4JUYA

Crystal structure of the pub domain of e3 ubiquitin ligase rnf31
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
193
structure length
193
Chain Sequence
HHHSSGRENLYFQGMPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Crystal structure of the PUB domain of E3 ubiquitin ligase RNF31
rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 64
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4juyA00
2CM0A 4JUYA 4OYJA 5LJNA 5LJMA 4P0BA 4P0AA 2D5UA 4OYKA 2CCQA 2HPLA 2HPJA 4P09A
chains in the Genus database with same CATH superfamily
2LRKA 3LBXB 2KMFA 4H9OC 2QVAA 3I1AA 4HTEA 3UUMA 4EEBA 5JDFA 3OJAA 1KFYA 1MIWA 1HX8A 5LGTB 5DABA 5LJMA 3C98B 1N36T 5IYZE 2XAJB 5LXTE 4HWFA 4TV8E 2CWYA 4X64T 5LGNB 2E9XB 2RPAA 3T1HT 4YY3T 2Y6XA 5FL0A 4MALA 2JRKA 3RYIE 3HR0A 4U7IA 1QLBA 5JDMA 3QC9A 1O3XA 4HWDA 4KBMB 4LF6T 2UXCT 3KV5A 3RPUA 4MLKA 4UVCB 2X66A 3O1IA 2BVMA 1T7SA 5FXZA 5LA6E 4BJNA 2VQFT 5AQUB 2KLQA 4X20E 2A72A 1T72A 2K3WA 4U72A 3SOLA 5CB4E 5HEOA 4KUMB 3LK2B 2B1EA 2Q9QA 4CI2B 1FMVA 2DWKA 3PJAJ 3PU8A 1UCUA 2J1DG 4H63H 2A2FX 5FY0A 5H6QB 2XUEA 4P09A 5ABEA 3N2OA 1NENA 3K3NA 4EYUA 2ZLYA 2D0TA 4TN7B 1HFAA 1JNZA 4GYSA 2LHNA 4HKAA 2X67A 5KX5E 2CHNA 3QOFA 4TNWA 2LJLA 4IT4A 2Q9QD 2HPLA 1XNQT 3NZQA 4I55E 5EZYE 5HWYA 1W0AA 4CXYA 4DR1T 3HA4A 3ZMVB 2W62A 4ZI3D 5JQGE 1XZYA 1SUMB 3T1YT 2BBJA 4WBNE 2XTLA 2V6YB 4HFBA 1M62A 3BQKA 4P1NA 3KV9A 3KINB 5HXHA 4AKRB 4LF7T 1XMOT 2DNXA 3ZMTB 3LK42 4TV9E 2EHOB 3Q5XA 3AA1B 5C2TA 2E9XC 5AQPB 5HXCA 5AQQB 2W4XA 3CX6B 2QYWA 2VK9A 2UXDT 5LHHB 2VVSA 2IDOB 4NXNT 2MPKA 4IE7A 1WCRA 3W15B 4HFCA 5L4HA 3PDYA 3TLUA 2FUPA 1FMWA 5FP3A 2VVNA 2N9DA 4AKLA 4KHZF 5HCMA 3ETVA 4C90A 5AQJB 3AXJB 3VU7H 1AJ3A 2UXXB 2YOEA 2WM9A 1OEDA 5FNVE 5ABHA 4UF0B 4ZI2D 3HKEE 5LGUB 5HEJA 2VASA 3AE6A 1BR1A 3M65A 4TWFA 3MXZA 4YSXA 3K8PC 3B13A 4YTNA 1UUSA 3ZT5A 5AQNB 1OWAA 2X9XA 4HFDA 5L4EA 1G73A 4JI5T 4U2YA 5EK3A 2VKHA 4ILAA 3CKDA 3ZSSA 3OVUA 5ADXL 5J0ZA 4CI3B 3LDQB 2D2SA 4JI8T 3H3MA 3EHZA 2PTFA 1U4QA 4L0RA 3ETUA 4LFBT 5L47A 2LT3A 1D0ZA 1UK5A 2XAQB 2BVLA 3GN5A 2EHOC 5CFBA 5LHIB 2RP4A 4LMJA 4X65T 1UURA 3L09A 4U2ZA 2VWAA 3Q5WA 4IE4A 3L39A 2CBIA 1E1HB 2JIWA 4IL4A 2WBLA 2UUAT 3ZCIA 2XZEA 3AE2A 4DV2T 2KNDA 2J62A 4CN4A 5AQGB 5FL1A 1HS7A 3HKDE 5FXXA 2CLYB 3AVRA 3ZPOA 5HXSA 3X1DA 3KVBA 4ANJA 4OFZA 2QA7A 2OV9A 1N32T 4AQYT 3U78A 3UUNA 1IBLT 2FJDA 2BKPA 2CXLA 4O2BE 1IJ5A 5IWAT 1UGOA 2XSAA 3AE9A 2VL0A 3ONJA 2C5KT 3N9MA 2LOPA 2Y48B 3EAMA 4J2CA 3UUBA 3PUAA 4PK4A 2E5VA 5JDNA 4QXCB 1Y64B 3ZC0A 2V6XA 3ZN1B 5HEGA 2W66A 2LLYA 1G8XA 3ZJ2A 3BQIA 1VCTA 2WZHA 4H9PC 3AE4A 4H63V 3AEGA 4IDOA 1D1BA 4P0BA 4AI6A 4HEAA 3EDVA 4ZS3A 5EK2A 4ADZA 4QX8B 2H3RA 2WQYA 2VKDA 4U31A 1XWMA 2ZM0A 5LMNT 4O4HE 4ILCA 2VKOA 4L5GA 2V7IA 5H6RB 3M3ZB 4PAGA 3PU3A 4E7SA 2JMKA 2D5UA 3RIAA 1MMGA 1WLXA 2W0GA 4ISTA 2DLRA 4L9IA 2HHHT 2MYSA 1W09A 4X1IE 4WBOA 2BG9B 3KV4A 3Q5DA 4G2AA 4F6RC 2KINB 4Q25A 3Q5EA 1WR6A 5FY7A 2XQ6A 2A3DA 2CLYC 2CCQA 1YW0A 5IHYA 4OYKA 2KWHA 1M7KA 3N5LA 2YDSA 4JI2T 2NWBA 2NW9A 3P4SA 1KNZA 4Z8XA 4QXHB 4UR9A 4AKIA 4O4LE 5C3JA 3OYXA 4AIUA 3GWHA 1EZ3A 1D1CA 2XQ8A 2WU5A 2I0MA 2YU1A 4HWIB 4OYJA 2BG9E 3RYHE 4DV5T 1T8BA 2WP9A 4ZZBA 2PG8A 4YTMA 3B5MA 4I4TE 5CGMA 1OXZA 2LKHA 4MFRA 3O9XA 2CWOA 3IBPA 4Z90A 1VCSA 5L3DB 4XAXB 5LCYA 3PV0F 3RIUC 2V7KA 3N2KE 1MMAA 3AEAA 4ZOLE 3R84B 4C91A 1YKEB 2B76A 2WS3A 5AQIB 4EOZB 3AAEB 5LNKA 5JTGA 1MIVA 4NPPA 3KDSE 3CK6A 3QUJA 5HXRA 4ZI7E 2FJEA 3RGLA 2E9XA 2NW8A 2VKJA 5LMUT 1JNRA 4E7ZA 4UIGA 1HX1B 4GK0E 3VR8A 3NKZA 2BG9C 2G0UA 4EEDA 2KXPB 2KT9A 1KF6A 4JUYA 2ACXA 3TLVA 5LG3A 4JLEA 2LSGA 2DI4A 2E9XD 2VB6A 3SFEA 5JDLA 3MACA 3RI5A 3IHRA 1UX4A 3QNUA 2J4GA 5DJQC 1D0XA 1YD8G 3EVYA 5EK4A 3GA8A 5AQHB 3NWIA 1MNDA 3SRZA 2YU2A 3QB5A 2WB5A 4IGUA 5M4YA 2MBGA 5L3FB 2NR4A 1E7PA 1S94A 3FZKB 3UUXB 3O1JA 3J9X1 3L3PA 3V5SA 4CN1A 5A1LA 1R8IA 4GK5E 2W00A 3FZFB 2JQHA 2CA5A 5AQFB 2K9AA 4HE8A 3FHNA 1E2AA 2A9UA 2V7LA 2K48A 3P4PA 2P9BA 2XQ4A 2X68A 4TZ4C 3ZT6A 3ANWB 3RQWA 1ZV4X 1QUUA 1HG5A 3PE0A 3Q9DA 4DVDA 5FXWA 4IDQA 2YKSA 4X5TA 3MK7C 4I50E 2BKOA 5KDMC 2V6YA 3ZMUB 4O4IE 2M6IA 3BK9A 5E0OA 3TLWA 2LSKA 3J7Yq 1Z0PA 4ZHQE 3A5XA 3NRXA 4HGAA 2EHOA 2XQYA 3NBXX 3P4WA 4UV9B 5ABGA 1I6ZA 1L0VA 3DJBA 3UTKA 1LKXA 3N9PA 4ZEYA 4X62T 2KSRA 4JI3T 4LF4T 