1FORH 3O3DA 5SV3A 1M7UA 4FLSA 4AOFA 2OA9A 5AAMA 2HT4D 4JM2A 1ORQB 2EC9U 5F7HA 1KLGB 4BA8A 1F02I 4APQC 4R7NB 1BGXL 5ESQB 4ZUWA 4H8HA 1W0WB 5L6YL 1KGWA 4DPCX 4XVJH 5BZDB 1S8DA 5KVGL 4OD3L 5F97E 1F3JA 5ETUB 4LOVA 3QUMH 4H25B 4NN6C 3RY5A 4WY7L 4K71B 2H6PB 1CK0L 4Q6KA 4ORGA 4LARH 2JJUA 2DKUA 2Z91B 2MJWA 1XGYL 3QZNA 4O5LL 1JYWA 2WGNB 5GZOA 3PGFL 4NQDD 1RMFH 3MVSA 5IBTH 1GMEA 3UTTB 4ANVA 3L5WB 5HHQA 4IYKA 4G5ZH 3FQRA 4MCMA 2NTSP 1MXDA 4H0GA 3GZKA 4PN6A 2PMZA 3A4DA 3OKNA 5E0FA 4XVUC 4YDZA 1G1YA 2EUXA 4JGMA 1VAHA 2HSIA 3FT2B 2PP8A 1M7DA 3BIKA 1I4FA 2R2BA 1ET5A 2R83A 1DFBH 4XZUA 5FUOL 4EPSA 1QNIA 3NTCL 4O2CB 4Y9BA 1B0GB 4F15C 3DPBB 4CN6A 1EVUA 3LS4L 5HBBA 4F7MB 4QRFA 5GGTH 1KYOK 3STZA 2EIJB 1QLRA 1VSCA 3JTSB 4FTVB 2PCPB 3TPKA 3KPNB 4F24A 2XN2A 4UOW0 5AYQA 2IBZY 1ZE3H 2VN5A 4NWTH 5HYJB 4UIMB 1X7QA 2D9CA 5K33A 2WLMA 2EVFA 4QHPA 5TDOA 3FF7A 4JM2F 1MPAL 3FOLB 5LGJA 4FQ1L 5D2LE 1S5IH 4HT1H 4AH2A 3GLEA 3ULUC 4PV1C 2ZJSH 3CDYA 1YN6A 2R0WH 1TZ8A 1FNEA 2VDML 3BLPX 3Q8CA 2WXMA 5BZZA 4A55A 1FJ1A 1RVFH 4XCCH 2ZF8A 1BF5A 1URIA 3H85A 4DQOL 5EB9A 4OI8A 1AG0A 1Q9OA 4XPHL 3VFTB 3I6SA 4Z7WE 2R1WA 3UTSB 2G0KA 1FAKT 5I0VA 1LEIA 1X5FA 1MJJB 1G9ML 4LLUA 1QFWM 5TPWH 3PRZA 1LYQA 5C6WH 4RSYA 4HK3J 3MFFA 2DY2A 4IRSD 4Z7WF 3BOVA 3ARSA 3O8XC 4PRAA 5GSRB 4YR6A 2ESVA 1QRNA 5LBSA 1NCBL 4J1UB 3SE9H 3HG3A 3CDGB 4XWOC 2MOGA 4YDIL 4I0PD 1GGCH 3ETBJ 1FYTB 1ZLUH 3SY0A 1SUJA 5DQDL 3DRTB 2O61B 4IGBC 3I75A 4OD2B 3RWHB 2X87A 5KVGE 1EO7A 3I84A 35C8L 2YQGA 3B6SA 3P0YL 4WO4A 3ZQ9A 3FQYA 3ZSTA 1VADA 1O6VA 4JFZL 5C0IB 5GJTH 1A5FH 3BGMA 2ZXAA 4FHBD 4BFEA 1KIQA 2NXYC 4FQXD 3PFUA 3MRIA 3UG4A 4OLVL 5MI0B 3RNQB 3HZMA 4WFED 5DMJB 1XCXA 4HZ1A 4BSWB 1BVKA 3CLEH 2QTVA 1NOFA 4YHYC 1RZ8A 1UEMA 5JXED 4NQCB 1HZLA 1TG8A 4NUMA 4TSBH 3X11B 3TTYA 2XVLA 15C8L 5FYJH 5HJBA 5DGRA 3M8OL 1BF8A 5FGCE 5HHNB 1YPZB 3RB7A 1FGVH 4JFFE 4JG5A 2PUQT 4H1LG 4WUUA 3C6LD 3V6OA 4DSYA 4NJAL 5I9QB 1MVFA 4A2FA 4MA3B 2J2ZB 3MV7D 5AOIA 3EYUH 3MOAL 3BE1L 1OALA 4O4YL 4TYUA 3PGFH 3FTGB 3T3MB 5I1LB 4Z8FH 1GJIA 5CMAA 5E00A 5LLIC 4FX5A 3O2VH 2ZAIA 4P3DB 2SEBA 4EN2A 4PJHB 3IJ7A 4YPJA 2G3MA 3VGGA 4DVRL 1X5MA 4FDWA 2Z91A 3RUGE 4C8XA 1KIPA 3D3VD 4IKJA 2VCOA 5T3XE 4WI0A 4GAJH 1MJ8H 1RFDH 3W11C 2DL9A 4XGZA 3KYMA 2NY5C 2X4TA 4F7CB 5CZRA 3Q5TA 3QISA 4P2QD 1Q9LA 3CHQA 4LHUG 5AYUH 2X4SB 3UABA 1KB5L 4CC1A 1S9YB 3VMNA 2VM3A 2G2RA 2EDJA 3C2AH 4HJUA 1SJXA 3VGHA 5C08B 3QSKB 5ANHA 5JYMA 4OLYL 3HPLA 4J3OF 1JYNA 4OCSH 4I85A 4FF9A 2GBAA 4NCC2 5B39B 5FO8A 2XTJD 3G08A 2H8PB 4PB9H 5DDHB 3HG0A 4W9CC 4GAYA 3GMLA 3L3JB 4ZUTB 5G2NA 2PPFA 4UDUB 4W9GC 3KPSB 4JRXA 1TEGA 1BM3L 3FO0L 1FORL 2BXZA 3KAAA 4JS7A 3NJJA 5SX5H 3LRKA 3IRPX 4R8WL 5GSVB 5EOCL 3ATBA 2FGWH 5K69A 5TDOB 1I9RH 4Y2DB 1TQVA 2ZAGA 1SN2A 4ZS6C 4X6CB 2ZOKA 5I17A 1B6UA 2AV1B 1FNLA 1P4BH 4PJFE 3MAWA 1I8IB 4PI0A 4FE9A 4UOW1 2O5NA 1OOWA 4PY7B 1K2DB 1W72A 2AJ3A 3F05A 4V11A 1FE8L 1FNEB 1ZMYA 4JFEE 5CEZH 5CCKH 4PJAE 4P4KD 3MLTA 1HH9B 1RURH 4PBXA 1MHEB 4OZFB 4N87A 4DUWA 1D7CA 3MREA 5HHOA 2DM4A 3T2OA 3IE9A 1X9UA 4JY4B 1HE8A 5A40E 1DJXA 2R2HB 1C1EL 2GPZA 1SN5A 1R5VA 3MJWA 4RAVB 3V79C 3VFVA 1F11A 1TNNA 2KKQA 4LAQH 5EO0B 3TO4D 3DTDA 4XXDA 3SYOA 1OGAA 1Z66A 4GG6A 