4JUTA

Crystal structure of a mutant fragment of human hspb6
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
84
Chain Sequence
ALPVAQPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHAARPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein beta-6
publication title Molecular structure and dynamics of the dimeric human small heat shock protein HSPB6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 12
structure length 84
sequence length 88
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jutA01
4ELDA 1GMEA 2WJ5A 3QORD 3AACA 4M5TA 4PBDA 2N3JA 4PCKA 2N0KA 1WH0A 2O30A 2Y1YA 3AABA 3VQMA 4M5SA 1WFIA 3W1ZA 4YLBA 5LUMA 4RZKA 1SHSA 3EUDA 4JUTA 4FEIA 4ZJ9A 3L1FA 4JUSA 2K8QA 2XCMC 5DS2A 3Q9PA 2BOLA 2JKIS 2Y22A 1RL1A 3L1EA 3L1GA 1WGVA 2KLRA 3GT6A 2CG9X 2KMWA 3QORA 2Y1ZA 2MNWA 4MJHA 2RH0A 4YLCA 3IGFA 3VQLA 4YDZA 5DS1A 4I88A 4YE0A 3GLAA 3QORB 1X5MA 4YL9A 3N3EA 2WJ7A 3QORC 3Q9QA 1EJFA 2CR0A 3J07A 3GUFA
chains in the Genus database with same CATH superfamily
1SJHA 2C9AA 1O75A 2WUBL 1HJCA 1DE4A 2I7OA 4X5LA 1U8MB 1V7NL 4ICWA 5FF6B 3CH1A 3BC9A 1VDGA 2FBJL 2VO5A 1KTLA 2ICES 5AOMA 2ZICA 3IFLH 4Q74A 3SZ6A 4Z7UE 3TBTA 1CDCA 1L6PA 3HE6D 4E9YA 1KXVA 1KELL 1IAIH 4OJCA 5JIPA 2FLMA 5A6LA 4R26L 4P46B 4CGUB 4YDNA 4HWEH 5KZCD 5IG7A 3QUKA 4TUKL 1UB6A 4R96A 4RAHA 5E2UL 3CZGA 3VYPA 4GG6F 1AXTH 1TJHH 1FZOA 1KG0A 3GSNL 4LARL 2FBRA 3DHJA 2DS4A 4QYOA 1N5YH 2X53A 1DN2A 5D7LA 2MSPA 5TQ2L 4LHUB 1CD9B 1UA6H 4G71B 4F7PA 2CCLA 4R9HA 4GRMB 1ZLSH 1PCXA 4GKOA 3V5HB 5AENA 5EWIL 3SE8H 1MRCL 3FPYA 3PV6B 1OB0A 4UMGA 3RWGA 4WDIB 3ESNA 4L4TA 3VQ2C 4X83A 4HJGA 1XQ4A 1P7QB 2IJ0C 1MWOA 4JLRB 4MMXA 3AREB 2YPVA 2WLLB 2O6EA 1KACB 4QXTB 2XZAH 2DQMA 4N8PA 5HHVH 3GXUB 3UYOD 1HIML 3TH3T 4WKXA 3UG4A 4DESA 5KYYA 1Q9KB 2WZ6A 4FFYH 1KPRA 4I4WB 1JWSB 1KT2B 2MNJB 4B50A 1FO0A 2F54B 2HRGA 4V2CB 4HIPA 3WGVB 3QRFM 4ZUVA 3QIBB 1EERB 3U9WA 1MAML 1E5BA 4TNGA 4W6XB 3JZYA 3TX4A 2FZ3B 3EJZC 3FUIA 2G5BA 4FQ2H 5CJQL 5IMKB 5I26A 2J43A 4I3RH 1VSCA 3WMQA 1UZGA 1F42A 3OAZH 2WTRB 1OT4A 1PG7X 4HF5L 3TJHC 4F5CA 2AJUL 3IVKA 3CV5A 3POHA 3QJRB 2NY3B 2BHYA 2BVOB 4OLZL 3EOTL 3BZEB 3IETA 3KLQA 2HVJA 4YAQA 2ORBH 4U05A 1XGPA 5FFLA 3P11H 4GXVH 1UJ3A 4TQEH 3PHQA 4MYWB 4OGAC 1FNSH 2X42A 4HLZG 5FYLD 3SPCA 3CZUB 3IF1B 3NZHL 2GBUA 3O11A 3L3HA 4XP5H 3DRTB 3FU8A 4UYQA 2E74C 1NCDL 5D1XC 5F0LB 1EXUA 5G55A 1HL5A 4E9QA 1TO4A 3IU4L 4MJHA 5DLMH 5DUML 3LIZH 1G7JB 4NJAL 1JZIA 2D4DA 3I2CH 2JKSA 6FABH 3QUXB 4B96A 4K8RD 4NJ9H 2J88H 4Z3IA 2IH1A 3CZLA 3PNWA 4ODBD 4X4XA 5CWSA 4XI5C 5H94B 2ZPKL 4A67A 1CZ8H 4NZUL 4QEGA 3VFPA 1WBZB 5LXGL 3PJSA 5GRUH 4XMVA 1IC1A 1R3HB 1FNAA 3ARPA 5BS0A 5K9JL 2V2XB 4AC4A 3OAUL 3CHRA 1XH3B 3ZKNC 1EO8H 4LCCB 4PLNC 4DW2L 5CN1A 2QEJA 1BQHA 1RIVL 1JZEA 3D25B 4KMTL 4PV1C 2ZWZA 4A55A 4ZFGH 3D30A 5J4MA 2F53B 3ZE1E 1K2DA 1K3IA 2X38A 4NCDA 2W94A 5IKCB 3HMXA 3NEOA 1G0DA 1NOAA 1I8MB 3QI9B 3GMMA 1HHIB 3K0YA 2KPWA 1IU1A 3NQKA 3CVHB 4O51B 1J5OH 3S36H 3TYFB 1N64L 3KG5A 4QXUL 2GCYA 2KS0A 2YMXH 3SN6N 5LJYH 3ATAA 4U33A 4XPHH 5D7SH 3RWIB 2NNXA 5AW8B 2NZ9C 1GW6A 1KCVL 4BFBD 4Z23A 3TNMB 4L8CA 4KY2A 4ZMPA 4FXKA 3B7SA 2VN7A 3NEEA 4U6TA 2E56A 4BZ2L 4GH7B 2VDRH 1MEXL 1TKWB 1HQ4A 3O4OC 1LJMA 1TCRB 2WVVB 2YUXA 3UTSB 4N6RB 1BVOA 4Z76B 3OG4B 2COVD 3T9WA 4FOMA 1WYJA 1H6FA 5B3JF 4XOBA 3VD5A 1RZPA 5E2VL 1TQCC 3ETBF 5A2CA 4LU5L 2UYLA 4QRFA 5I74B 1IILE 5PAZA 4TQIA 3FT2A 5GGVL 3GXDA 2F5AL 2IAMC 5IEKB 2P5PA 5IREA 1HILB 3ME0B 4PREB 1ZV5A 3KH3A 1CXLA 4RMSA 5DRZB 1X5GA 2EC8A 3MR9B 4XZUB 1HHJB 2PN5A 5C9JB 3BESR 2DQEL 3FH7A 2P43B 1EXHA 1DQIA 1P7KB 2B5IB 1PLCA 2GBTA 2HVBA 1VJSA 2XWTA 4PS4H 4OIBA 3DX8B 1GGBH 3VD4A 5HGDB 5C0CA 4HK3J 4YDIH 5AW0B 3ZL2A 5KVFL 3QEUA 2VMFA 2BY3A 1I4FA 1N10A 2VZ3A 4GMTH 3B7UX 2YFNA 3GBML 4Z7WA 3RWEB 4MKMA 2XIBA 4R7LA 4OGXH 1CU4L 2B9AA 4IRZL 1V3LA 1VB9A 5HI4C 3TBSB 4OGYL 4FTDA 3ES6A 5FYLL 4GG8A 4EXKA 4QI3A 5JOFB 2A6JB 2JELL 2RQEA 4B9FA 4PM1A 4GQZA 1M6OA 3NEXA 4D9QD 4X6EA 2OZ4H 1YEWA 1JL8A 1R0AL 5J1AA 2Y3AA 1SBSL 1JWUA 1WD8A 5IQ7H 4JJ5A 2F58L 1MIML 2FE0A 1JHKL 2GHWB 2ZAGA 2RALA 5C2BL 3WJJC 2AMUA 2DJMA 2V33A 4PJGA 1ZLDA 3HNTH 2WLJA 3WEBA 4KTDL 2MHAB 2HVKB 4QRQB 2G3NA 4TSBH 4NUJA 3DX6B 3BO8B 3FYEB 2WKGA 3QQXA 4Y2DA 4HS8L 1NM4A 1DSFH 1WRFA 2C4XA 4NT6A 4QRBA 1AR1C 1PYWA 1JI1A 1MI5A 4G2AA 3EIFA 3TBYA 1IM9A 2R0KL 5ICXA 1M57B 4Z7QF 5IMLB 4OCXL 1BVKA 1D9KC 4Y5VC 4B7IA 4WFGE 5CP3H 1VZIA 1KYAA 2XBTA 5CU5A 3NP4A 3DI2B 4A7UA 4J4PD 4ZFOL 3KR3H 1P1ZA 2IAND 1XF5B 1JZ6A 2XZQH 4WK4B 1O7DC 2BRRH 4DJMA 1RSYA 5EUKB 1E9PA 5GRYA 2AI0H 1QBLH 2VC2H 5D4JA 5HD8C 5JUEH 2AK4A 1NKRA 2A38A 1RZ8B 4JRFA 5FA4B 3T6VA 3X1EA 2AXJA 4HH9A 5ANME 5KYUB 1XB6A 1AI1L 2IV8A 3H9SD 3QDGD 1XCTB 5KS9B 1A47A 4CC1A 1PU0A 3HAEB 5JHDA 4LQFH 4YE4H 5DHEA 2Y2TA 3LSOA 1OXYA 4RFOH 1XSJA 2DKUA 2RQ8A 3CPLB 3RAJH 4Q4EA 4PN6A 5IQNA 1DQQB 3ABMB 3R06B 4ZSOA 4MZRA 2JTYA 1KGIA 2A9NL 3FT3A 5HGHB 2CMRH 3VXNA 3KYNB 2B4CH 2G0LA 2OYMA 2HG0A 2XIDA 3HG4A 3MJ8B 1YJDL 4I0KA 1UM4L 2JJVA 3NJLA 4NBZB 1R4XA 4H1LG 4OSUL 3ARTA 3K8LA 3M17B 4JFOA 1U3HB 2B7DT 2J2ZB 2GAZA 2BIHA 4HV8B 3X3GH 4Z0BL 