1IZNB 4IE0A 3V5UA 2WWUA 4PW8A 4JI6T 2WZIA 2EHOD 4WW0A 2CHOA 4DR6T 4KMCA 3AXJA 5CJ5A 3PUZF 2HH7A 5CA0E 1FJGT 4HFVA 5ABFB 2YN6A 1MMNA 2UUBT 3A7MA 4DNDA 4KHPT 4UF0A 2FJBA 3AE1A 4O4JE 4IL9A 5AQVB 3PUGA 4UVBB 3UU4A 2AE9A 3ONLC 2X0YA 4U7YA 3RYCE 3QB5K 3RQUA 3SFDA 3NZPA 1SHZC 3ZYLA 4JI4T 3L8RA 4PFOA 4LF8T 3CMLA 4YXDA 3EUHA 1DU2A 5LOVE 1IBMT 4UVAB 2XQ7A 2WAUA 2CPTA 3C4WA 3AECA 4LF9T 3RLFF 2UU9T 4QH5A 3RYFE 2UXNB 2W2UA 1ZOYA 3IA3A 2IUBA 2JQQA 3C51A 4DO0A 5F5WA 3FBLA 4DV4T 4IIJE 3ZKRA 2W61A 3I9WA 4WZXA 3CX7B 1OEDE 1W9RA 3NVOA 4LFAT 2XAGB 4I0UA 4JEUB 3FZLB 2WU2A 5F8PA 3UT5E 4A56A 2PFVA 3PUSA 5L2LA 4OX9T 4IDNA 4ILBA 2YINA 2WCAA 2XHEB 3AEEA 1J5ET 2HN1A 3N9NA 1NWMX 4K0UA 1BR2A 1H7CA 4AQFC 1D1AA 4DV6T 3ZJ1A 3P8CD 4YHHT 3EDUA 3RH3A 2YDQA 2ES0A 3N9QA 4UELA 5HAXA 3AE8A 2PBIA 4YJ3E 5L3EB 3LJCA 2WMNA 1XDOA 3E22E 4EAHA 5AFUL 2XQAA 2V26A 3LK3B 4ZS2A 3HI2A 2KWIB 2D0UA 5L3BB 2ODUA 1US7B 2V8SV 3K3OA 4JEHB 4WYVA 2WSSV 2XM1A 4PJMA 3KVAA 4EYYR 2OLTA 2J47A 1Z8UA 3TKLB 4WNKA 1YQ4A 2H88A 4COFA 3UFEA 4X1YE 4XBFB 3LSVA 5JR9B 2CXFA 3N2GE 2NOXA 4IDPA 3ZT7A 3CPZA 3FB2A 2RA1A 2CE7A 2CM0A 3R6NA 3RIUA 3F57A 4JYAT 2ODVA 3ZMSB 2DCFA 5FVKA 4F8HA 4DR2T 3RRCA 2AXDS 3SWHA 5FVLA 4BJMA 3EABA 2XM2A 4GYRA 4KI0F 5LP6E 2L8KA 4DUZT 3MA9A 1WFDA 2XQ5A 2MOZA 4FJOA 3ONXA 1HCIA 3VKHA 3UU3A 4U3CA 1V9DA 1WRDA 5AQMB 3WAJA 4EZHA 2QRXA 4HFIA 3CIRA 4AKHA 3PUQA 1KNPA 2BG9A 2VQET 5LYJE 3RKGA 2N1GA 4KX6A 1T98A 2BKNA 1N34T 4QH1A 5AQLB 4ASKA 4DBRA 4GIWA 4A98A 4ZZCA 1IBKT 2CMRA 2ZMAA 2W63A 2JMHA 2XY8B 1J1JA 3A8YC 4NXMT 2BBHA 4YSZA 4PJJA 2CEAA 3CQCB 3UULA 1HNXT 1J5WA 1B7TA 5JRCB 4HWHA 1CUNA 2JQKA 3PURA 3KBTA 3O1HA 5JDHA 5AQSB 3B57A 5HWXA 1N33T 2OA5A 2IHR1 4QXBB 1YKHB 4DV0T 2FBWA 2WWVA 4IDZA 2IC9A 1WYCA 3WI3A 3AEBA 3VKGA 4JI0T 3UQ4A 5LHGB 4FI5A 1KNRA 2NW7A 2WDRA 5C8YE 4CI1B 4QX7B 2X9YA 2LSYA 1SA0E 2IIUA 2UXBT 4DR5T 3HKCE 2X0LB 3CX8B 4M1PA 5FXVA 5DQVA 5L3CB 2HN2A 2XAFB 3T8OA 1HF8A 2ZM8A 4EV6A 4AKGA 5JR9C 4YLHA 3LBXA 2XAHB 4MBQA 1U5PA 3RC8A 2X51A 1ZHCA 3ESLA 2IMLA 1QSDA 4U74A 2E5LT 2Y8DA 4QH4A 2IAKA 3JAEA 1X79A 3ABVA 4YHJA 1MMDA 1XNRT 4B3RT 4B3MT 2H7VC 4GKKT 4ERRA 4CXWA 3JC6C 2I6HA 3HL6A 4X66T 3AEFA 4O2AE 5HEHA 3FBZA 3RRWA 2FJAA 5J2UE 2BS4A 2Q9QB 2E2AA 3AE5A 4H9SE 3FZHB 3PUYF 4PFPA 1ZKEA 4EXTA 1VRBA 4DR4T 2NP9A 1HNWT 5KMGP 2HPJA 4QKNA 3DTOA 4EIWA 3IF8B 3AE3A 4ZXLA 2XASB 3Q2MA 2D9DA 3ZYMA 3FZMB 4B3TT 3AAAB 4ILUA 1WYBA 2V5CA 5BR8T 3RF1A 4JV5T 2V5DA 3H3AA 1HTJF 4HFHA 3I0OA 5FY1A 2ACZA 2F4VT 2DHRA 2ZM2A 5CA1E 2SPCA 3PJAA 3S4UA 3H37A 5JH7E 2VURA 2M67A 1Y01A 4BA9A 3ANWA 5AQRB 4YTPA 4N78D 2BZBA 4NUVA 4JBWF 5AQTB 1IJ6A 3ZN0B 3QK6A 1CHUA 4YJ2E 2LEHA 4CZZB 4NUUA 4DV7T 3E0ZA 5LB7B 2LOSA 4A97A 3ZYKA 4G63A 2L9QA 2JQ9A 2YEVC 2H7OA 3UFGA 3VRAA 3JAFA 4AQFA 5KXJA 3MJXA 4LMLA 5JDGA 2C5IT 3TLTA 2X9HA 3EI0A 4NIQA 2C0SA 3PTRB 3ZEFB 1FIOA 1WR0A 2MAWA 4JI7T 5TAOA 4YFSA 2XSBA 3KBUA 3UU5A 2X0HA 3OPCA 3KV6A 2BS3A 2Q9QC 1FEWA 3CQGB 1OEDB 2I59A 2L3LA 4YT0A 4DV1T 4TUYE 4A5XA 3G06A 5ABFA 4DBQA 3RX6A 4KP3C 1GQEA 1KEYA 2CBJA 4ZI3C 3OYZA 3HKBE 1MNEA 3RC3A 4U33A 5AQOB 2PJQA 4OHFA 2WDQA 3VR9A 5IUXA 2BS2A 1MIYA 4AISA 3VRBA 4UXNB 2KZ7B 4HFEA 3AEDA 3NRYA 3K3QC 5GONE 4B6XA 3JADA 2Z6EA 4TNVA 1ZP0A 2V7MA 3P50A 4DIDB 5F3JA 1NEKA 4Z91A 3LG7A 2CXDA 3CWZB 3VHLA 3AA6B 2MTQA 1IAPA 3DP7A 2XQ3A 2NTYA 2YK0A 1LVKA 3P4QA 3UU6A 4DR7T 3GN5B 3D0TA 2JPFA 5LBQB 1HR0T 3AE7A 5J1GA 5LJNA 3GMIA 3P4RA 2CRBA 4ZI2C 3AA7B 1YXRA 1UX5A 3OBVE 5FKYA 3ZLIA 3IEEA 5JDQA 4EGWA 4QHOA 4HN9A 3PUWF 4CN6A 5FMNA 3RKOA 2DL1A 2LSIA 2ZM6T 4AQGA 2WMOA 3JCFA 1OEDC 2R6GF 1KK7A 5J2TE 3U3IA 5JVDE 4PK5A 2YDRA 3CVRA 2VL8A 5HEUA 2K5BB 3KFWX 1BR0A 4DUYT 4K0KT 2LM9A 2LSJA 2C5JA 5LBMA 3P7IA 2NTXA 1D0YA 3OKQA 2GK9A 3UQ7A 3RIFA 4DV3T 1BR4A 4HWCA 3CQXC 4EB6E 2X9WA 4H9NC 2V7JA 4LF5T 4B3ST 3ZMZB 5JR9A 1HG2A 2IC6A 2N2NA 3N9LA 4PNIA 1HNZT 4BAYB 3O4XE 3MZKB 4ISSA 4OK0A 2XJ7A 5ETWA 4PJNA 5HCJA 5L3GB 1I94T 3LFMA 3AA0B 2LM2A 3ZCJA 3WAKA 3AVSA 4QWNB 2W67A 2LE8A 4EZ4A 2LKGA 2LRLA 1S35A 4X1KE 3C64A 4H9RC 3E08A 3C50A 2BDEA 4MHCA 5FYMA 4P0AA 3C4ZA 2UUCT 3BQLA 2E8IA 3F31A 5DQWA 5HYAA 1NAFA 4UV8B 3ZSTA 2K24A 1YQ3A 3MKDA 3SS1A 5AQKB 4DR3T 4TWHA 3I9YA 1W0BA 2JJ9A 2XPKA 2XQ9A 2LHRA 2H89A 3UU8A 3N9OA 4UEMA 4DMVA 2WDVA 5HXEA 4IHJE 5JRCA 4GKJT 1XMQT 4GOUA 1SE7A 1X9BA 2M6BA 3AB3B 4IREA 4PJLA 3TLSA 4CQIA 5JREA 4LMKA 1ZEEA 3JC6D 1LVFA 5LG4A 3F2EA 3PUXF 2WY2A 3PUVF 4O8SA 3AAIA 4LFCT 4DMWA 4TX5A 3C4XA 4CXXA 1XDPA 4I43B 3OTOT 4H9QC 3ZC1A 3FXEB 1VOMA 3RHWA 4PK6A 2DWGA 4IE6A 2QGSA 4TWDA 5BMVE 1LRZA 4V1Av 3FXDB 4IE5A 4XZCA 2IW5B 4JI1T 3I0QA 4AXPA 3K1SA 4YSYA 2V1DB