1MCWW 2F54E 1UWEL 5K39A 4IDLA 3BESR 3IM1A 5FKPB 2YOCA 5FUOH 3L3GB 1N8ZB 2D0FA 4JANA 4LHUD 4UTAL 4UCFA 4GUOA 1QTYT 3SQRA 1QA9A 1UH3A 4UANA 1I3UA 3GJFH 1R47A 3U7WH 4FN0A 5I76B 2ZKXA 4Y1AB 5C09B 3REWB 3BGMB 2X4OA 4JM4H 4NOFA 1MW2A 2FEJA 1U3YA 3ZTJH 2BC4B 1LP9B 5DA0B 5DJAB 3L4YA 4GG6F 4WJG3 3NN8B 4OLXL 3WTYA 2A74C 1WDAA 1YC7A 5KSAD 1NGPL 2IG2H 4AUJA 4OJFL 1YYML 4NRZB 4XNQA 4U7SA 2ORBH 3X11A 4ELKA 2RQEA 1EJOL 3EFDL 2AV7B 4AJWA 1A14L 5GGVL 1A4KB 2DWXA 1J9TA 2V17L 3GRGA 2DQGL 4OGXH 1NUNB 3ESNA 4Q6YA 2KT6A 1G6RH 4JHWH 2D7NA 4F8QA 5LB1A 3WFHB 4BELD 1WUZA 1FL6B 1KFAL 4UI2A 1CFBA 4NYLB 3BDYL 1XGZA 1WBXB 3L7EB 1P5UA 1WZMA 1KB5H 2B5IB 5AOJA 2YD9A 4NAQA 2EZ0C 3UO8B 3IDJA 2BCKA 3IPEA 4JKNA 4ABQA 5B7EA 2FVNA 5LQBH 3MCLH 3CQPA 1I85C 4TMPA 5D6DC 1KPVB 4J6IA 1J9QA 5DMIL 4DTGL 3EXLA 3R7RA 3W0WA 3PWNA 1BYOA 1S9YA 4LLDA 3F6LA 3P3YA 2DJSA 3SQOL 3K1KC 2V9RA 4UV4H 1FNFA 4C57C 5L4IA 2KMWA 5IROD 2UY7B 3RWDB 3PL6B 4LSSH 1ACZA 1PEWA 1SFHA 3TEWA 4G8EA 3VFRB 4ETYA 1Q72H 3I02B 4JQIL 4HYTB 4PVMA 1YYCA 1WWAX 1F4HA 3KLLA 3RB5A 1T4KB 1SXCA 2BSBA 1PYWA 1R34A 3ULSB 3L4WA 2L0DA 1FNSL 3REVA 3TBSB 4TOYH 5A1AA 2GAZA 1OTUC 1HNFA 1M3IA 2XQBH 2JCWA 3L3JA 4MD4A 4OM0H 4V1DE 4U4BA 5GRVK 1AXTL 3U7AA 4GAFB 4N8UA 3PXJA 1JCVA 2DICA 3GSNH 3V6FB 5BJTB 3FU0A 2CO6B 4TSBL 2FR4A 1HSBB 4PGDA 1DVQA 4W9IC 4AQ8C 1TZOA 3H53A 1HZHH 4Z3IA 2DQMA 1EBPA 3ATEA 4MJ6B 3CZUB 4RIRA 3ZTNH 4EKJA 2GCYB 1EEYA 1DUZA 3EJZC 1YAZA 4W6XB 4JM2D 5B1JA 4LIQH 5TF0A 3FCSA 3W37A 3RVUD 1H5BC 3B7UX 4PJDB 1KJMB 3RX5A 1A4CA 3HFMH 3SCMC 3VXUE 1ZA6B 1TVBA 4TF4A 5E1QA 1CPUA 3MX0B 4OGQC 1WD9A 1CMOA 4EE2A 1JNNH 5AVQB 4HJGB 1K8DB 4WGWB 3MBWB 5CILL 5E9NA 3ARUA 4RH4A 3KWUA 1OPOA 3LPPA 4U6VH 1YNLH 4BZYA 1F11B 4X4KA 1KJ2B 2R69H 5SWZA 1OGAB 4UBDD 4Z23A 2QJDA 2UV3A 2HRPH 3TA3A 4URKA 4Q8BA 5D1XE 4EI5B 2PO6B 3H42H 1IAKB 1UZGA 3LYRA 4YSSA 5F7DB 2DLTA 4C83B 2NY1D 1J8KA 2UWEE 4RZKA 4M93B 3KWWA 4X50A 5C0BD 1A1OA 4HOZA 3FB6B 4HUWA 4ETQB 5ILTL 3GHEL 4JQIA 5I24A 3QIUD 4UTAA 2DB8A 5DEJA 5J6GA 4RNRA 1TO5A 5L2KA 4POYA 4BZ1L 1R3LB 4HXAL 4IKNA 1F97A 2WXNA 1LO4H 1VZHA 5KN5B 1DQML 3F6JA 5IOPB 1IM3D 5IUCA 4M1CD 2KI6A 2E7HA 1TJIL 1NFDE 3N40P 1OOAA 4G8AC 5GZNC 3O0RH 1OT4A 4NZJA 3IFNL 1GSMA 2UZYA 2DKMA 2JELH 2AEQL 4XPBL 2HPTA 3L48A 4ELMF 4F58H 3FRPB 1QRKA 6PCYA 1GGIH 1YEJH 2Y7QB 4IOSA 5IFJB 3DK0A 3I6LD 3QR2A 4QJ4B 1SDYA 2L8AA 1DHKA 4N3TA 2D7OA 1FFOA 1G9NL 1IBFA 1MRDL 4HUUB 4PJ9A 3WFHA 1AIFB 2RMNA 3ULVC 3F12A 3MCLL 1CFQB 1ETZB 3BO8B 3P9LA 3QJVB 5I8EA 3BWSA 1NAKH 5I1AA 2N4IA 1QNZL 4QRSA 3EBGA 1AD0B 3E38A 3RGVB 5FYJD 1UB5B 4JJ5B 4JW3A 4G80A 1GC1L 4M93C 3ZE0F 2EDNA 1K6QH 3CBRA 3AGWA 3WKMH 4RFOH 3Q6FB 4GSQA 2E7DA 1ITCA 2ZSVB 5D5MF 4G82A 4RZCB 4BKTC 5B1CA 3BWZA 1I9JH 2EDEA 1PG7X 1DL7L 1IZJA 1Q72L 2DJUA 4JHUA 4JQIH 5BOZG 2CGRH 2O5XH 4GKSA 4A7TA 1SJMA 2VLMD 3U82B 4YHPA 1MNNA 1ND0A 2FEEL 1I1FB 5I16A 2LU5A 3BH9A 4NKOA 2ZKMX 3INUL 1HU8A 2B77A 1EQWA 4OZIA 3KW7A 4G8GB 2I9TA 4V1DD 4DO5A 5E6UB 1SJEA 4N0CD 1R3IH 3NESA 4HZLB 4Y2LA 1N68A 4JB9H 3L4ZA 1XGQB 3DI3B 2WBXA 1V5JA 2YWZA 4UB0H 3FTZA 3O2DA 4Q4EA 2G9KA 2OR9L 3L9RA 3V5HB 5CBEB 2BIHA 1RLWA 1YEDB 1YECH 3V6FA 4M5TA 4X7TA 4NM4L 3UEZA 2Y6TE 3T8MA 5IBLC 3S37L 3J07A 1KBPA 4I0PB 