4JUTA

Crystal structure of a mutant fragment of human hspb6
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
84
Chain Sequence
ALPVAQPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHAARPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure and dynamics of the dimeric human small heat shock protein HSPB6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock protein beta-6
total genus 12
structure length 84
sequence length 88
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jutA01
5DS2A 2CG9X 3L1EA 5LUMA 2Y1YA 4ELDA 4FEIA 4JUTA 3GLAA 3QORA 2KLRA 2WJ7A 4RZKA 3GUFA 4YE0A 4YLCA 2BOLA 2N3JA 2Y1ZA 2CR0A 3L1GA 4MJHA 2Y22A 2XCMC 2K8QA 2MNWA 1EJFA 3Q9PA 1X5MA 3QORC 3J07A 1WH0A 1WFIA 3QORB 2WJ5A 2O30A 1WGVA 3GT6A 4I88A 3VQLA 4M5SA 3VQMA 2KMWA 4PCKA 3W1ZA 2RH0A 4ZJ9A 3Q9QA 3L1FA 3IGFA 4YL9A 3AABA 3EUDA 4YDZA 1SHSA 3AACA 1RL1A 3N3EA 1GMEA 4YLBA 4PBDA 5DS1A 4M5TA 4JUSA 2JKIS 3QORD 2N0KA
chains in the Genus database with same CATH superfamily
4ZMLA 3GBNL 3O45A 4WSGA 5CCKL 4CMMA 1FNGB 4G6FB 4G8GE 2GVYA 2X44D 4DKTA 2P28B 3R1GL 4WFED 3ARGD 4XVOA 3C8KB 1YVLA 2G3MA 2ZP0T 4NC2B 5T3ZD 2VCOA 1L7TH 3J07A 2FLBT 3QJRB 4UT9L 2BJML 1IGML 5GS1B 1UTDA 4Y4HD 2BVYA 1SXNA 4NZUH 5D7LA 3K72B 4JHWL 3II1A 4MB1A 5HD8D 3RURA 3VDAA 4ZSOA 5GZNC 3DXAA 4L8BA 5AW8B 4N2FA 4YSEA 2GSGA 4Z7UA 2BWQA 3BD4A 4ZPVB 4KZDL 1C1EH 5IW1A 3BN3B 5F9DC 3OMAB 3WS3B 5DMKB 2NY3B 3ZY7A 1UYWH 1KLUA 3D39E 3NRPA 2OW7A 2AQSA 5AVQB 3WNMA 1A66A 2H2SD 3FUDA 2ZUTA 1FRGH 5D2LA 4J3OH 4KKRA 4A38A 3QZMA 1MCOH 2WO3B 4QJ5B 3FB7B 3FU0A 4L8CA 3MI6A 4MA8L 5CKAA 1YN6A 3NIGE 2VGLM 4BSVB 2QSCL 5MHSE 2EIEA 1XF5B 3BZDA 4QOKB 5B4MC 5IHHA 1JF5A 2EVFA 1OAKL 4MZ2A 2MMXA 5BV7L 1OGAD 3Q2VA 2A6IA 3RGHA 2XKNA 5FO7B 1MJ7L 3VFGL 3GI9H 4RMSA 3L3DA 1KLGB 1EJFA 4AIOA 1HYRC 3EOAB 3HC3H 1DZBA 5CD3B 4XPTH 4HJJL 3KLHD 2KLSA 3I6LE 4ZUWB 5JW4M 4D9LL 4O5LH 1UCBL 3HLKA 2WBXA 4I0PA 2X2IA 3ZGIA 3LQAL 1NFDB 3JQOB 1D2OA 4EZMA 4YPJA 3V9FA 1ZK9A 1DE4B 1NAKH 1EO8H 1AFVL 1KDIA 1UACL 4HALA 2ZWNA 5DRNB 3ECUA 5AOKA 4J12A 3BH9A 3CFJB 3QUML 3A24A 4IU3B 3TWCH 5CLYA 3IRZA 3VMOA 1B4RA 1RXLA 4HC1A 4M48L 1FIGL 3IYLW 1BEYH 1UG9A 3RI5F 3HKFA 2BSTB 4A7UA 1MIMH 1CFQB 1XF3B 5KYWA 5DJ0A 1AOHA 1BYPA 2O61A 2CGRL 5EF2A 1XTLA 4G3YH 3GM8A 6FABH 2BHZA 2G2NA 4QCIA 2J7LA 1T7WA 1BD2A 4PJXF 1OEZW 3MXVH 2E4TA 2YD4A 2F58L 4F93B 2R2BB 3S4SB 5EBWA 2VDRH 4YXKL 4X9IA 1EAQA 5DEGB 4XNYH 2OZ4A 2B4CC 3JT0A 5DO2D 5IOPA 2WVVA 2QGCA 5C0AA 5ANMA 4AITA 3IXTB 4DO6A 2O5YL 5D2NE 1KGIA 2BSRA 1CLCA 4LESA 3V0HA 2ADYA 1IFHH 3MBXH 5C0CE 1OD7A 4YVUA 1D5XA 1ED3B 5GS0C 3AGVA 4OD3H 4L3ED 2EEDA 2W81C 1P4UA 2WCGA 3D48R 3FULA 1HH6A 3BVUA 3MX0A 2OMTB 1BZ8A 4JJ5A 4JPWH 2XFGB 1I7TA 2JKNA 4MX7A 1YC7A 2XZZA 4JFXB 1SQMA 2XCMC 4KUZH 3VWKC 3E6HB 5D1ZD 3O11A 3DUSB 4TQHA 3UZEC 2XWJB 1A1MA 3GKWH 4NN5B 5J3HD 1IBBA 2V4LA 5L88H 4LVNB 5DZLA 1CFSB 4Y2DA 1KJMB 1QTSA 3V0GA 2QPFA 3BDYH 4WI4A 1OK0A 4LCVA 3V8OA 4FMKA 2I60H 2HTKC 4FI6A 2BHYA 5CNHA 4ADIA 4D8PB 2OK0H 1OSPH 2TAAA 2R2HB 1XIWD 1A6AA 2L7JA 4F2MA 2CIIA 1FL3A 4KK9C 2H26A 1XBDA 2KYIA 3QCUH 4UT6H 4RETB 1W72B 2D7MA 4HZLA 4NPJA 4MNQE 5DJCA 1ZLWH 5IR1A 3CX5J 3QXUA 3DHJA 4WEMB 4EI6A 5D7KD 4ORZC 4PRIE 1JV5A 4NCC1 2HRHA 4U2ZA 4MZIA 5KSVB 3ZQ9A 4BSWB 2W9EH 2YA2A 5E5MA 4FDWA 1T3FB 3HFML 3WLBB 5EU4A 4LZKA 4F7MB 2VXSH 4LOEA 3QHFL 4G7VL 2KZBA 4GH7B 4QHLB 4WU5B 1KCRL 1PG7W 1MHPH 1B0GA 4FXLA 1MOEA 1QMUA 4HIHA 4EXKA 4UTAA 3P0VL 5HVHB 5I1DA 2ARJB 2E86A 3E3QE 1IBZA 3KPRB 3P0YH 5HP5A 2IAND 4LLQB 1IE5A 1G9NL 2NY7L 2ILLA 1R17A 5I6XC 1YQVL 1FA4A 1OP3H 1W0WB 4JFFD 4AI7A 5DD0H 3S0PA 1YYML 1HXYB 3D34A 1QSED 4HWBL 4DT2A 1AJ7L 3MREA 1NIDA 2G2RB 3APFA 2EABA 1KB3A 4GIAA 5KN5B 5AAWC 4PJIE 4J7RA 4UQ2A 5DHVH 3V6ZB 3K91A 2DLEA 5MENA 3GMLB 4RRPG 3H2WA 3V52L 4F7EA 1KN4L 5FK9A 1E2WA 4OKVA 3IDGB 3WKML 1C16B 5FA4A 5FYKL 5GZOA 1JTTA 2PCFA 5K39B 1FE8H 2QZ5A 3MJ6A 1UWEL 1UZ6E 4WU7A 4U1GB 4PJAF 5JPMA 1YAIA 4PJIF 4GO8A 4AYEC 4K3EH 1XGZA 5A3IC 3EGDA 4ZUVA 3B2XA 4IKLA 1DBKH 2X70B 1X9UA 1ZA6A 4HIJB 3PV6A 5AL0A 4WENB 4YWGL 2FJSA 4UNVA 3LIZH 3GBMH 1XR9B 1T89A 1A7OL 5AZUA 1JF1A 4NM8L 3SE3C 1XGPA 4MD4B 1MFCL 4Z3HA 3C60D 4MAYA 3D06A 3OHXC 3FO1A 1ZK5A 4GQRA 3PDGA 4JFZH 3SDAA 2EXSA 3BW9A 1YNKH 3K1DA 4WWKC 2BNQE 4ZAKD 5DURD 1S7VA 1QWNA 4MRCA 2E9IA 2OMZA 4K71C 1HSBA 2DEXX 5LGJA 4Y0GA 1K6QH 4Z18A 1GOHA 1WFTA 3VQLA 3VYOA 1UWGL 2Y6SC 3QXTA 2AXGA 3D5OF 5EU6A 3DV4B 3GJFA 3D0VA 1P9MA 1KCSH 4PY7A 1DVFA 1F56A 1MH5B 4WEBH 3SY0A 4KZ0A 3RTLA 2AI0L 2FD6L 3CVCA 5EU4B 1FC2D 4FFZA 4F7MA 1MG2C 4JG0H 5C08D 1H6TA 1MNUL 3UERA 3QUYC 5I1HH 2X4TB 2OBGA 5HGAB 3ULUL 1UZGA 1XL4A 3ESMA 1Q4NX 4POZD 4MB5A 1JPGB 3ECBB 3HE6B 4P59H 3OC5A 2WAQA 5INCB 4JY4B 2OKMA 4ZW6A 4PJ5E 4YHYB 1T1WB 2KMWA 4PB9L 4QXVA 4KY1H 2YAEA 3AT8A 4Y5XA 4E9RA 3B43A 4PJ8C 2XQYG 3PWVA 3PUUA 3EF4A 2HJFA 3DK0A 5HY9B 4JRYA 3U79A 4NZJA 4N8VB 3IRCA 2CDEB 3QEHA 2VZ1A 4PJ6A 4UAOB 3QXWA 4ZQTA 5KVEE 4PRDB 3QEUA 3S36X 2G9HA 1HX0A 2D9CA 4NT6B 3SDCB 1IGCL 3T2OA 2OMXA 4JZJA 4D3CL 1GGIH 3GD1C 1CDHA 1ZWIA 3ARGB 1IZKA 1CFTB 5E00A 1TNNA 2KUTA 4JY4A 5JW5B 2AEQH 3F6IA 