chains in the Genus database with same CATH topology
2JQQA 3C51A 4DO0A 3LBXB 4QX8B 2H3RA 2KMFA 3FBLA 1IJ6A 4IIJE 3ZN0B 3QK6A 4H9OC 4YJ2E 2VKDA 2W61A 2ZM0A 3I1AA 4HTEA 3UUMA 5JDFA 3I9WA 4O4HE 2LEHA 3OJAA 2VKOA 4L5GA 1MIWA 4CZZB 1HX8A 2V7IA 4NUUA 3CX7B 5LGTB 5DABA 5H6RB 5LJMA 3E0ZA 3C98B 4PAGA 3PU3A 2XAGB 2LOSA 4E7SA 4JEUB 5IYZE 5F8PA 3UT5E 4A56A 2JMKA 2D5UA 3ZYKA 1MMGA 2PFVA 2XAJB 1WLXA 5LXTE 3PUSA 5L2LA 2W0GA 4G63A 2L9QA 4TV8E 2CWYA 2YINA 5LGNB 2E9XB 2XHEB 4ISTA 2YEVC 2H7OA 3N9NA 1NWMX 4K0UA 2Y6XA 1BR2A 2JRKA 4MALA 1H7CA 4AQFA 2DLRA 4L9IA 4AQFC 3MJXA 1D1AA 3RYIE 3HR0A 2MYSA 5JDMA 3QC9A 4X1IE 1O3XA 4WBOA 5JDGA 2C5IT 3ZJ1A 3KV4A 4KBMB 2X9HA 4G2AA 4F6RC 2KINB 2C0SA 3PTRB 3KV5A 3RPUA 4MLKA 4UVCB 3P8CD 1WR6A 2X66A 2BVMA 3O1IA 3EDUA 5FY7A 1FIOA 5FXZA 5LA6E 3RH3A 4BJNA 3ZEFB 2ES0A 3N9QA 2KLQA 4UELA 5HAXA 4X20E 2A72A 2PBIA 2A3DA 2CLYC 5TAOA 4U72A 3SOLA 4YJ3E 4YFSA 2CCQA 5L3EB 1YW0A 3LJCA 5CB4E 3KBUA 4KUMB 3LK2B 2WMNA 5IHYA 2B1EA 4OYKA 3E22E 2Q9QA 3KV6A 2KWHA 4EAHA 3N5LA 4CI2B 2Q9QC 1FEWA 3CQGB 5AFUL 2I59A 2V26A 2L3LA 1FMVA 2NWBA 3LK3B 2DWKA 4TUYE 2NW9A 3PU8A 1UCUA 2J1DG 4ZS2A 3HI2A 4H63H 4Z8XA 1KNZA 4DBQA 2A2FX 4QXHB 3RX6A 5FY0A 2KWIB 2D0UA 4KP3C 2ODUA 1US7B 2XUEA 4P09A 5H6QB 4O4LE 5L3BB 4AKIA 3K3OA 4ZI3C 3OYXA 4JEHB 3OYZA 3HKBE 1MNEA 3GWHA 1EZ3A 3N2OA 1D1CA 2WSSV 3RC3A 3K3NA 4EYUA 2ZLYA 2D0TA 4TN7B 1HFAA 4GYSA 2LHNA 4PJMA 2PJQA 4HKAA 4OHFA 2YU1A 3KVAA 2X67A 5KX5E 4EYYR 4OYJA 3TKLB 3RYHE 4WNKA 1MIYA 2LJLA 2Q9QD 3UFEA 2HPLA 4X1YE 3NZQA 4I55E 2PG8A 4XBFB 4UXNB 5EZYE 4I4TE 2KZ7B 5HWYA 1OXZA 4CXYA 5JR9B 2CXFA 3NRYA 3HA4A 4MFRA 3ZMVB 3N2GE 2NOXA 2W62A 3O9XA 2CWOA 3IBPA 4ZI3D 3K3QC 5JQGE 3CPZA 3FB2A 2RA1A 2CE7A 5GONE 2CM0A 5L3DB 4XAXB 5LCYA 3R6NA 4B6XA 3F57A 2ODVA 2Z6EA 3ZMSB 2DCFA 2V7KA 3N2KE 4WBNE 2V7MA 1MMAA 2XTLA 4ZOLE 3BQKA 3R84B 4C91A 3RRCA 5F3JA 3KV9A 1YKEB 3LG7A 3SWHA 2CXDA 3CWZB 3VHLA 3KINB 3AA6B 4BJMA 2MTQA 5HXHA 4AKRB 1IAPA 4EOZB 3AAEB 4GYRA 5LNKA 2DNXA 3DP7A 5LP6E 3ZMTB 2L8KA 2NTYA 1MIVA 2YK0A 3LK42 3KDSE 3MA9A 4TV9E 1LVKA 2EHOB 2MOZA 3QUJA 3Q5XA 3AA1B 3GN5B 4FJOA 5HXRA 3D0TA 4ZI7E 3ONXA 1HCIA 2JPFA 2E9XA 2NW8A 3VKHA 5LBQB 2E9XC 2VKJA 5HXCA 5J1GA 5LJNA 1V9DA 1WRDA 3GMIA 3CX6B 3WAJA 4EZHA 4E7ZA 2VK9A 4UIGA 5LHHB 4ZI2C 4AKHA 3PUQA 4GK0E 3AA7B 5LYJE 4IE7A 2N1GA 2G0UA 1T98A 3W15B 2KXPB 4ASKA 4DBRA 4GIWA 3PDYA 1UX5A 2CMRA 2KT9A 2ZMAA 2W63A 3OBVE 3ZLIA 1FMWA 2JMHA 3IEEA 5FP3A 5JDQA 4JUYA 2ACXA 2N9DA 4AKLA 3ETVA 4QHOA 4HN9A 4C90A 4PJJA 4JLEA 2LSGA 2CEAA 3CQCB 3UULA 1B7TA 2DI4A 2E9XD 5JRCB 2VB6A 5JDLA 5FMNA 3MACA 3RKOA 1CUNA 2LSIA 3VU7H 1AJ3A 4AQGA 3PURA 2UXXB 3IHRA 1UX4A 2WM9A 3KBTA 5FNVE 2WMOA 3O1HA 5JDHA 5HWXA 3B57A 5DJQC 1D0XA 4UF0B 4ZI2D 2OA5A 1KK7A 5J2TE 3HKEE 1YD8G 3EVYA 5LGUB 5EK4A 3U3IA 4QXBB 5JVDE 1YKHB 4PK5A 2VASA 3GA8A 3CVRA 2VL8A 1BR1A 2K5BB 3KFWX 1BR0A 1MNDA 3M65A 3SRZA 4IDZA 3MXZA 2IC9A 1WYCA 2YU2A 3WI3A 4IGUA 2LM9A 5M4YA 2LSJA 2C5JA 3VKGA 2MBGA 5L3FB 5LHGB 3UUXB 1S94A 4FI5A 2NW7A 5LBMA 3P7IA 5C8YE 2NTXA 4CI1B 3K8PC 3O1JA 4QX7B 3L3PA 3J9X1 3V5SA 2X9YA 1D0YA 3B13A 3OKQA 4GK5E 5A1LA 2GK9A 2W00A 2LSYA 2CA5A 1SA0E 2K9AA 3HKCE 4HE8A 1BR4A 2X0LB 3CX8B 3FHNA 4M1PA 3CQXC 5FXVA 5DQVA 5L3CB 4EB6E 2X9WA 2V7LA 1OWAA 2K48A 2X9XA 2P9BA 4H9NC 2XAFB 3T8OA 1HF8A 1G73A 2X68A 2V7JA 4TZ4C 2ZM8A 3ZMZB 3ANWB 5JR9A 1HG2A 1ZV4X 2IC6A 2N2NA 4AKGA 5JR9C 3N9LA 4YLHA 3LBXA 4PNIA 1QUUA 1HG5A 3PE0A 3Q9DA 5EK3A 4BAYB 4DVDA 2VKHA 3O4XE 3CKDA 3MZKB 4ISSA 4OK0A 5FXWA 5ADXL 2XAHB 4MBQA 5ETWA 4CI3B 1U5PA 4PJNA 3MK7C 5L3GB 2D2SA 4I50E 5KDMC 3RC8A 2X51A 3ZMUB 1ZHCA 3ESLA 1U4QA 1QSDA 4L0RA 3LFMA 3AA0B 4U74A 3ZCJA 4O4IE 3ETUA 3WAKA 3AVSA 2Y8DA 3BK9A 5E0OA 2LSKA 4QWNB 2LE8A 4EZ4A 3J7Yq 1Z0PA 2LT3A 3A5XA 1D0ZA 3NRXA 4ZHQE 4HGAA 2EHOA 2XAQB 2XQYA 2BVLA 3GN5A 1S35A 2EHOC 2IAKA 4X1KE 3NBXX 3C64A 5LHIB 1X79A 4H9RC 3E08A 3C50A 2BDEA 2RP4A 3L09A 4YHJA 2VWAA 3Q5WA 4IE4A 4MHCA 4UV9B 3C4ZA 5FYMA 4P0AA 1MMDA 1E1HB 3DJBA 3BQLA 3UTKA 