4JUYA

Crystal structure of the pub domain of e3 ubiquitin ligase rnf31
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
193
structure length
193
Chain Sequence
HHHSSGRENLYFQGMPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Crystal structure of the PUB domain of E3 ubiquitin ligase RNF31
rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 64
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4juyA00
4OYKA 5LJMA 4JUYA 2HPJA 4P09A 4OYJA 5LJNA 2CM0A 2D5UA 4P0BA 2HPLA 4P0AA 2CCQA
chains in the Genus database with same CATH superfamily
3LBXB 3K1SA 4A97A 1YKEB 4X1YE 5CJ5A 5DJQC 3C64A 3B5MA 4I43B 1ZOYA 1D0YA 4KHPT 3AEBA 2DLRA 1KF6A 5L3CB 1MMNA 2H88A 4YLHA 4IDZA 2K24A 4LF5T 4GKKT 2EHOA 5FXXA 2WCAA 3CQCB 4DUZT 2EHOB 2XSAA 4ERRA 2XQ9A 5FXVA 5AQRB 3KBUA 1HG2A 4PK4A 2KXPB 2V7IA 2W0GA 3I0OA 1AJ3A 3UU3A 2VWAA 4QH4A 5E0OA 5AQKB 2RPAA 3Q9DA 5BMVE 2BBJA 2Y48B 1HTJF 4TNVA 4LFCT 3OPCA 3OJAA 4EXTA 3R84B 5HEJA 5LG3A 2CHOA 3PUSA 3AAEB 4EIWA 4Z8XA 3ZMSB 3PUXF 5ABFA 5ABFB 2X9XA 4U33A 4H9NC 2H3RA 3EDVA 3EHZA 3FZFB 2HPLA 3OYZA 1X9BA 1J1JA 2BG9E 2MPKA 3QOFA 3H3AA 2WDQA 2LSKA 4ASKA 3MA9A 3RF1A 4KHZF 4JEHB 4QXHB 1D0ZA 4ZXLA 2CBIA 5FKYA 4AQFA 2XQ4A 4AQYT 2WU5A 4IHJE 3PV0F 3AECA 4DBQA 5HWYA 1Z0PA 2XQ7A 1WCRA 3RYFE 2LSYA 2WBLA 3RKGA 4A5XA 3ZPOA 2W4XA 3KV4A 4YTNA 3GA8A 4GK0E 2KSRA 3X1DA 3I9YA 2IW5B 3F31A 2HH7A 2KZ7B 3MKDA 3Q5WA 2DI4A 3KV5A 3OTOT 4I4TE 1OWAA 2MBGA 2LHNA 2L8KA 3AAIA 2WZIA 3PUQA 1HX8A 3JADA 1YQ4A 3C50A 4G2AA 3PUWF 1T8BA 2DHRA 5LMUT 3IF8B 3RQWA 2Q9QC 3K3QC 5FMNA 3T1HT 3GN5A 3TKLB 3GN5B 3O4XE 4JLEA 5C8YE 3ZSTA 2A9UA 2LT3A 3RRWA 3NRYA 4NPPA 1GQEA 5LYJE 4QX7B 4ZS2A 5LHGB 2ODUA 4OYJA 3EI0A 4LMLA 3CIRA 1XMOT 4UV8B 5JDMA 1XMQT 4IE6A 3MACA 3RGLA 3U3IA 3RQUA 2QYWA 2XM1A 2CM0A 4U74A 2VURA 3A5XA 2ZM8A 5AQHB 5F5WA 1VOMA 4MHCA 2FUPA 3RKOA 2WP9A 4JUYA 2PTFA 2YKSA 1KEYA 2ES0A 4WNKA 4JBWF 4YHHT 4YSXA 1N34T 2WZHA 4DV0T 2V1DB 2K48A 4ZZCA 5ABHA 1OEDC 2W00A 2WB5A 4FJOA 3JCFA 3IBPA 3DTOA 3UU8A 2ZM6T 4QX8B 3PUAA 3TLUA 2WSSV 5FL0A 2W61A 1BR0A 3ZC0A 2D9DA 2UXDT 4AKHA 4QWNB 2EHOC 2BVLA 4ILBA 4JI0T 5AQPB 2VQFT 4O4IE 5L47A 1HF8A 4IE7A 4YSZA 5J1GA 3BQKA 2YOEA 5AQFB 4B3TT 3ZMUB 5LGUB 1FEWA 5TAOA 1VCSA 4F8HA 5CGMA 4LF6T 4QH1A 1S35A 3IA3A 3OYXA 4COFA 3O9XA 4I0UA 4DR3T 2E9XD 5HXSA 4AKRB 3KVBA 4ZI3C 2JMHA 5LGTB 4P0AA 2JMKA 2UUBT 3ZKRA 2UUAT 2WAUA 1YW0A 3VKHA 4IE4A 4K0UA 2LSGA 1Y01A 1KNZA 3RIUC 2KWHA 3DJBA 4XAXB 1WRDA 4X64T 4DV3T 5HYAA 2X0LB 3KFWX 3ZSSA 2R6GF 4KI0F 4CN1A 2WMOA 3N9MA 2H7OA 4O4HE 2XAJB 4HWHA 4B3RT 4IE5A 3AA1B 5HXCA 3NZPA 4J2CA 2K5BB 3LG7A 4UXNB 5HEUA 3O1HA 4AKIA 3L8RA 4QHOA 2B1EA 3CQXC 4KUMB 2NW8A 2ACZA 4A56A 1L0VA 3UULA 3CQGB 5LGNB 4IDOA 3RHWA 1KNRA 2PFVA 2XQ6A 2Z6EA 5HXRA 5HCMA 2XZEA 1M62A 5FL1A 2C0SA 4DV7T 2W63A 1XZYA 2Y6XA 5LOVE 4HFHA 2LHRA 4EAHA 4TN7B 4H9QC 2JIWA 4WZXA 4XZCA 4UEMA 3CKDA 2H89A 3AE9A 1NAFA 2VB6A 3AVSA 3ZJ1A 4BJNA 3NVOA 4X1KE 2OA5A 5DQWA 3C98B 4MLKA 2W62A 2BS3A 3ZCIA 1DU2A 3RIAA 4DR2T 1M7KA 2WQYA 4H9OC 1VCTA 3AAAB 3AE4A 3OBVE 2LJLA 5FNVE 3FZMB 2I6HA 4LFAT 5L4HA 4ZHQE 3FBZA 5AQSB 2C5IT 5AQIB 3CWZB 3CX7B 2UUCT 2CHNA 4ZEYA 2FJBA 1IAPA 4IL4A 1D1AA 1S94A 5EK4A 4CZZB 1T72A 4P1NA 4DMWA 2KINB 1HFAA 3UU5A 1IBMT 1XNQT 3ZT7A 1UX4A 5GONE 1MIWA 3HI2A 4EYYR 1MMAA 4MALA 2N1GA 3N9PA 2KWIB 2ZM2A 2VL0A 4CXWA 1LVKA 3VRBA 3SRZA 4U72A 3M3ZB 1B7TA 2MTQA 3D0TA 4DV4T 2IC9A 4DV2T 4P0BA 3ABVA 4ZI2C 3K3NA 4OYKA 4JI6T 5LP6E 1G8XA 3ZMZB 4K0KT 4HN9A 2E5LT 2YK0A 5L3EB 1BR2A 3QUJA 3P4WA 3RPUA 2D5UA 3WAJA 2Y8DA 1N32T 3VKGA 3LK3B 3AEFA 4KX6A 2VVNA 4YY3T 2DL1A 1IJ5A 4HFIA 5LJNA 4PJNA 5FVLA 3PUYF 1IJ6A 4AKGA 1E1HB 2XUEA 4UIGA 4HFEA 4LF4T 1UK5A 4IDPA 3AE2A 4AIUA 1CUNA 2XHEB 2W66A 5AQGB 2YEVC 4OK0A 2CXDA 2YDQA 2B76A 3RC8A 1KFYA 3JAEA 3UUMA 1HG5A 3KINB 3JAFA 3QB5K 4CN6A 2V26A 4GOUA 1FMWA 1BR4A 2VQET 3ZYLA 5J2UE 2X9HA 2XM2A 2CEAA 3FB2A 4CI3B 2LKHA 2UXCT 2BS4A 5FYMA 3LJCA 4B3MT 4O8SA 4TWFA 2VKOA 5AQJB 1HNXT 3S4UA 3K3OA 2WMNA 3QNUA 5JTGA 1ZHCA 4U7IA 5EK3A 2VKDA 5IUXA 4C91A 3Q5EA 4H9RC 1MIYA 3PU3A 4DVDA 4EZ4A 3UQ7A 3MJXA 3LDQB 1W0AA 3UUXB 3H3MA 4DO0A 3L3PA 2D0UA 3AVRA 2X0YA 4DMVA 2D0TA 4ISSA 2MOZA 3ZYKA 4O2AE 2LKGA 4O4LE 3VR8A 4ILCA 5JRCA 3JC6C 5JRCB 4YJ3E 3MXZA 4HWIB 3AEAA 2IIUA 4DR1T 2XQ5A 3E22E 4X5TA 2CXFA 2CMRA 3ZC1A 