4HBQA 1U8CB 1Z32X 4N90D 1USZA 2XA8H 1TZOA 2ESVA 2I9LB 4R84A 3SHSA 3VYNA 4MB5A 4ZX3A 3INUH 3UJIL 1R46A 4UYPA 3REVA 5C3IA 2CBPA 3Q9QA 4GRLB 5E6ZA 1JPST 1HSBA 1QSEE 1WQVT 3WL9A 3O2DL 4C57C 1GGCH 3O4LE 4C56D 2B0SH 4AEEA 4NYLA 4XPFH 1KCUH 4D0BB 4EI5A 1NCUA 2L7EA 5AYQA 5HVWA 4LL4A 4KAQH 4HK0A 4RQQB 3FTWA 1MFCL 3H1ZA 2JKIS 4HIQA 1ES0B 1JZDC 4JKMA 4ZAKA 1M2OA 2FO8A 5IVZA 5IFHH 2UZPA 3LKRA 3G6JF 3V4VL 1CYXA 1TCMA 2J1KA 2XX1A 5AZ2H 1FUNA 1VACA 3RYMA 3BT2L 2E9IA 1I9IL 1L9OA 2RMNA 4TNVK 3EYUL 1AE6L 4ZODA 5ELIA 3UTQB 2P45B 1Q72H 3Q8EA 3ZOAA 1CI3M 2GJZB 2EIDA 3K2IA 4ONFH 1JZ2A 2R8SL 4PWGA 5FCUH 3GJFB 1K6QH 3CFBA 3SCMC 4RH4A 1AO7E 1JZ7A 1J86A 1BA9A 4K7PX 2BRQA 5D96C 3R8QA 3DMMC 1R24A 4RVBA 3GPEA 1FVDB 1PZCA 4EUPB 1NGYB 3OJDA 4G8GD 1FFNA 2OMWA 3H3PL 5HYQA 3G6JE 5E94A 2OYLA 3ECBB 4QTIL 3II1A 3RKDC 1E4KC 4WWPA 4W9IC 5JIKA 3CWGA 4POUB 1G0XA 2FJHA 1FGVL 1N0XL 3C08H 4XAKE 1XZWA 1N0LA 2RFXA 4HEPA 3UFIA 2CR0A 3ULVE 3SBWA 1BOGA 4OLYH 4XB3A 5I0YA 1H3PL 5DFVD 4NZRL 5AKTA 5DJ0B 5AWNL 2X1PA 1ZGLA 2LLGA 3QR2A 4KKCD 4N8CH 4YHYB 2QQLL 3MU3A 3PIQA 2Y07L 4W9ZA 1E8WA 4P5MA 1A1NA 3C5SB 4FXGB 1HNFA 5I1IL 5DUJA 1SMOA 4L5FL 2L7UA 5J13C 1VA9A 3FCBA 1JV2B 1Q8MA 3HC4H 2ZQKA 4FRWA 3PP4H 3IFNH 4J8RA 3TEXA 3ARFB 4P46D 4DUVA 4Y4HB 4HGKC 4RLDA 1OAKH 3ARSA 4LASH 4BRJA 1EZVX 1YAZA 1PDKA 3QZMA 4KNSA 2X9YA 3WJLC 1SN5A 1M1XB 3B7RL 5HYIA 5CFAA 5AW1B 1T5KA 4LHUD 3IDJA 4HUVA 4MSWB 3D50A 5K69A 2FO4A 2X70A 2ZKMX 1DL7L 2WM0A 4LT7A 4EIUA 5TDOB 4HSCX 5BVJB 3F65A 3BWAA 4B9IA 3EJQA 5CNHA 4JFDA 1OM3H 4U0QB 4NO5A 5F7WC 5LXVA 4LCUA 1UURA 5IBUG 3CFCH 5L8LB 3HG1A 4JAMA 1YC8A 3D6GA 1P7QD 1OPGH 2BSSB 3MCLL 2DJUA 3PG2A 4Y19E 2F7RA 4EAEA 3ARED 4MJ6A 2NNAB 2DEWX 5EORH 3WFHB 3MMEB 3ETBJ 2FL5B 4AJWA 5CEZE 2KZBA 5J1TC 1RK1B 3CN4A 4WCYH 2FRGP 2NY5H 3WFZA 1IKOP 2EXSA 1FJ1A 4M5YH 2ZONA 2PYEB 3GI9L 1C7SA 3V5DB 1D6VH 5AW3B 2F54D 3S5ZA 3FO1A 4P04A 5H35B 1OEZW 1RZKH 3EH2A 5K39A 3QIBD 3BKMH 4K9EL 1DN0A 1SUHA 4FQCL 5JQ6H 2P80D 4YDVB 4J7RA 3GBNL 4YE0A 4JFHD 2YPLA 4NRXB 1R3IL 5T1MA 3KDMA 2BNRA 3UYPA 3KPNA 3U0WH 2ATKB 1IQWL 3UEQA 3QRLA 3QDMA 2GPZA 2G75B 1KZQA 2NY3D 4GJTB 4BFFA 4PJ8C 4HWBH 4RFEB 3O6KL 4P3CL 3RWFB 3IGLA 4NC1E 2ZSWA 2J8UB 1E3XA 2X88A 4V1DE 2VXSH 1GGUA 1U2YA 5HI5D 3EJRA 4LL9A 1YEHH 1P5UA 4UQCA 2PKDA 5KJRH 1JN6A 5DMKA 3HZVA 5B7FA 5A2AA 2CO6A 3GSQA 3HVDA 4JDTL 4Z7UA 3PFUA 2IDSA 3VDCA 1RULL 2DYPB 2DQHH 4XP9H 4DP4X 1M2VA 1NDTA 3QUXD 4RMTA 4U1JB 5CZVL 3KWTA 4IOIA 4LCWE 3VGAC 2J1WA 1FYTB 1RURL 4EI0A 4OCWH 2NY7H 4NQCE 3R4DA 4D0DA 2ICWB 1SDDA 2W9EH 3GXFA 4L3CA 5L4FA 5EEWA 3V0WL 1UVQA 3AWEA 3VXOA 1QLFB 3L9EA 4OR1A 1WIUA 4RWHA 2XT1B 3U9UB 1TQTA 3PJNA 3T0EE 4YHZL 3U7WL 4UNIA 1O5DT 2ENSA 3UXFA 1QA9A 5GXBB 3KPTA 4X6BA 3SQOH 2GT9A 2F53D 4F8PA 2W0PA 4AQOA 3FQNA 1MG2C 1V05A 1I53A 1T7XA 2APTA 1W80A 2R56L 2MOGA 3FB8B 3SE3A 2F68X 3QI9D 4H7VA 1TVHB 1P4BL 2AVGA 5I1GH 4BJLA 1NQBA 1GAFL 4P2QE 4XPGL 3SD2A 3CBJB 3ZXAC 4L0PB 4M43L 5F7DB 2XETA 4XBGB 3K1KC 3UTZB 1ZS2A 4OZHF 4PJXE 3GMLA 3PDOB 1FNEB 3K46A 5A7EA 3BP6A 4GKZB 1IC7H 4HIIA 3P4LA 3U1QA 4JM2B 1ZEAH 2NY4C 5E1GA 2VAAB 4B9GA 1S7VB 5K9OB 1FC2D 2J6EA 3Q9PA 1MFNA 4JFYB 4GQQA 4I48A 5CLYA 1MJUH 4K5LA 3IXAA 3BP5B 4NQUA 1P84K 3G7TA 1KB5H 3UTSD 1XWVA 1AGCB 2WXGA 4KUCD 1PCSA 1S78C 5LBGA 2CO7B 5I8KL 3CSYA 1F90H 2H6PA 4BQBA 4D3CL 1PZBA 2NY6B 2YRZA 2JLLA 1AZRA 4OI9A 4L4VB 4ZXBA 5DHYB 4CMMA 3V0HA 2XWEA 3V5KB 4HQQH 4OZHE 4W1TA 3S37H 3GF8A 4O5LL 2QSTA 1IE4A 2X40A 1FLRL 3IMVA 5GISH 4AUYA 2DKSA 3KMDA 1S7SA 2JKJA 4FFVD 1JTOA 4N2CA 4HUMB 1IQDB 2OP4L 3VFNA 1G7IB 3QIWA 1MFAL 1XB8A 1A6VL 3HPLB 3G6DH 4TM9A 2B2XL 1FGNL 1SFDA 4MCZB 5I1AA 2B1HL 1MCQA 4KX9A 4QXVA 1EXGA 1MZYA 4Y2OB 1AD0B 4CKQA 3L9RA 3C6LA 4BH8A 4KI5E 1P4IL 1C12A 3C2SA 4JZJA 2K70A 2YUVA 2XJKA 3TBWA 3V0AC 3SJVD 4UT7L 4D8OA 2J5WA 4LLUA 3QUMA 4OCSL 1TTUA 5KSAA 4UUJA 5FCSH 1CUOA 4I0CC 3BPNC 4HGWA 5EEXA 4PMEA 5ALBH 1A7BA 2DD8H 1L5GB 3EKCA 1WVZA 1T03H 2Y5TB 2EDEA 1SY6H 4JQXC 4NP4H 4PGDA 3FUNA 1OTUD 1ZY9A 4OI7A 4Q9BA 4NUPA 1F4AA 4JFXA 1OOWA 1BQKA 1QACA 4ODXB 1IO4C 3HZMA 5DQ9A 1UC6A 2DWXA 2E7LA 2CJUL 1YNLL 4DVBA 3GSOB 5F7EH 3T09A 4B27A 2PABA 3CHXA 4LDOB 1G1KA 4G8EB 3UTPE 4KKPA 4MCYB 4QHUA 4U1MB 4AGPA 1MCIA 1TJXA 4X7SL 1MF2L 4LEOB 3CXDH 3HFFA 2WINA 3VH8A 1JXFA 4UT6L 2CKBA 3FONB 3ATDA 3KPMB 4NHCL 5HDRA 1CE6B 4PI2A 1BREA 4AL8H 1WEJH 5CGYC 4NN5B 5L8KB 1SYVB 1OAZL 1CQYA 2VKXA 3MUGA 4ELMB 4MDIB 1NBZB 2C9XA 3QISA 1BYNA 3GFUA 4OZFH 1U41A 3M1BA 3C5XA 2Q3XA 2R69A 4PV8B 25C8L 4LSQH 5D1ZC 3Q06A 4MQ7B 4F7EA 2J56A 1NCAH 3IJSB 1IGCL 5HXMA 2XQYA 1QWNA 3JXAA 3TYGL 2EEDA 4UTCA 3UPAA 4NO2A 4EDWH 1NGWA 2C4FU 3NGBB 2Q7YB 4DCQB 4E42A 5I1DB 3NJFA 4UIMB 2WMPB 5F7NC 3T3PB 5C0GB 2OBGA 1J1PH 4XMZA 2YN5A 4YHML 5KANI 3QUZA 2VZOA 1F5WA 5BO0D 3N9GH 1CFSB 3BPLB 3G9AB 5DU7A 4AYBA 2BSTA 3OHXB 1HCVA 1U8IB 4KZDL 3CMGA 4XAWL 3NIGE 5F70A 4BK4A 1EQWA 2FD6H 3A24A 3J27A 3PL6B 1WA1X 3QJTB 4XNMA 4ESKA 2EEFA 4R4ND 5D70H 1X5YA 1A9EB 1MDTA 1FZJA 3BOVA 1SLUA 2AXFA 1KFGA 1OARL 4S1QH 1KPVB 3A67L 4K4KA 1MXDA 2K7QA 3BIKA 4LRNL 1MCDA 2XG4A 2WN3A 3GXIA 3T0VA 3RDTA 5LUMA 2GC7C 4LLAA 4DN3H 