1LKXA 2E8IA 3F31A 5DQWA 5HYAA 1NAFA 2WBLA 4UV8B 3N9PA 2H7VC 3ZCIA 2K24A 4ERRA 4CXWA 2KNDA 3JC6C 3MKDA 3SS1A 3HL6A 4O2AE 1IZNB 3I9YA 4IE0A 1HS7A 3HKDE 3V5UA 2JJ9A 5FXXA 2CLYB 3AVRA 3ZPOA 5HXSA 3FBZA 3RRWA 2LHRA 2WWUA 4PW8A 3N9OA 3KVBA 4UEMA 4ANJA 2EHOD 5J2UE 4DMVA 4OFZA 2QA7A 4WW0A 5HXEA 4IHJE 2Q9QB 4KMCA 4PFPA 4H9SE 5JRCA 2HH7A 5CA0E 4GOUA 1ZKEA 4HFVA 3U78A 3UUNA 4EXTA 1VRBA 2NP9A 5KMGP 3AB3B 2HPJA 1MMNA 4DNDA 2CXLA 4UF0A 4PJLA 4QKNA 3DTOA 4EIWA 4O2BE 4CQIA 1IJ5A 3IF8B 4O4JE 5EK2A 5JREA 1ZEEA 3JC6D 1LVFA 5LG4A 2XASB 3F2EA 3Q2MA 3PUGA 4UVBB 3ZYMA 2C5KT 3N9MA 2LOPA 2Y48B 3AAAB 4ILUA 4O8SA 1WYBA 3AAIA 4J2CA 4DMWA 3PUAA 4PK4A 4TX5A 3RYCE 3H3AA 1HTJF 3C4XA 5FY1A 3I0OA 4CXXA 5JDNA 4QXCB 4I43B 2DHRA 1Y64B 4H9QC 2ZM2A 3NZPA 3ZC0A 1SHZC 3FXEB 3ZC1A 1VOMA 3ZN1B 3ZYLA 5CA1E 2SPCA 4PFOA 3CMLA 3EUHA 1G8XA 3ZJ2A 3BQIA 5LOVE 4PK6A 3S4UA 2DWGA 3H37A 4IE6A 4UVAB 2WAUA 5JH7E 2QGSA 5BMVE 1LRZA 4V1Av 3FXDB 3C4WA 2M67A 4H9PC 4IE5A 4XZCA 4H63V 2IW5B 4BA9A 3RYFE 3I0QA 2UXNB 3ANWA 4AXPA 1D1BA 4N78D 4P0BA 4AI6A 4HEAA 3EDVA 4ZS3A 2BZBA 4NUVA 2V1DB 4ADZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CM0 A;  4JUY A;  4OYJ A;  5LJN A;  5LJM A;  4P0B A;  4P0A A;  2D5U A;  4OYK A;  2CCQ A;  2HPL A;  2HPJ A;  4P09 A; 
#chains in the Genus database with same CATH topology
 2LRK A;  3LBX B;  2KMF A;  4H9O C;  2QVA A;  3I1A A;  4HTE A;  3UUM A;  4EEB A;  5JDF A;  3OJA A;  1KFY A;  1MIW A;  1HX8 A;  5LGT B;  5DAB A;  5LJM A;  3C98 B;  1N36 T;  5IYZ E;  2XAJ B;  5LXT E;  4HWF A;  4TV8 E;  2CWY A;  4X64 T;  5LGN B;  2E9X B;  2RPA A;  3T1H T;  4YY3 T;  2Y6X A;  5FL0 A;  4MAL A;  2JRK A;  3RYI E;  3HR0 A;  4U7I A;  1QLB A;  5JDM A;  3QC9 A;  1O3X A;  4HWD A;  4KBM B;  4LF6 T;  2UXC T;  3KV5 A;  3RPU A;  4MLK A;  4UVC B;  2X66 A;  3O1I A;  2BVM A;  1T7S A;  5FXZ A;  5LA6 E;  4BJN A;  2VQF T;  5AQU B;  2KLQ A;  4X20 E;  2A72 A;  1T72 A;  2K3W A;  4U72 A;  3SOL A;  5CB4 E;  5HEO A;  4KUM B;  3LK2 B;  2B1E A;  2Q9Q A;  4CI2 B;  1FMV A;  2DWK A;  3PJA J;  3PU8 A;  1UCU A;  2J1D G;  4H63 H;  2A2F X;  5FY0 A;  5H6Q B;  2XUE A;  4P09 A;  5ABE A;  3N2O A;  1NEN A;  3K3N A;  4EYU A;  2ZLY A;  2D0T A;  4TN7 B;  1HFA A;  1JNZ A;  4GYS A;  2LHN A;  4HKA A;  2X67 A;  5KX5 E;  2CHN A;  3QOF A;  4TNW A;  2LJL A;  4IT4 A;  2Q9Q D;  2HPL A;  1XNQ T;  3NZQ A;  4I55 E;  5EZY E;  5HWY A;  1W0A A;  4CXY A;  4DR1 T;  3HA4 A;  3ZMV B;  2W62 A;  4ZI3 D;  5JQG E;  1XZY A;  1SUM B;  3T1Y T;  2BBJ A;  4WBN E;  2XTL A;  2V6Y B;  4HFB A;  1M62 A;  3BQK A;  4P1N A;  3KV9 A;  3KIN B;  5HXH A;  4AKR B;  4LF7 T;  1XMO T;  2DNX A;  3ZMT B;  3LK4 2;  4TV9 E;  2EHO B;  3Q5X A;  3AA1 B;  5C2T A;  2E9X C;  5AQP B;  5HXC A;  5AQQ B;  2W4X A;  3CX6 B;  2QYW A;  2VK9 A;  2UXD T;  5LHH B;  2VVS A;  2IDO B;  4NXN T;  2MPK A;  4IE7 A;  1WCR A;  3W15 B;  4HFC A;  5L4H A;  3PDY A;  3TLU A;  2FUP A;  1FMW A;  5FP3 A;  2VVN A;  2N9D A;  4AKL A;  4KHZ F;  5HCM A;  3ETV A;  4C90 A;  5AQJ B;  3AXJ B;  3VU7 H;  1AJ3 A;  2UXX B;  2YOE A;  2WM9 A;  1OED A;  5FNV E;  5ABH A;  4UF0 B;  4ZI2 D;  3HKE E;  5LGU B;  5HEJ A;  2VAS A;  3AE6 A;  1BR1 A;  3M65 A;  4TWF A;  3MXZ A;  4YSX A;  3K8P C;  3B13 A;  4YTN A;  1UUS A;  3ZT5 A;  5AQN B;  1OWA A;  2X9X A;  4HFD A;  5L4E A;  1G73 A;  4JI5 T;  4U2Y A;  5EK3 A;  2VKH A;  4ILA A;  3CKD A;  3ZSS A;  3OVU A;  5ADX L;  5J0Z A;  4CI3 B;  3LDQ B;  2D2S A;  4JI8 T;  3H3M A;  3EHZ A;  2PTF A;  1U4Q A;  4L0R A;  3ETU A;  4LFB T;  5L47 A;  2LT3 A;  1D0Z A;  1UK5 A;  2XAQ B;  2BVL A;  3GN5 A;  2EHO C;  5CFB A;  5LHI B;  2RP4 A;  4LMJ A;  4X65 T;  1UUR A;  3L09 A;  4U2Z A;  2VWA A;  3Q5W A;  4IE4 A;  3L39 A;  2CBI A;  1E1H B;  2JIW A;  4IL4 A;  2WBL A;  2UUA T;  3ZCI A;  2XZE A;  3AE2 A;  4DV2 T;  2KND A;  2J62 A;  4CN4 A;  5AQG B;  5FL1 A;  1HS7 A;  3HKD E;  5FXX A;  2CLY B;  3AVR A;  3ZPO A;  5HXS A;  3X1D A;  3KVB A;  4ANJ A;  4OFZ A;  2QA7 A;  2OV9 A;  1N32 T;  4AQY T;  3U78 A;  3UUN A;  1IBL T;  2FJD A;  2BKP A;  2CXL A;  4O2B E;  1IJ5 A;  5IWA T;  1UGO A;  2XSA A;  3AE9 A;  2VL0 A;  3ONJ A;  2C5K T;  3N9M A;  2LOP A;  2Y48 B;  3EAM A;  4J2C A;  3UUB A;  3PUA A;  4PK4 A;  2E5V A;  5JDN A;  4QXC B;  1Y64 B;  3ZC0 A;  2V6X A;  3ZN1 