3ETVA 2RP4A 5ADXL 2JQ9A 4OFZA 2ZLYA 2X9WA 2BS2A 4YTPA 3L39A 2P9BA 3O1IA 1XDOA 3C4XA 3KDSE 3NBXX 4X20E 2NW9A 4ANJA 3EABA 2XAHB 3FZHB 5IWAT 2G0UA 1LRZA 2A3DA 2YN6A 4HFCA 5JVDE 5FXWA 1W09A 2LLYA 4GYRA 4H9PC 3TLWA 2V7MA 2XAFB 4M1PA 3CMLA 5L3BB 5KXJA 2BG9C 3K8PC 4EEDA 1WYCA 3UU4A 1HNZT 2W2UA 2DWKA 4JI4T 1FJGT 4PK6A 3NRXA 5L3FB 2J47A 1YD8G 3FZLB 1W9RA 2OLTA 5KX5E 3KVAA 4X62T 5AQUB 2WWVA 3A7MA 4UELA 1W0BA 2XAQB 4JI1T 2E9XA 4NXMT 1US7B 2SPCA 2E9XB 4EB6E 5F3JA 5LMNT 4YTMA 1YKHB 5AQNB 4WBOA 1CHUA 3LK2B 5JDQA 4EGWA 4DR6T 1HNWT 2CLYB 3TLSA 5EZYE 3V5SA 4B6XA 5HEOA 2XQYA 3EVYA 4YXDA 2E5VA 2LSJA 3PUVF 3EAMA 1UGOA 4UVAB 4PJLA 3R6NA 1UX5A 4H63H 4IT4A 3T8OA 1ZV4X 4MFRA 2XQAA 4L9IA 4O2BE 4XBFB 3AEGA 4U31A 4GKJT 3UFGA 3RLFF 4F6RC 2A72A 1SUMB 3ESLA 3SFEA 1I94T 3ZMTB 5AQTB 1H7CA 3AXJA 3AA7B 2V5DA 3AXJB 4EYUA 3ZCJA 1SHZC 5JR9A 2KNDA 4IIJE 3B57A 3ZN0B 3N2KE 5JR9B 1LVFA 2LE8A 1MMDA 4V1Av 2MAWA 1O3XA 3ZT5A 1BR1A 5AQQB 5LJMA 2UU9T 1QLBA 1XWMA 4LF8T 2HN1A 2LM2A 4FI5A 3AB3B 4DR5T 3CX8B 3IHRA 4AQFC 3CK6A 4G63A 3AEDA 5JDLA 5CFBA 2PJQA 4JI3T 3EDUA 1T98A 2HPJA 5J0ZA 4U7YA 2GK9A 1QUUA 2BBHA 4X1IE 3RIFA 4GK5E 1D1CA 3ANWA 4HTEA 3ANWB 3HKCE 4ISTA 4B3ST 5J2TE 3RYHE 2WU2A 3N5LA 3W15B 2X0HA 5FY1A 3VR9A 2DWGA 2OV9A 4L0RA 4HGAA 2M6IA 3WAKA 2IDOB 3AEEA 2JQQA 2MYSA 5L2LA 1N33T 3PUZF 4UV9B 4WW0A 4TNWA 2J4GA 3HKEE 1VRBA 1YQ3A 4PFOA 1G73A 1Y64B 3UQ4A 2UXBT 2VL8A 2D2SA 1T7SA 2BZBA 2N2NA 4E7ZA 5JREA 4GIWA 3I1AA 3M65A 4AXPA 3E08A 2JJ9A 2H7VC 4OX9T 4ILUA 3P4SA 2JQHA 5HXHA 3HKDE 2BVMA 3HKBE 3L09A 4ZOLE 2FJAA 2K9AA 4Q25A 2PBIA 4UVCB 1ZEEA 5JH7E 2YINA 2XAGB 4C90A 3P4PA 3PU8A 4Z90A 5F8PA 1IBKT 4TV9E 3RYIE 3CPZA 2VK9A 5AQLB 3RC3A 5KMGP 2IHR1 4YSYA 2E2AA 3ZEFB 4WBNE 1WLXA 3F2EA 1MMGA 5LG4A 3QB5A 3Q5DA 3ETUA 3MZKB 5FY7A 4TV8E 4H63V 4BAYB 4EZHA 2Q9QD 3BQLA 1QSDA 3UFEA 2IC6A 1OEDA 4JV5T 2V7KA 1OEDB 2CLYC 2CWOA 3H37A 2LOPA 4UF0A 4HWDA 3C4ZA 4IL9A 4UF0B 4EEBA 1OXZA 3HR0A 3CX6B 2L9QA 3P50A 2WDRA 2WM9A 3P4QA 3GWHA 4NUUA 3KBTA 4PJJA 4KP3C 2X9YA 3RYCE 5IHYA 2BKOA 1UURA 1X79A 1ZP0A 3AA6B 4YT0A 3J9X1 2VKHA 3GMIA 2ZMAA 2XTLA 2CCQA 4CQIA 3NKZA 5LXTE 5M4YA 5CB4E 3UTKA 3SS1A 4IREA 4TZ4C 3VU7H 3EUHA 4HFDA 1WR0A 3C4WA 3PJAA 4HFBA 4A98A 5JR9C 4WYVA 1N36T 4H9SE 4IDNA 5HWXA 3UT5E 2E8IA 1KNPA 2YU1A 3N2GE 4YFSA 2VVSA 4OHFA 4Z91A 3P4RA 2CXLA 2V7LA 2BKPA 3FXEB 2FJDA 1ZKEA 2V8SV 3RIUA 4DNDA 2EHOD 1E2AA 4U3CA 5L4EA 4L5GA 1V9DA 1HR0T 2XQ3A 2YU2A 5C3JA 3IEEA 4TX5A 4AKLA 3AE7A 3OVUA 3AA0B 2NOXA 5HEGA 2WDVA 3PDYA 1KK7A 5IYZE 1JNRA 2IMLA 1OEDE 4LF9T 4KBMB 4QH5A 1SE7A 1XNRT 5BR8T 2HHHT 4NIQA 2NW7A 2PG8A 5KDMC 2CA5A 5DABA 5FP3A 3ZN1B 4ZI3D 4X65T 2NP9A 3ONJA 3UUNA 1D1BA 1WYBA 2I59A 5LNKA 1NEKA 4AQGA 4DIDB 3OKQA 4P09A 4BJMA 5CA0E 3PE0A 5FY0A 3FZKB 2BKNA 3HL6A 2AE9A 4HFVA 3LSVA 2JRKA 2C5KT 3DP7A 1I6ZA 3I0QA 3PTRB 1U4QA 2J1DG 2X51A 3QK6A 4EV6A 1XDPA 2VKJA 1FIOA 2NWBA 3P8CD 4CI2B 2DCFA 1J5WA 2CRBA 3P7IA 4QXCB 4TWHA 2KMFA 4U2ZA 1WR6A 4DR4T 3KV6A 4PAGA 3J7Yq 2I0MA 2VASA 4BA9A 3T1YT 2V6XA 2ZM0A 4PK5A 2N9DA 5CA1E 3AE5A 2CPTA 4IE0A 3SFDA 3TLVA 5C2TA 5JDHA 2W67A 5H6QB 1R8IA 4JI2T 4LMJA 5LHIB 2QRXA 3V5UA 2XASB 2V5CA 5JDFA 4U2YA 2LEHA 5LHHB 2NTXA 5FXZA 3AE1A 2JPFA 2RA1A 3VRAA 4HWFA 1Z8UA 4UR9A 2UXNB 3N9OA 3ZLIA 5JDGA 1MIVA 3ONLC 1HCIA 5AQOB 3N9LA 4DV6T 2YDSA 1D0XA 2XQ8A 3A8YC 3G06A 1MNDA 2X66A 3N9QA 4ILAA 3ZYMA 2LOSA 4JYAT 4DR7T 5HCJA 1LKXA 5AQVB 3VHLA 2XJ7A 3AE3A 1U5PA 2X67A 4CN4A 4NXNT 1E7PA 5LBQB 3MK7C 2FBWA 2XY8B 5HAXA 1UUSA 4LMKA 5HEHA 3Q5XA 2QA7A 3SOLA 2NTYA 5A1LA 4UVBB 2CBJA 3HA4A 2QGSA 3RH3A 4DV1T 2K3WA 4NUVA 4KMCA 4I55E 2QVAA 4ZI2D 3ONXA 3RX6A 5EK2A 1UCUA 4JI7T 1NENA 2HN2A 1HS7A 3ZJ2A 2AXDS 3RI5A 4CXXA 3CVRA 4IGUA 5LB7B 4AI6A 2YDRA 4CXYA 1FMVA 2M67A 3PUGA 2C5JA 3LK42 3QC9A 2IUBA 3AE6A 4AISA 4DUYT 1EZ3A 4PJMA 3Q2MA 5LA6E 5DQVA 4YHJA 3ZMVB 4QXBB 5ABGA 5LCYA 3WI3A 4HE8A 4LFBT 4MBQA 4E7SA 2IAKA 5LBMA 3E0ZA 1MNEA 3FHNA 2FJEA 1YXRA 5H6RB 4DBRA 3B13A 5AQMB 4ZI7E 4I50E 3TLTA 3I9WA 4HWCA 2F4VT 4O4JE 5L3DB 2J62A 5JQGE 1JNZA 4ZZBA 3F57A 1WFDA 3SWHA 2M6BA 4HEAA 2WWUA 5ABEA 3FXDB 2XSBA 1NWMX 3RRCA 2WS3A 3FBLA 3NWIA 2LRKA 2XPKA 4JI5T 3U78A 2NR4A 4HKAA 1J5ET 5HXEA 3KV9A 1SA0E 2A2FX 5L3GB 4TWDA 5ETWA 4LF7T 3AE8A 5JDNA 4N78D 3ZT6A 2LM9A 2L3LA 4TUYE 2CWYA 2Q9QA 3BK9A 2Q9QB 3UUBA 4DV5T 5AFUL 5FVKA 2LSIA 3C51A 3O1JA 3NZQA 2V7JA 4PW8A 2ACXA 2V6YA 4EOZB 2V6YB 3N2OA 2JQKA 3N9NA 2LRLA 2CE7A 4JI8T 3PJAJ 4JEUB 4X66T 2ODVA 2BG9A 1IBLT 4PFPA 2DNXA 3JC6D 2KT9A 4GYSA 2BG9B 2X68A 3PURA 2BDEA 4YJ2E 4ADZA 1HX1B 2UXXB 3BQIA 4ZS3A 4CI1B 4QKNA 3LFMA 2WY2A 3UU6A 2E9XC 4IDQA 4PNIA 3LBXA 2KLQA 1IZNB