4JVPA 2IALA 4FJ6A 3ES6B 3MO1A 3SO3C 1ORQA 4D0CB 3BUDA 4Z7VB 1COBA 2H1XA 3HI1B 2WCSA 4F37F 3A4EA 4ISVA 2D03H 3VTAA 4Z95H 1OAUH 3ELQA 1RLBA 2F5AH 1DSFH 4GAYB 4U1IA 2JCCB 5D1QD 3GSRB 1R3KA 5ICXB 2TRYA 1GC1L 1V10A 2JIXD 3IXTA 1KFAL 2VXQA 2JJTA 4IGBB 1Q9OB 3HHSA 3U4KA 2ENQA 1A47A 4KOBA 4MNGA 5IREA 2H32B 1AKPA 3DX8A 2K3TA 3S3JA 3QZLA 1HEZB 5B1JA 3CFIC 2XZAL 3A6BL 1INDH 3DOSA 3WTXA 4OZ4A 1ZE3H 5TDPB 3WKQA 5IQ7H 3I9AA 3QIBD 3SJVD 1T0MB 1N26A 5E4EC 5FO9A 4GQPH 4NSKA 2VDQL 4PBDA 1IEAA 5TE4L 5EN2A 5A7EA 4JRXA 1GH7A 3SD5A 3U9PL 4KI5D 1F8TL 3GUTA 3KPSD 3KYMA 5F9AC 2V3DA 1BGXL 1YMHB 5EBMB 3N44B 2YKLL 5IEKB 1A3RH 1AACA 4XPGH 4E0RB 1N8OE 2NUTA 3II3A 5IZ7A 1F2QA 3RWFA 3UROR 1A9VA 5EC1B 1UXWB 3G3LA 2LTQB 1BZ9B 3LSOB 5DK2A 1KB5B 1UZ8B 5T5FL 3WIIH 1EZUA 4TPRL 2DIEA 1OM9A 3OKKA 4B7IA 2DTSA 4A2HA 1SJEA 4K2UL 5DFVD 1PZBA 5GHWH 3EBAA 3VGDA 2BC4B 2XI9A 2R1WB 4KUCF 1UH3A 4R26L 1L7IL 3W39A 1WICA 4H88L 4JKMA 2FIRT 1LO0L 1H5BB 1JPTL 2UZIH 3SBWC 3L2LA 4NBZB 3RWIB 3MBWB 3NCFB 3CVBA 2GITB 3MCKA 1KLFB 3MLYL 3N40P 4GSUA 1TF4A 3UO1L 1HN1A 3H9ZA 5EUKA 3RFZB 5C0AD 3NPZB 2DI8A 4XWGH 5FO8B 4MZ3A 4LLQA 1VEOA 5JZ7D 3ASOB 4X7TB 1F11B 2P8MA 4Y9CA 5I6KA 1I8UA 2ARJA 1DCEA 3ZVVA 3MRDA 5F7EH 4L8SB 2C8NA 4ZS7H 3P3YA 4GO6B 3ZRFC 1UB5B 3GPEA 4CL7A 5DJ6B 3FSZA 3L3KA 1K2DA 1RZQA 3EJZD 4ACTA 2A99A 2XVKA 1JVOA 2WB1A 3O4LD 1MCIA 3WUWB 5MP6L 1TZHB 4GQ9H 4AT6A 3E9UA 4KBPA 5KSAB 1E28B 4XAKE 4GBXB 4M61A 1BFVL 4BK8A 3M1BB 3EXLA 3BAWA 1JK9B 3HOGA 1WA1X 3QZBA 3IMBA 1BX2A 4KROD 1LO5A 1MLBB 4Y2DD 2Z91B 1G0XA 5BPPA 4X5WA 4C56B 2F8IA 2VJXA 3CSYA 4M4PA 4E41D 2HRPH 4HWBA 2NY5L 3N44F 2VIRA 1ACYL 1NFIA 5F70A 4P05A 2NXYC 5EEWA 2GTQA 3FQ2A 1UWXH 4XP4L 3IBEA 5DK3A 2XG4A 4WV1B 2G4GA 3L16A 1FORL 5KSAD 3O45B 1Z5LA 4QD2E 3OB8A 3MLSH 4PJ9C 3P77A 5BOJA 3GMOB 3IMVA 1ZXKA 4AVHA 1AI1L 1CDIA 4RQQA 1O9ZA 3V8CA 3QWQB 3T3MB 1M7IB 1FO0H 4RNRA 1S7TB 1FV1A 2ZG3A 5I17B 1NUNB 3HRZB 2GUOB 3MRBA 1AGFB 1A4KB 2DOCA 3S97C 1E2ZA 1CXEA 1NC2A 1OAYH 1T1ZA 3LZFL 3MV8D 4Y2DC 4Y9EA 4JRLA 3KPNB 3GDBA 2PCPB 4QRRA 5F0MB 3BT0A 5FA3A 1OL0A 5BUGA 3U2SB 2X3AA 1QQDB 4ZG1A 3JUYA 4WNQB 3FCUB 3HI6L 3E7JA 2F53D 1VENA 4R8WL 1GZQA 5KW9H 5ID1A 5CO1A 4PUBH 2FQFA 2VDPL 1JK8B 5ETUA 3MJ7B 4L3AA 5C0CA 4FFYH 4P5MB 4PJXE 1HIML 4G1EB 4PP1D 4C56D 3RA7L 4OD1L 3TEUA 2O30A 5EUOE 4WHYH 4XP1H 1A7QL 1GYWA 4OZFB 1LVEA 3CQPA 1LEKA 1KIQB 2X3CA 5C70A 2X9WA 4DZ8B 1SEQH 3FQTB 5I1IL 1O6VA 1PFOA 4JO3L 4R7NB 1SLVA 5I75C 1A4AA 1AIZA 1J8HD 1CE6A 3EADA 4UQ9A 2EVIA 2YAPA 4HIXL 1QSEB 1U95A 5FUZH 3VXSE 1MHEB 3VFPB 7PAZA 3BI9X 5CD5C 2BVPB 3BUTA 3C09C 1RSFA 2ZOLB 4PD4J 3BQUB 2H9GB 4P2OD 4KQ3L 2CAKA 2D2CC 5AAPA 3E6FB 3OJMB 3ZL4H 4PCTA 5GGSB 4CRPA 3O6LH 2IH9A 1ZV9A 3BXNA 1CLYL 5HGHB 1QPXA 1P7QA 3N2JA 1U8OB 2YD0A 1YMMD 1OTSC 2WLKA 3Q43A 2W65A 5EFIB 4XBPB 5D71L 2AK4B 4I9WD 3REVA 4XMXA 4Z7WF 4LASH 4U6YB 3BT2L 3IPBA 4U1JB 1UKSA 3RIKA 3GXMA 3SPCA 3JBG7 1Z9PA 4H5SB 3NQIA 1JDAA 1CL7L 4IBZA 1SGKA 5HDQH 2GY5A 1BVZA 1MFDH 2A6JB 4JFEE 3DUHA 3C9NB 2HT4C 2ZAHA 2ZKMX 4K3DH 1UT9A 1ZV2A 1DVYA 4QRPD 2C3GA 3RTQD 3L81A 3MRIB 3QDMB 3H6JA 2VXQL 3AG3B 4RLDA 5E6ZA 5F9WC 2EDRA 3GSNB 1D5IL 1SNRA 5HDBE 4UTAL 1AD9B 4OFPA 3CPUA 3OAUH 1RZ7H 3FPXA 3IU4L 3LY6A 4PHZA 3U9WA 2P5EA 3OKEB 3FH7A 3KH4A 4Z7UB 4QRAA 3S2AA 3WNPA 2CBMA 4JO2H 4PWJA 4GP5B 4YK4B 2W92A 5IROA 3OX8B 4ZMXA 4PTTA 4DEPC 1MWAH 5DR5H 1NICA 2CO6A 3WDIA 4Q6IC 3Q06A 2HFFB 3HTLX 4NERA 3HFFA 1WHPA 2DN7A 1NM9A 5I6MA 4GAJL 1ZLEA 3GXPA 1F1DA 3FQYA 4PJEE 3V0JA 4YPGA 3TV8A 4AUYA 4AYBA 4AG4H 2BXZA 5GJTH 1XF2B 2CD0A 5HHOA 2OA9A 3LYRA 4TUJA 3MA9H 1A14H 3I2CH 5DVKA 1WT5C 4DW2H 5M95B 2CUAA 5F3BA 3CFKB 1QOKA 1WK0A 3QJZA 2WZ0A 4UDUB 4QRPE 4ZNEA 3MRRA 1VGKA 2IWGA 1RZIB 5EOCH 5DTFB 1H8OA 1NCDL 4JO4L 4CILA 3I85A 4P2RB 4YIQA 3O8XB 1E8WA 2IAMB 1CICC 1FFQA 1AD9A 2FJGB 2X4OA 3H1ZA 3Q5TA 3VXQA 4O58H 5D7SH 3SDCD 4DZBB 2CJUH 3FMGH 2YHGA 4X9YA 1WCBB 2L7QA 3EJTA 3T8MA 5HYSA 4NUGH 2YAHA 4ZS6C 4BYHA 3UJJH 5EO0B 3OG6B 3O9WC 4URTB 5E8NA 1ZHKB 2MTAA 2UWEF 2QFPA 2BNUB 1BQLH 2IFFL 4F57L 4NQDD 1JNHB 3H3KA 5DS8A 5FFOA 4LSVH 4GSQA 3VD7A 1MVYA 1QLRA 3V7AG 2J25A 1WIOA 2C9XA 4FYQA 2HJKA 1KBPA 4PQXA 3X14A 2J55A 2Z93B 3QG7L 4FG4A 1CG9B 4XVJL 3JV6A 4MJ6A 2GSMB 3CFQA 1F4YH 4X9GA 5AOJA 5HHNB 4JRWA 2VR3A 4LDEB 3L7FA 4CVXB 5IKCB 1EXHA 5F96H 5ID0B 1HILB 1E6JL 3O2WH 2AW2A 2Y9RT 43C9B 1V55B 2AJVH 1X5LA 4PLOB 2F53E 2ZXBA 3EYVA 4UUJB 5LN8A 1QEWB 2XACC 2G2PA 3SCMA 2AXFA 1S7UA 4HA1A 4ODUA 5F88A 4JPVL 2EUZA 1NGWB 3P4LA 1J05B 1R33A 3MFFA 4NDMB 2AAAA 4ODHL 3N1PC 1Q0YH 5C09D 4JN1H 2Y7OA 5L7XH 5TK4A 4X6FB 1T2QL 4F9LA 1OM3H 1JUFB 2ZOOA 2EDFA 4QOKD 2ZWSA 2ZXCA 3BAEL 3UTSE 1LL1A 1UXLA 2XPZA 5IM7A 4Y1AD 2DBJA 3NIDF 5D7JB 2AGJH 4G8GB 3ZE2F 3QA3B 4D9RD 1JXDA 3B5HA 4P5MA 3NJMA 1E5BA 4HAKA 2J1ZA 5F44A 3OVUB 3ZHFA 5HGBA 4NZDA 3MV8E 3UYRH 1KJVB 4OBRA 3MLWL 3TH2T 2DQHH 2A74B 4NQEE 1D6VH 2QHRH 3GZQA 5ALCL 3AG1B 4AYSA 1EHKB 3IJ7A 4FXGA 3MGTB 2FLRT 2Y5EA 2YXMA 2Z7YA 4R97C 4B3VA 1RK1B 3MACH 2JLLA 1GCYA 5I30H 3SDYL 4FQXC 4JS7A 4AENB 4LRNL 3IU3B 2V2WB 4AGPA 1DJWA 2D31B 2I7OA 3FCSA 4N90E 2X1OA 4XAKD 3MRHB 3CXDH 4BDVA 