B;  5HEG A;  2W66 A;  2LLY A;  1G8X A;  3ZJ2 A;  3BQI A;  1VCT A;  2WZH A;  4H9P C;  3AE4 A;  4H63 V;  3AEG A;  4IDO A;  1D1B A;  4P0B A;  4AI6 A;  4HEA A;  3EDV A;  4ZS3 A;  5EK2 A;  4ADZ A;  4QX8 B;  2H3R A;  2WQY A;  2VKD A;  4U31 A;  1XWM A;  2ZM0 A;  5LMN T;  4O4H E;  4ILC A;  2VKO A;  4L5G A;  2V7I A;  5H6R B;  3M3Z B;  4PAG A;  3PU3 A;  4E7S A;  2JMK A;  2D5U A;  3RIA A;  1MMG A;  1WLX A;  2W0G A;  4IST A;  2DLR A;  4L9I A;  2HHH T;  2MYS A;  1W09 A;  4X1I E;  4WBO A;  2BG9 B;  3KV4 A;  3Q5D A;  4G2A A;  4F6R C;  2KIN B;  4Q25 A;  3Q5E A;  1WR6 A;  5FY7 A;  2XQ6 A;  2A3D A;  2CLY C;  2CCQ A;  1YW0 A;  5IHY A;  4OYK A;  2KWH A;  1M7K A;  3N5L A;  2YDS A;  4JI2 T;  2NWB A;  2NW9 A;  3P4S A;  1KNZ A;  4Z8X A;  4QXH B;  4UR9 A;  4AKI A;  4O4L E;  5C3J A;  3OYX A;  4AIU A;  3GWH A;  1EZ3 A;  1D1C A;  2XQ8 A;  2WU5 A;  2I0M A;  2YU1 A;  4HWI B;  4OYJ A;  2BG9 E;  3RYH E;  4DV5 T;  1T8B A;  2WP9 A;  4ZZB A;  2PG8 A;  4YTM A;  3B5M A;  4I4T E;  5CGM A;  1OXZ A;  2LKH A;  4MFR A;  3O9X A;  2CWO A;  3IBP A;  4Z90 A;  1VCS A;  5L3D B;  4XAX B;  5LCY A;  3PV0 F;  3RIU C;  2V7K A;  3N2K E;  1MMA A;  3AEA A;  4ZOL E;  3R84 B;  4C91 A;  1YKE B;  2B76 A;  2WS3 A;  5AQI B;  4EOZ B;  3AAE B;  5LNK A;  5JTG A;  1MIV A;  4NPP A;  3KDS E;  3CK6 A;  3QUJ A;  5HXR A;  4ZI7 E;  2FJE A;  3RGL A;  2E9X A;  2NW8 A;  2VKJ A;  5LMU T;  1JNR A;  4E7Z A;  4UIG A;  1HX1 B;  4GK0 E;  3VR8 A;  3NKZ A;  2BG9 C;  2G0U A;  4EED A;  2KXP B;  2KT9 A;  1KF6 A;  4JUY A;  2ACX A;  3TLV A;  5LG3 A;  4JLE A;  2LSG A;  2DI4 A;  2E9X D;  2VB6 A;  3SFE A;  5JDL A;  3MAC A;  3RI5 A;  3IHR A;  1UX4 A;  3QNU A;  2J4G A;  5DJQ C;  1D0X A;  1YD8 G;  3EVY A;  5EK4 A;  3GA8 A;  5AQH B;  3NWI A;  1MND A;  3SRZ A;  2YU2 A;  3QB5 A;  2WB5 A;  4IGU A;  5M4Y A;  2MBG A;  5L3F B;  2NR4 A;  1E7P A;  1S94 A;  3FZK B;  3UUX B;  3O1J A;  3J9X 1;  3L3P A;  3V5S A;  4CN1 A;  5A1L A;  1R8I A;  4GK5 E;  2W00 A;  3FZF B;  2JQH A;  2CA5 A;  5AQF B;  2K9A A;  4HE8 A;  3FHN A;  1E2A A;  2A9U A;  2V7L A;  2K48 A;  3P4P A;  2P9B A;  2XQ4 A;  2X68 A;  4TZ4 C;  3ZT6 A;  3ANW B;  3RQW A;  1ZV4 X;  1QUU A;  1HG5 A;  3PE0 A;  3Q9D A;  4DVD A;  5FXW A;  4IDQ A;  2YKS A;  4X5T A;  3MK7 C;  4I50 E;  2BKO A;  5KDM C;  2V6Y A;  3ZMU B;  4O4I E;  2M6I A;  3BK9 A;  5E0O A;  3TLW A;  2LSK A;  3J7Y q;  1Z0P A;  4ZHQ E;  3A5X A;  3NRX A;  4HGA A;  2EHO A;  2XQY A;  3NBX X;  3P4W A;  4UV9 B;  5ABG A;  1I6Z A;  1L0V A;  3DJB A;  3UTK A;  1LKX A;  3N9P A;  4ZEY A;  4X62 T;  2KSR A;  4JI3 T;  4LF4 T;  1IZN B;  4IE0 A;  3V5U A;  2WWU A;  4PW8 A;  4JI6 T;  2WZI A;  2EHO D;  4WW0 A;  2CHO A;  4DR6 T;  4KMC A;  3AXJ A;  5CJ5 A;  3PUZ F;  2HH7 A;  5CA0 E;  1FJG T;  4HFV A;  5ABF B;  2YN6 A;  1MMN A;  2UUB T;  3A7M A;  4DND A;  4KHP T;  4UF0 A;  2FJB A;  3AE1 A;  4O4J E;  4IL9 A;  5AQV B;  3PUG A;  4UVB B;  3UU4 A;  2AE9 A;  3ONL C;  2X0Y A;  4U7Y A;  3RYC E;  3QB5 K;  3RQU A;  3SFD A;  3NZP A;  1SHZ C;  3ZYL A;  4JI4 T;  3L8R A;  4PFO A;  4LF8 T;  3CML A;  4YXD A;  3EUH A;  1DU2 A;  5LOV E;  1IBM T;  4UVA B;  2XQ7 A;  2WAU A;  2CPT A;  3C4W A;  3AEC A;  4LF9 T;  3RLF F;  2UU9 T;  4QH5 A;  3RYF E;  2UXN B;  2W2U A;  1ZOY A;  3IA3 A;  2IUB A;  2JQQ A;  3C51 A;  4DO0 A;  5F5W A;  3FBL A;  4DV4 T;  4IIJ E;  3ZKR A;  2W61 A;  3I9W A;  4WZX A;  3CX7 B;  1OED E;  1W9R A;  3NVO A;  4LFA T;  2XAG B;  4I0U A;  4JEU B;  3FZL B;  2WU2 A;  5F8P A;  3UT5 E;  4A56 A;  2PFV A;  3PUS A;  5L2L A;  4OX9 T;  4IDN A;  4ILB A;  2YIN A;  2WCA A;  2XHE B;  3AEE A;  1J5E T;  2HN1 A;  3N9N A;  1NWM X;  4K0U A;  1BR2 A;  1H7C A;  4AQF C;  1D1A A;  4DV6 T;  3ZJ1 A;  3P8C D;  4YHH T;  3EDU A;  3RH3 A;  2YDQ A;  2ES0 A;  3N9Q A;  4UEL A;  5HAX A;  3AE8 A;  2PBI A;  4YJ3 E;  5L3E B;  3LJC A;  2WMN A;  1XDO A;  3E22 E;  4EAH A;  5AFU L;  2XQA A;  2V26 A;  3LK3 B;  4ZS2 A;  3HI2 A;  2KWI B;  2D0U A;  5L3B B;  2ODU A;  1US7 B;  2V8S V;  3K3O A;  4JEH B;  4WYV A;  2WSS V;  2XM1 A;  4PJM A;  3KVA A;  4EYY R;  2OLT A;  2J47 A;  1Z8U A;  3TKL B;  4WNK A;  1YQ4 A;  2H88 A;  4COF A;  3UFE A;  4X1Y E;  4XBF B;  3LSV A;  5JR9 B;  2CXF A;  3N2G E;  2NOX A;  4IDP A;  3ZT7 A;  3CPZ A;  3FB2 A;  2RA1 A;  2CE7 A;  