chains in the Genus database with same CATH topology
3LBXB 1YKEB 4X1YE 3UULA 1US7B 2SPCA 5DJQC 2E9XB 4EB6E 2NW7A 3CQGB 2PG8A 3C64A 5LGNB 5F3JA 4I43B 5KDMC 1D0YA 1YKHB 4WBOA 2CA5A 3LK2B 5JDQA 5DABA 5FP3A 3ZN1B 2DLRA 2PFVA 2CLYB 4ZI3D 2NP9A 2Z6EA 5L3CB 1MMNA 3UUNA 1D1BA 1WYBA 2I59A 4YLHA 5EZYE 4IDZA 5HXRA 3V5SA 5LNKA 4B6XA 2XQYA 3EVYA 2K24A 4AQGA 2C0SA 2W63A 2Y6XA 3OKQA 5LOVE 4P09A 4BJMA 2LSJA 2EHOA 2LHRA 4UVAB 5CA0E 5FXXA 4PJLA 3R6NA 3CQCB 4EAHA 1UX5A 2EHOB 4H9QC 4TN7B 4H63H 4ERRA 3PE0A 4XZCA 4UEMA 1ZV4X 5FXVA 5FY0A 3T8OA 4MFRA 3CKDA 3HL6A 1NAFA 2VB6A 3AVSA 3KBUA 3ZJ1A 4HFVA 4L9IA 4O2BE 1HG2A 4BJNA 4XBFB 2JRKA 4PK4A 2C5KT 3DP7A 2KXPB 2V7IA 4X1KE 2W0GA 3I0OA 1AJ3A 3I0QA 4F6RC 2A72A 3PTRB 1U4QA 2OA5A 2VWAA 2J1DG 5E0OA 5DQWA 3C98B 4MLKA 3ESLA 3Q9DA 2W62A 2X51A 3QK6A 3ZCIA 3ZMTB 5BMVE 2VKJA 2Y48B 1HTJF 1FIOA 2NWBA 1H7CA 4H9OC 3OJAA 4EXTA 3R84B 3P8CD 4CI2B 2DCFA 3AA7B 3AAAB 3PUSA 3OBVE 3AAEB 2LJLA 5FNVE 4EIWA 4Z8XA 3ZMSB 3P7IA 4QXCB 4EYUA 4ZHQE 3FBZA 3ZCJA 2X9XA 1SHZC 2C5IT 4H9NC 5JR9A 2H3RA 2KMFA 3EDVA 2KNDA 4IIJE 3CWZB 3CX7B 3B57A 2HPLA 3ZN0B 3N2KE 1IAPA 1LVFA 2LE8A 1WR6A 1MMDA 3OYZA 5JR9B 4V1Av 3KV6A 1D1AA 4PAGA 1O3XA 1S94A 3J7Yq 2VASA 4BA9A 1BR1A 3H3AA 5LJMA 2LSKA 4ASKA 5EK4A 3MA9A 4CZZB 2ZM0A 4PK5A 4FI5A 3AB3B 2N9DA 4JEHB 3CX8B 3IHRA 4DMWA 4AQFC 2KINB 1HFAA 5CA1E 4G63A 4IE0A 4QXHB 1D0ZA 5JDLA 1UX4A 2PJQA 4AQFA 3EDUA 5GONE 1T98A 2HPJA 5JDHA 1MIWA 5H6QB 3HI2A 4IHJE 4EYYR 2GK9A 5LHIB 1MMAA 4MALA 1QUUA 4X1IE 3V5UA 2N1GA 3N9PA 2XASB 4GK5E 4DBQA 5JDFA 1D1CA 2KWIB 2ZM2A 5HWYA 1Z0PA 3ANWA 2LEHA 4CXWA 1LVKA 4HTEA 3SRZA 4U72A 3ANWB 5LHHB 3RYFE 2NTXA 2LSYA 2WBLA 5FXZA 2JPFA 2RA1A 3HKCE 4ISTA 3ZPOA 1B7TA 2MTQA 3KV4A 2UXNB 3D0TA 5J2TE 2IC9A 3GA8A 3RYHE 3N9OA 4GK0E 4P0BA 3ZLIA 3I9YA 2IW5B 4ZI2C 5JDGA 3K3NA 4OYKA 3F31A 2HH7A 1MIVA 2KZ7B 3N5LA 5LP6E 3MKDA 1G8XA 3Q5WA 5FY1A 3W15B 3ZMZB 4HN9A 2YK0A 5L3EB 1BR2A 3QUJA 2DI4A 2DWGA 2D5UA 3RPUA 2Y8DA 3WAJA 1HCIA 3VKGA 3KV5A 3LK3B 3N9LA 4L0RA 4HGAA 1D0XA 1IJ5A 4I4TE 1OWAA 3WAKA 5LJNA 2MBGA 2JQQA 2LHNA 2L8KA 4PJNA 2MYSA 5L2LA 4UV9B 3AAIA 4WW0A 1IJ6A 1MNDA 2X66A 3PUQA 3N9QA 4AKGA 1HX8A 3HKEE 1VRBA 3ZYMA 2LOSA 3C50A 4G2AA 1E1HB 1LKXA 2XUEA 4UIGA 2DHRA 4PFOA 3VHLA 1G73A 1Y64B 1CUNA 1U5PA 3IF8B 2X67A 2VL8A 2XHEB 2D2SA 2BZBA 5LBQB 2N2NA 4E7ZA 5LYJE 3MK7C 4GIWA 5JREA 2Q9QC 2YEVC 3I1AA 3K3QC 3M65A 4OK0A 4AXPA 3E08A 2CXDA 5FMNA 2JJ9A 5HAXA 3GN5A 3RC8A 3TKLB 2H7VC 3GN5B 4ILUA 3Q5XA 3UUMA 1HG5A 2QA7A 3SOLA 3KINB 2NTYA 5A1LA 4UVBB 3O4XE 5HXHA 3HKDE 2BVMA 4JLEA 3HA4A 2QGSA 3HKBE 3RH3A 5C8YE 3L09A 2V26A 4GOUA 4NUVA 1FMWA 4ZOLE 2LT3A 4KMCA 1BR4A 3RRWA 3NRYA 2K9AA 4I55E 3ZYLA 4QX7B 3ONXA 4ZS2A 3RX6A 4ZI2D 2X9HA 5EK2A 5J2UE 5LHGB 1UCUA 2CEAA 3FB2A 2PBIA 4UVCB 4CI3B 2ODUA 4OYJA 1ZEEA 5JH7E 2YINA 1HS7A 4UV8B 3ZJ2A 5FYMA 2XAGB 3LJCA 5JDMA 4C90A 3PU8A 4CXXA 3CVRA 4IE6A 3MACA 4IGUA 4O8SA 5F8PA 4AI6A 3U3IA 4TV9E 4CXYA 2VKOA 2CM0A 3RYIE 1FMVA 3CPZA 2M67A 4U74A 3PUGA 2C5JA 2VK9A 3LK42 3A5XA 3QC9A 2ZM8A 3RC3A 3S4UA 1VOMA 5KMGP 4MHCA 3K3OA 3RKOA 4JUYA 1EZ3A 4PJMA 2WMNA 3ZEFB 4WBNE 3Q2MA 1WLXA 1ZHCA 3F2EA 2VKDA 5EK3A 2ES0A 4C91A 5LA6E 4WNKA 5DQVA 4YHJA 1MMGA 4H9RC 1MIYA 3ZMVB 5LG4A 4QXBB 3PU3A 4DVDA 2V1DB 3ETUA 5LCYA 4HE8A 3WI3A 3MZKB 4EZ4A 4MBQA 2K48A 4A56A 5FY7A 2IAKA 5LBMA 4E7SA 4TV8E 4H63V 3E0ZA 4BAYB 4EZHA 1MNEA 3FHNA 2Q9QD 2W00A 3MJXA 3BQLA 1QSDA 5H6RB 3UFEA 4DBRA 3B13A 4FJOA 4ZI7E 2IC6A 3UUXB 4I50E 2V7KA 4DO0A 3IBPA 3L3PA 3DTOA 3I9WA 2D0UA 3AVRA 2CLYC 2CWOA 3H37A 2LOPA 4DMVA 2D0TA 4UF0A 4QX8B 3PUAA 4ISSA 4O4JE 2MOZA 3C4ZA 5L3DB 5JQGE 4UF0B 1OXZA 3HR0A 3CX6B 2L9QA 2WSSV 2W61A 3F57A 3ZYKA 2WM9A 3SWHA 3ZC0A 1BR0A 4O2AE 4AKHA 4QWNB 4O4LE 3GWHA 4NUUA 3KBTA 4HEAA 2WWUA 2EHOC 3JC6C 5JRCA 3FXDB 4PJJA 1NWMX 2BVLA 5JRCB 3RRCA 4YJ3E 3FBLA 4KP3C 2X9YA 3U78A 3RYCE 5IHYA 4O4IE 3MXZA 4HKAA 5HXEA 1HF8A 3KV9A 1SA0E 2A2FX 4IE7A 5L3GB 5ETWA 1X79A 3AA6B 3E22E 2CXFA 5J1GA 3BQKA 2CMRA 3J9X1 3ZC1A 2VKHA 