2XPGA 4LE8A 2DM3A 2HG0A 2ALWA 3K2IA 4LT7A 2R0LH 3SCMB 3S37L 2R29L 3TBYB 3W5MA 4UUJA 3APCA 5SWSA 3X1NA 1P7HL 2HMIC 2DAVA 4WUUB 1KULA 2ZYIA 3O3DB 3LEXA 4U3HA 1B0RB 3VI3E 2XETA 4DPCX 43C9A 1IBDA 3WTSA 4YAQB 3DRTA 3WFEH 5IY5B 2J1WA 4XBGA 3L3JA 2CBPA 1NOLA 1HHKB 1SXBA 3HG3A 4LSQL 5DU7A 2E7LA 2AABH 3BKJH 4Z7IA 1XMEB 3MRKB 4W81A 2QV4A 2W60B 1CG9A 25C8H 2N1TE 2VQ4A 1U8IB 2VN7A 5DSCA 5E1IA 2B5IC 3DUUB 4X6BB 2IH3A 5BXFB 3L5XL 1PZ5A 3FOMB 4G6KH 4PSRA 2BVQB 4UIMA 2Q8AH 4V11A 3PFUA 3U7YL 4EDWH 3QDJB 1SHSA 4OT1H 1KJVA 5F7LB 2QPEB 4H26B 3RNQA 2N0MA 4FNPA 3TCLB 3EW3B 1XGTA 2FB4H 4B41A 1RY7B 1UADC 1AKJB 1G9NC 1DFBH 5ERWA 3UIYA 2OP4L 3R4DA 4KKNA 4L3CB 4FQ2L 1SMOA 1PD1A 4XI5D 4KZEL 1JZIA 1RZJH 4KZCA 1PU0A 4P2CG 2VLKD 4AGOA 1CCZA 4RMUA 3QEGH 4M62L 4JHAH 4FHBD 3LQZA 5SWZA 4XP6H 3MBED 1I3GL 5DYOB 1JZJA 1XAUA 3NZHL 2KPWA 5SX4I 2MHAA 1OGTA 2FO8A 3MROA 1R24B 3NIDB 2X1QA 1PEZA 3OG4B 2DH3A 4XNMA 4YSPA 3L3IA 5FC9A 1DVUA 5J1AB 3MLXH 4LSSH 1IGIH 4HFWB 4Y9FA 2JB5H 3UADA 1MWOA 3DMMD 3IWUA 5EOCJ 1YEJL 4M8QA 2HB0A 4APQC 4FNTA 1DJYA 5HYIA 3CIAA 1P6WA 3BFQG 2Y7QA 4ONFH 4PJAA 5TPWH 4DCQB 3N6YA 4ODTH 5GISL 4L0ZA 5TF0A 4X5QA 3PL6C 5ANHA 1NL0L 1M7DA 1CK0H 2DM4A 1CDBA 1CK0L 5DZVA 3BZ4A 3VSTA 3UYPB 2YBGA 2JV6A 2K1MA 2OCFD 4YLCA 5JIQA 3C6LA 2HKHL 5TDNA 1AGEA 3ARDB 2M26A 1IE4A 1I1YB 1L9NA 2OTUB 1YEGH 4ZXBC 2B0SL 5KYXB 4NRZB 5GS2D 4D7PA 4KJWC 4XTRC 2DIJA 4JCLA 1GZHC 4FP8H 2PR9A 3HG1B 4ANKA 4B9IA 1ADQL 1MRCH 1I9EA 4ABUA 4N28A 5DT1L 5ACLA 3VXRA 3QEQA 1Y7VA 3MUY1 4P2RA 4KHTL 3NZHH 3MRRB 3Q8AA 4XP6L 4U4BA 5AVXB 1U0QA 4QJ3B 1OTSD 1UC6A 5B4MD 5L2KD 4Q6IA 3MNVA 1AMXA 3TL5A 3DBXA 1QW9A 1OP5K 2GTZA 3VXPB 1ZVSA 4S1SL 4IOSA 3BP7B 2FQDA 2A9MH 2V7HA 3IMRA 3EFDL 4RAHA 3NJJA 1A3LH 4H0GA 1DEEA 3CBJB 3U6XA 1IIIA 2FB4L 1IZJA 3FCGA 3BH8A 3PV7A 1T04A 3JV5A 4PGJA 2OZ4H 3MTXA 1ZS8B 4J4PA 1HTYA 3BX7C 4AEEA 4AJWA 4LSPL 1NC4D 2VR7A 2Q87A 2ZCKL 3ILPB 4LCWE 1OTUD 1U3HC 2WCPA 2YPKA 3A3YB 4A39A 3VD2A 1I8IB 3BDBA 5DRXB 2F54A 2V9QA 4LBAA 3CZSA 2IOMA 3HG0A 4N8VG 4Z3IA 5FW7A 3QIBC 3VGHA 3FW6A 3O2DL 4N8CH 2GI7A 4P46C 3TNNB 4Z76A 2VLKE 5E9DA 5I1EL 3VI3B 3VXSD 3NEXA 3KPQB 4PYHA 3EJYD 4RMRA 3VSQA 1J0JA 1U92B 4QKTA 3WO3B 2FYYB 1YEDA 3B7RL 2QPUA 3MOAL 3MNZA 1DBAL 4X8JA 3TESA 4YDLC 2R29H 2VWEE 3V0FA 2R0LL 2MOVA 2XBZA 4WIQA 2WO4A 3NRFA 2FECI 1F3RB 4ZX6A 4GEJA 5I71C 1GMIA 5J7CC 3CXDL 1GYVA 3TEZA 3RX8A 4NQDA 2OI9C 5KVEH 3CLEH 3EO0A 4Q56A 4KK9D 5DFAA 4BA8A 5J6GB 1FLRL 1NIBA 1S3KL 1BD2D 4N8UA 3VFVB 4PR5A 3RPKA 4F1SA 5BV7C 1M2OA 3JXAA 3SDYH 4Y8DC 3QG6A 5DUML 3V6FB 4PRPA 5E9NA 4EAEA 1KXQA 5A2IH 3RY5A 3Q2WA 4OSUL 1TZAA 15C8L 1NPUA 3RZCD 1B6UA 4QNPF 5FUCE 3ULVC 4Y16C 4A2EA 1AR1B 1U36A 4NQEB 4HU8A 2FHCA 2LR4A 3JV4A 2OJEB 2Y1ZA 4PGBB 5E5LA 3RDJA 3PUCA 1BQHA 5I19H 2VZSA 2XKSA 2DPKA 4NNXB 1EEZA 5CJ8A 1Y0LA 4FNQA 1FAIL 3LXUX 3HR5A 4NZ8A 4L4TB 1QLFA 1TPXC 1KG0A 5C0GB 3AG2B 4FXGC 4U6HA 4QYOA 5GJSH 1XO8A 5LG6A 3BC9A 4OUUB 2CJSA 3V5KB 1IM3D 2AGJL 2VIRB 1KIQA 5LVEA 4BA0A 3L48A 3LRSA 4OZFA 1KZYA 5IMOB 3HS8A 3M46A 3CSYB 3QCTH 4URKA 1TQUA 2CJ3A 1F86A 2CCWA 4Q9CA 3OPZH 3JZ7A 1RPKA 1QHOA 1NCUA 2A7BA 4JN1L 4WKZB 4RWYH 3V6OA 1E6OH 4LO9A 4ILDA 2PPEA 4U7MA 4X6DF 1X5HA 4H26A 2ADGB 4JPVH 4MXVF 4TL5A 5TK2A 2EKSB 2UVFA 2OLDA 3RUGE 2NCMA 4DP8X 2JXMA 1OVZA 5H37G 1G9MC 2VLJE 3D6GA 1AXSB 2DQFB 1ESOA 1OCZB 5E7BA 4WI5A 2V5YA 5DK0A 4LCWA 4YHPB 2B8OT 1FL6B 5F7MC 2E59A 3MRKA 1IBFA 2RR3A 4F2EA 5BUAA 1DEDA 2CKBA 3FO0H 1DUZB 3U4EB 3KPLB 3LXCA 4XVJH 1N59B 4JFEA 1E65A 1LO4H 3H9SE 4EN3D 5A6LA 2FHBA 3NCXA 3O6MH 2HYMA 2AITA 4FQQA 3FRPG 4NJ9H 3LH2L 1JRHI 2K9UA 3H85A 2J4WL 3UTTB 4BV1A 2J72A 1L4IA 1NJ9A 4O2EB 2C9PA 4ANXA 4WI0B 1DQQA 3C60C 5CKGA 5FM4A 5EIIA 2NY5C 4Q89A 5DMGC 1W8NA 1TMCB 1J9SA 3CHOA 5J6SA 1MAML 1RIVH 3TA4D 3TBVB 4Q9QL 2EE0A 2QQQA 4O58L 1J87A 3OPUA 2NYYD 3GMMA 1OGPA 4P2RE 4UDTA 1HZLA 1NKGA 4OCXH 3WXVH 3QO1B 1JIBA 7FABH 3DO7A 5B8CA 4Z7NE 3H9SA 1T21B 3PAUA 2DM2A 3DX0A 5FPIA 3DURA 1VFOA 2B20A 5HJDA 3D3VD 3SDDB 5E2TL 4KITB 5MEND 3DA0A 2NY3D 2EEFA 4LRIC 3UC2A 3NDYE 2XNAB 4PH8A 3HG5A 3G5YA 4BQ8A 5HPMB 1UKQA 2GC4C 4UQ3B 1N2RB 3GMQB 3LRHA 1AZCA 2I7SA 2M1KA 4MAZA 2DL2A 5IQ9A 1EHAA 2X6BA 4HJUA 4GAJH 5DF0A 2HJLB 3ESOA 1DHKA 2YOAA 1NGXA 1X5JA 1KIPA 3L5JA 2Y07H 5D6CA 3OBAA 3MA7A 5TGBA 4CKVX 2ED6A 3VG9C 2V5TA 3DX6B 1AD0B 5CGYD 3RYMA 1MWAL 3MYJB 3SPGA 4BKLA 3GSWB 1RCYA 3NIGF 4X6FA 1GAFH 1QFHA 3V0AC 2QQLH 1C12A 3VFNB 4RGNB 3N5AA 4DFIA 2DV6A 3BMVA 5KYUB 5HDOA 2JCCA 1T1YB 4L3EA 4TLUA 4P5TD 2UY6B 3GSQA 3OAWA 3QYMA 2KDGA 1D5IH 4YGVB 1JSYA 1FNSH 2ICEB 4PMFA 3AT9A 3QORB 2BCKA 5E4OA 1MFEH 2LT9A 1P84J 2FH8A 2YPLE 4YDKL 2DIAA 1OXYA 2IPUG 3SDXE 3FQRA 3KPRD 2WYHA 3MJ8A 1CL7H 5T5NG 1NGYA 3S3DB 5AB9A 1JHLH 2Y3AA 3F3HA 5D2NC 3VE0A 2QSTA 4AKPA 1YEIL 4PRPE 3DDFA 3VH8B 1XGQA 2KQNA 4PRDA 2WK2A 3L1EA 1WBZB 1BMZA 3OKOB 3L3GA 1PY4A 4ZK8A 3ZDWA 4YC2B 1KBWA 1A22B 3DARA 4R96B 4IDLA 2Q1EA 3IGUA 3VM7A 5H37A 2R29A 5DRWA 4OI8A 1L9MA 3S35X 3MRFA 4AYFB 2AF2A 4ZFQA 1VSCA 3RPIB 2W0PA 5L2JB 3EYQC 4GKOA 5C97A 4WW1A 2Y1VA 3CC5B 2WWMD 4FQJH 4GNKB 5FUZL 5KS9B 5J1TC 3FO9B 3VXMB 3ZKND 1EZVX 2P4AB 