2CM0 A;  3R6N A;  3RIU A;  3F57 A;  4JYA T;  2ODV A;  3ZMS B;  2DCF A;  5FVK A;  4F8H A;  4DR2 T;  3RRC A;  2AXD S;  3SWH A;  5FVL A;  4BJM A;  3EAB A;  2XM2 A;  4GYR A;  4KI0 F;  5LP6 E;  2L8K A;  4DUZ T;  3MA9 A;  1WFD A;  2XQ5 A;  2MOZ A;  4FJO A;  3ONX A;  1HCI A;  3VKH A;  3UU3 A;  4U3C A;  1V9D A;  1WRD A;  5AQM B;  3WAJ A;  4EZH A;  2QRX A;  4HFI A;  3CIR A;  4AKH A;  3PUQ A;  1KNP A;  2BG9 A;  2VQE T;  5LYJ E;  3RKG A;  2N1G A;  4KX6 A;  1T98 A;  2BKN A;  1N34 T;  4QH1 A;  5AQL B;  4ASK A;  4DBR A;  4GIW A;  4A98 A;  4ZZC A;  1IBK T;  2CMR A;  2ZMA A;  2W63 A;  2JMH A;  2XY8 B;  1J1J A;  3A8Y C;  4NXM T;  2BBH A;  4YSZ A;  4PJJ A;  2CEA A;  3CQC B;  3UUL A;  1HNX T;  1J5W A;  1B7T A;  5JRC B;  4HWH A;  1CUN A;  2JQK A;  3PUR A;  3KBT A;  3O1H A;  5JDH A;  5AQS B;  3B57 A;  5HWX A;  1N33 T;  2OA5 A;  2IHR 1;  4QXB B;  1YKH B;  4DV0 T;  2FBW A;  2WWV A;  4IDZ A;  2IC9 A;  1WYC A;  3WI3 A;  3AEB A;  3VKG A;  4JI0 T;  3UQ4 A;  5LHG B;  4FI5 A;  1KNR A;  2NW7 A;  2WDR A;  5C8Y E;  4CI1 B;  4QX7 B;  2X9Y A;  2LSY A;  1SA0 E;  2IIU A;  2UXB T;  4DR5 T;  3HKC E;  2X0L B;  3CX8 B;  4M1P A;  5FXV A;  5DQV A;  5L3C B;  2HN2 A;  2XAF B;  3T8O A;  1HF8 A;  2ZM8 A;  4EV6 A;  4AKG A;  5JR9 C;  4YLH A;  3LBX A;  2XAH B;  4MBQ A;  1U5P A;  3RC8 A;  2X51 A;  1ZHC A;  3ESL A;  2IML A;  1QSD A;  4U74 A;  2E5L T;  2Y8D A;  4QH4 A;  2IAK A;  3JAE A;  1X79 A;  3ABV A;  4YHJ A;  1MMD A;  1XNR T;  4B3R T;  4B3M T;  2H7V C;  4GKK T;  4ERR A;  4CXW A;  3JC6 C;  2I6H A;  3HL6 A;  4X66 T;  3AEF A;  4O2A E;  5HEH A;  3FBZ A;  3RRW A;  2FJA A;  5J2U E;  2BS4 A;  2Q9Q B;  2E2A A;  3AE5 A;  4H9S E;  3FZH B;  3PUY F;  4PFP A;  1ZKE A;  4EXT A;  1VRB A;  4DR4 T;  2NP9 A;  1HNW T;  5KMG P;  2HPJ A;  4QKN A;  3DTO A;  4EIW A;  3IF8 B;  3AE3 A;  4ZXL A;  2XAS B;  3Q2M A;  2D9D A;  3ZYM A;  3FZM B;  4B3T T;  3AAA B;  4ILU A;  1WYB A;  2V5C A;  5BR8 T;  3RF1 A;  4JV5 T;  2V5D A;  3H3A A;  1HTJ F;  4HFH A;  3I0O A;  5FY1 A;  2ACZ A;  2F4V T;  2DHR A;  2ZM2 A;  5CA1 E;  2SPC A;  3PJA A;  3S4U A;  3H37 A;  5JH7 E;  2VUR A;  2M67 A;  1Y01 A;  4BA9 A;  3ANW A;  5AQR B;  4YTP A;  4N78 D;  2BZB A;  4NUV A;  4JBW F;  5AQT B;  1IJ6 A;  3ZN0 B;  3QK6 A;  1CHU A;  4YJ2 E;  2LEH A;  4CZZ B;  4NUU A;  4DV7 T;  3E0Z A;  5LB7 B;  2LOS A;  4A97 A;  3ZYK A;  4G63 A;  2L9Q A;  2JQ9 A;  2YEV C;  2H7O A;  3UFG A;  3VRA A;  3JAF A;  4AQF A;  5KXJ A;  3MJX A;  4LML A;  5JDG A;  2C5I T;  3TLT A;  2X9H A;  3EI0 A;  4NIQ A;  2C0S A;  3PTR B;  3ZEF B;  1FIO A;  1WR0 A;  2MAW A;  4JI7 T;  5TAO A;  4YFS A;  2XSB A;  3KBU A;  3UU5 A;  2X0H A;  3OPC A;  3KV6 A;  2BS3 A;  2Q9Q C;  1FEW A;  3CQG B;  1OED B;  2I59 A;  2L3L A;  4YT0 A;  4DV1 T;  4TUY E;  4A5X A;  3G06 A;  5ABF A;  4DBQ A;  3RX6 A;  4KP3 C;  1GQE A;  1KEY A;  2CBJ A;  4ZI3 C;  3OYZ A;  3HKB E;  1MNE A;  3RC3 A;  4U33 A;  5AQO B;  2PJQ A;  4OHF A;  2WDQ A;  3VR9 A;  5IUX A;  2BS2 A;  1MIY A;  4AIS A;  3VRB A;  4UXN B;  2KZ7 B;  4HFE A;  3AED A;  3NRY A;  3K3Q C;  5GON E;  4B6X A;  3JAD A;  2Z6E A;  4TNV A;  1ZP0 A;  2V7M A;  3P50 A;  4DID B;  5F3J A;  1NEK A;  4Z91 A;  3LG7 A;  2CXD A;  3CWZ B;  3VHL A;  3AA6 B;  2MTQ A;  1IAP A;  3DP7 A;  2XQ3 A;  2NTY A;  2YK0 A;  1LVK A;  3P4Q A;  3UU6 A;  4DR7 T;  3GN5 B;  3D0T A;  2JPF A;  5LBQ B;  1HR0 T;  3AE7 A;  5J1G A;  5LJN A;  3GMI A;  3P4R A;  2CRB A;  4ZI2 C;  3AA7 B;  1YXR A;  1UX5 A;  3OBV E;  5FKY A;  3ZLI A;  3IEE A;  5JDQ A;  4EGW A;  4QHO A;  4HN9 A;  3PUW F;  4CN6 A;  5FMN A;  3RKO A;  2DL1 A;  2LSI A;  2ZM6 T;  4AQG A;  2WMO A;  3JCF A;  1OED C;  2R6G F;  1KK7 A;  5J2T E;  3U3I A;  5JVD E;  4PK5 A;  2YDR A;  3CVR A;  2VL8 A;  5HEU A;  2K5B B;  3KFW X;  1BR0 A;  4DUY T;  4K0K T;  2LM9 A;  2LSJ A;  2C5J A;  5LBM A;  3P7I A;  2NTX A;  1D0Y A;  3OKQ A;  2GK9 A;  3UQ7 A;  3RIF A;  4DV3 T;  1BR4 A;  4HWC A;  3CQX C;  4EB6 E;  2X9W A;  4H9N C;  2V7J A;  4LF5 T;  4B3S T;  3ZMZ B;  5JR9 A;  1HG2 A;  2IC6 A;  2N2N A;  3N9L A;  4PNI A;  1HNZ T;  4BAY B;  3O4X E;  3MZK B;  4ISS A;  4OK0 A;  2XJ7 A;  5ETW A;  4PJN A;  5HCJ A;  5L3G B;  1I94 T;  3LFM A;  3AA0 B;  2LM2 A;  3ZCJ A;  3WAK A;  3AVS A;  4QWN B;  2W67 A;  2LE8 A;  4EZ4 A;  