5F7KC 2EQDA 2EIKB 5ITBH 1LLAA 3AVEA 2GCYA 3B7YA 3P9MB 1RZPA 3E2HC 3FCUB 4CDGC 4F80A 4OAWA 4WF7A 3U46B 3O2WH 1CGYA 3CXDL 3B9KA 1XL4A 3BP7A 5C6PB 3GSNA 1OSEA 1P6WA 2VDLL 4G1MA 4MYPA 4QHNA 1R3KA 2VDRH 3ELQA 4O9HH 5DS1A 4EI6A 5I6XC 3ZE2E 4IGBA 2RH0A 3O6FC 5DFTA 4KI5C 4WDIA 4K9EC 3QHZH 3GXIA 4JL1A 2EUWA 2Z35B 3VTTA 3QWOA 4YHYB 1JD9A 1B3IA 1GIGH 3O8XA 2NOYA 1IUZA 1UXSA 2QQLL 3BKYL 2FUTA 4M1DL 3TV3H 4NO3A 4BGDA 4N86A 1EAPB 4XPFL 3OX8A 4MBRA 1HC1A 3DIFA 3LN9A 3QUYD 4JQXC 1N8OE 3WN5B 5L0QB 4Y4HB 1FV1B 3QDAA 1H8NA 1YEGH 12E8H 2GEEA 1BD2A 2GUOB 3RU8L 4PLKD 3G5YA 2NY7L 2Y5TA 1WC7B 3FTXA 3VTAA 4A7SA 3TA3C 4NQDA 3IDMA 5IGXH 3US1A 1FVEB 2WZAA 1KB5A 4PMEA 1G9NH 1MRDH 2XIBA 3IRCA 1NCDL 5CSGA 3K7UA 2F53B 2V37A 2H3KA 5E1HB 4Z7NE 5EF0A 5BVPL 3VFGL 3GKZA 4EIGB 3ARBB 1LP9E 3DURB 5D1ZA 4GQRA 1GS8A 2F5AH 2WSDA 1XF3B 3RL1B 2NUPA 1IQWL 5IHBA 4IU3B 4Z7NF 5C7ZA 2NXZB 4QYAA 1NDMA 1AIFA 1RSYA 2XFGB 2JJWA 4RGOL 5K9OA 3O11A 2A4CA 2WB7A 4G9FE 1OLLA 5IJKA 5JO5A 1SOQA 1KB9J 5CCHE 3FQ4A 4MD5B 5IQLA 2ERJC 4NZ8A 4WU5A 5BV7H 1T5XA 2PYEA 4I0KA 4P59L 3GM8A 4PB0L 4CVXA 2OYKA 5HHOD 5BQ7B 5B38A 3JWNE 5F9OL 3TNNB 4Z7VF 4XPGL 4YHKH 4RA3A 2YPLB 4B7LA 2J57A 2MNJB 1PX8A 3CPLB 4Q2ZA 1XCQA 5FX3A 4TL5A 3HS0B 1CE6B 2W88A 3DECA 4PRBB 1TXKA 3T3ME 1NGZA 1SM3L 1JUFA 1T6WA 3IGFA 2QADC 2YFNA 2XBZA 4HIXH 2PLTA 3C5JA 5BRZD 3FT0A 1I1AC 3D7PA 3OKDA 1JS4A 5CGMA 5ILTH 4L3FA 3ARGB 4OZFG 5EEYA 3MGTB 4XI5D 5GGRA 5JZ7D 4K8RC 3DMMA 3IN0A 4YXKH 3MLUH 3UJJL 4AVHA 1T7VA 4NPKA 2O5YH 2ZG1A 4ECNA 4LHQB 4DP2X 1ZJAA 2PXYD 1H8OA 1UWXK 2XTJE 1LO4L 2Q86B 4YHML 4PJ8A 3FFDB 3ZVVA 2FJGA 4MRBA 3BW9B 4JG0L 4ZOBA 4G6FD 3V5HA 4LCUA 2NY4B 1FFPA 3QRBA 2N3JA 1UATA 5MEPA 4M8QB 2YAOA 2WKOA 2X7LB 1JFQH 2AK4D 4AEHH 1A22B 4HWBH 4I0PA 4UZGA 1T83A 3JXAA 4X4YB 4G6AC 3V5DB 3FPXA 4Y4FB 1DSFL 1GCYA 5DC9B 5J6HB 1OSZA 43C9A 2Y1ZA 1JYVA 3GI9L 2PW2B 1JPSH 4XN2A 2WBKA 2G5BB 5KSVA 1YJDC 4GRLA 4I5BB 4X8JA 1KT2A 3M17A 3AADB 5CCGE 2R23B 2F6AA 4HG4K 1HQ4A 3GSXB 4ZPTA 2JMRA 1B9ZA 5KSAB 1MFAH 2LGNA 4JPVH 2R9HD 1U3HB 1DL7H 4GKZA 2GJZA 5LGKA 2A74B 1H3XA 3GM0A 5K1VA 1L9PA 2IDSA 4KKQA 1GJWA 4KRLB 2HH0H 3THMH 5HYQA 4L1SA 4G42B 1JE6A 2ZUWA 1KTDA 2BZDA 3CN4A 3E6FB 1V7NL 2O6FA 4ZO6A 4H26A 1XR8A 3VXRD 4DP1X 1JPFB 1QSEE 1U8KB 1UB6A 4B9PA 4F1ZA 3G9AB 3BUYB 3CVHB 3H8NA 3R4DA 4N2NA 2XVBA 3WFBL 4HUVB 1BPLB 1WFMA 3FAWA 4G6JH 3U36A 3P3TA 5F93C 5FM5M 3BPOB 2A73B 4HV8B 4LSQL 2FLRT 5ALBL 3V6OE 3UJTL 5AB2A 1TLKA 2QSTA 3M6DA 3DHUA 1BYPA 4YJZL 4B3VA 1F6AB 1VZGA 3WTUA 5LXVA 3H7BB 4MZRA 1SXZA 1NLDH 2DDQL 3AC0A 3TWYA 2YQ3A 1JXFA 1CGUA 4L1LA 5HVHC 1R3HA 2C3VA 1AR1B 3GJFK 2CLVB 3FQ1A 1Z9SA 4FFYL 1EERB 3OTTA 4PJXB 3NK3A 4MQSB 2ENYA 2R27A 2DJ4A 3APMA 3L3DB 4OVUA 4E9WA 1X9QA 1X5KA 4MDIB 3EFFB 4IU3A 3ZX1A 2I9LB 4BUQA 2VZTA 2W0KA 1L7IH 3HR5A 4XMLH 2R0KL 1I3GL 4HALA 5E8NA 3O0LA 4K5MA 4PTTA 4N8VA 1AXSB 3L95A 4HUKB 1A7RL 4O00A 1AHWB 3HN3A 3KM2A 3GEWB 4FMVA 4P04A 1CL7I 1B88A 3FT9A 3LKQA 4PY8I 4OI9A 3D8MA 1TFPA 4NQTA 3VWJB 2BSTB 3FQWA 3GMPA 2CO7B 3NZ8A 4CJ0A 3LY6A 3IPFA 3LCYA 3WUWB 2YKKA 3RURA 2RFXB 2R2EB 5HDRA 3UIYA 3QJQB 2VDNH 5SWZD 3TYGH 2KQMA 3FFCA 1WAPA 4KK6C 4MAYD 4QCIA 2BVQB 3ROLB 2LABA 2I7OA 3LB6D 1OGPA 2FL5A 3H4FA 3AWEA 