5AG9A 5DTFA 3KWVA 1Z9SB 4G6AC 35C8L 1WITA 3NCMA 1BXUA 1OV8A 4CDHA 4OZIB 3LMJH 2ZSVB 1SEQL 3LS5H 2APWA 4LF3A 1T1YA 3AJ7A 4L3EB 4HMDA 3NJGA 5DHYA 4E42B 2X4PB 1JZEA 4Y4FA 4ZUUB 4B97A 3GJFB 3DV4A 2DW5A 1YNLL 3DROB 4R6UA 4W9HC 1D7DA 3KYKH 1RFDH 3MV7A 4KFZC 4Z1PA 2FR4A 1JGEA 1HIMH 3CX2A 4XMZA 5E94B 1YZZA 1U8LB 2V5RA 1JXJA 2Y1YA 3H8NA 5CFAA 5JXAL 2VDPH 4GKZA 4IKJA 4WWKD 4XCCL 5A1AA 1TVHB 1C5DB 2ZKHL 3A47A 1Z9MA 4DQAA 5E9AA 4TV3A 2NY6B 4Y9GA 5FUCC 2WHVA 3B9EA 1KLUB 5GZOD 3SJVA 3UMTA 4BZ2L 1SHXA 2HTKD 5DEFA 2OR9H 5F6IB 5HHPA 2F54D 3ARSA 1TO4A 3NPSB 5K69A 1LMIA 5JNYB 1EFXB 3DPBB 5G5DA 3ZDYE 4F92B 3L08A 1XL6A 4HAGA 3QDMA 1FO0L 2Z6FA 3GS7A 3KNBA 1BCIA 3NRQA 1U4FA 5AFAA 5AVYB 2C9UA 3O2VL 2CDFA 1JPSH 2WLIA 2HFEA 1DBBL 4AH2B 1OQXA 1QRNE 2ATKA 3BKCL 5EO1B 3I02A 2HT3C 4IOIB 4KQ0A 2WXIA 3C8KA 1G84A 5GRZA 2VZVA 3TBVA 3KCWA 3ZKXC 3HE6A 1AH1A 4DKFL 3TO4B 4RGMC 3MBEC 4HLEA 3H7BA 5GSRB 3BIAX 4XP4H 3ZTEA 1K3IA 1KEGL 5DFWH 4K9EL 4OTXH 2WUBH 1RUQH 1DDHA 2OS7A 1PX4A 1T21A 1U8KB 4TNFA 4ZODA 4ES9A 4ZD3H 2VERA 1U8QA 3FT0A 1DYZA 1ZT1B 4P5TB 4N2LA 4UQAA 4WHTA 1VADB 3WIFA 2NY5H 2PWEA 3F6JA 3PF2A 1XCXA 2FJFB 1EVUA 1A4CA 5PAZA 3SKNA 3G6JB 2HRPL 3T1FB 3W3BA 5I1DB 3JWDL 4PWFA 4AIEA 2CA4A 2ZOLA 2F8XC 5EO9A 2F1BA 5H2BA 3T1FA 5IW3A 3T77A 2CKBB 3RX9A 5TFSH 2J1XA 5D72L 1JXGA 4UOQA 4CC4C 1CYGA 3WEBA 2Z7WA 3OMIB 2BH0A 5KBKA 2VR9A 1M6OB 2HLEB 1NKOA 3VD3A 2K4WA 1JV5B 4GQ9L 5MP6H 2GK0B 4G5AA 4AM0Q 1DUZA 5JIKA 3U4EA 2IANE 4PS4L 1IFRA 5AVSB 3EGDB 5L6YL 1FL3B 2ED7A 3BVWA 3L4TA 3MSPA 1BLIA 2F5BH 3FUEA 3P30L 4AQ8C 1LK2A 1ZHNA 4GT0A 3DGGA 2ZOKA 4JRYD 4X8GA 2AQNA 3NFNA 3NCCB 4NO3B 3ELAT 1AC6A 4Z6AT 4L9LC 1H3VA 2IGLA 3IAGC 2HWZH 2XRAL 1SY6A 2VM9A 1CR9H 3IE4A 5KBLA 3TZVA 2F61A 1X5ZA 2YLHA 4ONHB 4LDCA 1GZQB 1YEFH 4KV5F 4AE0A 1OCCB 3UO1H 3LKQA 2E5EA 5E8EB 3T8XB 1M1SA 2W95A 3CFCH 2F19L 1E40A 1TVHA 4MS6A 1KIRB 2F08A 5D8JH 3FJTA 2VC2B 4GW4A 3NSFA 1OTUC 1TZIB 1MNNA 3MRGA 4NFCA 2AEPL 2MH4A 3IJSB 5A6IA 1MVUA 3WFDL 4PVNA 4U1SB 5E2JA 3OKLA 4HP5A 4QGTA 4Q9RH 1PZUB 1OSZA 4HIHB 5J13C 3WIIL 1WE5A 3ZMNA 2DDQH 2R56H 3IDIB 4MD5A 4PR5B 3GTNA 4EN2A 4HV8A 2IG2H 5CBAA 1HSAA 4KMTL 4WSKA 1UA7A 3WE6A 2X4SB 3ASNB 1OGSA 3Q8CA 2X2HA 2BX5A 1BGXH 4Y16A 1CBJA 4BBWA 4LHUG 3FU7B 3ARBC 5TH2B 4J27A 3IDYC 4XVUC 2HLAB 3LD8C 2W9LA 3AQZA 5EU3A 1WAAA 5IQ7L 4MRBA 2E9BA 4TLKA 2WIMA 5FIEA 3LPWA 3H9SD 1YNTA 3JSSA 2WSDA 3JWNG 3RAJH 2G0KA 2F7PA 5CEZE 2NX5E 2CRYA 2V8MA 1ADWA 2JCCE 3OB0K 3ZMEA 4OVVA 3ATEA 1A7PL 1RHHA 3R06A 4PRNB 4GW5A 1OAUL 1SLUA 2MQ3A 2ICWA 1UJ3C 5TDOB 2BVOA 4BKTC 1JF6A 3C5SA 2X4SA 1KCBA 3VI3A 1PIGA 5IBTL 5KYNA 1GZPA 2F54E 3ESUF 2D3JA 1KB9J 4ZUWA 3VQMA 2Z0UA 3ZOAA 4D3CH 1UEMA 1IC5H 2YAFA 3F7PC 1GKEA 3MJ9H 3K5SA 1G7IB 3HC0B 4K07A 1FDLH 2R0KH 3N85L 2R4RL 1SDDB 4J1UB 2DWDA 1TEFA 3MQIA 1JGDA 3ZX1A 1FG9C 1JG9A 4ATTA 4C59B 3FU8A 1JFQH 1YYLH 3Q6FB 5D70H 3QDHA 1YCSA 4P4RB 5BVJB 2H3NB 4HG4J 4GIPD 4JZOA 4KY1L 1DLHA 2ZNWA 5AUMB 3FB7A 4BWTA 2H1PL 1I8LC 3MNVB 3H9HB 1HHHB 4Z23A 3L6FA 5KANI 2R1YB 2YN5A 4UILL 1BPLB 4X6CB 1H8NA 1P6FA 3CZFA 3CXFA 5BRZD 3VD1A 3HKZA 5HHXH 1HEJC 5EA0L 3AB0C 5AENA 2O61B 1BQKA 3ZE1E 1QUNB 1OGAE 3OJDB 1QFOA 3ULUH 5EMYA 1MNUH 2C9QA 2N1KA 5I1HL 2YD7A 5GGVY 2F9BT 4TLSA 2AI0H 2FD6H 4CMHB 2Z31B 4UMGA 4NO0D 4C47A 2OMUA 5L8KB 4GKNB 3QNXA 3QIWB 3PWLB 5B3SB 4UNUA 2VLRB 3KYMB 1A6ZA 4BCYA 2WUCH 3THML 4FQ1L 1AG0A 1W91A 1NGZB 1X5YA 1M6OA 1PD0A 1R1CA 1K6QL 3PHAA 1LO2H 2IDFA 3GMRA 3QISA 1IEAB 4ZNCD 2P5ED 1A65A 5IOKA 2B2XH 3QORD 2QKSA 3EIFA 1YNKL 1B88A 1S8DB 5KSBB 1NBVL 4UT9A 43CAB 4NOFA 2H0EA 3TBTB 4KJPC 3VD4A 3LZOA 5CN1A 1QBML 4DCQA 3VYNA 1M7UA 2K8MA 3R7QA 1YNTF 3O0RH 5HXMA 5AW2B 4LOVA 5LHDA 5JXEA 5IFJB 3QR2A 1GGTA 2ZX5A 3CG8A 4LL1A 1UWEH 1JL8A 1ZLUK 3CH1B 4NQTA 4M6ML 1W15A 1WT5A 1XIWC 3RJOA 2IALB 3MR9B 1ZTXH 1TZ8A 5IVXF 4XCFH 1NEUA 1DLFL 2MQGA 5A40E 1AQKL 2OMNA 4H20H 4HOXA 1F6AA 4BCZA 3QCVL 3K6OA 4LXFA 4MS8D 4OCYH 4G6JL 2WJ7A 3WCYA 2DQFA 4QR7A 4OQTH 3RGVD 2V2XA 3BVNA 4MB4A 1G43A 1SM3H 4OY9A 4LQFH 3RIFK 3GXDA 1AC0A 2ZKYA 3F8UB 5JYLA 3S5LG 1MJ8L 2ZUVA 1Q0EA 2QQNL 3KJ6L 1U8PB 1UFGA 3ORJA 4PWGA 2Y2WA 1N68A 4MHHI 2NLJA 2E9WA 3DV6A 1M53A 5IV2B 2F74B 1SY6H 2J5LC 4ODXB 5KJRH 2AQ2A 2XX0A 4KKAC 4DPRA 2VDRB 5HJBA 1SUHA 2EVHA 2WC7A 2KT6A 2AJSH 4HUMB 1AOZA 1A6WH 4O4YL 1E7VA 2GCYB 2FO4B 2WTOA 3QDJA 3QHFH 2VXSL 1AHWC 5FOJA 5CCHE 3QULB 3VXUA 3RVUD 5I0ZA 2MCG1 3TTYA 1DO5A 4F37K 3FB6B 5IVXB 1R5WB 1IQWH 1BOGB 3GZKA 3LEXB 4M5YH 1ZLVH 4MNQB 3O2DA 4Q4IA 1XXFC 2X1PA 3X12B 3HIZA 4NRYB 4JY6A 3RNKB 1SJHB 1G5GA 3TJEH 1HQ4B 4HJ0C 1YY9C 4P23D 2DLFH 3B2VL 4DESA 3WEMA 4UT6L 1HHKA 2VJ0A 3ARFA 4J8RA 3B6SA 3LNDA 2NT0A 5DRZB 2ZPKH 4U1SA 3ZZ1A 2ZUYA 2CHDA 3G5XB 3POHA 3V4VL 3HNSH 5E4AA 1CXHA 4X0NA 3WE1A 2OK0L 1VERA 4HEMA 3ATDA 1NANH 3BDYL 4BDVB 3QFDA 2A73B 3LVTA 5HVWA 3HUJF 4NOBA 1JRHL 4GUPA 1NAMA 1NIFA 4MD4A 1E4WH 3EUUA 4IDJH 5KOVC 5J9PA 4BELD 2PTTA 4KUZL 4TL4A 3DOHA 2EDQA 3OAYK 5IEHA 2E0PA 1THCA 1WWCA 4ZUVB 3WMQA 1JZGA 4XRCA 1CFBA 2NZIA 4OLZH 1F4WH 1F13A 3PWPA 4HKBA 5CJQH 1V7NL 1BXAA 6PAZA 2E7HA 4ZMAT 4DJMA 4Z9KB 2R4SH 1RIHL 1KXVC 2VOTA 5EEUA 2JKWA 