2LKG A;  2LRL A;  1S35 A;  4X1K E;  3C64 A;  4H9R C;  3E08 A;  3C50 A;  2BDE A;  4MHC A;  5FYM A;  4P0A A;  3C4Z A;  2UUC T;  3BQL A;  2E8I A;  3F31 A;  5DQW A;  5HYA A;  1NAF A;  4UV8 B;  3ZST A;  2K24 A;  1YQ3 A;  3MKD A;  3SS1 A;  5AQK B;  4DR3 T;  4TWH A;  3I9Y A;  1W0B A;  2JJ9 A;  2XPK A;  2XQ9 A;  2LHR A;  2H89 A;  3UU8 A;  3N9O A;  4UEM A;  4DMV A;  2WDV A;  5HXE A;  4IHJ E;  5JRC A;  4GKJ T;  1XMQ T;  4GOU A;  1SE7 A;  1X9B A;  2M6B A;  3AB3 B;  4IRE A;  4PJL A;  3TLS A;  4CQI A;  5JRE A;  4LMK A;  1ZEE A;  3JC6 D;  1LVF A;  5LG4 A;  3F2E A;  3PUX F;  2WY2 A;  3PUV F;  4O8S A;  3AAI A;  4LFC T;  4DMW A;  4TX5 A;  3C4X A;  4CXX A;  1XDP A;  4I43 B;  3OTO T;  4H9Q C;  3ZC1 A;  3FXE B;  1VOM A;  3RHW A;  4PK6 A;  2DWG A;  4IE6 A;  2QGS A;  4TWD A;  5BMV E;  1LRZ A;  4V1A v;  3FXD B;  4IE5 A;  4XZC A;  2IW5 B;  4JI1 T;  3I0Q A;  4AXP A;  3K1S A;  4YSY A;  2V1D B; 
#chains in the Genus database with same CATH homology
 2JQQ A;  3C51 A;  4DO0 A;  3LBX B;  4QX8 B;  2H3R A;  2KMF A;  3FBL A;  1IJ6 A;  4IIJ E;  3ZN0 B;  3QK6 A;  4H9O C;  4YJ2 E;  2VKD A;  2W61 A;  2ZM0 A;  3I1A A;  4HTE A;  3UUM A;  5JDF A;  3I9W A;  4O4H E;  2LEH A;  3OJA A;  2VKO A;  4L5G A;  1MIW A;  4CZZ B;  1HX8 A;  2V7I A;  4NUU A;  3CX7 B;  5LGT B;  5DAB A;  5H6R B;  5LJM A;  3E0Z A;  3C98 B;  4PAG A;  3PU3 A;  2XAG B;  2LOS A;  4E7S A;  4JEU B;  5IYZ E;  5F8P A;  3UT5 E;  4A56 A;  2JMK A;  2D5U A;  3ZYK A;  1MMG A;  2PFV A;  2XAJ B;  1WLX A;  5LXT E;  3PUS A;  5L2L A;  2W0G A;  4G63 A;  2L9Q A;  4TV8 E;  2CWY A;  2YIN A;  5LGN B;  2E9X B;  2XHE B;  4IST A;  2YEV C;  2H7O A;  3N9N A;  1NWM X;  4K0U A;  2Y6X A;  1BR2 A;  2JRK A;  4MAL A;  1H7C A;  4AQF A;  2DLR A;  4L9I A;  4AQF C;  3MJX A;  1D1A A;  3RYI E;  3HR0 A;  2MYS A;  5JDM A;  3QC9 A;  4X1I E;  1O3X A;  4WBO A;  5JDG A;  2C5I T;  3ZJ1 A;  3KV4 A;  4KBM B;  2X9H A;  4G2A A;  4F6R C;  2KIN B;  2C0S A;  3PTR B;  3KV5 A;  3RPU A;  4MLK A;  4UVC B;  3P8C D;  1WR6 A;  2X66 A;  2BVM A;  3O1I A;  3EDU A;  5FY7 A;  1FIO A;  5FXZ A;  5LA6 E;  3RH3 A;  4BJN A;  3ZEF B;  2ES0 A;  3N9Q A;  2KLQ A;  4UEL A;  5HAX A;  4X20 E;  2A72 A;  2PBI A;  2A3D A;  2CLY C;  5TAO A;  4U72 A;  3SOL A;  4YJ3 E;  4YFS A;  2CCQ A;  5L3E B;  1YW0 A;  3LJC A;  5CB4 E;  3KBU A;  4KUM B;  3LK2 B;  2WMN A;  5IHY A;  2B1E A;  4OYK A;  3E22 E;  2Q9Q A;  3KV6 A;  2KWH A;  4EAH A;  3N5L A;  4CI2 B;  2Q9Q C;  1FEW A;  3CQG B;  5AFU L;  2I59 A;  2V26 A;  2L3L A;  1FMV A;  2NWB A;  3LK3 B;  2DWK A;  4TUY E;  2NW9 A;  3PU8 A;  1UCU A;  2J1D G;  4ZS2 A;  3HI2 A;  4H63 H;  4Z8X A;  1KNZ A;  4DBQ A;  2A2F X;  4QXH B;  3RX6 A;  5FY0 A;  2KWI B;  2D0U A;  4KP3 C;  2ODU A;  1US7 B;  2XUE A;  4P09 A;  5H6Q B;  4O4L E;  5L3B B;  4AKI A;  3K3O A;  4ZI3 C;  3OYX A;  4JEH B;  3OYZ A;  3HKB E;  1MNE A;  3GWH A;  1EZ3 A;  3N2O A;  1D1C A;  2WSS V;  3RC3 A;  3K3N A;  4EYU A;  2ZLY A;  2D0T A;  4TN7 B;  1HFA A;  4GYS A;  2LHN A;  4PJM A;  2PJQ A;  4HKA A;  4OHF A;  2YU1 A;  3KVA A;  2X67 A;  5KX5 E;  4EYY R;  4OYJ A;  3TKL B;  3RYH E;  4WNK A;  1MIY A;  2LJL A;  2Q9Q D;  3UFE A;  2HPL A;  4X1Y E;  3NZQ A;  4I55 E;  2PG8 A;  4XBF B;  4UXN B;  5EZY E;  4I4T E;  2KZ7 B;  5HWY A;  1OXZ A;  4CXY A;  5JR9 B;  2CXF A;  3NRY A;  3HA4 A;  4MFR A;  3ZMV B;  3N2G E;  2NOX A;  2W62 A;  3O9X A;  2CWO A;  3IBP A;  4ZI3 D;  3K3Q C;  5JQG E;  3CPZ A;  3FB2 A;  2RA1 A;  2CE7 A;  5GON E;  2CM0 A;  5L3D B;  4XAX B;  5LCY A;  3R6N A;  4B6X A;  3F57 A;  2ODV A;  2Z6E A;  3ZMS B;  2DCF A;  2V7K A;  3N2K E;  4WBN E;  2V7M A;  1MMA A;  2XTL A;  4ZOL E;  3BQK A;  3R84 B;  4C91 A;  3RRC A;  5F3J A;  3KV9 A;  1YKE B;  3LG7 A;  3SWH A;  2CXD A;  3CWZ B;  3VHL A;  3KIN B;  3AA6 B;  4BJM A;  2MTQ A;  5HXH A;  4AKR B;  1IAP A;  4EOZ B;  3AAE B;  4GYR A;  5LNK A;  2DNX A;  3DP7 A;  5LP6 E;  3ZMT B;  2L8K A;  2NTY A;  1MIV A;  2YK0 A;  3LK4 2;  3KDS E;  3MA9 A;  4TV9 E;  1LVK A;  2EHO B;  2MOZ A;  3QUJ A;  3Q5X A;  3AA1 B;  3GN5 B;  4FJO A;  5HXR A;  3D0T A;  4ZI7 E;  3ONX A;  1HCI A;  2JPF A;  2E9X A;  2NW8 A;  3VKH A;  5LBQ B;  2E9X C;  2VKJ A;  5HXC A;  5J1G A;  5LJN A;  1V9D A;  1WRD A;  3GMI A;  3CX6 B;  3WAJ A;  4EZH A;  4E7Z A;  2VK9 