5GZND 1UOKA 5FM4A 1G9HA 1N64L 2ZCHL 2I85A 5KTEH 2C1PB 2FSEB 2ZXBA 1FDLH 1NFIA 2Z9TA 2JFCA 2C9QA 2E4FA 4FTVD 4JPSA 3F7PC 4W9EC 2GIYA 5DYFA 3ARPA 1W8NA 3ZZLA 4DHLA 4X4ZA 1JGUL 1XF5B 1U8JA 2Q86A 4ZMYA 1P4UA 4TL4A 3TBVA 3LDBC 1VGKB 2FRGP 3RZCB 4M03A 3ALXA 2VDKH 2R0ZL 3FFCE 1KZQA 1L4IA 2Z92B 3NPSB 2CLZA 5IG7B 4I18A 1FAIL 3ARDC 3N1QC 3POHA 4AE0A 2NY3B 1RUAH 4M8QA 3WHE1 3N06B 3ZKSD 1W0YT 3I6GA 2YLHA 3LQAC 5HJ3A 1U8HB 2VDOH 4PJ5D 3D2UD 1OW0A 3UG5A 3WS3A 1SPDA 2C9RA 3L9YA 5FLUA 1QFWI 4XX1E 1DJSA 2ZOOA 4L4TA 4G5ZL 1V3LA 4GEJA 4RMTA 2VW7A 3N85H 5AKRA 5DQ9A 4LFHD 5F9JB 1D5MA 3CVHL 2EIEA 4R83A 5HTSA 3QG6B 4XMPH 1T22B 5E56A 4NSKA 2X4PB 4X8XA 2CIKA 3GRWH 5EC1B 4F2EA 4IIQC 3AXHA 1E6OH 4QR7A 5HHME 4ZUVA 5HYFA 5L7XH 4NQSA 4RGND 2PCXA 1MHPL 3HRPA 2LTQC 4WI8A 1PG7W 4X8GA 4JN2A 4PWGA 5GGTA 4Z5RA 4DKEH 1ZXKA 3EOYG 4N25A 4I3GA 5JDJA 2A6JB 3HVDA 3V8CA 4NERA 1F4XH 3G5ZA 4UUJA 2OP4H 2HVBA 5GGTL 3V4VB 5GXBB 2WLLB 3WV0A 1MFUA 4XNBA 1G7QB 1XD0A 5AVWB 3MYJA 1DBBL 4ZDHB 1IIKA 2FJFB 3TIEA 3NMEA 4GYBA 2NQDA 1KYOJ 1MCFA 4NLHA 4XN4A 3QZBA 1JSYA 3P0VL 1JMXA 1RZIA 3BUYA 3CVHA 3T9WA 4DNLA 1U8LB 4HH9A 3MNWB 1HL4A 2BWDA 3FOMB 3EOBB 2NQ3A 3R0MA 1NLDL 5DLLA 2C3WA 4GAGH 3R0NA 4IEFB 4LCWA 2WP3T 1C7TA 1OLZA 4WU7A 5DU7A 2A6DB 2D0GA 2ZJSL 1SOXA 1CT8A 1Z9MA 3FO2B 1XX9C 3DGDA 1A2YB 1M1XA 3TCTA 2UZIH 4X4XB 5EZIH 1W16A 3WHE0 1AGEA 1ZV2A 2NNRA 2FWSA 4NIKB 1C5DB 2EE0A 1IGFH 4WSGA 3MROA 3U0PA 1HXKA 3ARDA 4U1JB 5I1JH 3CSYA 4UQAA 1ZLUK 4XXCC 1LO3H 1JGIA 3W9DB 4HBCH 4FG6C 3KCPA 5ITFB 3SDYL 2QZQA 4LCCA 2A83A 3IU4H 3OXRB 2OMVA 4AYFA 1CIDA 2F7IA 4MXWL 4FA7B 2BSTA 2NXZD 3IU3B 1CTOA 3WHXB 3NP4A 1F00I 4EXPX 4YHZL 1FVCB 2C4FU 5KANG 4BCYA 3TCLB 1YUHB 3R1GH 3C8HA 3E7JA 4MSWA 4U3CA 1IAIH 3R06A 2WWNA 2B39A 1AANA 3MJ7A 3LZRA 1CXIA 3UBHA 4LPTA 3WL9A 5DMKB 2EVIA 1U3HC 3IJYA 1AR1D 3CLFL 4NHUB 1OAKL 3F5WB 3MV8B 1LD9B 1D5IH 2GVYA 5SWSA 5C8JA 2ED8A 4H8UA 1BOGA 4BCXA 3H9SA 2VJ8A 1G7LB 3CZNA 4BHUI 3RWCB 4NAMA 1MRCH 1N2RB 1PZCA 3CBKB 1SY6A 2N56A 3N3EA 2FSEA 3B8YA 3LNHA 1BXXA 1YEFL 3CNKA 1W15A 4IRJC 2WBWB 1OAXL 4M62L 3U79A 3SJVA 4OLUH 2NZIA 5IHZB 3N2JA 1SEBB 1OP5H 1HILA 3NUKA 3VD7A 4WY7H 2WVVA 3NIGB 2CNYA 4TS6A 1UXLA 2BNQB 2VDMB 2E0PA 3BQVA 4QYOA 3HUJF 2B9BA 1AOHA 1FG9C 2NY5L 2E9JA 4PP2A 4WNQB 1J0ZA 4Z7UF 3RVVC 2YEVB 2Q3ZA 3D0LB 3TBYA 1DFBL 3AFLA 4RBPK 4UNTA 5D1QE 4CVZA 4KKBC 4YDLC 1CXHA 2N7SA 4QRRA 3T4YB 2DN7A 4WW2A 4JRLA 4E41B 4GRWE 3Q1SH 4CMMA 5E8PA 5CINL 4PJAF 1R5WA 3MR9B 3PJLA 1KXVC 1F58L 2X4PA 2OP4L 3ZPDA 1LO2L 3NDYE 5EN2B 1S3KL 2HLFC 4Y0GA 1TLMA 4MA7L 1Q1PA 5CEXA 5JDSB 1EX0A 1MNUH 2F8IA 4JFDE 1NIDA 5KVDE 3ABZA 4P4RB 2EDFA 1XMWA 3OR7B 1P7QA 1TZHB 5HY9A 1OAZL 2A7BA 1EFQA 3M8OH 4R7DA 4Q9QL 2BIMA 4X9FA 4LVOB 1A6TB 3TYGL 1JK9A 4PJ9D 2UX6A 3ZDYB 3A6CL 4IQHA 2IWEA 1DVUA 5EEZA 1MQKH 3X1NA 1U3HD 4Z8FL 1MPAH 5HHXH 6PAZA 4NUGH 4OLWH 2HKAA 2WO2B 5KJRL 5CP7B 5T5FL 4LLVB 4EI0A 5AW8B 4G6AD 1CD0A 1E27B 4QXGL 5JNYA 3QEHA 3WNPA 4KTDL 3F7KA 3MRCA 5G4NA 5HP5A 3ESPA 3GBML 4PWHA 3ZDYF 2DWDB 1CFNA 1GGTA 4MAZA 1RZKC 3IMSA 1I7TB 1D5ZB 2VLJA 3GBLA 4X6DB 4YDKH 3WIHH 3JWNG 3CH1A 4I0PC 5T1KD 3VXNA 1QYGL 4ICWA 5BRZE 4HLZG 4Z3GA 2AKRB 2DQTL 2IAND 5GRVL 3MLYL 2W81C 4MB3A 4PRPE 1E5UI 