3VFRA 2XN9B 2APSA 4MMZC 2PYEE 1CXKA 2Q86A 2AEIT 3RWGA 3GMLA 4XNQB 5F7HA 4KVNL 1Z9OA 2NDGA 3SODB 5JHDB 4B5ZA 2JJUA 3ZUNC 2PR4L 1HE8A 2LABA 4X6EB 2YRLA 3H4FA 1NCTA 2VDRL 3GSQB 2RD0A 5E08H 3CZNA 4G71B 3OGCB 1E4JA 1DVQA 4RA3A 3MXVL 4MSWB 1EDQA 4HQQL 1HCYA 1BJ1H 2DKUA 6FABL 1FFOB 1F3JA 4M7ZB 5IK3A 3ZDYB 3T2QA 4ETQA 2Z0BA 3CFEB 4MHHG 4BKLB 1QFWI 3FTUA 1J05A 2H2SC 3MFFB 4NDMA 5IB3A 1MCPL 4Y88A 4GPVA 2H32H 5IHZA 4M48H 4EPSA 5SWSD 2WOBA 3GQFA 3NCYS 3EYVB 4WHTB 1ZLSH 1SYSA 1M57B 3QUMH 1QX1A 1A6TA 3AADB 5AW7B 1UACH 1AFVH 3L9RA 1EO8L 2J43A 2ZICA 3BE1H 1UHVA 4PRAA 4OZHA 4OAWA 1GYAA 3L4CA 3LQAH 2Q3XA 4HLZG 1YY8B 2J2ZA 2XN9A 3LRLA 1HCVA 4M02A 5F7FA 1FIEA 4D9LH 3HG1A 4OJYA 4RESB 1FYTA 3FONA 3EG9A 5F1SA 5AG8A 1PSKL 2Z8SA 1OE1A 2FK9A 5GGTH 3NTCL 2P3YA 1NGQH 4NRZA 3QXAA 1JJUA 2H4EA 2L4OA 4GT7A 5HJ3A 4L3EE 2XKUA 3TFBA 2IAMA 3GI9L 4OZIE 1BLNB 2XBDA 1MJ7H 4TVPE 1UVQA 1TYRA 3VFGH 3WHXA 4XC1L 3QDAA 1JZ2A 4FTVA 4IJ3C 3DJ9A 4OLVH 4FEIA 3LDBC 4U3CA 1L6ZA 1JZHA 1WUNT 1ZVYA 2QSCH 3TIDA 2PWFA 1WAAF 5EOTB 3MUJA 4I1RA 3K5RA 1BMGA 2UZPA 1E5YA 5EH1A 1AY1L 3UTZB 3WENA 3SBQA 1E3ZA 4NENA 5JOPD 2WINB 1RVFL 2C1PA 3UAFA 1FVDB 4MQSB 4KXCA 2GJPA 4HS8L 1L5GB 3AC0A 3MBEA 4MQXC 2WW8A 1ZT7B 4XX1G 3NGBC 4H0LC 3WY2A 1GJWA 5C09A 2R23B 3DVGA 5HHOB 1J1PH 1RJLB 3GRWA 3BD3A 4PMEA 3WY4A 4KPHL 1AO7E 4F9PC 2YFOA 1QFWH 2R23A 4AQOA 5CGYC 5H4YA 1C8PA 4U1MB 1GTFA 1KJ3L 3OWEA 2BXYA 5DEGA 2YGVA 3IF1A 3QSKB 5EBWB 4ZMVA 2ZCHH 4MZRA 4LPWA 1WZ1H 2BJMH 4IMKA 3DNKA 1BZ7B 3EBHA 4PY8J 1MPAL 3FC8A 3TN0C 4BE6A 5CCJA 1NKRA 1QR1A 3QHTC 4NZFA 3MOBL 1DN0B 1OQOA 4FTVB 2BSTA 1S5IL 5ESAB 4M7LH 5CCKH 4MDJA 2R83A 4Q7DA 3WMPA 4ABVA 4Z7QB 4WWKB 1EA9C 4RGNE 5JHDD 2DEYX 3BJ91 2ITEA 2WLJA 4IRSC 4K71B 1N5YL 3GSNA 4HJTA 2BVQA 2BRRL 2NNXA 3L95A 1IU1A 4WQOA 3L3GB 4XO3A 5KYYB 5D1XD 4YXHH 5C0RL 3W1ZA 1EHXA 4N2MA 5F7NC 4UV7H 3AWFA 4L4TA 4R4FL 4DK3A 4TQIA 5IVXE 1PYWA 2N4IA 3A22A 5JR1H 3P4OB 2DWYA 1NGYB 5J3HC 1VJSA 4GRLD 3G5ZA 3WXWH 1MHHA 4J2QA 5LUMA 3T0EA 5BRZB 4NQEA 2CBOA 3QORA 4JPSA 4N87A 1IAOB 2QTEA 2I27N 1KPUB 4YDNA 4LFHG 2R7EA 4IJTA 1U2HA 1FO0B 4WEEA 5EDSA 1YPZB 3FYEB 3WD5H 5DD3H 3IBOA 4A04A 2JJVA 1VFAB 4K7FB 1NBCA 2IV9A 3GRWH 2PTVA 1FHGA 2CDGA 2ZOWA 2H0FA 2IF7A 2UX7A 4ZAKB 1IAII 1C7SA 2YEZB 6TAAA 4LSRL 3F7RA 4DP2X 5H37H 2YWYA 3Q2NA 5IF0A 2VSCA 1IQDA 1BXVA 4LGSB 3GBDA 4X8JB 1J48A 4EUPG 2BOBB 3D30A 5EWIH 3HPJA 4EIGB 3LHPL 3H6AA 4O2FA 1KB5H 3UH8A 4R4BA 2CO7B 5CZXC 4XNQA 3QAZC 1R3LA 4IRJA 4MDIB 5IW1B 3TCXA 4YL4A 1J1OL 2QSVA 1R3LB 4JMNA 3H7LA 3OZ9H 3EDDA 1IGJB 4F3FA 4N68A 1AIFA 1JNNL 3FQUA 3SDAD 3DURB 3T0VA 4ZSOB 3UYOD 1YYCA 1ICTA 3T6WA 3QJQB 1YJDC 5JIIA 5ITFB 1NC2B 2ZCLL 5AAMC 1D5RA 3U4BH 4HS6B 4LAQL 4JM2C 1OAJA 4OD2B 4Y5VC 5GZND 2VLJB 1EXUA 2NT1A 3K81A 2ENPA 3W11C 4HVBA 4WUUD 2LLGA 2CDGB 4Z8FH 4PRHB 5EIIB 3CJJA 1EO5A 3BISA 4LCIL 4FQCL 4RFOL 1I7RB 5GSVB 4RAVA 3NJXA 4TULL 1FO0A 4OGZA 2EO9A 4RFEA 1BQRA 1KPUA 1UASA 1WZAA 1OE2A 1PVHA 1BEXA 3APNA 4GQQA 2O5XH 1EJ8A 4FYTA 5T1KA 1HVXA 1TJHH 3A23A 2VRKA 2EC8A 3QQNA 5F1OB 3X13A 5ID0A 3GMOA 4M6OL 4A2GA 4KTGA 3D4CA 1O5DT 2IOOA 3GBEA 1CLZL 4BWUA 3RP1A 1OARL 3S3PA 1MCDA 3QIWD 3HNTL 1E5AA 3W9EB 3BO8B 5CLWA 5HYQA 3L3HA 4FQHB 1A9BB 5IW6A 1BZEA 4QT5B 1Z3GL 4R7VA 2HRGA 4R90H 4NQUA 3WLWC 2XN1A 1OF0A 2BNQA 5ISZD 2LE9A 1J8HB 4YQXH 3RUGF 3CVDA 4N0FB 3D7PA 2X6AA 4MXWL 5FCSH 1PLCA 5D1XB 3RL2A 4DGVL 4MXVE 3GSVB 5ABDE 3SDAC 2ADIA 4XNXL 1U3ZA 1RQ5A 1H19A 2MFNA 4X6DE 5LWYH 1JD9A 2Z91A 2R9HC 1MW3A 1YSOA 3FTSA 2CSPA 3BPCB 2XG5B 3DHPA 3M17A 1RUAH 5J0BA 5GRUL 1OAXH 3MRQB 2F7IA 4KXZH 3MRPA 5KSAA 1JGLL 1XSIA 1MWAB 3TBCA 8FABA 1FCGA 3UBGA 1EK3A 3RLSA 2EUWA 3WUWA 1Z9LA 1KELH 1N70A 1RZGA 4IOSD 4L8SC 1LD9B 3NOIA 32C2B 5MENE 3H42L 4TUJB 1LJMA 2ZUQB 3CPLB 3BVTA 1PEWA 3HC4H 1AQMA 1UB5A 2JIXA 3QZPA 1AZNA 4K55A 4G7QB 2GITA 4OGQC 3VH8A 1KCKA 4E5XA 3T9WA 4R7DA 12E8L 4EN3A 4PVMA 5CINH 3LQZB 4NQCD 2ZSWA 5SWZB 1KCLA 2WJ5A 4B6ZA 1FVDA 4EN3B 5KZCD 3KAAA 3F58H 1SXCA 2IEPA 1HJBC 2VH5L 4N20A 4NKIH 5JIHA 3TV3H 4QNPE 3AT0A 3Q6GH 5E6IC 3FSOA 3FUJA 1KPRA 5JHMA 3S88H 4X6DA 4HIEA 4P2QD 3L9YA 3TT1L 2XQBH 4NGHL 4LBEA 4WI9A 3LSOA 1EANA 2YZ8A 4WTWA 1KPVA 4PWHA 3TM6A 2X28A 4AYMC 3GMRB 4I3SH 2IPTH 4PD4K 4GINA 1HZHL 5T3XL 2I24N 1JXFA 1XGYH 4JO1H 5IHWA 4ZXBD 3HG1D 4PWKA 4KTEL 5EF1A 3VWJA 1KENH 4HEME 1G9HA 3K2UL 3Q2LA 1I82A 4M93C 1W9XA 2WOYA 3AQXA 1KMGA 5G4OA 2OQJB 3DTDA 4X9HA 5J4MA 2OSXA 4NLHA 4YGAB 2B14A 3DYPA 2ATPB 4C57C 4G8EA 5CJOH 2X87A 4K8RC 2GJZA 1K85A 1MI5A 1MRDH 1HEZA 2HFTA 3CHRA 4GRLC 4HKJA 2H32A 5HDRA 3VI3F 3DRQB 4PJAE 4XN4A 3MLZL 5C0BD 1U30A 5JMRA 3CLFH 5ECJE 3NMEA 1HHHA 3KJ4C 3RVWD 4POZC 5DUBA 5IESL 1OAZH 2WXHA 3DYMA 2XWRA 3A21A 1CFNA 1NMCB 4ECNA 2H3NA 4JANB 2WZPD 4NB7A 5JUEL 3FCSB 5D6DA 3ECVA 3MNWA 1K8IA 3RY6A 3MV11 5B7MA 3H3PH 3QK0A 3OWRA 4MSWA 2WAHA 4P5TA 1HKLL 3K4ZA 2XA3A 5CSZB 4XN5A 3ARED 2YR3A 2P47B 2P5WE 4GG6B 1I9RH 2D3VA 5GRJH 3W2DH 3PHOB 2I9LB 1CGUA 4PW4A 4F80A 5DD1L 3FH8A 2FEDD 1BECA 2VLJA 2FX9L 5DGQA 2ATKB 5EO1A 2B4CL 2W07A 2MCAA 5C0AE 3RWGB 1YEKL 3KWWA 3PWUA 2EH8L 3IB4A 3VJ6B 2ZXAA 3GSNH 4ZDHA 5B39G 5C71A 