3ETVA 3GMIA 2RP4A 5JDNA 2ZMAA 3ZMUB 5LGUB 2XTLA 4N78D 2CCQA 4CQIA 1FEWA 5TAOA 5ADXL 2LM9A 5LXTE 2L3LA 5M4YA 4TUYE 2CWYA 2Q9QA 4OFZA 3BK9A 2ZLYA 5CB4E 1S35A 2X9WA 2Q9QB 3OYXA 5AFUL 2LSIA 3C51A 3UTKA 3O9XA 3O1JA 2P9BA 3O1IA 3SS1A 3C4XA 3KDSE 3NZQA 3NBXX 4TZ4C 4X20E 2NW9A 4ANJA 3VU7H 2E9XD 2XAHB 2V7JA 3EUHA 3C4WA 2G0UA 5HXSA 1LRZA 3KVBA 4AKRB 4ZI3C 2A3DA 2JMHA 5LGTB 5JR9C 4P0AA 2JMKA 4PW8A 5JVDE 2ACXA 4H9SE 5HWXA 3UT5E 2WAUA 2E8IA 1YW0A 5FXWA 3VKHA 2YU1A 4EOZB 4GYRA 4IE4A 4H9PC 2V7MA 2XAFB 3N2OA 4M1PA 4K0UA 3CMLA 5L3BB 3N9NA 3N2GE 4YFSA 2LSGA 3K8PC 4OHFA 1KNZA 2KWHA 2CE7A 1WYCA 2CXLA 3DJBA 4XAXB 2DWKA 4JEUB 1WRDA 2V7LA 2ODVA 3FXEB 1ZKEA 4PFPA 2DNXA 2X0LB 5HYAA 4DNDA 2EHOD 3JC6D 2KT9A 4GYSA 3KFWX 2X68A 4PK6A 3PURA 3NRXA 2BDEA 4YJ2E 4L5GA 1V9DA 4ADZA 2WMOA 3N9MA 5L3FB 2YU2A 3IEEA 4TX5A 1YD8G 4AKLA 2H7OA 4O4HE 2UXXB 2XAJB 3BQIA 4ZS3A 4CI1B 4IE5A 3AA1B 3AA0B 2NOXA 5HXCA 4QKNA 3NZPA 3PDYA 1KK7A 2K5BB 4J2CA 3KVAA 5KX5E 3LFMA 3LG7A 2E9XC 4UXNB 5IYZE 3O1HA 4AKIA 4QHOA 2B1EA 3CQXC 4KUMB 4PNIA 4UELA 4KBMB 3LBXA 2XAQB 2KLQA 1IZNB 2NW8A 2E9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYK A;  5LJM A;  4JUY A;  2HPJ A;  4P09 A;  4OYJ A;  5LJN A;  2CM0 A;  2D5U A;  4P0B A;  2HPL A;  4P0A A;  2CCQ A; 
#chains in the Genus database with same CATH topology
 3LBX B;  3K1S A;  4A97 A;  1YKE B;  4X1Y E;  5CJ5 A;  5DJQ C;  3C64 A;  3B5M A;  4I43 B;  1ZOY A;  1D0Y A;  4KHP T;  3AEB A;  2DLR A;  1KF6 A;  5L3C B;  1MMN A;  2H88 A;  4YLH A;  4IDZ A;  2K24 A;  4LF5 T;  4GKK T;  2EHO A;  5FXX A;  2WCA A;  3CQC B;  4DUZ T;  2EHO B;  2XSA A;  4ERR A;  2XQ9 A;  5FXV A;  5AQR B;  3KBU A;  1HG2 A;  4PK4 A;  2KXP B;  2V7I A;  2W0G A;  3I0O A;  1AJ3 A;  3UU3 A;  2VWA A;  4QH4 A;  5E0O A;  5AQK B;  2RPA A;  3Q9D A;  5BMV E;  2BBJ A;  2Y48 B;  1HTJ F;  4TNV A;  4LFC T;  3OPC A;  3OJA A;  4EXT A;  3R84 B;  5HEJ A;  5LG3 A;  2CHO A;  3PUS A;  3AAE B;  4EIW A;  4Z8X A;  3ZMS B;  3PUX F;  5ABF A;  5ABF B;  2X9X A;  4U33 A;  4H9N C;  2H3R A;  3EDV A;  3EHZ A;  3FZF B;  2HPL A;  3OYZ A;  1X9B A;  1J1J A;  2BG9 E;  2MPK A;  3QOF A;  3H3A A;  2WDQ A;  2LSK A;  4ASK A;  3MA9 A;  3RF1 A;  4KHZ F;  4JEH B;  4QXH B;  1D0Z A;  4ZXL A;  2CBI A;  5FKY A;  4AQF A;  2XQ4 A;  4AQY T;  2WU5 A;  4IHJ E;  3PV0 F;  3AEC A;  4DBQ A;  5HWY A;  1Z0P A;  2XQ7 A;  1WCR A;  3RYF E;  2LSY A;  2WBL A;  3RKG A;  4A5X A;  3ZPO A;  2W4X A;  3KV4 A;  4YTN A;  3GA8 A;  4GK0 E;  2KSR A;  3X1D A;  3I9Y A;  2IW5 B;  3F31 A;  2HH7 A;  2KZ7 B;  3MKD A;  3Q5W A;  2DI4 A;  3KV5 A;  3OTO T;  4I4T E;  1OWA A;  2MBG A;  2LHN A;  2L8K A;  3AAI A;  2WZI A;  3PUQ A;  1HX8 A;  3JAD A;  1YQ4 A;  3C50 A;  4G2A A;  3PUW F;  1T8B A;  2DHR A;  5LMU T;  3IF8 B;  3RQW A;  2Q9Q C;  3K3Q C;  5FMN A;  3T1H T;  3GN5 A;  3TKL B;  3GN5 B;  3O4X E;  4JLE A;  5C8Y E;  3ZST A;  2A9U A;  2LT3 A;  3RRW A;  3NRY A;  4NPP A;  1GQE A;  5LYJ E;  4QX7 B;  4ZS2 A;  5LHG B;  2ODU A;  4OYJ A;  3EI0 A;  4LML A;  3CIR A;  1XMO T;  4UV8 B;  5JDM A;  1XMQ T;  4IE6 A;  3MAC A;  3RGL A;  3U3I A;  3RQU A;  2QYW A;  2XM1 A;  2CM0 A;  4U74 A;  2VUR A;  3A5X A;  2ZM8 A;  5AQH B;  5F5W A;  1VOM A;  4MHC A;  2FUP A;  3RKO A;  2WP9 A;  4JUY A;  2PTF A;  2YKS A;  1KEY A;  2ES0 A;  4WNK A;  4JBW F;  4YHH T;  4YSX A;  1N34 T;  2WZH A;  4DV0 T;  2V1D B;  2K48 A;  4ZZC A;  5ABH A;  1OED C;  2W00 A;  2WB5 A;  4FJO A;  3JCF A;  3IBP A;  3DTO A;  3UU8 A;  2ZM6 T;  4QX8 B;  3PUA A;  3TLU A;  2WSS V;  5FL0 A;  2W61 A;  1BR0 A;  3ZC0 A;  2D9D A;  2UXD T;  4AKH A;  4QWN B;  2EHO C;  2BVL A;  4ILB A;  4JI0 T;  5AQP B;  2VQF T;  4O4I E;  5L47 A;  1HF8 A;  4IE7 A;  4YSZ A;  5J1G A;  3BQK A;  2YOE A;  5AQF B;  4B3T T;  3ZMU B;  5LGU B;  1FEW A;  5TAO A;  1VCS A;  4F8H A;  5CGM A;  4LF6 T;  4QH1 A;  1S35 A;  3IA3 A;  3OYX A;  4COF A;  3O9X A;  4I0U A;  4DR3 T;  2E9X D;  5HXS A;  4AKR B;  3KVB A;  4ZI3 C;  2JMH A;  5LGT B;  4P0A A;  2JMK A;  2UUB T;  3ZKR A;  2UUA T;  2WAU A;  1YW0 A;  3VKH A;  4IE4 A;  4K0U A;  2LSG A;  1Y01 A;  1KNZ A;  3RIU C;  2KWH A;  3DJB A;  4XAX B;  1WRD A;  4X64 T;  4DV3 T;  5HYA A;  2X0L B;  3KFW X;  3ZSS A;  2R6G F;  4KI0 F;  4CN1 A;  2WMO A;  3N9M A;  2H7O A;  4O4H E;  2XAJ B;  4HWH