1NDGB 4C4KO 1I1AB 1ZRUA 3AU0A 4M7KH 4PJ5B 5E2UH 1E8ZA 3WEMA 2Q7YA 1MJUH 2VR9A 1GGCL 4P8QA 3T4AB 1DCLA 1YEHH 4P57A 3AUVA 3UC0H 1L3NA 1UXWB 2G3NA 1J1XL 4OF0A 3QNFA 2OMVB 1X4XA 3VD0A 2H3NA 4NWUL 3NJNA 4GO9A 4L5FE 3AREB 4G9FD 1XH3A 5BCAA 5JYLA 1WBYB 4IRJB 3QCTL 2XTLA 2EXTA 1PIFA 2HRGA 2FQDA 4XE5B 2A0LD 3ILQC 1KULA 5MERB 1BZDA 1ZS2A 3B34A 5GGSA 1BD2E 3WIFA 1CCZA 3CGTA 1Q0XL 4ESKA 4NLAA 4DVRH 3DTXB 4IBQA 3AAZB 4QRQA 3S0PA 2OW7A 2DBLH 5AD0B 1N19A 2F74A 3WXWH 1PZ3A 5IB2A 3CXFA 4FG2A 2AITA 5CJOH 2W95A 3NA9L 4WWKD 4UV7H 4YR6B 5I5MA 4HKXA 4K5NA 3W39A 1MLBA 3PNRB 4AUUA 3KVQA 5BQDA 2W65A 1IEBB 4HPYH 1A4BA 4DK3A 1ZANH 2GKIA 3H2PA 4MJJA 4OLYH 2VLKD 4A68A 4HWZA 2IGLA 3QWQB 4BKLA 5I1JL 1LEGB 4IU2A 4G8IB 5J06A 2A9AA 2FQEA 5FUCC 3DX1A 3GD1C 1MCNA 4YLCA 5KZCB 1AI1H 1MUJB 3C2AL 3HZMB 1J87A 2Z7YA 1VHPA 4JM4L 4F2ME 5EMYA 1HNGA 5IJVB 4MMYA 3BCDA 4H13C 4IDJL 5F8RC 4KKLD 1NMCB 2CKBB 3QDMD 4UYQA 3FTSA 1I31A 2EXWD 4PJFB 4JY6B 1O7DE 5D70L 2IH8A 4FXKB 4L4VD 5PAZA 5BS0A 4DP0X 1M2OA 1TYJA 2WNXA 5HHXL 1IAIL 3BZ4B 1WCBA 5F3FA 4S0HA 4LF3A 2UUDH 3FT3B 2FO8A 2OL3L 2HVKA 2FNWA 1ZLEA 2XG4A 5GRZA 1E4KA 3HC0B 5T5FH 7CGTA 1JPTL 3MLVH 1FGVL 4R8WH 4YHMH 4I48A 2XJLA 4ZK8A 2Q20A 1F90H 4PJGF 3K46A 1OTSC 2FD6H 4MS6A 3DIDA 3BDYH 2CM5A 2GBTA 2WWKT 4HS6B 2FJSA 1ORSB 4FOMA 4OLEA 1OCWH 5DK2B 3DUHA 3ES6B 4ODHH 3D25A 4PRNA 4I4WB 3RYMA 2X4SA 5EBMB 1XH1A 4OCRL 2DWEB 1A8JH 4KOBA 1B4LA 5T3ZH 3TTSA 3BD5A 1RJCA 3DIVA 4K7FB 3MNZB 2XWZA 1GXEA 5I74B 3HPLB 2HLAA 1MJUL 1UFGA 3OMNB 3LKRB 3VFSB 5F6HI 2JB5H 5DDHA 4NQED 1ZHLB 1HS6A 1KCKA 4LASH 2FWLB 5IVZB 3L08A 5FHAH 1T6BX 4XC3H 4JNXA 1NGXB 4PJ5A 3OM3B 2R0LH 1AZNA 2CO2A 4PGEA 6TAAA 4M6NH 5KYYA 3N5AA 4OCLC 5FW6A 1JDDA 5EH1A 1EGJL 4GXVL 2AC0A 1SMAA 2EIZB 1UXWA 2OJZH 3C6LC 4RBPH 4R3SA 3WFCL 4Y2DA 2MCAA 3O4LA 4BSJA 2TSAA 2Z8SA 4IOIA 4LEOB 3FULA 1QLFA 2J25A 5DVOA 3AQXA 5LXGH 3UGXA 2V17H 4MQTB 1BQSA 3FO0H 3KXFA 1OZTG 1E8WA 2J6WA 5LBGA 2V7NA 2FO1A 2DIAA 3TYFA 5E5MA 4ILDA 4AYEC 2AEPH 2D3NA 2J71A 3MRJA 4G6ML 1E28B 5DUBA 1DQMH 4QHKI 4KROC 3VWKC 1M71A 4GRLD 4JY4A 3KLSA 4YSEA 1KIRA 4F3FB 5D1ZI 4KGJA 4BFIA 1UJ3C 3GSUA 1XB3A 3UX9B 1D3CA 4FABH 1KB9K 1X9RA 4M61A 1KMGA 2C8NA 2JCCE 3WNIA 1K72A 4OZGF 3CN2A 1P84J 3L3OC 1S5HA 2BJML 2UZPA 4F2FA 2PP7A 4D0BB 3NFSL 1LEKA 1G7IA 5IK3B 4FQLH 25C8H 4B9IA 1CLVA 3OAZK 2JCCF 2F9BT 3SQOH 3UAFA 1YLBB 4WIQA 5IESL 3L3GA 1RK1B 3KPRD 4PV9B 4K94H 4FKEA 4X6DE 5ESVA 1IAII 1UA7A 4CMHB 1THAA 3ULVH 2GT9A 3QDJE 2BNQE 3MBXL 3GMQB 2E7LA 1BM7A 4YX2H 5E8OA 1G94A 4ADJA 4IKLA 1TJXA 4EXKA 43CAB 2R2CA 4JZOB 4ZXBC 3HHSA 3PWJB 1TJGH 1RK0A 3AG3B 4PEEA 4WI6A 3F7YB 1KJ2L 1MCBA 4E9QA 4E5XA 2H0PA 3O3DB 3O3AA 4I77H 4QHMB 1A3QA 4ZW5A 4TULL 1HZHL 1TEYA 3OHMB 1KCUH 4PJFA 1M56B 1EAOA 4MASA 2BSRA 1QHQA 2GW5A 5A2JH 3QEQE 1ID2A 2P45B 5JHDD 4D7BA 5T33H 2ISDA 2VDQL 3BZ4A 4KITB 1AXTH 5TFSL 1KBKA 4JQXA 1T80A 2YRLA 1EMTH 2HVKB 4OZHF 3EFDH 4LU5H 3VFMB 4LPWA 3PGCB 1KDJA 1ZD6A 2HTKD 4UILL 5D72H 1JWSA 2OSYA 1A7NL 2YRBA 4Z7WA 3RX8A 2WVSA 3QNZB 2Q9OA 3DV4B 1VPOL 1EO8H 1KFAH 4NDMB 4JHAH 2OI9B 3H9SD 3HR6A 3UBXG 5CR1A 3ES6A 3FW6A 1XSKA 2CLRB 3NA9H 3P3SA 4AM0B 4HMCA 1JXDA 1A25A 5EBMA 2OK0H 4LLDB 4HS3B 2DWEA 4BH7A 2DJMA 3M7OA 3D5OF 1SXAA 