3A23A 3S3DB 4N0YL 1VADB 3W2DL 5KVDE 2WBWB 3UAJA 1JF6A 3U30C 1U3HD 3MTRA 4LLDB 5D71L 5E95B 2DPKA 3ZTNH 4CN4A 1ACXA 1ZMYA 2M26A 1NFKA 4YHNB 3RGVC 1GGYA 3Q6FB 4UBDD 5TK2A 1YQVL 1GXEA 2XN1A 3MODL 4YPGA 4JCWA 4EVNB 2NTFA 4ZZFA 3LYRA 5T3XH 5HDQL 2XV6B 5CUSH 4LAJH 1J8HB 2GJ6B 5GJSH 3OD3A 1FC1A 3UAAA 1FL5B 4Q7DA 5HY9A 2H6OA 2ZUTA 1DUYB 4NWTH 2IFFH 5C0EA 1J5HA 1T21A 1D5BA 5CJOH 1EIBA 3C60B 3FCTA 2VM9A 1FVCA 1RZKC 1DJWA 1WJ3A 1DR9A 2GB2A 3NPZB 4OIIH 1MOEA 2OULB 4TF4A 3C9NB 3FRUA 4JQIA 4E9RA 2Y7OA 2FVNA 3QEGL 2OTUB 1EJOH 2VXTH 1U93A 1XH0A 2WZPA 2BZDA 3TJEH 2CM5A 5IB2A 3T04D 3SE4A 4KRMB 3NSXA 1CFNA 5DRXA 2WWNA 1JZJA 5DVKA 2C26A 4PP2A 1NGZB 2YGOA 1J0KA 4M5SA 2FATL 2QQKL 5DD1L 4E9VA 4Y5XA 4PAZA 5ANMA 4A2LA 1FFPA 3DTUB 5DYOA 3WN5A 2Q7NA 5HYFA 2GSIB 2LFGA 4JZOB 3VWKA 4KO7A 2PP9A 4S1RL 4TLKA 1KGUA 4N24A 5F72S 4LFHD 3I85A 3ARBA 4HHAA 4LQ1A 5IK3B 3U46A 5I5JA 1URZA 5A2BA 3KLAB 5AEAA 3DSFH 2OMBA 3DX2A 3RU8H 4Z7VB 3UZEC 3BSGA 4FQJH 4NOFA 5CCKH 4JN2A 2OMZA 3VI3F 3Q1SL 4XMKH 1OK8A 2H2SC 5FHBH 4A2MA 3I6LE 3EO9H 4X80H 4PWJA 3O9WB 4PY7B 3HAEG 1V3JA 3Q0HA 4ZMOA 4IBSA 4BK5C 4J3WA 5FW8A 3UROR 2WVSA 3EG9B 1THCA 4YDMA 2P5EE 2XLLA 2V2WB 4CJ0A 3SQBA 1J0YA 4S11A 3MBXH 3ZT7A 4X8XA 3TVMB 43C9B 2CGYA 1C1EL 4XNUH 3F04A 5K5YA 3T4YB 3ARFD 4RA0C 1AMXA 4U3SB 4Y4HD 2UY6B 5B1AB 1MSPA 2WY3B 3B5HA 1NANH 2JWYA 3IDYC 5LCVA 4BUQA 1RZGB 5F6IB 4KK6C 4L1HA 4NXKA 4WI0A 4ZNEE 3X12A 5LDSA 3AB0C 1IBHA 4M56A 4IHOB 4MMYA 4U0RC 5JW3L 3CLFL 1BVZA 1NAMA 5IFJB 5GGTL 1MWAB 3MLPA 4G8IB 1UD2A 1QSEA 4JRXE 2DMCA 5KSUB 3O4LA 1E9QB 2O5NA 3M1OA 2YQ2A 3ZKXB 4P2OA 4PG9B 2LU3A 3KCPA 5B8CB 1DQKA 3K74B 3C09C 4YDKH 1VFBB 2EDMA 4R0LA 2X1XR 3E1F1 4N1EA 1LXMA 3O4OB 2K9UA 4IOSA 5JXEC 1IT9L 1IEBB 2PYED 1Z9OA 1MQKL 2X4TA 2MPAH 1MUJA 2WXNA 3K4ZA 1JNNH 3F58H 3L3OC 4MJIE 2ROYA 2ZTBA 3OV6A 2G60L 2IG2H 1IX2A 1AO7A 1Y1UA 5LWYH 3KJ4C 4WI2A 1QG3A 3GWJA 4XPAH 4YXHH 2YA1A 3VFOB 2VL4A 3MX0A 1F4WL 1WCBA 4XBEH 4XHJD 1SXCA 3MGOB 2K6YA 1NIFA 2UVEA 2Y3NA 3G6JA 5JPMA 3DNKA 4YFLI 2HH0H 1Y6NR 5CLZA 4PS8A 3VRIA 4I5BB 4JVPA 3IDIB 5TH2A 3BRDA 2IVFC 4TMPA 3BE1H 1CGTA 2OJEA 4G8FB 1FRGL 1LO4L 3QQ9C 2EDLA 4YGVA 4P4KA 2OX5B 3UBXB 1FPTL 4JKWA 4JHAL 4LFHG 3VI4B 4EUPG 4QTHB 1R3LA 3MI6A 4MXQD 5F9JA 4HOMA 5LVEA 4ZO9A 3UEZA 3ZRSA 2CHXA 1AHKA 2DQTL 2VLME 2XYCA 1SZNA 3NSJA 4I18C 1W0WB 2DYPD 3L9BA 1JF5A 2NYZA 2VDMB 1MRFH 2ZOLB 3LY6A 3D85A 1JZ4A 1TO5A 2ERJC 3DETC 3OQRA 4CILA 1FYTD 4KH9A 2LE9A 2XVGA 3HFML 5EBMA 5L7XL 1OY3B 1RPQA 4F3FA 2CK0L 1JYVA 4H8PA 5I23A 1DLHA 4M62H 1YDPB 2A74B 1VAHA 1AHWB 2PW1B 4NOBA 4PLJC 3UPRA 3GHBL 2KI6A 5DJAA 1GC1C 3HEIB 4HC1H 4PJIF 1X7TA 3Q2WA 5DZAA 2O5YH 5A6IA 3MV8E 1YYLL 3BN3B 3GM8A 4YOKA 5EZOL 4CBZA 4PH8A 5JHLH 2HPOA 1E65A 1J1OL 2NXYC 1BQLL 4NAMA 3GM0A 4Y19A 1T83A 2B1AL 3QWRD 4M9PA 2R4SH 3FN0H 3ZZ1A 3EH5B 2RA1A 3AMLA 4AL8C 1J48A 2DN7A 3EYSH 3L3IB 4V33A 1HH9A 1JNLH 1W72H 3IGFA 1OAJA 2VDLB 1ZHLA 3NJNA 4JW3A 3W3BA 1P2CA 5C2UB 1AR1B 2JXMB 2BVQA 2YFOA 3C6SA 3MLSH 3O0RH 4QCIA 4WW2F 1FE8L 3TP4A 3U2SB 4WGVB 3LKSA 3CDGA 2OMUB 4Y5VB 3ZUCA 4J1UA 2ZOKA 3MXWH 1REIA 3V6OC 1T1ZA 2ZF9A 1RPKA 3SDCB 4XWOC 5F9AC 5C3TA 4IM8A 4OFDA 2UUDK 4RDQF 4I1NB 5I1JL 1Q90A 1IJ9A 3UGEA 2ZF8A 4JM2D 1LO5B 2FB4H 2ZX5A 4UILH 5DK3A 2IGFH 2FEEL 3CC5A 3MYZA 3F6IA 2OL3B 5HPMA 2YD0A 3QDJE 4PTTB 3RI5F 5E1QA 3WIHH 5EA0H 3E8UL 4FYSA 3MRPB 4KVPA 3F12B 5EIIB 4FZEL 2NY6D 3TA3A 4JN1L 3W5MA 2VLJE 3QNYB 1T0MB 4L4VD 4Y16A 4W9GC 4JRYE 4CVXB 4RNRA 4MXVE 3ETTA 1HCYA 2XN9E 4QAMB 2YAHA 4N2GA 4BZ1L 1ZVSA 2EDKA 2IFGA 2HYMA 3D05A 3WKNA 3ELQA 4JJHA 4LCYA 5DRNB 5CMAA 1L4IA 4LCWA 3MRRB 1QASA 4IBLT 2MQ0A 3AY2A 3P9LA 4NQCA 4A7GF 2NY1C 4L9LC 2ZXGA 5GZOC 1BFVH 1XH1A 2NR6A 1N3NA 3D33A 5IW3A 2Z91A 1XMEB 1XCQA 2OI9C 4KKLD 1ZD6A 3LPWA 4MAYC 4Y2NA 4YSTA 2XKSA 5D6DA 3M1CA 1ZTXE 4C54A 1XBRA 4KNTA 1BM3H 3FTZA 4PLKD 5E4EC 2BFGA 1SJVA 3L95A 3LS4H 3A22A 3T0EA 1RJCA 5BUPA 3ZDYE 1K8DB 2R29A 2Q86B 2FO1A 2EYSB 3V6FA 5KJ4A 1BPLB 5EDSA 1NWOA 4OKDA 1MCWM 4Y4FC 3FB7A 4G7YH 5HHMB 3V4PH 5IHUL 3F7RA 2IPTH 2BY0A 2VDNL 5CLTA 2QTVA 3VD1A 1DJYA 1I3RB 3NT0A 3GMNA 4LPCA 4Z3HA 4KO5A 1FBIL 5FYKU 3MKKA 1L9TA 1MFBH 3VXTB 1HZHH 1RZJL 4P2QA 3D09A 1XF3A 3CFKB 4PVBA 3IBEA 3EFFB 4JO3H 2IQAB 2FH8A 3F7YB 3LZNA 3BH9A 4M8QA 1OCCB 2H5UA 5IHLB 3EOBB 4K9JA 5FX3A 1MRDL 2GTWB 1JHTB 4PJXA 1L7IL 5DS8A 4TSCL 5E08L 4PWIA 2WBJA 4WNQB 3LRHA 1GIGL 4EKJA 4MZ3A 3VRLF 1A65A 3GBLA 2NW2A 1PVHA 2VKWA 4LLQA 4ISVB 3T6QC 2HZHA 4CW1A 3TS8A 1GYWA 1KGCE 3PAUA 2EE6A 1QBML 3EJSA 1GJWA 1HI6B 4ZYKA 1E43A 2KT6A 5D96B 4XXWC 3AVEA 1LNUA 1OO2A 1T0OA 1G9NC 5KOMC 2DLIA 1ZLWK 1PSKL 3LKQB 5F71A 3UAFA 3ZO9A 4X9YA 4OZHA 5BXFA 4M6OL 5J6GA 1IAOB 1IC4H 5E56A 2DQJH 2BSRB 2H0PA 3G9VA 1NCHA 5L9DH 1WHPA 4P59L 3N1PC 2OMTA 1NCTA 5CD3B 5D1QE 2DIJA 4OF5A 2ED9A 1MPAH 2BVEA 4O58L 3BMWA 4X8JB 1UKQA 3IAGC 3ZE2F 2QGBA 3S34L 1B0RB 3O6LL 3ZE0E 3K81A 2UY7B 2ZKHL 1J0ZA 2ZUUA 5EU6B 2LU7A 1L0QA 1W0VA 1CICC 4IRSA 2A83B 3OBAA 3R7RA 3JYBA 3ML9A 4KK5D 1G6RA 2WGNB 2AJZB 5ES4B 5HJDA 5JDSA 4MCNA 5HDWA 2NUPA 1GYAA 2OFQA 3KPPA 3PL6D 5LBSH 1E42A 1U3ZA 5B4MC 3FMGH 4R90L 4JDEA 1H15A 2JTDA 3MUUA 