4UQIM 4F7CA 1TZGL 3NACL 1CDGA 4Z0BL 5I75B 3NIDE 5G5DB 3HPJB 3SGKC 4MCZA 5MEPB 1I9IL 4JGMA 1JYWA 1RU9H 2BOBA 2VR8A 1IGTB 3FTZA 5DC0A 2X40A 2QKIA 1GHFH 4OZGA 4M8VA 2LVCA 4R2GB 1F4XH 3FUIA 5F0PB 5LXGL 4R4BB 1YNTB 1KYFA 2ZX6A 3F7LA 5CR1A 3CQFA 4YS4A 3U2SA 4U4IA 4A7QA 9CGTA 5JO5B 4RWHA 3W11D 3BQUC 2O4EA 3QI9C 4HBCL 1HNYA 1DBMH 2I5YH 2A73A 3H2PA 3B8YA 1TLKA 2C5DC 4HPOL 3WFCL 1MH5A 2HT4D 2NR6C 1ZGLP 4QIRA 4AEHL 4PJHF 3LQAC 3ROLB 1WSST 3E2HB 5DMJB 4UZGA 1RULL 4Y5XC 2JFCA 5HGAA 3PHSA 3T0EB 4MJ5B 5JHLA 5FM8A 2RGSA 5LBSA 3ATBA 4JFYB 1XF1A 3MV8A 3NCJH 2OMZB 5CEXB 4HXBH 5IMLA 1WVZA 3G5ZB 5GGQL 4RGND 4OIIL 1SJHA 4A7VA 2GTWB 3NJNA 4FYSA 5ELIA 2AJYH 2AXGB 3RBGA 2DD8H 1HNFA 3GXFA 5AEAA 4W6WB 3FZUC 3VXUB 2EIKB 3QP3A 3D3VA 2CK0H 3QBTB 1TJGL 3RPIA 4ESKA 3IDJA 4ZUTB 3C12A 2CLZB 4C56A 1G94A 1JWSB 1N64H 2WQUA 2IGFL 3IPEA 3VSUA 5ERWB 4OB5L 3KVDD 1U41A 2JTYA 4A7TA 5E8EA 3T8XA 3IJYA 4PV8B 1I8MB 5EBGA 2XN0A 4IEFA 3VDBA 2WN2A 3QJUB 2B16A 3GDCA 5ESQB 1RZKC 3E0GA 5FM5M 4N6RB 5F21B 4IRZH 1U21A 2NMSA 5CD5D 1KYDA 1I9JL 3OXSB 2DYPD 3UTPE 3UPRB 3QQDA 3VFSA 1I8AA 3WIHL 1T89C 3EJCA 2WO2B 4OLUH 2WIIB 3D3VE 4KK8C 4NHUB 1K2DB 4UM8A 1D5MA 2G3ZA 4MQ7A 3SDXF 4RISH 3O81A 1QSFB 2E9GA 4N2DA 5ADPL 3AS1A 3HA0A 5KN5A 1E9OB 5C07B 2EVJA 1SMAA 3L2NA 2IXQA 2EUVA 4WFFE 4Y89A 2Z1KA 4YAQA 2BFGA 1HZKA 4X4MA 4P2OA 4UQEA 5GZNA 3V4PH 3W9DB 5J89A 2V37A 3E8UL 1E4XH 1MFBH 3B83A 4U1LA 4W6YB 1ZS2A 4FJZA 4XVTH 1CGSH 4WKXA 2IIJA 2BWDA 2X0VA 3UBHA 3GSUA 3O3AA 3ARXA 4PRID 5A16A 3TBTA 1L0PA 2XJLA 3VWKD 2WQ8A 1B0GB 5DJXA 1ECZA 2ESVE 4HUVA 1HINL 2COQA 4GW1B 3IETB 4EZKA 2Q6WB 4KHXH 3LCYA 3QQ4B 3S96A 5DQ9A 3AREC 3BWSA 2Z64C 3VGGA 3HE7D 3WN5C 5HYJA 1C5CH 1LDSA 3ARVA 3UZVA 4GMSH 3JTSA 3VXNA 2OTPA 1OF2A 3MCYA 4GP8B 4B9JA 4XVUD 4IS6B 1ET7A 4IOIA 4G5ZL 4FN0A 1CDUA 1XGRA 3MGOB 3KYAA 1F90H 4UTCA 5MERA 2BNQD 4AVKA 4E0RA 1N4XL 2YD8A 5GS3A 4JGUA 1YMHA 3AS0A 4OGYH 5EBMA 1XF4B 4IRZA 4GRMA 3DDGA 2JWYA 1E90A 2WKOA 4AL8C 4RX4A 1MRFH 1NCOA 3OKMA 2GBAA 5HHPB 4LARH 3HMWL 3ZDYF 4YSTA 4AMWA 3QQ4A 4KX8A 2N59A 4Q0XH 4F33A 4X98B 1B2YA 2H6PA 3LX9A 2GJ6B 4FFWC 4JZOB 2WXFA 4PRAB 1D5XB 1FZKA 2VC2H 4NYLB 3RVVC 1BYNA 2VZUA 3Q6FA 1R3HA 4FCAA 3GSUB 4NM4H 1Q9LA 2BSRB 1CE1L 2W5PA 3DMMB 5LGHL 2IMNA 3MV7D 4FQQB 2EDEA 5AKSA 4MTMA 2F7RA 1WC7B 1KDJA 1GIGL 1PX8A 1X5IA 3ZYIA 5CGTA 5ADOL 4NHCL 1WFMA 5HI4D 3QRFM 1EJOL 4Z3TA 1IVTA 2XVBA 3S5YA 4TQ8A 4XOBA 5GS0L 5K9QI 4ZX4A 1XH3B 5HHNA 1EJOH 2OMXB 3IFOA 4JZJB 4IIQB 3A4FA 3OMNB 3ME0A 4PJFF 4ETYA 3IVKB 4J8QA 4QRTA 5FYLE 5BNXD 3GF8A 1UH4A 4JKPH 3FRUB 2BVOB 1XAKA 1CGTA 3V5DA 3O6FD 4P9MH 1K4CB 2DS4A 3KYNA 4FI8A 1I7ZB 2CDEA 3QEHB 4UNTA 2FIKA 4OCRH 1F97A 4JR9H 1SN0A 4RA0C 5JOFB 3GUFA 5HY9A 3PREA 3U2JA 3O6KL 4K7PL 4FQXB 1BZQK 4MMYA 3X3FL 4HEPG 3WTUA 5LCVH 3BAYA 1NCAL 2YUVA 4ZFZB 4ENED 3QJTB 3SGJC 4B9YA 3HMWH 5D7JD 4QHUB 3QDGB 3VWJD 3BUYA 1FN4B 1VAHA 3QB7C 3SCMC 3V5KA 2H0PA 4YJZL 1IKNA 2DJSA 4OGYL 2NYYC 2A6KA 2P8LA 1N5AB 5I1JL 1NFDA 4XR8C 3ATFA 3QWRA 1EEZB 2PPDA 5HDBB 4Y1TA 2COVD 1B4JH 5JDSB 1N67A 3SJVE 2Z92A 1A25A 1QNZH 4U0RC 1G6RH 4Z77B 1QFUL 4FQLL 4PJXA 1E9PB 5IVXA 2VRQA 5T33L 2FT7A 3NCBB 5AYTA 4YDVB 2HFFA 3C08H 4KTDH 4R84A 4Z7WA 3J8F7 2IDCA 1TZIA 4Y1AA 2A6IB 4JAMB 3IKCA 4M3JA 5TF1L 3TVMB 3RX7A 3JWNE 3MPCA 4MAYB 5EU5A 1XCQA 1X7TA 4XGZB 1JZDC 5FDWA 3WNIA 3WHE1 4YDIL 1NFKA 1E4XL 2Q76A 1KUMA 2PUQT 1T66D 2F1AA 5TTRA 4G83A 5EBLB 2ENJA 2F74A 4ODXA 3ZTJG 1EAOA 5IMKB 4LPCA 2NLJB 4PJBA 4B5EA 2V9TA 3KWWB 4Y2NA 5F7UA 1W80A 4F9PA 1TVBB 1FFNA 1E42A 1U8JB 3P2BA 4FQXD 3UAJD 4O9HL 3V6BR 1URZA 4CN6A 4TQEH 1X3DA 2O6FA 2PLTA 3VMPA 4XE5B 5FFGA 3GIZH 4BSJA 4CMMB 5I15H 1F11A 2Y5QA 4B9FA 2A83A 5LBSH 4APQB 5AKVA 4J3VA 1WYJA 5DA0B 4Z7NF 2Z7UA 2B1HL 1BW8A 3B2UC 3QR1A 2EYTA 3MCKB 4UMSA 5FCUL 3F7VA 2CM5A 4XPBL 3QO0A 3IDMA 4PJ5A 4PJXB 3V6OE 4KKAD 3D9AL 4NZTL 5DS2A 5EO9B 5H2BB 5C08B 5TD4A 4OLEA 4E9SA 3QO0B 2K7PA 1TJGH 2BVPA 4NWUL 1XQ4A 4MCYB 2PO6C 3DOIA 5DQDL 5KVDL 1VZGA 2EJ1A 1INEL 3NZ8A 3WLBA 4DN3L 2ITFA 5LGYA 3F2LA 2RBLA 2DD8L 1J9QA 2WMPA 2OYPA 2HG5A 3FRPA 4LVHC 2Z31A 2ZOTA 2CHNA 5GGQH 3UAAA 3ZTJH 4LCWB 4YHPA 2X9YA 4AH2A 1ZAGA 1TDQA 1JN6A 1N19A 4XPFH 5B1JC 2CXGA 4PI0A 4IU2B 5GRVL 2CA3A 2V17H 3CHQA 1REIA 1DQJA 5F8QC 3WFCH 2BP0B 4WZ9A 2EIMB 3ML8A 1PQZB 3B7YA 4BQ6A 3SGJA 1LE5B 5EPMA 1GL4B 4TNWF 5D7IB 1T1XA 4G9DA 2PMZA 4ZUSB 4WKZA 3RTQC 3TPUB 5BVJA 2JE8A 1RD6A 1K5WA 2BNRA 1K8DB 2DQEL 2BP5M 2VLLB 1H3WM 3QNZA 1IAKA 4FNRA 2BIHA 3IFOB 2OJZH 4OJDH 5L0QB 4GUCA 3HBGA 4GS7B 1R3KB 5ICXA 3SQBA 2ISDA 3VXUD 4BZYA 1GGCH 3V55A 3CZEA 3KVQA 4BRJA 3BKML 1NDGA 4ISVB 1QYGL 5I17A 2NDFA 2X4UB 1TZGH 3NACH 4QF1A 3FQNA 1OCOB 3KPTA 1BDYA 3GSNL 2CKNA 1MSPA 4RQQB 4V1DB 3OAZK 5GXBB 2CBQA 1YEKH 1WAPA 1ZMYA 1J0ZA 1OZTG 4JFSA 3AU0A 3O0LA 4LLVA 4YZFE 4P23B 3RJQB 2PNDA 1WS7A 2EZ0D 2UX6A 5C0AB 4WK4B 4GFTB 4GXVL 4NO2B 2MJWA 3DLQR 3G04B 4NT6A 1DVFD 3BEWB 5FW8A 4MXQD 2EXTA 3QHZH 3V7AE 2VSMB 1KBKA 1E8YA 4N85A 1U3YA 1BFSA 1MIEL 1TKWB 1WHOA 3F85A 3R06B 4H8HA 4PRNA 4WY7H 3T0XA 2Y4SA 5GGVL 4AVJA 1JPFA 3M17B 4J3WA 5DJ0B 2R8SL 3EO9H 3RFRA 3QUYA 4QPEA 5JYMA 2VISB 3LNIA 