4UT6H 5FHAL 4F33B 5A2FA 2P48B 4B0MM 2EE9A 4YBQD 3HN8A 1YNLL 2J1WA 3KLAB 1EGJH 1P7HL 2CKBL 2NZ1A 3LKRA 1RUPH 4HXBH 1GW0A 4LSVL 4XE0A 5DSCB 3VVWA 3JWNH 5AVXB 3ZO0A 1ZSHA 1BG1A 3ZE1E 2P80A 3BAJA 3QIUC 4F27A 5IT2L 1VENA 2AQTA 4MD4B 4L37B 3A6BH 4XBPA 4FTVA 1OK8A 3P9WB 2WXOA 1KCBA 1VA9A 4D94A 2VQUA 3D33A 3GO1L 3BUBA 2LFGA 3GJFA 3NRFA 3X3FH 4PRPB 1BBDH 3RI5F 4PGDB 5TE6L 4KTGA 5C2BL 1WZ1H 5EUOA 3D48R 4MJ6A 3O4LB 3ZMRA 4IOIB 1WFTA 3FOLA 3DNKA 1M7IA 1QSFA 4AZ8A 1TF4A 4L5FL 4KUZL 2EEXA 3GSNL 3H0TA 2BNRA 5D7IA 5FOBB 3JV0A 4PS7A 1KJMA 4UT6A 5C0FB 2OBGA 1JPTH 1NGWA 2XN1A 3MLVL 5C0CB 4XTRC 5ADPL 5L2JA 3RE0A 1UWYA 3HI1B 2R1WB 3M7FB 3UTSA 3NFSH 4GW4A 5B8CC 5CD5C 1V7MH 3D18B 1NC2A 4MJIE 1MAML 1II4E 3CWGA 3MA9H 3N41B 4LBEA 1H3GA 2QLVB 1GS7A 4U1SB 3W9EB 2BOCB 2YQBA 2Z31C 3GXUB 4XXWC 3MTXA 3QCVL 3RBSA 4MMXB 3UZVB 2DEYX 4OZHE 2WYHA 1G7IB 2A5UA 1WZAA 4EOWH 2YAHA 1GC1H 4F7PB 1KGJA 1RK1A 3L3HA 3SO5A 5KS9A 2DWYA 3RA7L 1OTUD 5T5NG 1DJIA 3L8QA 1VADB 5F70A 5C0IA 4M6MH 2EXYC 4WO0A 3UTZB 5IEHA 3GZOA 4KAQL 2B4CH 3EJUA 3Q1EA 4U6HA 5F7AA 3U2SA 2XWTA 1K5NB 4L18A 1RK0B 3PP3K 3LNFA 3QDJA 1HHJA 2YUWA 3MUGA 4JFTA 4NC1C 5LNGA 4HGMA 1IEAB 4TLTA 3EYQD 2FYYA 1CG9B 4FKKA 1G0DA 4MCNA 3QJXA 4QHMA 5E4EB 1Q90A 1NUDA 2AVFA 2GITA 2XN9D 1R3IL 2IWGA 4PTUA 1XDTT 4WUUB 5C07E 1AH1A 2Q76A 2VH5H 1EJFA 2BWQA 5AB9A 5D72L 4AQAA 3V0EA 1A7NH 3DXAB 3GHBH 1IT9L 3WEOA 3PHQA 1LTXA 3W82A 4GKNA 4OF8A 5FWQA 3WN5C 2BY0A 4NPYB 5E8EA 4L9DA 3SE3A 2J3SA 3QYCA 5T1LB 3X12B 2ZSWB 4UQBA 4QXUH 4ZX6A 2P49B 2WGXA 3P30H 5HHVH 5JORA 4FQIH 5D8JL 2D8KA 3P2TA 4OY9A 2ZSVA 4IS6B 4PGJA 1G9EA 1AMYA 1SJHB 4J3VA 4WI0B 4MXQC 2M1KA 3CC5A 3SPCA 1OAQL 1RPKA 4BSVB 4FAAB 5IV2B 2YPKA 1NCWL 2EH7L 1XMEB 2ZG3A 3KPQA 1SRDA 4FXTA 4APXA 3QFJA 4HXBL 3GBNH 1FO0L 1W6LA 4HISA 4IMKA 5FO9B 3NCYP 3R4RA 4HK0B 3SYQA 1CTMA 5HYJD 1KWKA 4MNGB 4X42A 2NXYD 2LLLA 3HLAA 3HRZA 4HIXL 5B4MD 4Z77A 3QUYC 4LP4A 3GNMH 2HT4C 1DBJL 2RACA 4M7LT 4XBGB 1KTCA 2L04A 3DETC 2MKWA 3EYVB 1Q9KA 2ZUUA 3LRMA 3QDGE 3UAEA 2NY7H 3TEZA 4QY8A 1UWGL 1XB8A 2FB4H 1FLRL 2GTWA 3H3PL 3LNDA 4QRPA 3OGOE 4G7VH 5B3NA 4HF5L 4QHLB 4YSOA 2LW3A 3V6ZA 3OPZH 4YHIA 4HWEH 3BUIA 4GP5B 2W59A 4GBXC 5PCYA 2VL4A 4W93A 3OWEA 3D9AH 4NKDA 5AQ0A 4ZW7A 4ZW8A 2FX9H 1F2XK 2VDQH 1GTNA 1JFQL 1Q9WB 4N3UA 4N0UA 3SBWA 1HIML 2ID5A 4UT9L 5CGBA 3L1OH 1S7QA 3MRRA 5ITBL 3QE5A 4HSCX 1MIEL 4LRIA 2ITCA 3EO1B 3I9AA 4R4NC 5EFIA 3C6SB 4LL1A 3NABH 4G2AA 2EO1A 5M95B 4LEBA 4N9GA 3Q9QA 2KYIA 1R5VB 1TYRA 4RAVA 1A6UL 3QJOA 4Z7UB 3VYPA 2DYPB 1WISA 5EO0A 3K8KA 4Y7OC 5FM5O 3SDDB 2BOCA 5BXFA 5HHPB 4PVNA 1TTAA 4JZJC 3RA7H 2NW3B 3ZGHA 3O6ML 3U2JA 2EYRA 4YBQC 5GS1C 1HSAA 1SM3H 5AW1B 3MLPA 1E5AA 1G9NC 1NCOA 2CHNA 5F1IA 4EMZA 3THML 1JV2A 4ZFFA 4HCFA 4FADA 3KPLA 1JZJA 1UWFA 5EF2A 4Z18A 2FEDD 3QIBA 2X89A 3T0EE 4GG8A 1LNUB 4M1DH 2O6DA 4Y16B 4IIQA 3K80A 4HAFA 2L7EA 3ZE0B 3S96B 1FVEA 3L2LA 5BO1H 4KRPC 4PRID 1OARL 2FUQA 3E1ZA 2ARJB 4WWOA 1F42A 3VH8B 3ZSSA 1IEAA 3MXWL 5BVJA 1RIHL 4GRMA 2JKXA 1ILSA 1GZHA 4P5RA 1JTTA 4ELKB 1CDCA 2N7AA 5CJQH 5LBSL 4A6YA 5CJXC 2AXJA 3O4LE 2E6PA 4PTUB 1KLGA 2Z93B 1S6NA 3NCCB 1IZKA 4AQAB 1CGTA 1YQ2A 2GYSA 5DTFB 2EDKA 2VM9A 3PHQB 3BUDA 4YSCA 4FP8H 2IANA 4JZJB 4XTRD 