4N2KA 1KB9K 4ZJ9A 4ZTPL 1Z0MA 3PF2A 3ZE2E 1JFQL 1GGTA 1H19A 2Y23A 3QG7L 4MBRA 3VQMA 2PYFB 3VFTB 2B3IA 4PJ5B 1CGSL 1XZ0A 2I07B 4YZFE 3S35L 3VJ6A 4DIXA 1NLDH 1XIWC 2HN7A 2PXYA 1OGSA 2VIRB 1U8LB 3JWDL 4NBYB 4GO8A 3HBPA 1Y1DA 3ULUL 5F1NB 2WPGA 3RWHB 3F7QA 2NUTA 4RAVB 1RJLA 5I1KH 4D9LL 5EF1A 3F84A 4OZ4B 4PJFE 5IB5B 1KJ2A 4M93C 1IL1A 3H6JA 1EO5A 5C92A 4FL4C 5DA4A 4QHLB 7CGTA 4OB5L 3U2JA 2EVHA 2VDRB 4I0PA 1J8HD 2GJ6D 3GRWA 1BFTA 2F74A 4N2NA 1A4JB 1HL8A 4RWYL 3WGUB 3HNSH 1QRNB 5MEOB 3J7HA 5KN5A 5H37H 5I75B 2V3FA 2IDCA 3OKDB 3UTTE 3C60D 5J8OA 4OT1H 5ACLA 3EJZD 3WFCL 4MQXC 1RFDL 2VZUA 1MLBB 5C6TL 3BUTA 2DZEA 4XXDB 2HT3D 5BV7H 4R4FL 1K5NA 2XFXA 2ZXAA 4OCNC 3Q2CA 2HFEA 4ODWA 1UG9A 4N2MA 1H5BC 4QXWA 3TJHD 1H0DB 4E0RB 2VRQA 1M3JA 3ESUF 3ILPB 5I30L 4KV5E 4OFYD 3UJJH 5INDB 3PJLA 3WXWL 1QFWI 4N9OB 3E38A 5DDHA 4DQAA 2ITDA 5ICYA 4K2UL 3ARGC 2M2DA 1IC5H 3THML 2HWZL 4Y4KC 4JG1H 4CN6A 1KULA 4PWFA 2XBDA 3F7PC 4GAYB 1KIRA 1USQA 1YN6A 1ZVHA 4I8DA 4R2GB 4BXSV 4PGEA 3ZYJA 4YXLL 2CLVA 4H5SA 4KJWC 4LIQH 1HAWA 3GZQA 1EVUA 2MIZA 4AYFB 1F2XK 2YD6A 2MMXA 3UZQA 1A7PL 5LKNA 2YUWA 3CQFA 4B9JA 3QORC 3S3JA 3GLEA 4UMSA 4XWGL 5BRPA 5E6IA 5KW9H 1EFXB 3NABL 3AROA 4UIKL 4J6RH 2B15A 2V17L 3HKZA 3NESA 5FW6A 3VGAB 2MRYA 1A22B 3EOAA 4XI5D 4X7TA 4MD4B 2DQDH 1J8SA 1E4XL 1KXVC 1C08B 1AG0A 3O9WD 3OJ2C 5I6KA 3DOSB 1SGKA 4TUUA 1D5XA 3KE0A 3QJSB 3MN8A 3NPSB 4I77H 1NA8A 4OCRL 3ZKND 2QGDA 3TOPA 1T4KB 3MLYL 1E9OA 2C3GA 4P2CG 4WEBL 3S8FB 3H9YA 4F7CA 3KL5A 4H26A 5F93C 3TVMD 4AKQA 2Z64C 5FYKH 2X4RB 5D6CB 4HU2A 1BBDL 1ED3B 1PMYA 3L3JB 4R4BA 5CJ8A 3UERA 4LNRB 4ANXA 2ATPB 2ADIB 4AQ1A 5DC2A 4FQ1H 4ZQKB 1E0OB 4ZD3H 3TV3H 1SYSB 1MCPH 4FMKA 3S3BB 5C9KA 4RA3A 2EAEA 1OSYA 1F45A 1SEQH 3HJ0A 4NIKB 1K8IB 2R2BA 4MMXC 3Q1EA 1E67A 3BSZH 4YSUA 2J7LA 2NZ9D 3P77A 5PCYA 3E2HB 5F7LB 3IGKA 1DVQA 2VL5A 1Q9LA 4NQDB 3CFNA 4DUXA 3D52A 3N40P 5FA3B 4OQTA 2NW3A 4U4IA 1A4KA 1YEEH 2NY4B 1AD9A 1H3VA 4W9CC 4ZUWB 2WO4A 2VC2B 4X6CF 3P9MA 3KAAA 3EJTA 3MLWL 1EDQA 3BAEL 1TZ8A 3VD9A 4X8GA 4TRPL 2AJYL 3HRZA 4UWQB 5J7CC 1OIOA 3NCYS 3NFSL 2DWTA 4LVHC 4CAGA 1LEKB 1NSNH 4NKMA 2GY7B 4JPWH 1E7VA 1HZLA 3CZFB 2OR8A 3K7UA 2UZIL 5JTWA 1WFMA 3LXUX 3BZ4A 5J3HC 1FFQA 4ENEC 2LLLA 3BUYA 1QW8A 3LKOB 1QFWM 2H26A 3EUUA 3FUEA 2ICEC 3MPCA 5G4NA 2IDUA 1TOXA 3MCG1 3B2PA 3FRPB 3B34A 4YVUA 2HLAB 3APMA 1Q1JH 5CD5C 4N2OA 1D6EA 5C0JB 4PRHB 3HZ3A 3NG5A 2V9UA 1QO3B 3N04A 3CFDA 3D0AA 4IKJA 3T8XB 2XG5B 4XMWA 3FC8A 5T5NF 3N55A 3N3EA 1PW3A 3QQ4B 4JKPL 1JZHA 4YHPA 2R0WH 4WENB 3HZYB 4X50A 3L3DB 1JPTL 4K07A 5I19L 3ZL4H 4GG6B 3BPNB 2P5EA 2VERA 5K9QG 4EE2A 1KN4L 4BFEA 3MRKA 3G5ZA 5HI4D 3BRGC 2CHWA 3D5OF 5FM8A 1G7PA 2IOIA 3VI3A 2QVMA 1R3JA 4PJ6A 5EEUA 4A63A 3RPKA 4FCHA 3OWEA 4FP8H 4UINH 3MLUH 4ZNEA 4V11A 1HE7A 1YAIA 4BZYA 3NCYP 1U8QB 4XP1H 1QSFB 4FXTA 2L7QA 5DC9B 3ALXA 4QGYA 2QGEA 3DARA 1V7NH 3UYRL 1LVEA 1ZANL 2FHCA 3I84A 4JRXA 4Z0XB 4DP6X 5MERB 5FKPA 5HJ3B 3SQRA 3L5HA 2QADC 1JGVL 2LVCA 3RVUC 2VISA 1A7NH 4R26H 4N6QA 4AYMC 3BYYA 1KV7A 1TPXB 3AW5A 5FO2A 4DUWA 2FUQA 2QMJA 2W80C 2P7TB 2VDKH 1J9SA 2B20A 5E2UH 5MHSD 4U6XB 5C0BB 3U6RA 2JCCB 1TT6A 5F2FA 1IVLA 2CHDA 4QHPA 5DJ6B 5HJGA 4FXKC 1AR1D 4UB0L 3UC2A 3O41A 4N2EA 2G5UA 3E1ZA 3X1FA 4KKNA 4MJIA 1BM7A 3MNWB 3VM5A 3QXUA 4ZUUB 2C9UA 2VXQA 3SDCD 2YSSA 4HJUA 4X8CA 2A4EA 1HH6B 1MRCH 3BHBA 4HP5A 2BCKA 5FWRA 4UOW1 2JI1A 3IYLW 5ADPL 5F88B 4YZWA 2XX0A 4NLHA 5EO9A 3GT6A 2ZAHA 2OM5A 3QFGA 1QQDB 5D7KE 5HD8D 1LWRA 4I3GA 2ENJA 2X4OB 2NNRA 1WZKA 2E4TA 1NIAA 3P69A 4M4PA 4QRTB 4WEUD 4WW2A 2DL2A 5DRWA 1KIPA 1J1XL 3RIFF 1F1GA 3HZKB 2AV7A 5IB1B 1JJUA 3QJFB 5CZKA 3CQPA 4AUUA 2VUKA 1KZYA 4MMZB 1UOKA 3RVTC 1T2QH 3T2NH 4L37A 3LQZB 2G9KA 4NQEB 1KFAL 3MNDA 3HNVH 4X6DF 1J05B 3Q8CA 3ISRA 4MLIA 4NAJA 3WV0A 4ACPA 4Z7OF 1UZ6F 2FLRT 2ZWLT 3QCUL 2KDGA 2W38A 3IDNA 1TEYA 5GRVK 1DP0A 1MJ7L 4KPHH 4KO9A 1I3GH 3IFPB 2DYSB 4HJSA 3WSQH 4PVLA 4N2FA 3UBXG 4XN5A 2NXZB 2WP3T 3O6FA 4MZIA 5KYWB 1WGOA 4R7NB 4JGMA 5I17B 3II2A 3QO1A 2XV0A 4G72B 1BZ7B 3BLPX 1QUNA 1G4RA 1NCDH 4NKOA 3EBIA 2R9HC 4HOWA 5CHNA 3IU4H 3MA7B 4FDWA 3PWVB 2IXQA 5DUMH 4PUBL 4HETA 1KEML 1RHFA 3MV8A 3SDAA 4Z7OE 1UZ6E 1ORSB 4HIXL 4NQTA 5HHMD 1GZQB 4B0MB 1GS8A 3KXFB 4U1LB 3P54A 1QHPA 1I8KA 3KZ8A 5GS1A 5F89A 3IE9A 3ROOA 5IIEA 1QR4A 4LBEB 3GIVA 4HWNA 4XB8A 3FBKA 4APQC 1Q9WB 3V10A 2JQAA 5ACZB 4OIFA 4J27A 5LXGH 2VQUA 2APSA 2H3NA 2YKKA 1E5AA 1B90A 1DQLH 2HKAA 5K9JH 2E9JA 2DWEB 1KBGL 1YPZE 1OQOA 2CG9X 3B2VL 5DSCA 3FQWB 1O9WA 5IUCA 2ZX7A 5C0DA 5TE7L 5I28A 4HT1H 2IANE 5I8CB 3SKOA 3BQUB 1RIVH 5JYLA 1YRKA 1EMTL 1ADWA 1NUFA 5CIPH 1C5DB 4RGMB 2FTAA 3OWRA 2L3BA 1ILUA 2ZG2A 3C8HA 4ZTOH 3V7AG 3K71A 1XV8A 2OQJB 3P3YA 3OR6A 3PY9A 3UADA 2QDVA 1EAPB 3PUUA 3QDGE 1TQBB 2N0MA 2OMXA 3T1FB 4IBZA 1IE5A 1N64H 4ALAC 4DP5X 4IIQA 4PJBF 5E8PA 2AQ3A 4AEHL 4F7TB 3RUGF 3CFJB 1JPFB 1CLOH 4JRYA 3QXDA 4I9WD 1JHLH 3BP4B 4U4BA 3RKDD 4CVUA 2XN9A 4PJEF 1NICA 4MKTA 1PZ5A 1TZIB 3K6SB 2VM3A 1UOLA 4GO6B 1E8ZA 2VDLL 1I82A 4YSSA 3IXTB 2BS8A 1JD7A 3LCYA 4H20L 3S3PA 1T22B 4BDVA 4LAQL 2HKFL 1MEXH 3MNVA 3WUWA 3PFQA 4PWKA 5EIIG 1ZLUK 3WTSA 2ODHA 