A;  4B3R T;  4IE5 A;  3AA1 B;  5HXC A;  3NZP A;  4J2C A;  2K5B B;  3LG7 A;  4UXN B;  5HEU A;  3O1H A;  4AKI A;  3L8R A;  4QHO A;  2B1E A;  3CQX C;  4KUM B;  2NW8 A;  2ACZ A;  4A56 A;  1L0V A;  3UUL A;  3CQG B;  5LGN B;  4IDO A;  3RHW A;  1KNR A;  2PFV A;  2XQ6 A;  2Z6E A;  5HXR A;  5HCM A;  2XZE A;  1M62 A;  5FL1 A;  2C0S A;  4DV7 T;  2W63 A;  1XZY A;  2Y6X A;  5LOV E;  4HFH A;  2LHR A;  4EAH A;  4TN7 B;  4H9Q C;  2JIW A;  4WZX A;  4XZC A;  4UEM A;  3CKD A;  2H89 A;  3AE9 A;  1NAF A;  2VB6 A;  3AVS A;  3ZJ1 A;  4BJN A;  3NVO A;  4X1K E;  2OA5 A;  5DQW A;  3C98 B;  4MLK A;  2W62 A;  2BS3 A;  3ZCI A;  1DU2 A;  3RIA A;  4DR2 T;  1M7K A;  2WQY A;  4H9O C;  1VCT A;  3AAA B;  3AE4 A;  3OBV E;  2LJL A;  5FNV E;  3FZM B;  2I6H A;  4LFA T;  5L4H A;  4ZHQ E;  3FBZ A;  5AQS B;  2C5I T;  5AQI B;  3CWZ B;  3CX7 B;  2UUC T;  2CHN A;  4ZEY A;  2FJB A;  1IAP A;  4IL4 A;  1D1A A;  1S94 A;  5EK4 A;  4CZZ B;  1T72 A;  4P1N A;  4DMW A;  2KIN B;  1HFA A;  3UU5 A;  1IBM T;  1XNQ T;  3ZT7 A;  1UX4 A;  5GON E;  1MIW A;  3HI2 A;  4EYY R;  1MMA A;  4MAL A;  2N1G A;  3N9P A;  2KWI B;  2ZM2 A;  2VL0 A;  4CXW A;  1LVK A;  3VRB A;  3SRZ A;  4U72 A;  3M3Z B;  1B7T A;  2MTQ A;  3D0T A;  4DV4 T;  2IC9 A;  4DV2 T;  4P0B A;  3ABV A;  4ZI2 C;  3K3N A;  4OYK A;  4JI6 T;  5LP6 E;  1G8X A;  3ZMZ B;  4K0K T;  4HN9 A;  2E5L T;  2YK0 A;  5L3E B;  1BR2 A;  3QUJ A;  3P4W A;  3RPU A;  2D5U A;  3WAJ A;  2Y8D A;  1N32 T;  3VKG A;  3LK3 B;  3AEF A;  4KX6 A;  2VVN A;  4YY3 T;  2DL1 A;  1IJ5 A;  4HFI A;  5LJN A;  4PJN A;  5FVL A;  3PUY F;  1IJ6 A;  4AKG A;  1E1H B;  2XUE A;  4UIG A;  4HFE A;  4LF4 T;  1UK5 A;  4IDP A;  3AE2 A;  4AIU A;  1CUN A;  2XHE B;  2W66 A;  5AQG B;  2YEV C;  4OK0 A;  2CXD A;  2YDQ A;  2B76 A;  3RC8 A;  1KFY A;  3JAE A;  3UUM A;  1HG5 A;  3KIN B;  3JAF A;  3QB5 K;  4CN6 A;  2V26 A;  4GOU A;  1FMW A;  1BR4 A;  2VQE T;  3ZYL A;  5J2U E;  2X9H A;  2XM2 A;  2CEA A;  3FB2 A;  4CI3 B;  2LKH A;  2UXC T;  2BS4 A;  5FYM A;  3LJC A;  4B3M T;  4O8S A;  4TWF A;  2VKO A;  5AQJ B;  1HNX T;  3S4U A;  3K3O A;  2WMN A;  3QNU A;  5JTG A;  1ZHC A;  4U7I A;  5EK3 A;  2VKD A;  5IUX A;  4C91 A;  3Q5E A;  4H9R C;  1MIY A;  3PU3 A;  4DVD A;  4EZ4 A;  3UQ7 A;  3MJX A;  3LDQ B;  1W0A A;  3UUX B;  3H3M A;  4DO0 A;  3L3P A;  2D0U A;  3AVR A;  2X0Y A;  4DMV A;  2D0T A;  4ISS A;  2MOZ A;  3ZYK A;  4O2A E;  2LKG A;  4O4L E;  3VR8 A;  4ILC A;  5JRC A;  3JC6 C;  5JRC B;  4YJ3 E;  3MXZ A;  4HWI B;  3AEA A;  2IIU A;  4DR1 T;  2XQ5 A;  3E22 E;  4X5T A;  2CXF A;  2CMR A;  3ZC1 A;  3ETV A;  2RP4 A;  5ADX L;  2JQ9 A;  4OFZ A;  2ZLY A;  2X9W A;  2BS2 A;  4YTP A;  3L39 A;  2P9B A;  3O1I A;  1XDO A;  3C4X A;  3KDS E;  3NBX X;  4X20 E;  2NW9 A;  4ANJ A;  3EAB A;  2XAH B;  3FZH B;  5IWA T;  2G0U A;  1LRZ A;  2A3D A;  2YN6 A;  4HFC A;  5JVD E;  5FXW A;  1W09 A;  2LLY A;  4GYR A;  4H9P C;  3TLW A;  2V7M A;  2XAF B;  4M1P A;  3CML A;  5L3B B;  5KXJ A;  2BG9 C;  3K8P C;  4EED A;  1WYC A;  3UU4 A;  1HNZ T;  2W2U A;  2DWK A;  4JI4 T;  1FJG T;  4PK6 A;  3NRX A;  5L3F B;  2J47 A;  1YD8 G;  3FZL B;  1W9R A;  2OLT A;  5KX5 E;  3KVA A;  4X62 T;  5AQU B;  2WWV A;  3A7M A;  4UEL A;  1W0B A;  2XAQ B;  4JI1 T;  2E9X A;  4NXM T;  1US7 B;  2SPC A;  2E9X B;  4EB6 E;  5F3J A;  5LMN T;  4YTM A;  1YKH B;  5AQN B;  4WBO A;  1CHU A;  3LK2 B;  5JDQ A;  4EGW A;  4DR6 T;  1HNW T;  2CLY B;  3TLS A;  5EZY E;  3V5S A;  4B6X A;  5HEO A;  2XQY A;  3EVY A;  4YXD A;  2E5V A;  2LSJ A;  3PUV F;  3EAM A;  1UGO A;  4UVA B;  4PJL A;  3R6N A;  1UX5 A;  4H63 H;  4IT4 A;  3T8O A;  1ZV4 X;  4MFR A;  2XQA A;  4L9I A;  4O2B E;  4XBF B;  3AEG A;  4U31 A;  4GKJ T;  3UFG A;  3RLF F;  4F6R C;  2A72 A;  1SUM B;  3ESL A;  3SFE A;  1I94 T;  3ZMT B;  5AQT B;  1H7C A;  3AXJ A;  3AA7 B;  2V5D A;  3AXJ B;  4EYU A;  3ZCJ A;  1SHZ C;  5JR9 A;  2KND A;  4IIJ E;  3B57 A;  3ZN0 B;  3N2K E;  5JR9 B;  1LVF A;  2LE8 A;  1MMD A;  4V1A v;  2MAW A;  1O3X A;  3ZT5 A;  1BR1 A;  5AQQ B;  5LJM A;  2UU9 T;  1QLB A;  1XWM A;  4LF8 T;  2HN1 A;  2LM2 A;  4FI5 A;  3AB3 B;  4DR5 T;  3CX8 B;  3IHR A;  4AQF C;  3CK6 A;  4G63 A;  3AED A;  5JDL A;  5CFB A;  2PJQ A;  4JI3 T;  3EDU A;  1T98 A;  2HPJ A;  5J0Z A;  4U7Y A;  2GK9 A;  