1PZ2A 1G4MA 2K4WA 2L4OA 4V2CB 3S3PA 2NNAA 1OW0C 2AJUL 1MHHB 3OPUA 1HKFA 4GSRA 2VZUA 1MAMH 3NSFA 5D7JB 2EC9T 4YIQB 1MELA 3QJFB 1AZRA 1RUAL 3DX8B 3JYCA 3VSVA 5KYUA 3TFKD 3AZUA 4PJBB 3UTTA 5FB8B 2WZ0A 2UUDK 1TDQA 1M42A 3VCLB 3PWNB 3CPLA 3WDJA 2D2OA 3MRBB 3HS0A 4OGAD 5IVXA 1I8AA 3PNWB 4TNVK 2WVUA 3BP5A 3FQXB 1O9WA 1LO0L 1ITBB 1WGVA 3MRMB 5DRWB 3ZL1A 4F1SA 1QQDB 2IQAA 1QSEB 3MLXH 3QA3A 5I1KL 3B2VH 2F58H 4YZWA 4XMVA 3R7QA 1A9VA 4OKVA 3V4VH 2COQA 5I8CA 3PAVA 3WE6A 1XFPA 1B0GA 3T65A 2QELA 4MNGA 3DMMB 4KTEH 2WIMA 4MVBD 1RZKH 2F1EA 4ONHB 1HEZB 3IKKA 3CZJA 5CJ5A 1CR9H 4P2OA 1Z9NA 3M1CA 2GTZB 1A1NA 3VE0A 1P9MA 5I15L 5ISZE 2X12A 3QJHB 5DJ0B 4XOAA 4KY2A 4RETB 5FFOA 2O5YL 5IM7B 3KR3H 3IGLA 1ODUA 4PJXE 2ZP0T 4RIRB 3D2TA 1DUZB 1C16B 5LGJB 5DEZA 5DI8A 3QO0B 4KHTH 2VAJA 4K8RH 3U30B 1Q9WA 43C9B 3PDOA 1U92B 4N0UB 5F0LB 2ZX7A 1AO7D 4NOBA 3IMTA 3S8GB 3IVKB 2IQ9L 1XHHA 3OMZA 3JV6B 3ZN6A 3WTSA 1I3GH 2Q7AA 3C60B 4ZAKD 2YMTA 4JMNA 2HZHA 1OF0A 3T77A 3P2BA 5F71A 3TJEH 4QRRE 1J1PL 2YC1A 3KDPB 5D1QA 3FS9A 6CGTA 5EUOE 1Q0EA 2C9XA 4KKPA 4PIRF 5DF0A 3SPIA 2Q5BA 3B83A 4DKEL 2P8LB 2B3RA 2XG5A 3CQFA 2JKWA 4I7ZC 4LPCA 1WJ3A 1KTDB 1M53A 1T04A 3PHAA 4ODWB 3S3CB 4YDNA 3CDGA 4JPVL 4YXLL 3SO3C 2DD8H 4I2XE 1BQ5A 1YCSA 1NGYA 3UTSE 3R8QA 3MU3A 2DLFL 1OARH 3MRNB 4KDTA 3V55A 5FLVA 5D96B 3H55A 2PXYC 4AL8C 1QVOB 4F92B 1DBJH 2NW2A 2O72A 5IP4A 1A6ZA 1TSHA 3LKPA 1KB3A 2NY6B 1VZIA 5A2LH 4O51B 3PQYA 1QX1A 3P77A 2YGNA 3I3BA 2RB8A 3CQQA 2IBZX 2X6CA 2OYLA 1E4XL 2EYSA 1PZBA 2ZUSA 1PPIA 3VI3B 1G84A 3KVPA 4BA0A 2D4FA 3LZFH 3E6HA 4HDIA 1FAIH 3HI5L 3SKMB 4PGBB 2UYLB 3U6RB 4GT7A 5IBUB 1N4XL 1RU9L 2RGSA 3BKJH 3FK3A 1UZ6E 3UJTH 4XN1A 2XV3A 3QRGL 3VYNA 1AZBA 1F8TH 5AZEH 1DZ0A 1RCYA 4MA3A 4CU6A 4PJ9B 2I9LA 1B0WA 5D7SH 5JW4Q 2VN3A 4CW1B 2I69A 4PI2A 2HT3D 2DDQH 3HR5B 3TBWB 5DJDA 3SBQA 4D9QE 1XGTA 3EGSA 5JQIB 1IC7H 2CJUL 9CGTA 2GSGB 5DEGB 4NBXB 3HAEH 3DX6A 4JRYB 5HVFB 1IBBA 3GRWL 4KKBD 5D7JA 3IXTA 4PJXF 3ZZQA 1NCCL 1YY9C 2JKLA 2VE6A 4M6OL 1UG9A 3FQWB 3GMPB 2KC0A 1DQDH 2XWEA 4O02L 2Z7UA 3C5SB 1JD7A 3FU8A 4FNTA 1D5RA 2DM3A 4LSUL 1SXBA 3L45A 4UWQB 3SGJC 2GSIB 1HVXA 4ISVA 4JLRB 5DD5L 2ZWYA 5J9PA 4GKSB 3K71B 1CICA 5DRWA 2DWTA 1QQDA 5DC2A 5I5RA 3R1GL 3CUPA 1XF4B 2ZKWA 3HC3L 1RJLA 2RA1A 4MA7H 2H26A 3D12B 4G8GA 2I9TB 2HKHL 3TWCL 3IF1A 4P06A 1JZGA 3BEVB 1T5KA 4FNPA 2CUIA 3QDME 4DIXA 2BSDA 5GS2H 3N43B 4R5TA 4YGAB 4MCYA 3TOPA 5LCVH 2VABA 3IMWA 3PDDA 4P2OB 5K1NA 3EOAA 2WLHA 5AVTB 4G7YH 2WQAA 1CLYL 4E41D 3ETBF 5TQ0L 4Z7VA 2X9XA 5IB4A 1DDHB 4JRXB 4C55A 3VXSA 1HYSD 1RIUH 3BMVA 3ME0A 2VDOB 1OPGH 4FZEH 2BS71 2CA4A 2OTUA 3MJ9L 3EGDA 3P9MA 1C16A 5I6NA 2LLNA 2Z6FA 3VNZA 4WTZA 1U6AH 2VL5A 3ISRA 4TRPL 4KNSA 5IMKB 2YR3A 2XVKA 1U42A 3BVNA 1EZUA 2BOLA 5FCUH 1D5MB 3FTYA 3VSQA 5KJ4A 4S1DC 3KPSE 2CDFA 2GBUA 2UZIL 2VDOL 4NSKB 4Z7AA 1NA8A 4EI5D 1NCUA 7TAAA 3DX0A 2NSMA 2QHRL 1XR9A 1JPGB 2I27N 4JDTL 2XI9A 4DN4L 3D4ZA 3HB3D 1BIHA 2X40A 1EPFA 1P4LB 1AGBB 4GP8B 5B1JC 5KJ7E 4NEHB 3FH8A 3CVIL 2G75A 3O8XB 3EYOB 3NP3A 4NO0B 4U0RB 2WLLA 4PJAB 5FF6B 2G60L 5I23A 2EEAA 3PAUA 4PVBA 2WXPA 1VEMA 4PHXA 2C7UB 4CN1A 1HHIB 3F58L 4JANB 3LNEA 1NGYB 5T1LD 3MRNA 1ZTXL 2A1WH 4XBEL 3WN5A 3AABA 4YHZH 4F15B 