2B16A 3WDJA 2DMKA 1DCEA 5EU6D 3C6EA 4BWTA 5C7XL 3FN3A 3VB9A 2NOYA 3DV4B 5FV2A 3BYTA 1BVLA 3DDGA 2W88A 4HIEB 4UU9A 3BEVA 2X4SA 3ASOB 4BE6A 5FDWB 1TDQA 3VW3L 3U4EB 4M8VA 2EDXA 2ARWA 2WXRA 2FWOA 1M7IB 2M1KA 4LO9A 4ODUA 2W0FB 2YS4A 4PJEE 1FFOB 2F5AH 3H2PA 2OL3L 5CKGA 2C9QA 3IDYB 4POZC 3N91A 4PJCE 2E6QA 3BW9B 2Q10A 5EUOB 5DD3L 3O8XA 1MCRA 3SYAA 2WKOF 2J1ZA 3B2XA 2DQEH 3DRQB 3LH8A 1ETZB 2WLZA 2PPDA 2YN3A 4FLHA 1RCYA 4GUCA 2ZXCA 4U0RB 3IFLL 3KBPA 3N1QC 5T1LA 3WDIA 4QNPE 1C5CH 2XC8A 2Y4SA 3D48R 1WS8A 3PNRB 4GUPA 1M6UA 3QAZB 4PJ5D 1IAIL 4Q4IA 5CJXC 4C56E 3O3DB 3MBWA 4DP9X 3VGGA 4XTRC 1JG9A 1TTBA 2CGRH 5KVFH 3SGEI 4JKNA 1W91A 3B2DC 3A4FA 1OWRM 1TJHL 4WO4A 1NDMA 1N5YL 5L0QB 3WEXB 3U25A 4IRZH 2K1MA 1F4HA 4FNSA 1UA6L 4PWEA 4YSAA 5AG9A 4X0KB 1UWXK 4C83A 1KCBA 4OGYH 1T5XB 4NZTH 1ZLSL 4Z7QB 2HRLA 4MTMA 4GRWE 4PU2A 5FYLH 1BIHA 3SE8L 3QWQB 1KB5B 1KIUA 2R2EA 2VSKB 3WTYA 3L3OB 4KKBC 1IBBA 5C8JB 3LH2L 4OD3H 3VXMB 1QRND 4KX8A 1HHGA 1UASA 4KQ3L 2Y69B 5LLIC 3M88A 4Q0XL 3VFRB 3R0MA 1CL7I 3GSNA 4HUUA 5SWQA 5MEPA 1SHWA 2TSBA 1SBSH 3HHSA 2XZAL 3IMRA 2IQ9L 3FT0A 1GPOH 1MIMH 2VLLA 4KK8D 5F6HJ 1LQSR 1JHKH 4FFYL 3NUKA 5C09E 4HZLB 1UXMA 1UXSB 1MJJB 5C2BH 5E7BA 3AS1A 1FF5A 5JLZB 3U6XS 3VXUA 1IGFL 3TIDA 4BCXA 3CXHJ 5D1QA 4LXFA 5ENWA 4FQ2L 4KVNL 3LV3B 2HTLD 4Q52A 3DSNA 3FF8A 2W9DL 4HS8H 5C0IB 4I3RL 4R2GD 4S1DC 3D0LB 3FSVA 2JE8A 4HG4J 3KYOB 4JBSA 3BUIA 2OLDA 2QL1A 5FO7B 3IWVA 2PWGA 2HMIC 4IEFB 3I9IA 1AGBB 2CIIA 4OF3A 4JFTA 1ZOXA 1FVEB 3TCTA 3B2UC 4HUXA 1EFXD 1NPUA 4XZ4A 4KGJA 4L1SA 1A6ZA 4XCNA 3JYCA 4GXVL 1GY1A 3GSUA 4YMPA 4TQEL 1IUZA 1YEJH 4KK9D 1FNSL 4XP5L 2CK2A 3PWPB 5EN2B 1O6TA 2WCSA 2CNZA 2C9RA 1VKXB 4PRIE 2X3CA 3QO0A 1S9KC 4B3EA 1MREL 2K0RA 4G5AA 3B9KC 3SBQA 3I2CL 3BKJH 5CM1A 1P5VA 2BDNH 2HJLB 6FABL 2E0PA 3OKEA 1A3LL 2J88L 1CFQB 5DJYB 1HSAA 4HAFA 4RRPG 1XF2B 1RJYB 1FH2A 1HC1A 2EICA 1CDBA 4PB9H 2WTPA 3FQXB 2I7SA 3EFOB 1FNFA 3T4AA 1VFUA 2WXLA 2Z7ZA 1Z5LA 4ZMYA 2Z8VC 4DNLA 3W37A 4NDMA 1RJZA 4FKEA 3EGDB 5KSVA 2YJLA 3QEQD 1EO8L 2A9NH 1I1YB 5A16B 2F54E 1S8DB 5KJ7E 1MVYA 2NLJB 4OZFB 4N2AA 3GXMA 5CR1A 5BW7C 4AJYV 1YJDH 3J07A 1UM4H 2JI2A 1GMEA 4ZFGL 4HIHA 3UTTA 1CD8A 5EH1A 2MCPL 1I8LA 3PWNB 3FPXA 4PRDA 2X10A 4JFHE 1XD1A 4NQDD 3NBNA 5F7BA 2VE6B 4HHWA 3S96A 3BPCA 2BOBB 3JTSB 3QC6X 3D4YA 4X99B 2NY4D 3NJHA 4Z0BH 2DWDA 2Y22A 1MW3A 1J5OL 2RACA 2YA0A 1FAIH 3EHBC 2YQBA 1T0PB 2YMXL 2PCXA 5FYJL 1BXUA 1NCWL 32C2B 4XPHL 5D7SL 2EIEA 2BMKB 1S78D 5EBWA 4AENB 2A6IB 1OE2A 3TIEA 5EF3A 1KSRA 1DBML 3S97C 5BNXD 3MACL 3O2DH 1WFIA 1EX0A 4HEPG 4P48A 4XN8A 4HZAA 1DEEA 2X6BA 2XWDA 2O72A 2Z4TA 4RETB 3HE6A 4L8SA 4P49A 1MFCH 1HJBC 3O45A 3OKLB 4YBQD 2EDBA 4UDUB 1X5KA 1R75A 1TQWA 2Z31B 5IQOA 4YDLB 5KWYC 3DROB 3W0WB 3D87B 4EZKA 4B9CA 5FO8B 3D7PA 5DK0A 4F8TA 3IKCB 1GYUA 1D5IH 3VDBA 1WD9A 4PRHD 3EYUH 4EPSA 4L9LB 2WJ7A 2QTEA 3WHXA 5A7BA 1IIKA 1KYOK 3A4EA 4WSJA 2VYRE 3L7EB 4JFPA 2GIXA 5I1LB 1DJHA 3GNML 2R8SH 3I6KB 5D93B 4D2NA 3T2OA 5FFOA 3MRLB 4BZ2A 1P7HL 5DK2A 4ZQTA 1Q0YH 4RZCB 1JZ5A 4LPTA 4WZ9A 3MYJA 4XNYH 1UYWH 2AC0A 2SEBB 3EBGA 1CLVA 2MKWA 3NIDF 1S3KL 2CKNA 4Y4FB 4UQBA 4CSPA 3TA4D 1CJYA 3WLWC 1GGBL 1S7TA 4BA8A 5IW1B 2C3XA 3K5SA 1OHQA 4YDIL 1FGVH 3IGAB 2WXHA 1MHEB 2EYRA 4MBOA 1P1VA 3TJPA 4GMTL 4RDBA 1H3PH 4GKSA 4AV5A 1ZT4A 1KY7A 4MS6A 4OGXL 1QSFD 4NQXB 4HDIA 2HLFC 2QQLH 4R7DB 2GK0B 2QV2A 1OKEA 5I1IH 3LN5B 4K3JL 4L5FH 4EXPX 5HHPA 5DVNA 1CXKA 5JW4R 2CDGB 2GTZA 5B1CA 4XNBA 1LMKA 5DJXB 3K2UH 5ESVB 2QZQA 2X4QA 4CU8A 2FECI 2OZ4L 1MN4A 2CO2A 4EZJA 3OMNB 3UTSE 5C0BD 3QK0A 1F11A 3IDGA 3KCWA 2AVFA 4FNQA 3AY4C 5A3IC 1Z9SA 2X6CA 4NHUB 2R0ZH 1WUNT 3P0YL 1FL6A 2GUOB 4NI3A 4H8WH 2A9AA 1KEGH 1MH5B 1PLAA 3MRGB 3AITA 2VQTA 2W81C 4WGKA 2N1KA 4JPKH 1RZ7L 4R97C 2NDFA 3HOGA 2QQNL 4WTWA 4ZMTA 1DSFL 4EIGB 1PJWA 1QFOA 3VXPA 5GGUA 3K72A 4PMFA 4AM0Q 4NKQB 3ABKB 4HPOL 4PCSA 3TTYA 2WCGA 4N8VA 4IU2A 4Q2ZB 3WO3B 3BLKA 1F3RB 3QJOA 3IRCA 1GSKA 2L0DA 3QIWC 1CLYL 4W93A 2D0HA 2ZCZA 2BRRL 1R5IB 3IFOA 3I9AA 3SPVB 3X17A 2AI0L 2VC2L 4YFEA 2ROXA 1ZTMA 3AU1B 2OMVB 3D18B 4MLSA 5JUEL 4NM8H 4QRSA 3C6LC 3GBNH 4G6KH 4MB4A 2V8LA 2Y25A 2YD5A 4G43B 1R3IH 4NQED 4JDVA 4XH2A 1AGEB 4DFIA 1A4AA 4CVZB 5IJVB 5FO9B 1HK6A 1MVUA 3FU6A 3FRPG 3I50H 4J3SA 5J9PA 1N7MH 4RFNC 1ID5I 2OSLA 5IB4B 3MRJB 12E8H 3GSRA 1IB5A 3AG2B 1PJ9A 4L3AA 3GS7A 1HHHB 2AEWA 4JUSA 2KLSA 3RAJL 4NKDB 2FWSA 3KJ6H 2BSBA 2H2PC 3K6FA 2NXZD 1L7TH 3QHZL 2UUDH 2N56A 3KYKH 1SJMA 3MRBA 4LGSB 5ISZB 4P5TB 1N8ZA 3PU7A 2ADJB 3VE0B 4WY7L 5FDYA 4AW4A 2RTTA 1BQRA 4L1BA 4DAGL 4DN4L 4BSVA 4MD5B 4G83A 4X6FB 2PNDA 4WJ5A 3OGCB 1RULH 5LAXB 3BN9D 1WBYB 3KXFD 4OH2A 1KXTB 2MJWA 4R5TA 5I8OH 2E7LC 2PCPA 3RHWF 3K80A 3JWOC 1RURH 4J6IA 1A3QA 1BLNB 2PP7A 2XCMC 4ELKA 3EDKA 1J18A 4LPYA 5J0BA 3X3GL 3IN0A 2GFBB 3KPSB 3MTXA 3FT9A 8FABA 5FKAB 2XA8L 1BHGA 1FN4A 3PABA 1DQTA 2Z6FA 3V0WH 1CYWA 1ZAGA 2BS9A 1VFOA 3INUL 3FHAA 1VESA 3VM7A 4YHZH 2B59A 3U7WH 2YAFA 3NRFA 4F7KA 4UTBL 2OK0H 4ZO6A 4AYSA 3BQUD 2HT4C 4JPQA 4CU6A 1GGCL 3CX5K 2B0SL 2GI7A 2ITCB 4HSQA 1Z9PA 1KCUL 2XQBL 4FQLL 2XJLA 4IJ3B 3ZW3A 1V55B 1X5LA 5LG1A 2ADGB 3IAPA 1F6AB 