4M4RA 2CRIA 1MJUL 2BLFA 1C8QA 4MYPA 4JO8A 4S1RH 2MCPL 4E2OA 3VXRD 4JK0D 1PL3A 2IDTA 5E6YA 2C3WA 3JT2A 1N10A 3FU9A 1R5VA 1K4CA 1S7WB 1BVLB 1OF2B 3ECQA 4ATWA 4Y16B 3STZA 1HFUA 4RDQG 1QP1A 5DI8B 5JLZA 1WEJL 1A2YA 1IL1B 1HL5A 2VDKL 3CUPA 3QT2A 3ME0B 3IFNL 4KJPD 2X89D 3Q01A 3L3KB 5F7BA 3UEZA 3S96B 1FBIL 4OJAA 5FECA 5B38A 3MV01 2NNFA 4AQZA 4CSZA 4G8IB 5JA8B 4LDOB 2NUPA 1SUJA 2PW1B 3GJFH 4KJYA 5H8DA 1CYWA 4UBDC 2J88H 3L5IA 4TVPH 2P80A 4JFFB 4AZUA 4DIXA 2VDMB 5EUKB 3RFZA 5IBUB 1XR8B 1ZLDA 3CZGA 3QDJE 1KGWA 4MJHA 3KBPA 4WCYH 1DL7H 4ZFOL 2IXQB 4M43L 4C58B 1D9KA 3MFGB 1O9WA 2YBRA 1SXSA 5KVDE 3FNKA 3QWOA 3GI8L 3TV3L 1GTNA 1GY2A 5K9QG 4MQ7B 3EFOA 3UO8B 1S5HB 3AABA 3E1F1 1U93A 4HCIA 5AVVB 4NI6A 1RUPL 4UI2A 3VXMD 4AOFA 2HH0H 2D4FA 1KV7A 2B9BA 4HUKB 4QXUH 5KBNC 2GEEA 3JTTB 1JS4A 2MKLC 1WFJA 1IT9H 4ERSH 2P52A 3WN6A 5FGCB 3G6AB 4LEEA 4L4VE 4ZPVA 5ESQA 3EYOB 5BOPA 1FGNL 4PN6A 5K59E 3LEYL 3CMOH 3FFCA 3CDFA 5EU6E 3VI4B 3ULUD 4NKMA 4ODWB 3UGXA 5AZEH 3TYGH 1HYSC 3NFNB 4GMTL 1TYEB 3VXNB 1JWSA 1IGFH 1R46A 2J6EL 1JGLH 1RJYA 2MPAL 1OCWH 4YDJA 2AVFA 1W0WA 2E6QA 4QRRE 1TFHA 3RB7A 5I2IB 2KBGA 4IMLA 3BPLC 3ULVD 2C9VA 3BZ4B 4EXPX 3EHBB 3LEVH 3U48A 1IM3B 2FSDA 1YLBB 1J5IA 4KROC 1MCJA 4P2QB 1XSKA 4OI9A 1DQQB 4H8UA 1ZSDA 4QDGA 5ILTH 3LKPB 4KDWA 4R90L 1M71A 1MJJB 4FULA 3N06B 5E2UH 1F58L 5HI5D 3IGLA 2X7LA 3Q44A 4Z7VA 5I8OH 3ROLA 3IDMB 4PJ5B 3ES6A 3MO1B 2D2OA 2JI1A 3ABGA 2X09A 1YQ2A 5C9JB 5HTSA 5C0JA 2ERJC 3BOVA 2VUOA 1PS3A 1ZOXA 1MFUA 1T5WA 1ZY9A 5E8OB 5CSGA 3QQDB 3CK0L 5I24A 1B9KA 2VN4A 3FQWA 4FQCH 3GMNB 4L5FE 4RFOH 2NNCA 1TJIH 4QHKJ 3HC2A 4XMUA 2K4AA 3S34L 2ITDA 4P3DB 2D3NA 1OHQA 1Q1JH 4NKOA 4DTGL 3C2SA 4PRHE 5EBLA 4D0DA 2IWKA 4LAQH 4OLWH 5GS0D 1EX0A 2DLGA 4RGNC 1EBAA 1EFXA 3DPBA 3HMXH 3PWJA 1J5OL 3U30C 4JJ5B 5BO0D 5DLML 5AZ2H 5F72S 4UU9B 3SYQA 1QVOB 4ADJA 3NJIA 4JFED 2DM7A 2P5PA 2KC0A 5CJBA 1GR7A 2IH3B 1ZEAL 4DN4H 1F45A 1XCQB 4XGZA 3OZ9L 1PY9A 1ZIBA 3VD9A 1CD1A 3ROOA 1PIFA 3QUZB 3X1EA 4CBZA 4FL4B 1KC5H 2H45A 1IV8A 4X9FA 5DHYB 1RERA 2XU9A 1KB5L 4WO4C 1BG9A 4OM0L 2QHLA 1H3GA 4X5LA 4YOKA 1ORSB 3O6FC 5T1DH 2VDPB 1E9PA 2QADC 4KVCH 4LLWA 4TNVK 4E68A 1IKNC 4PJDA 3QIUA 4OF6A 2C1PB 3CFUA 1OALA 3F5WB 4XC3H 5LGJB 4LNVA 4YHIB 2IFGA 4XZUA 5IB4A 1A1OA 4WW1B 2IBGA 4YC2C 1IFGA 1YN7B 5DMIH 3VXOB 4OV6F 3D85D 2VDQB 5JO5A 2ZT9C 2NSQA 2YKKA 1YUHA 1V7MH 3IDXH 1RIUL 1FNEA 3BIKA 4G7YH 1ZA6B 2R59A 3WS6C 3K6SA 1FHNA 2QVMA 4QRRD 4HUUB 3CC5A 1T6VN 3KPRE 3P54A 2E4FA 3UC0H 4YFLI 1QWUA 2F53A 2H2PD 4KDTC 1JHTA 2ZJSL 4PJEB 4FFZL 1CLOL 3FN9A 2EDDA 2P1YA 1XSOA 2A74A 3WXWL 3L1GA 3Q1SL 4G1MB 3FH5A 4Y4KB 4NPKA 3PWUB 1YY8A 5LKNA 1AYOA 1G7HB 1Y1UA 3GHBH 3SE9L 5SWQA 1WS8A 3OZKA 4AMKL 4XBPA 5C0RH 2VDNH 1I8IA 1XB6A 2F18A 1RP9A 1A0QH 5E0QA 4DGUA 2BRRH 3ZE2E 2A5UA 3FT1A 1WLHA 2BNRD 3HCVB 3QPXH 4UWQB 5TQ0H 2DQGL 4KRPC 4TRPH 4ZNEE 5IBLD 3PXHA 2ZAGA 4K94C 1T04B 5D93C 1K4DB 1S5IH 3KLQA 3WEAA 2DBLH 3ARZA 3NA4A 3GPSA 2A1WL 5BRQA 4ETQB 1ACXA 1FZMB 1YA5A 3OHXA 3RWDB 3MMEB 2NY6C 3B9KC 1F3JB 1FFOA 2GB2A 2ZXEB 4UT7H 5LDSA 1MPAH 4EKJA 3S9DB 1PLBA 4P5KA 3QXVA 5I1GH 1W0YT 3VXPA 2ZCHL 3NFSH 4NQSA 4I5BA 3ARBD 1EMTL 3WIHA 4IYKA 1HOCB 3NPSC 4TVSa 2H3XC 3KPPA 4JRFA 4XNZC 5AWNL 4WJ5A 5DC4B 4LMQE 3EKCA 1XVSA 1XZ0A 4XP9L 3WSQL 5DJDA 3BSGA 1QFWL 2HVJB 3DJTA 4P5RA 3L4VA 1N2RA 3GMQA 1AD0A 4X98A 1URIA 4KPHH 4B3EA 1I4FB 2ATPA 2DJUA 3EJZC 2XNAA 2GIYA 4LOFA 3QI9D 4LCUA 4POYA 1AGBA 3F84A 3OKMB 4ORGB 4Y4HC 1EZSA 1NGXB 4FABH 4HS8H 3I6KA 4TXVB 5D7LD 5FOBB 2DTMH 4HF5H 4G1EA 5DC2A 4ZFGL 1KCUH 1RVFH 3ZIMA 1I3VA 4L5FL 1S7QB 5IMMB 5DS8B 1UJTA 1HT6A 3G5YB 3RIAF 4CC4A 2OL3H 4JFHE 3BEVB 1QSEE 4QXGH 1P7BA 4LEXH 4RGOL 3MCLH 4JN2B 4OCSL 3U0WH 1RZPA 3DETC 2PCPA 3ARRA 5DEJA 3TEXA 2IWEA 4HGWB 2FJGA 2X4OB 3FQXA 1V54B 2L3BA 5BS0D 1WBXB 2GI0A 3X3GH 4GW1A 2FCBA 5EUOB 5GGTL 4KXZI 3IDNA 1JZ5A 3L3IB 5J1AA 4JGNA 2WV3A 3PGDB 2WGXA 3RBSA 1KBGL 2IBZY 2X4QB 3P1VA 2Q3ZA 4GEIA 4Z3EA 3D0LA 4J6RL 2AJXL 4PRHA 4LPTA 3W0WA 3K71A 2J8UA 1ADQA 1NFDE 4P0DA 4P2OB 3E1ZA 4PCYA 3VD0A 3FFOA 1ZLSL 2JB6B 1J5CA 1NFIB 1UCTA 2VLRD 2V5SA 4I0KA 5D2LE 1XD0A 2XLLA 3GT6A 1BQHG 1DCLA 5F89B 5IMMA 1P2CA 5FYKU 3FTXA 4KJQC 2VDML 3U82B 3LV3B 4HX1A 1XZWA 5GRXG 5C0FA 1NBQA 1CT8B 3KPMA 1V3KA 3GZPA 4RSVA 4BH7B 5CZVL 4HQQH 3VGEA 4Y5VA 4UF7C 1H3TA 1PGRB 4X2UA 5E08L 4QTIH 4HULB 4JM4L 3DIFB 2BY1A 4JNXA 4FI7A 5KVFL 1UD4A 5KG9A 4GLRI 2PR4H 4CVZB 3UBXI 5E23A 3PGCB 5IGXL 4KVNH 1J5DA 1CU4H 3DX7B 1T6WA 2QTVA 4DOHE 3RL1B 4HD5A 5DJ6A 2BIMA 5C3TA 4IRJC 3PG2A 4N5EC 1RIHH 2O72A 5DEZA 2PYEB 1RMFH 2B1AH 3K4AA 2CLRB 1AXTH 5CP3A 2R0ZH 1V7NH 3CH1A 5CJQL 2WTPA 5B7EA 2APXA 4DK5A 2LFEA 4WWOA 2V8LA 2EDXA 5T1KD 3ARBB 1XBRA 1IEBA 1WA2X 4NNXA 4S10A 2R7EB 3DX1A 4GRWH 1JTOA 2ORBL 4IDJL 3INUH 4YNYA 3WFBL 4PJCF 4PGBA 2NZ1A 2CALA 5IHUL 3BZEA 1NCHA 1JRHH 1XDTT 4PJ8D 1OANA 3VFWB 1S8DA 5FDYA 1R5IB 1UM6L 1DQDH 1KSRA 3WYRA 3CQQA 3PP4L 2PETA 4AXWA 4L8CB 3FFDA 3T0DA 3K2KA 3VMNA 4Z7OB 3MNZB 1FJ1A 4HGKC 4F58H 3QIUC 2FYYA 4GOSA 4DGYL 4CVZA 1HXMB 2IH8A 1PLAA 1KB5A 4DZ8A 1Y1DA 1A64A 1QWHA 3S4SG 3TNNA 4Z76B 3PPEA 2PPAA 1J1XH 2NUTB 5BZWA 1XSJA 