1YEIH 1WH0A 3GK8H 1WZLA 5I76A 2XPGA 4IEFA 5JW4M 4NUQA 4NWUH 4CU7A 2APSA 5IHUL 4QJ3B 2ICWJ 4OLWL 3VXPA 4N5ED 3WI9A 4PJEF 2A6KA 2WWKO 2Q8BL 2R7EA 3MRDB 1OTTD 3NN8A 1EZLA 4DAGL 1D5IL 3FH7A 2VQTA 4Z1PA 1Q94B 4XVJL 5ESAA 1X5GA 4PJGB 1A0QH 3E6HB 4OZ4A 1ZXQA 3QUML 5EOTA 4P2RA 1JZHA 3ESMA 1C5DA 2ZCLL 3AW5A 4XO3A 5KVDL 3VFUA 1A4KA 1YEFH 3U0PB 3FUFA 4UDTA 1BMZA 5D2NC 1NFDB 3DRQA 3CSYB 5C09E 3GDBA 2JVUA 5CLZA 1KCWA 4WI7A 3HE7B 4N2FA 4PW3A 5MENA 5DJ8A 4Z76B 5CINH 1U30A 4I3SH 2NY5H 4BDVB 2KH2B 3VNYA 4PJFF 2PETA 5F88A 1A7QH 5JW3L 1WBXA 2OPCA 4JFQB 4U6YB 4LRNH 2WY3B 3VFWA 5IR1B 4ZSOA 1G7HA 1KCSL 4YL9A 1JGDB 5CJXA 1B3JA 2JWYA 2Y07L 3I6LE 3C5SA 4XN8A 3Q1SL 1KENL 5E2WH 1OAZH 2HMID 2ED7A 3TXAA 1MEXL 1CE6A 5EPMB 1PFOA 5DMKA 2PYED 2WD0A 4PWJA 3TP4A 1IGTA 1AQDA 2V3DA 4AIEA 4AENA 5E8DL 4AKOA 1LD9A 4HC1A 4LK4A 5EEXA 4ZSOE 4S1QH 2J8UA 3DVIA 3MV01 2XZCL 4TQEH 4O58L 4OIAA 1HZKA 2NCMA 4QRTA 4WHDA 2N59A 1Y18B 3U25A 4HJ1A 2JK5A 1ZHKB 4G11A 4M3KB 1Z9LA 4NKMB 3SJVB 4FCHA 3SHSA 4KQ0A 4FQQB 3L7FA 3FNKA 5E1IA 5LAXB 4QYOB 4WRLA 2H5UA 2R29L 3GXTA 1MQKL 4DKFH 4YDLB 1OE1A 2IPKA 4JFVA 1I3VA 3EHBC 2CO6A 4X2UA 1M9SA 5E9DE 3D0LA 3WU1A 4MJ5B 2Y1AA 3MV11 1F90L 5E5LA 2OTUB 4HJ0D 1QYGH 1ZT1B 1CGWA 2E9WA 3D85D 1J0KA 3V5DA 1FCGA 4N20A 4PW9A 4YHLL 3RJQB 3DOSB 4YL4A 3CIAA 5J0BA 3FCSB 1D5XA 5IROC 3CFEB 4BWWA 3P3RA 4M7KL 2N7BA 1VJSA 3GBMH 4ZOAA 4UT7H 2V8LA 4CVUA 3CVIH 4FHKA 3BT2H 1S7SA 3HNSL 5B4MC 3VQLA 3EJYC 1FH5H 1JPGA 4LQFL 4V1DA 3SDCC 3TL5A 2EVHA 4DN3H 1ZCRA 2WAQA 4N8PA 1AKJA 4HLZH 4XRCA 4IBUA 2B59A 2QV2A 2WQXA 4URTB 5I1DA 2I32A 1OCZB 1MRFL 4NX0A 1NEUA 3CCHB 4Q6IB 1T1YB 3KGRA 3D39B 4TPRL 1JK9B 3KCWA 1AS6A 2B3IA 1A8ZA 4FFVD 4ODVL 2YUZA 3KPRB 2P42B 5KBMA 1HQRB 2BWIA 4WZ9A 4ZQKA 4OD3H 4LOUD 3FB6A 4FERA 2NQCA 4X6DF 4YBLC 2JLPA 5D9SA 5CEZD 1OO2A 5H94A 3D34A 3LXAA 1F56A 3NCEB 3RJOA 4JG9A 1IM9D 2A73A 4HV8A 1A21A 15C8H 1O6TA 3ABLB 5E6IB 5DK3A 5F1NB 3A23A 2MPAL 1BZEA 2VJ0A 4G5AA 3WJJC 1INDL 5TQ0H 1IKNC 3V0VB 4AYMC 4J2XA 2Z7WA 2NYYC 3NIFB 2CBPA 4P2OD 5CHNA 5ENWB 1X5JA 2UWEB 4NKIL 5EZOH 1ULVA 3P1VA 2K9FB 3RPIB 1QSVA 2YJLA 5E7FA 2OQJB 3HUJA 1X9LA 3HZ3A 1G9MH 1RUQH 2FHBA 1E0OB 3MUJA 3O8XD 2VLLA 3EFFA 1NDGA 1QW8A 2G30A 3DC0A 3KWXA 4LSPL 4W4NA 3S88L 4B5EA 1QASA 1SOSA 1XGUB 1XT5A 3F12B 4DP5X 3ZHNA 3SQBA 3SD2A 3TO2B 1NINA 2XWRA 4FQ2H 3L95B 4KO7A 2VLRE 3QH3A 4FEMA 4UU9B 5EU6A 3X1FA 1AD0A 2B2XL 4HPYL 4JFQA 2DQTH 5IESH 1GYWA 3CE1A 4YQXL 4YBLB 4JPWH 5GS0H 1WQVT 4KFZC 3WSQH 2V9TA 4BQBA 1ASPA 1XIWB 5J11C 4M3HA 2VWEE 4DZ8A 5I6LA 1XCWA 4I1PA 2OAAA 1OQXA 3TH2T 3EYFB 4ODTL 1WF5A 3M1BA 1KBGL 5DD6A 3QJUB 2P9RA 4KZ0A 4OCNC 3U9UA 2NY2D 4HIQA 2BVQA 3F58H 3HA0A 2Z31A 3DVNA 3PV6A 2WC7A 4JGUA 5K93A 3QIWC 3HG1A 3JZYA 4IK6A 4MA8L 2AEPL 5KG9B 5EIQA 3DTXA 3DHJA 2R29H 3RVWD 4BFFA 4KH9A 1U2YA 4DVBA 3MBED 3O6KH 4TSAL 4XNMB 2AK4B 2UWEF 1XF5A 4MA1B 5E6RB 4HCRA 1PVHA 3Q8BA 5KUMA 1Q0XH 1T7WA 4FQQA 4HKXB 5TFSH 1ZHNB 5FYKL 4DAGH 3BLKA 3L9RB 5J3HD 1ASQA 4QD2E 3B1TA 3QZOA 4PRHB 2WXQA 4XN7A 2W65B 5I5IA 1PCXA 2L7UA 3KPPA 5DRXA 4PJGE 4K3HA 1KLFA 3PWPD 3HZVB 3ZKND 5I73B 2NX5B 2YGOA 2ZWLT 3D4CA 3WUWG 3CHPA 4K5PA 3OQRA 5FCSH 5EA0H 1KF9B 3ZHKA 2WLIA 4K5OA 5HPMB 1YDPB 4B53A 3QIBD 1NTDA 5ICUA