3BVUA 1KNOA 2WSDA 2XXCB 2GG1A 2VMDA 1J5DA 5KS9E 2IV9A 5IFHL 1GAFH 4B95C 4XPGH 5DMGC 5IWLA 1A6AB 2NCEA 3PS6A 1CT8B 2QV4A 2B39A 3AMKA 4JFQB 1SLWA 1T1XB 2Z92B 3N40F 4M43H 5AZ2L 4BSJA 3BCDA 3QQDA 3S4SG 3QORB 4H1LA 5KSBE 1OW0A 4QDGA 1SJHB 3MRMB 1Q72L 1WC7B 4U3HA 3WE6A 1N2RB 2EXWC 4YFDB 4N22A 1G7QA 2DM2A 1OSZA 4PS3A 3QUZC 4ONFL 3OC8A 3QZOA 1K6QL 3FU7B 3G5VB 1QRKA 4P3DA 3WYRA 1J9TA 2MQGA 4U6YA 4WW1B 4PRPB 2UXVA 1TYJA 4UOJA 2BZCA 5D1ZI 4AIOA 2P24B 1NUNB 3OKNB 1FG9C 3ESMA 5ETUA 4AZ8A 3V4VA 2X6VA 4LSTH 3P4MA 4G7VH 2C3VA 4LE8A 3C08L 4QY8A 3R7QA 5FK9A 1Z6JT 4KXZH 3QZWB 1Q9OA 4O5LH 3S7GA 5FR3A 5ITBL 2CSPA 1U8PA 4OLYL 3RTLA 3RPIA 1MXGA 4L9DA 3BWZA 2ZCHH 4OGQC 1LEIB 2OP4H 1A9BA 3I75B 4J3UA 3UAJC 2BP5M 1A6VH 4C4UA 3G5XA 3WTUA 2H9GA 1EA9C 5A2JH 3WY4A 2HXAA 4CL7A 5CSGA 3EYQC 1W72B 3Q48A 1UT9A 4L29B 2WAHA 3Q44A 3HC4L 3EGXB 1ZLWH 4GXUM 1HXMB 1P4IH 3QPQC 3S5LB 5BRZB 2P8PB 1NOFA 2H0JA 2WSKA 5EC2A 2LFEA 2KHAA 2QMKA 1UENA 1V10A 6PCYA 1EK3A 4O9HL 3CHOA 2ZWSA 4OCSH 4EQ3A 4TS6A 1HKLH 1ZHKA 2ZCKH 5GSRB 1YPZA 2UZYA 2BY2A 5EZPA 1N9PA 3SGJC 4J4PA 4G8AC 4MNHA 2IANA 3DPBB 1Z5HA 2G9HA 2K6ZA 4OZGF 1CE1H 5GGSY 2R1YB 3X3FH 5DJZA 4OD1H 1CC3A 3DYMA 3VXMD 1TZHA 3LNFA 4GAFB 3CDCA 3H9SA 3QDGA 3E8VA 4PP1C 3SE4C 1RMFL 4DH2A 3LDBC 1DSWA 4KBPA 4ZUSA 5EORL 1DUZB 3ETSA 1KTDB 1YNLH 2CRMA 2YXWA 3VXRB 3ZT5A 1UM6L 4KU1A 2UZXA 4WTZG 1ROWA 4WCYL 1HE8A 2NY5L 1XB3A 3CSTA 3LRSA 3VGHA 1PIFA 1KDIA 2W0LA 2FJSA 4M5YL 5E5MA 5I9QC 5IY5B 2OR7A 2ICEB 5KYXA 3I74A 5IW6A 1D6VL 3KLKA 3WN5C 1Y0LB 2XBZA 1RZKL 4KMLB 1RUQH 3BKML 4AQZA 4MXWH 4R3SB 5JQ6L 4NHCH 5EOQL 1CGVA 5F3BB 2Q8BH 2Z34A 1CGXA 3MCKA 4WU7B 1AHMA 3QQ9D 4HKJA 3WNPA 5C08B 1HYSC 1S6NA 1RZIB 2WCPA 1I7UA 4TL5A 3RWJA 2JF1A 3CTTA 2D7MA 3HR5A 4NXSA 3OKKA 1KCRL 4PJBA 4POYA 1V3KA 4U6HB 5GJTL 4HULB 1M05A 4HJJH 1G7HB 3TWCL 2WLNA 3UO8B 4HWBL 3MREA 2BJML 2X12A 4PJEA 5L2JA 1A6UH 1OQXA 5IGXL 3DETD 3LD8C 2YD8A 3V4PB 5A43C 2X0VA 3TYGH 3LPGA 1T2XA 2VXSL 3P73B 3US1A 1V3MA 2FQEA 4HS3A 4PYHA 1L3WA 5GGQL 1Z3RA 3V0VB 1ECZA 4LLWB 1TJGL 4OKVB 2EDYA 5D7IB 5GS0H 1I7ZA 2DAVA 1NL0L 2H32A 3B3BA 4PLJD 4C56A 3RL1B 2DQHL 4XP9L 3BPOC 4YNYA 2A9BA 5IHBA 4KHXH 4OCWL 2NY7L 2QADB 4XAWH 4QWWC 2EVIA 5DJ8B 2V2TB 1T0NB 1S9XB 4MWFB 3VXQB 2WKOA 4BFJA 1BX2B 2WNKA 4X9IA 4NM4L 5IOPB 3QULB 2VDOL 3HPJA 4L1TA 4AQAA 4ZMVA 1ZA3A 2BK8A 1OARH 2GEEA 2PYEE 3EF7A 3LAFA 4P2OC 2X4UB 4P4RB 2LW3A 4LRIA 4QHNB 4XXCA 4HWZA 4JFSA 4R0LC 3SQOL 3ZRCC 4A7SA 3FK3A 4N0YH 3BWUF 4XWOD 4F2MB 3FQYA 1UA3A 1UWYA 1XEUA 5GS3A 2F2HA 4ETYA 4G8GA 2CO3A 2ETWA 4PLOB 3LEVL 1A8ZA 1B4TA 1XGYH 2CBOA 2VMCA 2Z35B 3LTVA 3RB7A 2F8OA 4KJQC 5HDQH 1CTMA 2W07A 4CADA 3NQIA 4NKIH 5IB3B 5B38B 3TESA 2V3EA 4FHKA 3RWCB 3NIFF 5D72L 2EH8H 4WNJA 1P4LB 2JQZA 2J8UE 4M3JA 4JPVH 1U8MA 2IO5A 2YGNA 5FF6A 3UBFA 1KC5L 1OZTG 1ZEAL 5CBEB 3BUPA 3PUCA 2I25N 4A2GA 4N5EC 1WCQA 4PHXA 5I6XC 1N26A 3W56A 2H4EA 4M5ZH 4RSYA 1MJUL 1CGYA 3KBHE 3MJ7B 1KB5L 3OPUA 4LSSH 3FT1A 2EO9A 1YLBB 3US9A 4JO5A 3B43A 3ZN6A 4IKNA 2Z31D 4P46A 1F90L 2YRBA 2GTQA 4XOCA 3DVNB 4P4KC 4JDZB 3FSAA 1BD2B 1H9VA 2AEQH 2DH3A 1ZT1B 3S37L 2RAMA 5GZOD 3WFCH 2FATH 2XVKA 4XPBL 5GISL 2QQKH 5CCJA 3NZUA 1HESA 4I1RA 3KDPB 1U8HB 2X6MA 4LHUA 2IF7A 4HEME 3HTLX 4MAYD 2MPVA 2Q20A 2G2RB 4GG8B 4Z18A 3G6DL 3SGKA 2C1OB 4JMXA 3V5HA 5KBLA 2Z8RA 3D8MA 1EEUA 1NFDB 3PV6A 3TASA 1TNNA 3HI6H 4WDIA 4P07A 3U0TB 4BFRA 3IU3B 3MQIA 4K7FB 4Y4FD 1P7QA 5T3XD 3MC0A 4JLRA 3AREA 4JM2F 2R83A 5GGSB 3NN8B 2WLLA 4LSVL 4APQB 4QXTA 3P0GB 5LHDA 1Q9KA 4GXUN 5CKAA 4TVPH 2AQ2A 2XVBA 3NJKA 4I4WA 1JWSA 1KT2A 2F54A 2V7HB 2E8ZA 1HINH 1TTCA 5E6RB 2XSKA 3UGXA 3IDMB 2EUVA 3QIBA 1S9YB 4DPRA 1SY6L 4NP4L 2P80A 2IDQA 5BV7B 2VLRB 2FZ3A 1CVSC 5DT1H 5L88H 5IMKA 2Z4QB 2QPEB 4FN0A 1C1EH 4YEFA 2ZJSH 3EJJX 2WTRA 3ULUF 3ALWA 3T1WA 1J7VR 4M5TA 1F86A 4IGBC 5IJKA 3CU1A 1NMBH 5F7EL 1GC1L 5HHQB 2BVOA 3BZEA 4PG2A 4OZFG 5D5MF 5DMIH 5JW3H 2KL6A 2O5XH 1EHLH 3LNGA 3CXDL 3VFSB 4L4VE 1IBGH 3FUKA 5IJBC 5LN8A 3X2QB 1JPSH 1DANT 3IF1A 4C8XA 1ET8A 2AEPH 2ED6A 3DRTA 2J71A 2BIOA 1N19A 4AL8L 1WEJL 1URLA 5T1JA 3MJ9H 3D9AH 4EMZA 3VNYA 2JJTA 1PLBA 2BVPA 3VB8A 1G7JA 3TA3C 2EDJA 1A7OL 4KNUA 4NC1C 3QUXA 4NC0B 3W1ZA 1OTSC 4Y16C 1I31A 3ARRA 4KZEH 4KJYB 3HCVB 1PZ3A 4YO0B 3SY0B 1SXSA 1BLIA 2EC9U 3CIAA 1T4WA 5H94A 1J8KA 4GEIA 5EZIH 1WBZA 4JY6B 4FFZA 3D4CA 4W4OA 5AB1A 3VYOA 1UB5B 4UT6A 3B37A 5EFIB 4KRLB 1D2PA 3LJ3A 3RVVC 2V2XA 4EDWL 4LGRB 3RIKA 4NWUH 1DTUA 1WZ1L 1XH3A 2E7MA 4LCCA 4MNQB 1FSKB 1I7RB 4E41B 2DDQH 1KTCA 1F4WH 1UOVA 5B4MD 5FOJA 2VR7A 3ENEA 3D25A 1VEMA 2CCWA 2GVYA 2TRYA 2F53A 1W16A 3N9GL 3WTVA 5AUMB 1ADQL 4EOWH 5IKCA 1IMHC 1W6LA 2TAAA 1I8MA 2DTMH 2WQRA 3QI9A 4OF7A 1UXLA 5HDBF 3CBKB 1PAZA 1HHIA 3T0EC 4PJIB 5EB9A 1GHFH 4HCRH 4O51A 4J5VA 2Z1KA 3CVHA 4J2XA 3TYFA 4GKNB 4LVOB 4QR7A 4OUUB 5ISZD 4P5TD 4C59B 1QI3A 3RWIA 4JHAH 1VGKB 4HH8A 4FJZA 3MXVH 4PY8I 4S1QL 3E0GA 2OSWA 3TNMA 2H45A 4JCLA 1B0GB 4JX0A 4WHDA 3TN0C 3C5ZC 5H2BB 2DQTH 4HX1B 3LRGA 3S88H 4DN3L 4B6ZA 5JDJA 1OGAB 1J8RA 3E6FA 4JO1H 3F7VB 1OF2B 5DZVA 4JO8A 1RVFL 2BC4B 3HFMH 3KS0H 1ZIAA 1TKWA 3ZTNL 1UD6A 5L7XH 4ELME 1TCRA 2WVVA 