A;  4UIG A;  5LHH B;  4ZI2 C;  4AKH A;  3PUQ A;  4GK0 E;  3AA7 B;  5LYJ E;  4IE7 A;  2N1G A;  2G0U A;  1T98 A;  3W15 B;  2KXP B;  4ASK A;  4DBR A;  4GIW A;  3PDY A;  1UX5 A;  2CMR A;  2KT9 A;  2ZMA A;  2W63 A;  3OBV E;  3ZLI A;  1FMW A;  2JMH A;  3IEE A;  5FP3 A;  5JDQ A;  4JUY A;  2ACX A;  2N9D A;  4AKL A;  3ETV A;  4QHO A;  4HN9 A;  4C90 A;  4PJJ A;  4JLE A;  2LSG A;  2CEA A;  3CQC B;  3UUL A;  1B7T A;  2DI4 A;  2E9X D;  5JRC B;  2VB6 A;  5JDL A;  5FMN A;  3MAC A;  3RKO A;  1CUN A;  2LSI A;  3VU7 H;  1AJ3 A;  4AQG A;  3PUR A;  2UXX B;  3IHR A;  1UX4 A;  2WM9 A;  3KBT A;  5FNV E;  2WMO A;  3O1H A;  5JDH A;  5HWX A;  3B57 A;  5DJQ C;  1D0X A;  4UF0 B;  4ZI2 D;  2OA5 A;  1KK7 A;  5J2T E;  3HKE E;  1YD8 G;  3EVY A;  5LGU B;  5EK4 A;  3U3I A;  4QXB B;  5JVD E;  1YKH B;  4PK5 A;  2VAS A;  3GA8 A;  3CVR A;  2VL8 A;  1BR1 A;  2K5B B;  3KFW X;  1BR0 A;  1MND A;  3M65 A;  3SRZ A;  4IDZ A;  3MXZ A;  2IC9 A;  1WYC A;  2YU2 A;  3WI3 A;  4IGU A;  2LM9 A;  5M4Y A;  2LSJ A;  2C5J A;  3VKG A;  2MBG A;  5L3F B;  5LHG B;  3UUX B;  1S94 A;  4FI5 A;  2NW7 A;  5LBM A;  3P7I A;  5C8Y E;  2NTX A;  4CI1 B;  3K8P C;  3O1J A;  4QX7 B;  3L3P A;  3J9X 1;  3V5S A;  2X9Y A;  1D0Y A;  3B13 A;  3OKQ A;  4GK5 E;  5A1L A;  2GK9 A;  2W00 A;  2LSY A;  2CA5 A;  1SA0 E;  2K9A A;  3HKC E;  4HE8 A;  1BR4 A;  2X0L B;  3CX8 B;  3FHN A;  4M1P A;  3CQX C;  5FXV A;  5DQV A;  5L3C B;  4EB6 E;  2X9W A;  2V7L A;  1OWA A;  2K48 A;  2X9X A;  2P9B A;  4H9N C;  2XAF B;  3T8O A;  1HF8 A;  1G73 A;  2X68 A;  2V7J A;  4TZ4 C;  2ZM8 A;  3ZMZ B;  3ANW B;  5JR9 A;  1HG2 A;  1ZV4 X;  2IC6 A;  2N2N A;  4AKG A;  5JR9 C;  3N9L A;  4YLH A;  3LBX A;  4PNI A;  1QUU A;  1HG5 A;  3PE0 A;  3Q9D A;  5EK3 A;  4BAY B;  4DVD A;  2VKH A;  3O4X E;  3CKD A;  3MZK B;  4ISS A;  4OK0 A;  5FXW A;  5ADX L;  2XAH B;  4MBQ A;  5ETW A;  4CI3 B;  1U5P A;  4PJN A;  3MK7 C;  5L3G B;  2D2S A;  4I50 E;  5KDM C;  3RC8 A;  2X51 A;  3ZMU B;  1ZHC A;  3ESL A;  1U4Q A;  1QSD A;  4L0R A;  3LFM A;  3AA0 B;  4U74 A;  3ZCJ A;  4O4I E;  3ETU A;  3WAK A;  3AVS A;  2Y8D A;  3BK9 A;  5E0O A;  2LSK A;  4QWN B;  2LE8 A;  4EZ4 A;  3J7Y q;  1Z0P A;  2LT3 A;  3A5X A;  1D0Z A;  3NRX A;  4ZHQ E;  4HGA A;  2EHO A;  2XAQ B;  2XQY A;  2BVL A;  3GN5 A;  1S35 A;  2EHO C;  2IAK A;  4X1K E;  3NBX X;  3C64 A;  5LHI B;  1X79 A;  4H9R C;  3E08 A;  3C50 A;  2BDE A;  2RP4 A;  3L09 A;  4YHJ A;  2VWA A;  3Q5W A;  4IE4 A;  4MHC A;  4UV9 B;  3C4Z A;  5FYM A;  4P0A A;  1MMD A;  1E1H B;  3DJB A;  3BQL A;  3UTK A;  1LKX A;  2E8I A;  3F31 A;  5DQW A;  5HYA A;  1NAF A;  2WBL A;  4UV8 B;  3N9P A;  2H7V C;  3ZCI A;  2K24 A;  4ERR A;  4CXW A;  2KND A;  3JC6 C;  3MKD A;  3SS1 A;  3HL6 A;  4O2A E;  1IZN B;  3I9Y A;  4IE0 A;  1HS7 A;  3HKD E;  3V5U A;  2JJ9 A;  5FXX A;  2CLY B;  3AVR A;  3ZPO A;  5HXS A;  3FBZ A;  3RRW A;  2LHR A;  2WWU A;  4PW8 A;  3N9O A;  3KVB A;  4UEM A;  4ANJ A;  2EHO D;  5J2U E;  4DMV A;  4OFZ A;  2QA7 A;  4WW0 A;  5HXE A;  4IHJ E;  2Q9Q B;  4KMC A;  4PFP A;  4H9S E;  5JRC A;  2HH7 A;  5CA0 E;  4GOU A;  1ZKE A;  4HFV A;  3U78 A;  3UUN A;  4EXT A;  1VRB A;  2NP9 A;  5KMG P;  3AB3 B;  2HPJ A;  1MMN A;  4DND A;  2CXL A;  4UF0 A;  4PJL A;  4QKN A;  3DTO A;  4EIW A;  4O2B E;  4CQI A;  1IJ5 A;  3IF8 B;  4O4J E;  5EK2 A;  5JRE A;  1ZEE A;  3JC6 D;  1LVF A;  5LG4 A;  2XAS B;  3F2E A;  3Q2M A;  3PUG A;  4UVB B;  3ZYM A;  2C5K T;  3N9M A;  2LOP A;  2Y48 B;  3AAA B;  4ILU A;  4O8S A;  1WYB A;  3AAI A;  4J2C A;  4DMW A;  3PUA A;  4PK4 A;  4TX5 A;  3RYC E;  3H3A A;  1HTJ F;  3C4X A;  5FY1 A;  3I0O A;  4CXX A;  5JDN A;  4QXC B;  4I43 B;  2DHR A;  1Y64 B;  4H9Q C;  2ZM2 A;  3NZP A;  3ZC0 A;  1SHZ C;  3FXE B;  3ZC1 A;  1VOM A;  3ZN1 B;  3ZYL A;  5CA1 E;  2SPC A;  4PFO A;  3CML A;  3EUH A;  1G8X A;  3ZJ2 A;  3BQI A;  5LOV E;  4PK6 A;  3S4U A;  2DWG A;  3H37 A;  4IE6 A;  4UVA B;  2WAU A;  5JH7 E;  2QGS A;  5BMV E;  1LRZ A;  4V1A v;  3FXD B;  3C4W A;  2M67 A;  4H9P C;  4IE5 A;  4XZC A;  4H63 V;  2IW5 B;  4BA9 A;  3RYF E;  3I0Q A;  2UXN B;  3ANW A;  4AXP A;  1D1B A;  4N78 D;  4P0B A;  4AI6 A;  4HEA A;  3EDV A;  4ZS3 A;  2BZB A;  4NUV A;  2V1D B;  4ADZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...