1QUU A;  2BBH A;  4X1I E;  3RIF A;  4GK5 E;  1D1C A;  3ANW A;  4HTE A;  3ANW B;  3HKC E;  4IST A;  4B3S T;  5J2T E;  3RYH E;  2WU2 A;  3N5L A;  3W15 B;  2X0H A;  5FY1 A;  3VR9 A;  2DWG A;  2OV9 A;  4L0R A;  4HGA A;  2M6I A;  3WAK A;  2IDO B;  3AEE A;  2JQQ A;  2MYS A;  5L2L A;  1N33 T;  3PUZ F;  4UV9 B;  4WW0 A;  4TNW A;  2J4G A;  3HKE E;  1VRB A;  1YQ3 A;  4PFO A;  1G73 A;  1Y64 B;  3UQ4 A;  2UXB T;  2VL8 A;  2D2S A;  1T7S A;  2BZB A;  2N2N A;  4E7Z A;  5JRE A;  4GIW A;  3I1A A;  3M65 A;  4AXP A;  3E08 A;  2JJ9 A;  2H7V C;  4OX9 T;  4ILU A;  3P4S A;  2JQH A;  5HXH A;  3HKD E;  2BVM A;  3HKB E;  3L09 A;  4ZOL E;  2FJA A;  2K9A A;  4Q25 A;  2PBI A;  4UVC B;  1ZEE A;  5JH7 E;  2YIN A;  2XAG B;  4C90 A;  3P4P A;  3PU8 A;  4Z90 A;  5F8P A;  1IBK T;  4TV9 E;  3RYI E;  3CPZ A;  2VK9 A;  5AQL B;  3RC3 A;  5KMG P;  2IHR 1;  4YSY A;  2E2A A;  3ZEF B;  4WBN E;  1WLX A;  3F2E A;  1MMG A;  5LG4 A;  3QB5 A;  3Q5D A;  3ETU A;  3MZK B;  5FY7 A;  4TV8 E;  4H63 V;  4BAY B;  4EZH A;  2Q9Q D;  3BQL A;  1QSD A;  3UFE A;  2IC6 A;  1OED A;  4JV5 T;  2V7K A;  1OED B;  2CLY C;  2CWO A;  3H37 A;  2LOP A;  4UF0 A;  4HWD A;  3C4Z A;  4IL9 A;  4UF0 B;  4EEB A;  1OXZ A;  3HR0 A;  3CX6 B;  2L9Q A;  3P50 A;  2WDR A;  2WM9 A;  3P4Q A;  3GWH A;  4NUU A;  3KBT A;  4PJJ A;  4KP3 C;  2X9Y A;  3RYC E;  5IHY A;  2BKO A;  1UUR A;  1X79 A;  1ZP0 A;  3AA6 B;  4YT0 A;  3J9X 1;  2VKH A;  3GMI A;  2ZMA A;  2XTL A;  2CCQ A;  4CQI A;  3NKZ A;  5LXT E;  5M4Y A;  5CB4 E;  3UTK A;  3SS1 A;  4IRE A;  4TZ4 C;  3VU7 H;  3EUH A;  4HFD A;  1WR0 A;  3C4W A;  3PJA A;  4HFB A;  4A98 A;  5JR9 C;  4WYV A;  1N36 T;  4H9S E;  4IDN A;  5HWX A;  3UT5 E;  2E8I A;  1KNP A;  2YU1 A;  3N2G E;  4YFS A;  2VVS A;  4OHF A;  4Z91 A;  3P4R A;  2CXL A;  2V7L A;  2BKP A;  3FXE B;  2FJD A;  1ZKE A;  2V8S V;  3RIU A;  4DND A;  2EHO D;  1E2A A;  4U3C A;  5L4E A;  4L5G A;  1V9D A;  1HR0 T;  2XQ3 A;  2YU2 A;  5C3J A;  3IEE A;  4TX5 A;  4AKL A;  3AE7 A;  3OVU A;  3AA0 B;  2NOX A;  5HEG A;  2WDV A;  3PDY A;  1KK7 A;  5IYZ E;  1JNR A;  2IML A;  1OED E;  4LF9 T;  4KBM B;  4QH5 A;  1SE7 A;  1XNR T;  5BR8 T;  2HHH T;  4NIQ A;  2NW7 A;  2PG8 A;  5KDM C;  2CA5 A;  5DAB A;  5FP3 A;  3ZN1 B;  4ZI3 D;  4X65 T;  2NP9 A;  3ONJ A;  3UUN A;  1D1B A;  1WYB A;  2I59 A;  5LNK A;  1NEK A;  4AQG A;  4DID B;  3OKQ A;  4P09 A;  4BJM A;  5CA0 E;  3PE0 A;  5FY0 A;  3FZK B;  2BKN A;  3HL6 A;  2AE9 A;  4HFV A;  3LSV A;  2JRK A;  2C5K T;  3DP7 A;  1I6Z A;  3I0Q A;  3PTR B;  1U4Q A;  2J1D G;  2X51 A;  3QK6 A;  4EV6 A;  1XDP A;  2VKJ A;  1FIO A;  2NWB A;  3P8C D;  4CI2 B;  2DCF A;  1J5W A;  2CRB A;  3P7I A;  4QXC B;  4TWH A;  2KMF A;  4U2Z A;  1WR6 A;  4DR4 T;  3KV6 A;  4PAG A;  3J7Y q;  2I0M A;  2VAS A;  4BA9 A;  3T1Y T;  2V6X A;  2ZM0 A;  4PK5 A;  2N9D A;  5CA1 E;  3AE5 A;  2CPT A;  4IE0 A;  3SFD A;  3TLV A;  5C2T A;  5JDH A;  2W67 A;  5H6Q B;  1R8I A;  4JI2 T;  4LMJ A;  5LHI B;  2QRX A;  3V5U A;  2XAS B;  2V5C A;  5JDF A;  4U2Y A;  2LEH A;  5LHH B;  2NTX A;  5FXZ A;  3AE1 A;  2JPF A;  2RA1 A;  3VRA A;  4HWF A;  1Z8U A;  4UR9 A;  2UXN B;  3N9O A;  3ZLI A;  5JDG A;  1MIV A;  3ONL C;  1HCI A;  5AQO B;  3N9L A;  4DV6 T;  2YDS A;  1D0X A;  2XQ8 A;  3A8Y C;  3G06 A;  1MND A;  2X66 A;  3N9Q A;  4ILA A;  3ZYM A;  2LOS A;  4JYA T;  4DR7 T;  5HCJ A;  1LKX A;  5AQV B;  3VHL A;  2XJ7 A;  3AE3 A;  1U5P A;  2X67 A;  4CN4 A;  4NXN T;  1E7P A;  5LBQ B;  3MK7 C;  2FBW A;  2XY8 B;  5HAX A;  1UUS A;  4LMK A;  5HEH A;  3Q5X A;  2QA7 A;  3SOL A;  2NTY A;  5A1L A;  4UVB B;  2CBJ A;  3HA4 A;  2QGS A;  3RH3 A;  4DV1 T;  2K3W A;  4NUV A;  4KMC A;  4I55 E;  2QVA A;  4ZI2 D;  3ONX A;  3RX6 A;  5EK2 A;  1UCU A;  4JI7 T;  1NEN A;  2HN2 A;  1HS7 A;  3ZJ2 A;  2AXD S;  3RI5 A;  4CXX A;  3CVR A;  4IGU A;  5LB7 B;  4AI6 A;  2YDR A;  4CXY A;  1FMV A;  2M67 A;  3PUG A;  2C5J A;  3LK4 2;  3QC9 A;  2IUB A;  3AE6 A;  4AIS A;  4DUY T;  1EZ3 A;  4PJM A;  3Q2M A;  5LA6 E;  5DQV A;  4YHJ A;  3ZMV B;  4QXB B;  5ABG A;  5LCY A;  3WI3 A;  4HE8 A;  4LFB T;  4MBQ A;  4E7S A;  2IAK A;  5LBM A;  3E0Z A;  1MNE A;  3FHN A;  2FJE A;  1YXR A;  5H6R B;  4DBR A;  3B13 A;  5AQM B;  4ZI7 E;  4I50 E;  3TLT A;  3I9W A;  4HWC A;  2F4V T;  