5FHBH 1NPNA 5ESAA 4F7TA 2Y36H 3NSDA 3AFLA 5JHLL 4AL8H 1BQUA 2CO1A 3TA3B 1IC0A 4EUPH 4UINH 3QA3A 4MAUL 2DQTH 1T4KA 3OSVA 3SDXA 1EGJH 5HI5C 1I85C 4UYPA 4EBQH 4NEHB 1C08A 3BHBA 4XZUB 3C6SB 1N0LA 2AJSL 3CZJA 4X4YA 3PGFL 4ELDA 2Z35B 2ZAIA 5GGRA 3ZHDA 3KDMA 4WGWB 1OP9A 2NW2A 1AZBA 1OGAA 2MIZA 3MJGX 1QTYT 3MCG1 2C4FU 3L3OC 4R0LB 3NH7H 2FBJL 2XVLA 3KPNA 4ZFFB 5BJTA 3DVNB 4JG9A 3KJ6H 4WFGE 1E27B 3QNYB 2W91A 2EUXA 2LAAA 2QEJA 2FX8L 3PABB 1DSWA 4R5TA 2WP3O 1K8IB 3CTTA 5FGCE 5IFAH 1UB6B 4J3SA 2P8PB 3BSZH 4OQTL 4E9QA 4TSCL 2D4DA 2NXZC 2B9AA 3QUMB 1XEDA 3OLGA 4BHUA 3DSFH 1TITA 2X1XR 2ZZUT 4XCFL 1CFNB 1J12A 5K9KB 3N9GH 3VFUB 5FYJU 4DGIH 4ZYKA 4YMPA 4HXAH 1Z3RA 4J6IA 3QEUB 4ZMZA 1RAMA 1E0OB 4ODSH 5KYYA 4PGDB 2K70A 1KJ2H 2GAZB 3BPOB 3NCYP 4ZXBA 3O0RL 3M45A 2VE6A 3FL7A 1ZKAA 1XXDC 1BJMA 1A4BA 2QADD 1AS6A 1UXSA 1X4YA 2P5WD 3SQOH 2WKOF 5ALBH 3VRJA 2ARWA 3HZMA 1T0OA 1LK3H 4WO4D 4XB8A 1GW6A 1G7MB 2GFBB 2B2XL 4YFEA 1BZ7A 3WY3A 5KSBE 3T2NH 1LO2L 3SE6A 1OKEA 4XPHH 5I1CL 3FTWA 5TH2A 1WAEA 4FQ1H 2WUCL 3IF1B 3ZKQD 1SOSA 1BIIB 1O6SB 3UYPA 3G9AB 4MMXC 4X83A 5IG7B 1M7DB 3MRJA 4S1DC 3WJJC 2VLRE 2OJ1A 3C75A 4HV8B 4PJGA 3STLA 1W8OA 2XFXA 5I0YA 3LNEA 2UY7A 4NN7B 4YLQT 3LPFA 5SWZD 4WDIB 2QMKA 3W5NA 1HWHB 3QPQC 2ZUWA 1OGAB 1OHZA 3NABL 3OAYH 2XWTA 3D69A 3M8OH 2H1PH 4NENB 5AVUB 1G9ML 3CDYA 2J12B 4PJGF 5EZIL 2EEXA 3RGBA 3CZLA 5D70L 4JDEB 3B9KA 3PAVA 4HHWA 5K59F 2BFVL 5F97E 4F8NA 1FSKB 2B59B 1YAZA 1TCMA 2X70A 4HIJA 4I8DA 3W39B 1XEUA 2YPVL 2P5EB 4NWTL 2Q86B 5GGTA 2R4RH 3N85H 2OSLA 1FDLL 2BC4A 2R0KL 1AG6A 3NN8A 2E7LC 4MWFA 2HUEA 1AHWB 2Z9TA 1ZANL 3S35H 3Q5OA 5I8KH 3KW7A 3QJSB 4OI7A 1IC5L 3TNMA 4PJEA 4ONOA 4QI3A 3V4UL 2IQAA 1YC8A 3F12B 3KHOA 4UT6A 5C09E 5JW3L 1JXKA 2JJWA 4PW3A 5EC1A 1FYTB 5KBMA 4F7EB 1RL1A 4X4XB 1UM4L 3C5XA 1N7ML 2J2ZB 3AWEA 4YBLB 2PTTB 5IBTH 1CN4A 2NXYD 4UIMB 1D9KB 1R5IA 2BNQB 3U36A 3D33A 4HJIA 3L9RB 4GUPB 2W65B 5B1BB 3X2QB 1BOYA 2EYSA 4R9HA 3POCA 2JQZA 2E47A 5IB4B 3CVHB 4NC0B 4LIQH 4JKKA 5D7IE 3KHQA 4TUKL 3SE8H 1YMMB 1LMKA 4OF0A 4OZ4B 3HAEH 3ISRA 5TDPA 2MTPA 4EOWH 5DJZA 3UJTL 2NX5B 3W81A 1XFPA 5B1CA 5DJZB 4LHUA 2FX7H 2FWLB 7PCYA 2HTLC 4JM2A 4JG1H 4H8QA 3WIFB 1U91A 3P11L 1KNOA 4J23A 2IADB 3F7QA 4RAVB 4BSWA 3T4AA 1OE3A 5D7HA 5I73B 2OFQA 3P3RA 5E2WH 2QT6A 3UTTD 1S78D 1N6VA 3FHEA 4PGEB 4PJIB 1TO5A 1JGVL 1TTCA 2K9FB 1Z7JA 5DJAA 1KGYE 1KXQE 5E00B 3QIBA 2Q5BA 4X4XA 1HXKA 4A68A 5B39A 3T71A 3WFDH 2ZX9A 2G9HB 3MGTA 2EE3A 2OXGB 4K5NA 5E1AA 1J0IA 1UQSB 2A6DA 3LV3A 4HX1B 4WFFD 4P3DA 1FNLA 3ARPA 4UB0H 2BZDA 2CUMA 3F83A 3JWOL 5JNYA 5ABZA 3T1WA 1B4LA 3IK2A 4GUOA 2CG9X 5F89A 3GMPB 3GJEA 3V0VB 3PS6A 3VFMA 2OSLB 3N41F 3NN8B 4MAYD 4QRSB 5KUMA 1JUFA 4GP4B 1RKRA 1MXDA 1MDTA 3CFCL 3OKNA 4YX2L 2YMXH 4PJDE 5EU7C 1NAMB 1BMWA 4MA1B 1YEFL 1F42A 1Y6KR 2AZUA 3LKNA 4P23A 2R69L 1HCZA 4K9JA 4N25A 2JCWA 1SN5A 4EI0A 1T1ZB 4W9GC 5IF0B 3ETBF 3Q13A 1CICD 2A9AA 2HWZL 1A4KA 1G87A 2UUDH 4NXKA 1HK6A 5D55A 5CIPB 4JREB 5EZOL 3DROA 1F2XK 4BQBA 4HYTB 5F7AA 4AC4A 3H3BC 5IJCC 4UCFA 1DSYA 4QRUA 5FYJH 1MQ8A 1WG3A 4QTHB 2ZSVA 1T5XB 1KGXA 4QHKI 3GHEL 2UVEA 3EYUL 3GTTA 3MOQA 3Q8FA 2IANB 2WTRB 2HKFH 3FOLB 3U1SL 4NN6C 2DIBA 4M8UA 1NEZA 3LPGA 1PQZA 5I2IA 5D72H 2ZNXA 4B0MM 4XCNA 2BINA 3GGWB 4CSTA 1S3RA 2QSQA 2QGBA 1FVEA 2QMJA 3LDBB 4FQPA 4JKWA 1JOIA 1D6EA 4PJCA 4H40A 4L1LA 1MW1A 5T8IA 1P4IL 3MODH 1BZOA 1IC7L 4HD9A 1RLWA 4RAUA 4WTQA 4Y5YB 2EDLA 5E8NB 5GS1C 5CF3A 3RB5A 3BH9B 1RUQL 3CFJA 4M5SA 4K9EH 3SB3A 1KEGH 1A4JA 2A4CA 4DKFH 1S9XA 2NNAB 4WJ5B 3NGBB 4PIRF 1OB1A 4I0PB 2LAGB 4OKVB 4B0MB 4J3BA 3SE4A 3H53A 4N1CA 3VFUA 4NQSB 5BOZG 3HAEG 4QHNB 5AOLA 5C0IB 2YARA 4HWEH 1SHWA 3JWOH 1AGCA 2WXRA 1VGKB 3D2UD 1FZOA 3MRNB 4KWUA 1O6TA 2ITCA 1EV2E 3WJMB 2EDKA 3FCTA 1SXZA 1XH2A 1G7IA 4FA6A 1YUKB 1CMOA 4X7FC 5A2KH 1X9LA 3EJRA 2VT0A 1NCNA 5T5NF 4PY8I 5DD6A 5J11B 4W9ZA 3TXAA 1G7HA 2QZQA 4N3TA 4P9HL 1N0LB 3APDA 4IRSB 1QSZA 3T0BA 4PJBF 1S9YB 1RFDL 3Q5YA 2P7TB 3ZDXB 3HMXA 4GG8B 1NBZA 2YRBA 4PJGE 3I9GH 4XP5L 3PWLA 3O9WD 4AKOA 1NTDA 3OKEA 4EOWL 3SYCA 3IAPA 1TUPA 5T3XE 2Q9OA 1DTUA 3I74A 3LMJL 4M4RB 1WWAX 3WJLA 5F7YC 3EGSA 1J0YA 2YD3A 4U6YA 3FHAA 4H1LH 2WYTA 1CL7I 4HJ1A 5JQIB 1FFPA 3P3SA 5A6MA 3J7HA 4RH4A 5F3HA 3C87A 2GJ6E 5I0VA 2ZWKA 2IO5A 2OYMA 1FF5A 4QXTA 1T0NB 2XWJA 1XCWA 2GK2A 3B34A 4LEOA 3KLHC 4NO2A 3V4UH 5JW3H 4KMQA 5FUOL 3MLRH 5I8KL 4TUOB 3S35L 1SYSB 3UMNA 2AC0A 2CUIA 3OTTA 5T1JA 4J1UA 3UTOA 1A6VL 2AKRB 3IDIA 4MD5B 4OV5A 1IEBB 3BCFA 4KNUA 5F1IB 4IQHA 4PJ7E 4ZTPH 4NWTH 4AX3A 2YPVH 4LSUH 1QRNA 4P4KA 2N7SA 4HOZA 3UZEA 2BFVH 4GKSB 1ORQB 4HJGA 1JHLL 1SN2A 4AEIL 1FZJB 4ELMF 1JVLA 3BSHA 4JDZA 3TN0D 3GXUB 1IC4H 2CKBH 4JY5L 2I07A 1GZPB 3O3UN 5AW9B 2BM3A 2GHZA 1FNSL 2APVA 2ESVB 1CTOA 2YPLB 4ZUSA 2NY1C 2PWHA 4OFYA 1LE5A 3FDWA 2DI9A 2QQLL 4Y5VB 2ZP9A 2OXGA 5E1AB 2HUHA 3HG2A 3ALPA 4DPBX 1QQDA 4F5CE 4O51A 4N2KA 4NN5C 1NLDL 3KGSA 3S8WA 2Y07L 3R8QA 5AVWB 4LRIA 4JBSA 5I1CH 2C7FA 2RHEA 5DJAB 1RK0A 3GK8L 4LL9A 4ELMB 1N9PA 2ZX8A 3W0WB 4DPAX 3N0PB 1I1FB 2BSCA 2O6CA 3RWJA 3NJHA 2W94A 4ZZKA 3A5VA 5CU5A 1CVSC 5LBVA 4JRYE 1MN4A 2OJEA 4FXKB 2X2JA