3UTSA 3IMSA 3UP6A 4MVBD 4N6RA 5TK4A 2X41A 3KPSD 4PI0A 1QI5A 1FCGA 4Z76A 5E6UB 3P40A 1VACB 2WBJC 5EPMB 3TGXA 4MQXD 4M7ZC 4K7PH 5T3XL 3OX8B 4LSRL 4FQHB 4YSRA 5EO0B 4LVNC 2YRPA 1OL0A 1XCWA 4UV4H 1DQJB 3D3VB 1Z66A 5AYUH 2Y1YA 5TPWL 4F58H 5IEKA 1HILA 3LNDA 3ME0A 4PREA 1XHHA 4GUOA 3DX7A 1YYLH 5DRZA 1TVDA 1GMIA 5EZOH 5SWSB 3SDYH 2IFFL 3MR9A 4O2EB 4XZUA 1HHJA 5C9JA 1DLFH 4K3DL 1J1OH 5CJOL 2VM4A 3ARGD 1K9TA 3FZUD 2HJKB 3CZSA 4AUJA 4OIIL 4Y4KD 1P7KA 3T3PE 5CSZB 1M53A 1YN7B 5FM5M 5E23A 3T3MB 1BPVA 1XBDA 4JCMA 4ORZC 2DOCA 1O5PA 4PR5B 1EJOL 1ODUA 3QYCA 4H25B 5HGDA 3TJEL 3T6ZA 4EIBA 3RFZB 1D5MB 2E9BA 2FJGB 3SOBL 3L4CA 3QORD 5G2NA 2IOOA 1RY7B 3D08A 1NIBA 3RWEA 4TPRL 1P9MA 4FC3E 5A2KH 4P23C 5F3FA 1IGJB 4KI5C 1ORQB 3U7YH 5I1JH 4GMSH 3Q5YA 3TBSA 4TVUA 1G9NL 4PRPD 3VD7A 2AEOA 5JOFA 2A6JA 1DVXA 3BEWB 1IIIA 4NNXB 4J8RB 2YA2A 5E03A 2IAAC 5GS0C 3EO0B 1QEWA 4UQ3B 3B8YA 3B9KB 3L4VA 3RU8L 4H0IA 4FZEH 2J20A 1HHKB 4FQJL 5CCKL 1BG1A 3O6MH 4HIJB 5EBGA 3TH4T 4DVRL 3WKYA 1YC7A 3O2VL 4XMKL 5GS2H 2E6PA 2KPNA 4L05A 4LCIL 3X1NA 4X7DC 1E5YA 4BZ1H 2A9MH 5ILTH 1UT1A 4D7BA 2VDKB 2NSMA 4Z1PA 2GJ6E 4KKRA 2MHAA 2HVKA 2XFGB 4QRQA 5DD6B 3STBA 1TTRA 1OP5K 4OZIF 2HAZA 3CJJA 3DX6A 3BO8A 4YDZA 5FECB 1N6UA 4KDVA 3MBXL 5D4QA 2PWFA 2HG5B 4XNUL 1NC4B 5BRZD 3NCWA 1MCKA 1WA2X 1LHZA 5MENB 4R8WH 3P4NB 4I0PC 5KVGH 4N87A 5IMLA 2Y6SC 3EJPA 4JS7A 3KPOB 4NQVB 4QRUB 1OPOA 2ICWJ 3EHBB 1THAA 3RX5A 2X4PB 4Z7VF 1ZLUH 1A6WH 1XF5A 1BVNP 3OKYA 4QRRB 5IHUH 1DDHB 5CILH 5EUKA 2VDNH 3FF7A 4TTDD 4XR8C 3S48A 4HUKB 3Q05A 4XO9A 2OYKA 4G6AC 1RZ8A 5FA4A 3V8OA 5KYUA 3L17A 3TONA 1IGTB 1XCTA 1HOEA 5KS9A 4ODVH 3PHSA 3HAEA 3GK8H 2C9PA 4N4YB 4Y1AB 4IBUA 4BYHA 2BOCB 1PEZA 3FTGB 4NSKA 4YDJB 4ENED 1IZJA 3VXRD 1G84A 2DIBA 2QJDA 1MZZA 5D7LE 2C1PB 3CPLA 4WFED 5GGTA 4PRBB 4Z7VE 1MRDH 2FWUA 1DQQA 3R06A 1JNNL 1L7IH 1P4UA 2YO3A 5E08H 3OZ9H 3P3RA 1UZ8B 3I9GH 1NPNA 5LWYL 3GEWB 5J11C 4YXHL 1OP3H 1PX4A 4I1PA 4L4TE 5HGHA 1L6XA 5E6IC 3KYNA 4U31A 4XBEL 1ZK5A 1QBMH 3MJ8A 5C08D 4X5WB 3QZBA 2NY2B 4A39A 3WENA 3ZBMA 3DOIA 3IRPX 3UO1H 1TTFA 2PPAA 3M17A 1U3HA 5GRWA 3WFBL 1UWXH 3VFVB 1KWGA 1TFPA 1K4CB 2J2ZA 4L3CB 3VGFA 3BD4A 3BE1L 3ATBA 4HV8A 4L4JA 1E2VA 1PY0A 3FUFA 1U8CA 4PY8J 4GEJA 3RA7L 3FFDB 2LAGB 3ARUA 3QR0A 2I9LA 4F8NA 4FQXB 4UDTB 2Q7AA 2R7EB 1KB3A 2WYTA 2NCMA 4GP5B 1ZWIA 1NOLA 4XP6H 4EQ2A 1MNUH 3DLQR 3S34H 1QLEL 4GRLA 3O6LH 2XWJB 5K33A 3R8BB 3WMPA 5AAMA 4NPKA 1FIEA 2EEAA 3L1FA 5JZ7C 3IRZA 3LVEA 4LMQE 1PZAA 4M02A 4XE5B 4D0BA 2J8HA 4AQ1C 1MHHB 1G1OA 1AAJA 1XGUA 2QADD 4RQQA 2XY2A 1FORH 3CGTA 3KWUA 1RH8A 4M62L 2MH4A 4NN6C 5AVQB 4DN4H 2Z65C 4R90H 5CIPB 3Q43A 1ZXQA 4BGDA 1PKOA 5BMFH 1XTLA 3OB0K 3QIUB 5AVVB 1ZLVK 1JFQH 5EHFA 2G3XA 4EN3C 3QG7H 2XRAL 1XR9B 3UTQA 3IBOA 3O0LA 2UXFA 2WBXA 5K9QI 1GCYA 3S35H 1CGSH 2GJZA 2O5YL 2PO6C 4M7LL 3GJFA 2ZOWA 3QGVA 3ULUH 1YG9A 3JVGC 2O4EA 3SKUD 3UACA 1GKOA 3FN0L 4R97B 1FVDA 1UADC 2JLPA 4EUPA 1NGYA 1BZEA 1J9RA 3IMUA 5MEQB 3HRZC 4M1CC 4D9LH 1JNLL 1W72L 2WLMA 2Y2WA 3ECBA 1A5FH 3MROB 5BS0E 4WJG3 3O0RL 1BYOA 3MLSL 2YPVL 1V7MH 3HC0B 4DPAX 3C5JB 3MXWL 2WNWA 1BFSA 1X6NA 2WO2B 4AGOA 5I16B 5DJ0A 1ROCA 3NJVA 3MJGX 4FTVB 4WUKH 3GHPA 3EOYG 3QCTL 1LILA 4NX0A 5TQ0H 2AFNA 2OXHB 3QNZB 4X5XB 3VI4E 3GMQB 3KGSA 3MLTB 2DBLH 1BGXL 3C5SA 4FXGA 1UTDA 3EH4B 3EZJB 5M7QA 2FB4L 1RUKL 4UILL 5C0AB 1RFDH 2CXKA 2IGFL 2Y1VA 3C6LB 3RVTD 1AQKL 4AEFA 1JV2A 5CEXB 4FNTA 1NC2B 4WI9A 1JYNA 3WIHL 1E6OL 3ARFA 3K6IA 5EA0L 4Y4HA 4Z5RB 1UT2A 3CFTA 4QGTA 1J88A 5I30H 3D39E 4LMQI 4UTAH 3WXWH 1BD2D 3D1MC 3V95A 4JEGB 4UZGA 2GQHA 2A0LD 4OVUA 5ADOH 4YQXH 1M1XA 2HWZH 5FGCB 3DHMA 5KVEL 4C55A 2HX7A 4MSWA 3IS1X 2Q76B 4NZFA 5BVJA 1BAGA 5TDOA 1VCAA 4YXLH 1U9KA 5C07B 3HN3A 1I7TB 3UGUA 2R9HD 3F05A 4PFEA 1CI5A 3SDXB 1JRHI 1A7PH 2CD0A 4OJDH 4ZS6D 1EGJH 4PJHE 2F15A 4KHTL 2BSSA 3V4LA 4Z95H 4BSWB 1JGEA 4DVBB 1BZQK 2NNAA 4P2YA 1JZFA 3MMEA 3WFHA 2FL5A 1IFGA 3APCA 4APQD 3V7AE 1BM3L 4KRPB 5I73C 3CZEA 1MW0A 1E4XH 1I9JH 4YS4A 3LS4L 1HEZB 3MLVL 2PYEA 3V5DA 5BUGA 2F61A 5H35A 2IOMA 3V4PL 4G7YL 4OCRH 4FF9A 3VQLA 4X6CB 5IQ9B 2NQ3A 2VLRD 2E7BA 4YDVA 1JV5B 3B9VA 4NRXA 4H40A 4JY5L 5HVGB 3TL5A 2WP3O 1S5HB 2HT2C 4YK4C 1MFBL 5C0CE 1EH9A 1HZHL 4M7JL 2ATKA 1A6PA 1QUPA 4XT1C 3AS2A 2O61B 4JO3L 4RFEA 2J6WA 3CZNA 2OTWB 3RWFA 3DUSB 3ZKMD 2J8UA 2DLFL 3DBSA 4RCAA 4YSCA 1DVUA 1EBAA 1VCBC 2ZSVB 2VDPL 4R7XA 2IPKB 2VDQH 3BIAX 2ZUWA 4N0FB 3MZTA 3O2WL 4ZFOB 5TDPB 2DH2A 1JI2A 2DYPA 3LKPB 4U1JA 5B38G 3CN1A 2EINB 2F8VA 1FYTA 5DHMC 3FU5A 3VDAA 5JORB 3L5JA 2O93L 3OLGA 2GY5A 2ICWA 1IC4L 4TRPH 1ML0A 4JPIB 3L1OL 2IBZY 4BWWA 1AACA 1R5VB 2X2HA 5L9DL 1FZJB 1WDAA 1FFRA 3NFSH 4Z8FL 4F2FA 1UFGA 1A25A 1QLFA 2AK1H 2XKUA 1MPAL 4K73A 2YAQA 5CEYB 3U9UA 1KWKA 4MNQD 3L4ZA 4MA3B 2P26A 4OFIA 5E00B 4LOFA 2VN6A 5FYKD 1A1OB 5I1EH 2IGLA 2UWEF 1A66A 2WIIB 5HHME 1MI5E 3HB3B 3O6FC 2H1XA 4LDLB 3HR6A 5J57B 4GNKB 4RMUA 3BVVA 3QWRA 2V9RA 3S8WA 3FB8A 1U58B 5B21A 1TVHA 1F6FB 4LLMB 3UJTL 4YPGB 4XTRD 5I2IB 3C8KB 4TUJB 1S7WB 2XZZA 1BZOA 2DM3A 3SDAC 4J3VA 4JKPH 1Z7JA 4F8QA 5F7DA 4XO4A 4XBGA 5GS1C 2BPBA 4JG9A 4N0UE 3NSCA 3KPQB 5DJDB 