4O4J E;  5L3D B;  2J62 A;  5JQG E;  1JNZ A;  4ZZB A;  3F57 A;  1WFD A;  3SWH A;  2M6B A;  4HEA A;  2WWU A;  5ABE A;  3FXD B;  2XSB A;  1NWM X;  3RRC A;  2WS3 A;  3FBL A;  3NWI A;  2LRK A;  2XPK A;  4JI5 T;  3U78 A;  2NR4 A;  4HKA A;  1J5E T;  5HXE A;  3KV9 A;  1SA0 E;  2A2F X;  5L3G B;  4TWD A;  5ETW A;  4LF7 T;  3AE8 A;  5JDN A;  4N78 D;  3ZT6 A;  2LM9 A;  2L3L A;  4TUY E;  2CWY A;  2Q9Q A;  3BK9 A;  2Q9Q B;  3UUB A;  4DV5 T;  5AFU L;  5FVK A;  2LSI A;  3C51 A;  3O1J A;  3NZQ A;  2V7J A;  4PW8 A;  2ACX A;  2V6Y A;  4EOZ B;  2V6Y B;  3N2O A;  2JQK A;  3N9N A;  2LRL A;  2CE7 A;  4JI8 T;  3PJA J;  4JEU B;  4X66 T;  2ODV A;  2BG9 A;  1IBL T;  4PFP A;  2DNX A;  3JC6 D;  2KT9 A;  4GYS A;  2BG9 B;  2X68 A;  3PUR A;  2BDE A;  4YJ2 E;  4ADZ A;  1HX1 B;  2UXX B;  3BQI A;  4ZS3 A;  4CI1 B;  4QKN A;  3LFM A;  2WY2 A;  3UU6 A;  2E9X C;  4IDQ A;  4PNI A;  3LBX A;  2KLQ A;  1IZN B; 
#chains in the Genus database with same CATH homology
 3LBX B;  1YKE B;  4X1Y E;  3UUL A;  1US7 B;  2SPC A;  5DJQ C;  2E9X B;  4EB6 E;  2NW7 A;  3CQG B;  2PG8 A;  3C64 A;  5LGN B;  5F3J A;  4I43 B;  5KDM C;  1D0Y A;  1YKH B;  4WBO A;  2CA5 A;  3LK2 B;  5JDQ A;  5DAB A;  5FP3 A;  3ZN1 B;  2DLR A;  2PFV A;  2CLY B;  4ZI3 D;  2NP9 A;  2Z6E A;  5L3C B;  1MMN A;  3UUN A;  1D1B A;  1WYB A;  2I59 A;  4YLH A;  5EZY E;  4IDZ A;  5HXR A;  3V5S A;  5LNK A;  4B6X A;  2XQY A;  3EVY A;  2K24 A;  4AQG A;  2C0S A;  2W63 A;  2Y6X A;  3OKQ A;  5LOV E;  4P09 A;  4BJM A;  2LSJ A;  2EHO A;  2LHR A;  4UVA B;  5CA0 E;  5FXX A;  4PJL A;  3R6N A;  3CQC B;  4EAH A;  1UX5 A;  2EHO B;  4H9Q C;  4TN7 B;  4H63 H;  4ERR A;  3PE0 A;  4XZC A;  4UEM A;  1ZV4 X;  5FXV A;  5FY0 A;  3T8O A;  4MFR A;  3CKD A;  3HL6 A;  1NAF A;  2VB6 A;  3AVS A;  3KBU A;  3ZJ1 A;  4HFV A;  4L9I A;  4O2B E;  1HG2 A;  4BJN A;  4XBF B;  2JRK A;  4PK4 A;  2C5K T;  3DP7 A;  2KXP B;  2V7I A;  4X1K E;  2W0G A;  3I0O A;  1AJ3 A;  3I0Q A;  4F6R C;  2A72 A;  3PTR B;  1U4Q A;  2OA5 A;  2VWA A;  2J1D G;  5E0O A;  5DQW A;  3C98 B;  4MLK A;  3ESL A;  3Q9D A;  2W62 A;  2X51 A;  3QK6 A;  3ZCI A;  3ZMT B;  5BMV E;  2VKJ A;  2Y48 B;  1HTJ F;  1FIO A;  2NWB A;  1H7C A;  4H9O C;  3OJA A;  4EXT A;  3R84 B;  3P8C D;  4CI2 B;  2DCF A;  3AA7 B;  3AAA B;  3PUS A;  3OBV E;  3AAE B;  2LJL A;  5FNV E;  4EIW A;  4Z8X A;  3ZMS B;  3P7I A;  4QXC B;  4EYU A;  4ZHQ E;  3FBZ A;  3ZCJ A;  2X9X A;  1SHZ C;  2C5I T;  4H9N C;  5JR9 A;  2H3R A;  2KMF A;  3EDV A;  2KND A;  4IIJ E;  3CWZ B;  3CX7 B;  3B57 A;  2HPL A;  3ZN0 B;  3N2K E;  1IAP A;  1LVF A;  2LE8 A;  1WR6 A;  1MMD A;  3OYZ A;  5JR9 B;  4V1A v;  3KV6 A;  1D1A A;  4PAG A;  1O3X A;  1S94 A;  3J7Y q;  2VAS A;  4BA9 A;  1BR1 A;  3H3A A;  5LJM A;  2LSK A;  4ASK A;  5EK4 A;  3MA9 A;  4CZZ B;  2ZM0 A;  4PK5 A;  4FI5 A;  3AB3 B;  2N9D A;  4JEH B;  3CX8 B;  3IHR A;  4DMW A;  4AQF C;  2KIN B;  1HFA A;  5CA1 E;  4G63 A;  4IE0 A;  4QXH B;  1D0Z A;  5JDL A;  1UX4 A;  2PJQ A;  4AQF A;  3EDU A;  5GON E;  1T98 A;  2HPJ A;  5JDH A;  1MIW A;  5H6Q B;  3HI2 A;  4IHJ E;  4EYY R;  2GK9 A;  5LHI B;  1MMA A;  4MAL A;  1QUU A;  4X1I E;  3V5U A;  2N1G A;  3N9P A;  2XAS B;  4GK5 E;  4DBQ A;  5JDF A;  1D1C A;  2KWI B;  2ZM2 A;  5HWY A;  1Z0P A;  3ANW A;  2LEH A;  4CXW A;  1LVK A;  4HTE A;  3SRZ A;  4U72 A;  3ANW B;  5LHH B;  3RYF E;  2NTX A;  2LSY A;  2WBL A;  5FXZ A;  2JPF A;  2RA1 A;  3HKC E;  4IST A;  3ZPO A;  1B7T A;  2MTQ A;  3KV4 A;  2UXN B;  3D0T A;  5J2T E;  2IC9 A;  3GA8 A;  3RYH E;  3N9O A;  4GK0 E;  4P0B A;  3ZLI A;  3I9Y A;  2IW5 B;  4ZI2 C;  5JDG A;  3K3N A;  4OYK A;  3F31 A;  2HH7 A;  1MIV A;  2KZ7 B;  3N5L A;  5LP6 E;  3MKD A;  1G8X A;  3Q5W A;  5FY1 A;  3W15 B;  3ZMZ B;  4HN9 A;  2YK0 A;  5L3E B;  1BR2 A;  3QUJ A;  2DI4 A;  2DWG A;  2D5U A;  3RPU A;  2Y8D A;  3WAJ A;  1HCI A;  3VKG A;  3KV5 A;  3LK3 B;  3N9L A;  4L0R A;  4HGA A;  1D0X A;  1IJ5 A;  4I4T E;  1OWA A;  3WAK A;  5LJN A;  2MBG A;  2JQQ A;  2LHN A;  2L8K A;  4PJN A;  2MYS A;  5L2L A;  4UV9 B;  3AAI A;  4WW0 A;  1IJ6 A;  1MND A;  2X66 A;  3PUQ A;  3N9Q A;  4AKG A;  1HX8 A;  3HKE E;  1VRB A;  3ZYM A;  2LOS A;  3C50 A;  4G2A A;  1E1H B;  1LKX A;  2XUE A;  4UIG A;  2DHR A;  4PFO A;  3VHL A;  1G73 A;  1Y64 B;  1CUN A;  1U5P A;  3IF8 B;  2X67 A;  2VL8 A;  2XHE B;  2D2S A;  2BZB A;  5LBQ B;  2N2N A;  4E7Z A;  5LYJ E;  3MK7 C;  4GIW A;  5JRE A;  2Q9Q C;  2YEV C;  3I1A A;  3K3Q C;  3M65 A;  4OK0 A;  4AXP A;  3E08 A;  2CXD A;  5FMN A;  2JJ9 A;  5HAX A;  3GN5 A;  3RC8 A;  3TKL B;  2H7V C;  3GN5 B;  4ILU A;  3Q5X A;  3UUM A;  1HG5 A;  2QA7 A;  3SOL A;  3KIN B;  2NTY A;  5A1L A;  4UVB B;  3O4X E;  5HXH A;  3HKD E;  2BVM A;  4JLE A;  3HA4 A;  2QGS A;  3HKB E;  3RH3 A;  5C8Y E;  3L09 A;  2V26 A;  4GOU A;  4NUV A;  1FMW A;  4ZOL E;  2LT3 A;  4KMC A;  1BR4 A;  3RRW A;  3NRY A;  2K9A A;  4I55 E;  3ZYL A;  4QX7 B;  3ONX A;  4ZS2 A;  3RX6 A;  4ZI2 D;  2X9H A;  5EK2 A;  5J2U E;  5LHG B;  1UCU A;  2CEA A;  3FB2 A;  2PBI A;  4UVC B;  4CI3 B;  2ODU A;  4OYJ A;  1ZEE A;  5JH7 E;  2YIN A;  1HS7 A;  4UV8 B;  3ZJ2 A;  5FYM A;  2XAG B;  3LJC A;  5JDM A;  4C90 A;  3PU8 A;  4CXX A;  3CVR A;  4IE6 A;  3MAC A;  4IGU A;  4O8S A;  5F8P A;  4AI6 A;  3U3I A;  4TV9 E;  4CXY A;  2VKO A;  2CM0 A;  3RYI E;  1FMV A;  3CPZ A;  2M67 A;  4U74 A;  3PUG A;  2C5J A;  2VK9 A;  3LK4 2;  3A5X A;  3QC9 A;  2ZM8 A;  3RC3 A;  3S4U A;  1VOM A;  5KMG P;  4MHC A;  3K3O A;  3RKO A;  4JUY A;  1EZ3 A;  4PJM A;  2WMN A;  3ZEF B;  4WBN E;  3Q2M A;  1WLX A;  1ZHC A;  3F2E A;  2VKD A;  5EK3 A;  2ES0 A;  4C91 A;  5LA6 E;  4WNK A;  5DQV A;  4YHJ A;  1MMG A;  4H9R C;  1MIY A;  3ZMV B;  5LG4 A;  4QXB B;  3PU3 A;  4DVD A;  2V1D B;  3ETU A;  5LCY A;  4HE8 A;  3WI3 A;  3MZK B;  4EZ4 A;  4MBQ A;  2K48 A;  4A56 A;  5FY7 A;  2IAK A;  5LBM A;  4E7S A;  4TV8 E;  4H63 V;  3E0Z A;  4BAY B;  4EZH A;  1MNE A;  3FHN A;  2Q9Q D;  2W00 A;  3MJX A;  3BQL A;  1QSD A;  5H6R B;  3UFE A;  4DBR A;  3B13 A;  4FJO A;  4ZI7 E;  2IC6 A;  3UUX B;  4I50 E;  2V7K A;  4DO0 A;  3IBP A;  3L3P A;  3DTO A;  3I9W A;  2D0U A;  3AVR A;  2CLY C;  2CWO A;  3H37 A;  2LOP A;  4DMV A;  2D0T A;  4UF0 A;  4QX8 B;  3PUA A;  4ISS A;  4O4J E;  2MOZ A;  3C4Z A;  5L3D B;  5JQG E;  4UF0 B;  1OXZ A;  3HR0 A;  3CX6 B;  2L9Q A;  2WSS V;  2W61 A;  3F57 A;  3ZYK A;  2WM9 A;  3SWH A;  3ZC0 A;  1BR0 A;  4O2A E;  4AKH A;  4QWN B;  4O4L E;  3GWH A;  4NUU A;  3KBT A;  4HEA A;  2WWU A;  2EHO C;  3JC6 C;  5JRC A;  3FXD B;  4PJJ A;  1NWM X;  2BVL A;  5JRC B;  3RRC A;  4YJ3 E;  3FBL A;  4KP3 C;  2X9Y A;  3U78 A;  3RYC E;  5IHY A;  4O4I E;  3MXZ A;  4HKA A;  5HXE A;  1HF8 A;  3KV9 A;  1SA0 E;  2A2F X;  4IE7 A;  5L3G B;  5ETW A;  1X79 A;  3AA6 B;  3E22 E;  2CXF A;  5J1G A;  3BQK A;  2CMR A;  3J9X 1;  3ZC1 A;  2VKH A;  3ETV A;  3GMI A;  2RP4 A;  5JDN A;  2ZMA A;  3ZMU B;  5LGU B;  2XTL A;  4N78 D;  2CCQ A;  4CQI A;  1FEW A;  5TAO A;  5ADX L;  2LM9 A;  5LXT E;  2L3L A;  5M4Y A;  4TUY E;  2CWY A;  2Q9Q A;  4OFZ A;  3BK9 A;  2ZLY A;  5CB4 E;  1S35 A;  2X9W A;  2Q9Q B;  3OYX A;  5AFU L;  2LSI A;  3C51 A;  3UTK A;  3O9X A;  3O1J A;  2P9B A;  3O1I A;  3SS1 A;  3C4X A;  3KDS E;  3NZQ A;  3NBX X;  4TZ4 C;  4X20 E;  2NW9 A;  4ANJ A;  3VU7 H;  2E9X D;  2XAH B;  2V7J A;  3EUH A;  3C4W A;  2G0U A;  5HXS A;  1LRZ A;  3KVB A;  4AKR B;  4ZI3 C;  2A3D A;  2JMH A;  5LGT B;  5JR9 C;  4P0A A;  2JMK A;  4PW8 A;  5JVD E;  2ACX A;  4H9S E;  5HWX A;  3UT5 E;  2WAU A;  2E8I A;  1YW0 A;  5FXW A;  3VKH A;  2YU1 A;  4EOZ B;  4GYR A;  4IE4 A;  4H9P C;  2V7M A;  2XAF B;  3N2O A;  4M1P A;  4K0U A;  3CML A;  5L3B B;  3N9N A;  3N2G E;  4YFS A;  2LSG A;  3K8P C;  4OHF A;  1KNZ A;  2KWH A;  2CE7 A;  1WYC A;  2CXL A;  3DJB A;  4XAX B;  2DWK A;  4JEU B;  1WRD A;  2V7L A;  2ODV A;  3FXE B;  1ZKE A;  4PFP A;  2DNX A;  2X0L B;  5HYA A;  4DND A;  2EHO D;  3JC6 D;  2KT9 A;  4GYS A;  3KFW X;  2X68 A;  4PK6 A;  3PUR A;  3NRX A;  2BDE A;  4YJ2 E;  4L5G A;  1V9D A;  4ADZ A;  2WMO A;  3N9M A;  5L3F B;  2YU2 A;  3IEE A;  4TX5 A;  1YD8 G;  4AKL A;  2H7O A;  4O4H E;  2UXX B;  2XAJ B;  3BQI A;  4ZS3 A;  4CI1 B;  4IE5 A;  3AA1 B;  3AA0 B;  2NOX A;  5HXC A;  4QKN A;  3NZP A;  3PDY A;  1KK7 A;  2K5B B;  4J2C A;  3KVA A;  5KX5 E;  3LFM A;  3LG7 A;  2E9X C;  4UXN B;  5IYZ E;  3O1H A;  4AKI A;  4QHO A;  2B1E A;  3CQX C;  4KUM B;  4PNI A;  4UEL A;  4KBM B;  3LBX A;  2XAQ B;  2KLQ A;  1IZN B;  2NW8 A;  2E9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...