3LPPA 4WI3A 3UTZA 1H3XA 4Z7NF 5C0EB 3EYFB 1CLZL 3PDOA 1RIHL 1FNEA 4YHOH 4KOCA 1BEYH 4F20A 1NLDL 4GKZA 1OGAD 2VAAA 5FIEA 1S7VA 3FQ1A 5K9OA 2P5WB 2PCFB 4BKLB 3BDYL 4JFYA 4DKEL 1FV1B 1KOAA 1GYCA 5H37G 3BP5A 2VXVH 1VENA 1XGRB 5I1KL 1AGCA 1BEXA 5DEGB 2CO7A 4EO5A 3A4DA 3LB6C 4WV1C 1KTKE 4X9HA 5ESQB 4L4VA 2X87A 1HNGA 5DHYA 3V5KA 4I9WE 2VLKB 3W38A 2LR4A 4HUWB 3LXAA 2LGNA 3L4UA 1S7UB 1DBAH 1JGVH 5ANHA 3HUJF 2YAPA 5SWSD 3TNNB 1EHAA 1IQDA 2VQ1B 3FS9A 4GQ9L 4ONHB 5IVXB 1G7IA 2QVFB 3L1EA 2E75C 3HPLA 4IIQC 3DO7A 4OT1L 1PQZB 3U46B 1WFOA 3Q13A 4MCZA 4UAOC 5T1KB 4XHQA 1AD0A 3GSWB 4YIQB 3EGSB 5DQDL 5BV7L 1XVSA 4UB0H 2YD7A 4R7VA 5FLUA 4ADIA 5ERWB 4X6DB 4R5XA 4QAWA 3Q8BA 1QBBA 3CIQA 4EBQL 1QSVA 4O02H 5EO1B 4ERSH 4HFUL 4S0SD 5EOCH 3KLHD 5EC1B 4E9TA 5DFWH 1IC5L 3OKMB 2AERT 4JG1L 4YUEH 1U6AL 4FLQA 7FABL 1MAKA 5ADPH 1I9RH 1KY6A 5D2NB 1URIA 15C8L 5JW4Q 2E27H 1L5GA 4DTGL 4QRPB 4ALAL 5C0FB 3T0XA 2Y5TA 3NK3A 2CJSA 4LIQL 1NM9A 2LTQC 5CJ5A 4I87A 5I71C 3GXPA 2WIMA 1XL6A 1FL3B 5AAPA 4LVEA 1DVFC 3B9KD 3PWUB 4ODXA 2FDBP 2VRKA 4TN9A 5KW9L 1J1XH 2F5BH 3GYRA 2VQ4A 3O8XC 3LKNB 5DJ2B 5F1SA 2W9LA 5F7UA 2EVJA 3GSOA 2PF6A 4Z6AT 2Z93B 1A21A 2DQDL 1ZA6B 2YLKA 4XCEB 2J4WH 2ZP0T 1JFHA 4G8EA 3QZLA 2APWA 1XF1A 4MCYA 4U1MA 1BF2A 4PJ7F 5DHVH 4LEOA 1KFAH 1U8NB 2COQA 3ROLB 2D0GA 5LQBH 3FONA 4I77L 3KPMA 2I24N 1CE6A 4BQ9A 4WO4C 5DEFB 1QPKA 3GKZA 4OCYL 2DJSA 1QRNE 3TEUA 4IBWA 4ELDA 1SYVA 5FYKL 4ELMA 4MDIA 1NBZA 4G3YH 1NC4D 4DZBB 4HUNB 4HCFA 2HFGH 1GOFA 4LSDA 5MEND 1RLBA 3U1SH 4PV8A 2VSMB 4N0CD 4U1GB 1F3JB 4OQ1A 3LEYL 1N68A 3SPHA 5IMMB 4FQ1L 4ZD3L 3TV3L 1MCPL 2DBJA 2NZ1A 3IJSA 2D73A 2BVYA 3EHBD 5GPRA 4JB9H 1SEQL 4PUBH 5FGBA 4AV0A 5HVHB 1AIFB 4HIXH 4QRRD 2WC7A 2W60B 2ZUVA 4G80B 4DP8X 3BGAA 3CU7A 4FLOA 1EJFA 2Q7YA 3DIDA 4DCQA 5I1DA 2EE3A 4GQPH 1EO7A 1RZFL 2WMPA 2ARJB 1X44A 5C0GA 4RDQG 1U36A 2H7WA 2Y7NA 2A9DA 1YEEL 3CFIC 3HI5L 3U36B 3ULSB 5K59E 1CFSA 2G4GA 5I6XB 4OI8A 4Y1AD 1HVXA 2NZIA 7PAZA 3OHXA 2D9CA 3FOMA 3WUWG 1KBGH 1NMAL 4I3SH 3B2VH 3W11D 1JOIA 1MQ8A 3RLSA 1RUML 1ZE3H 3PL6A 4DGIH 3DX1A 1QFPA 2YAEA 3VFUB 5IP4A 1Z3GL 4Y1TA 1A9EA 4A2DA 3B56A 4JFDE 4LP8A 4JPWL 2VCOA 1KPVA 5EU7E 2BNUB 5EEVA 4OGZA 5GSVB 4MA7H 1BJ1H 4PEEA 2NY2D 4CC4A 1VADA 1QABA 3CSBA 3RNKB 4YX2H 4XO8A 5DMJB 1Q1JL 1E28B 3LXBA 4LLDA 5FYJU 4N2DA 4OLXH 4YHNA 3PGDB 2HSIA 1UACL 3Q6FA 1SEBB 1T2JA 5D8JH 3R0NA 2EXTA 2FSEB 4DGWC 3ILDA 4EVNA 4FQXD 5AOZA 3TEYA 5CN2A 1CVRA 4I9XA 2A6KB 1J8HA 2GJ6A 2FIKB 4LAQH 5AL0A 2HKFH 1FL5A 2HRPL 3ZHDA 2ZKWA 1DUYA 2P8LB 1TZGH 2ZUXA 3C60A 4IU3B 2D7QA 1WITA 3MOBL 3PE9A 4IMLB 4NQDE 3VW3H 3ZR6A 1WICA 4K5MA 4UINL 3C9NA 3MBEB 1E90A 4FMVA 4PD4K 1XSOA 4XP1L 1ZK9A 3OL2A 2XKNB 4J1UB 4ZX5A 4IGBB 1T1ZB 3OPZH 4OFYA 4YSOA 1DCLA 3JV6B 1ZPUA 3O3AB 3QIUD 4KI1A 5LNDA 5FC9A 3EFDH 1NGZA 1O6SB 4P5RA 3BZDA 4JO4L 2RB8A 1A7NL 2IALB 1A14H 4XNDA 2YC1B 4X98B 2GSIA 4IK7A 2O1AA 4JZOA 3Q5OA 2B1OA 2VDKL 3SGEH 4A7QA 1JK9B 3ELAT 4N3TA 5IK3A 4GQRA 1MCBA 1SDAB 3KLAA 4V1DB 4Z7VA 4BGLA 3IKKA 4NBXB 1DO5A 2FR4B 1UEYA 4J2QA 3MLXH 3EUDA 4KUZL 4PJDF 4DHLA 4HYTB 4KKAC 3W82A 4L8SC 1LO0L 1O0VA 3CSGA 1TJMA 2JQMA 3LH2H 2XACC 3O9WA 4FMFA 4FTVD 4KQ3H 4PY7A 5TD4A 5I15H 4WSGA 3R1GH 2ZWYA 3OXSB 4Q0XH 4ZK8A 1UWEH 3V0EA 2P48B 2DI8A 3DIFB 1CL7H 3BDXA 4GG6E 3EG9A 4LEXL 5CN3A 5C0AD 3P9LB 3C6LD 2V2WA 3HBZA 2IQ9H 1YZZA 1ZVYA 3TVMA 43C9A 1X5HA 1NC2D 4F37K 7PCYA 3T4YA 4HFWB 3VVWA 4U3SA 2UY6A 2WW8A 1PD1A 1RZGA 5IFAL 1IGFH 3QE5A 4U1KB 5D7JB 4D8PB 5AKRA 2P49B 4ZS7H 3ALPA 4PW3A 5DR5H 2JCCF 4IHOA 3I02B 4KVNH 1QSFE 3T2NL 1T2QL 3V6ZB 1O9VA 1RU9L 2W9DH 4YHKL 5IFJA 3GTNA 1MWAA 2NT1A 4GBXB 3UCRA 4G8IA 4ZFQA 3HNVL 5KSUA 1E9QA 2QR0B 5C07D 4DK6A 1SDYA 4NZJA 3QPXH 3B3IB 3TN0B 2YPKB 2EEXA 3C5ZB 4PG9A 4UQ2B 3RVWD 4KPHL 4IBQA 1XF3B 5B8CA 1I3GL 1WO2A 1GZHC 3LPFA 3WSQL 3VTTA 4HZ1A 1VFBA 1Q4NX 4IIZA 5I1CH 4NGHH 2LVEA 3MJWA 2JCCE 5C0BE 1ZGLM 5JO5B 4PBVC 4KRPD 2D7PA 5I66B 1IEBA 4CRPA 2Q9OA 5TGBA 4QXGH 4M7ZB 1MREH 4WGWB 2XY1A 5DGRA 4L1DA 1MELA 5I8EB 1A3LH 2Q3AA 2UXGA 4PCYA 4K23H 5BUAA 3VFOA 1R5WB 1JXKA 5DHDA 3VXSB 4GI9A 3MGOA 2AZUA 3NJXA 1A4CA 3PWLB 1DQLL 2VRAA 1A3ZA 4Y5YB 4Y8DC 4A68A 3I6GB 4I5BA 3IDIA 3V0IA 1XGZA 5DMGD 4G8FA 4AGQA 2VH5H 4HT1L 5HI3D 2AKRB 3MRCB 2OW6A 3RY6C 3VA2C 4K8RC 2AANA 2OX5A 3UBXA 4H0GA 2F8IA 5L4IA 3VI4A 2MCPH 4QTHA 3TFBA 4ZTOL 2C9VA 4P23B 1JBJA 3QUZD 4NQEE 1G7MB 4DPBX 5AALA 3FFCB 1W0WA 1NBCA 4AYDC 2ZOLA 4Y1SA 2J6EL 5BOJA 2NDGA 2PTTB 2JK5B 3WS6A 3D39A 5FYJH 3VG9C 1NCWH 2A6DB 1CLOL 1JHLL 5J12C 2V3DA 2Z1PA 4BUHA 3N42B 1PTZA 3NIDB 1DBMH 2WQXA 1YDPA 2A74A 2B14A 2VWEC 3OTTA 1YEGH 3MACH 4FKHA 4JPSA 1AHWA 2GIYA 3CK0H 4GI6A 2EZ0C 4P9MH 4LKXB 1W0YT 2WAQA 5C6PB 3BD3A 2K3HA 3NFNB 3WJJA 4ES9A 3IJ8A 4P99A 4W6YB 1KJMB 4NFDA 4F8OA 1BMWA 1A3RH 2CUIA 1GZPB 3Q2NA 3HB3D 4PJHA 3KXFE 5AVWB 1C9SA 2DF3A 2BIQA 3SO5A 3MV01 3L3IA 3QPQD 1JZ3A 3QJUB 3HJEA 3GD1C 3DGCR 5JOEA 2JXMA 3U2SA 4XNAA 3GNMH 5DUBB 3U48A 4UAHA 3KGTA 2OMUA 3OMIB 4Y5VA 4F9PC 4LSPL 1FIGH 4DGUA 3L4XA 3SDCA 5CS7A 5D2LF 1C5CL 2MCAA 3HBGA 2DLGA 4H2AA 4R5VA 1AY1L 5DVMA 4B9YA 2GEQA 5B3JE 1S3KH 1CXHA 2F6AA 3SJVB 5DD3H 1LO5A