4JUYA

Crystal structure of the pub domain of e3 ubiquitin ligase rnf31
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
193
structure length
193
Chain Sequence
HHHSSGRENLYFQGMPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PUB domain of E3 ubiquitin ligase RNF31
rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords E3 ubiquitin-protein ligase RNF31
total genus 64
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4juyA00
5LJMA 4P0BA 4JUYA 2HPLA 2CM0A 2CCQA 4P09A 2HPJA 2D5UA 4OYKA 4P0AA 4OYJA 5LJNA
chains in the Genus database with same CATH superfamily
2CWYA 2UXCT 4HWFA 5H6RB 2W4XA 3P4PA 2XQ3A 4DVDA 4HN9A 3AE3A 4KMCA 3RRCA 3WAKA 2XUEA 2VKDA 3NBXX 3OJAA 2W2UA 4ZZBA 4IDZA 4ISSA 3C4XA 4HEAA 4A5XA 2FBWA 4OHFA 4PFPA 2KSRA 2E9XA 2LE8A 2XPKA 5KX5E 3PUAA 4YTMA 3R6NA 2MPKA 3I0OA 2VKOA 4HFIA 4DV7T 2BKNA 4G63A 4H9RC 4GKKT 1FMWA 2VQFT 5AQGB 3RPUA 3TLVA 2WMOA 2PBIA 2V5CA 4LFCT 3EUHA 2VQET 2XASB 2BZBA 4UR9A 2WDRA 2XM1A 2HPLA 4KUMB 2AXDS 5EK3A 3OBVE 2B1EA 4X64T 4TWHA 4UVBB 3NWIA 1VCTA 3RC3A 4IL9A 4JI7T 1T98A 3EHZA 4IGUA 1LRZA 2DHRA 2BVMA 4F8HA 4DMVA 5KXJA 1Y64B 2PTFA 5JDLA 4OK0A 3O1HA 3S4UA 4ILBA 2WDQA 1CHUA 2H7OA 3AXJA 2KZ7B 2VL8A 3FZMB 3K8PC 1N36T 1OXZA 2V7LA 3A8YC 3CX8B 3CPZA 4GOUA 4HFDA 4AISA 5LHHB 4DR4T 3ZJ2A 4H9QC 4AKGA 3C4WA 1OEDA 3PUSA 4PW8A 4B6XA 5AQIB 4CXWA 3PJAJ 2ODVA 3HA4A 2N1GA 4JI6T 4YTNA 2JQKA 3P4RA 1JNZA 5E0OA 2FJDA 4LFBT 3RI5A 2WB5A 4GK5E 2LJLA 2LM9A 4CN6A 5HEOA 4DIDB 2DNXA 2WWUA 3NZPA 3ZN1B 4ANJA 1M7KA 1ZKEA 4DMWA 2CM0A 2NTYA 2YKSA 3RH3A 3K3QC 2R6GF 4CXXA 2D5UA 5HWXA 2ZM0A 5JRCA 1BR2A 3VR9A 3ZCIA 4F6RC 5LB7B 3C98B 3V5UA 2XHEB 2ZM8A 1XNRT 5FP3A 2W67A 3RIUC 2A2FX 3CX6B 3FHNA 4LMLA 3PURA 4QX8B 4PK5A 4ISTA 2KNDA 1Z8UA 2JMKA 3ONJA 3PE0A 3MJXA 5CFBA 5LGTB 1YXRA 5AQTB 5HXRA 5HXHA 2WU5A 2X66A 1LVKA 5F8PA 2V6YB 4DNDA 3QNUA 1WCRA 1OEDC 3I0QA 4JI0T 2H7VC 5CGMA 2ZM6T 3ABVA 3AE5A 3ESLA 2LSYA 4KBMB 5AQHB 4AQFA 1HNXT 2C5KT 4ZHQE 2BVLA 2N2NA 2XTLA 4EZ4A 2XQ6A 4EYYR 3HKBE 1HTJF 2JMHA 2AE9A 3QC9A 4WZXA 3RKGA 2QGSA 2NOXA 3ZMTB 4CZZB 3MKDA 4EEDA 2H89A 5L3GB 2BBJA 2LLYA 1MMDA 3N9LA 3QB5A 4EIWA 1WR0A 1S94A 5EK4A 4A56A 5L4EA 4U72A 5FMNA 1HX8A 4DR3T 1MNDA 3I9WA 2VB6A 5C8YE 3N9MA 1ZOYA 3PDYA 1SE7A 2B76A 1O3XA 2UXNB 3BQLA 2KMFA 2Q9QD 4X1KE 2VKHA 2ZMAA 3IA3A 2RPAA 2WQYA 3KV9A 4ZI3C 4CN4A 4DR2T 4AQYT 2UUCT 4UELA 2FJEA 2WU2A 4E7SA 4K0UA 2XQ8A 3BQIA 3RYHE 2YU1A 5LGUB 3GN5A 5HXCA 4QXBB 2JPFA 3PUGA 1UUSA 3KBTA 3TLTA 4YSXA 2OLTA 5J2UE 1W9RA 5FKYA 4EV6A 4DBQA 1WRDA 3ZT6A 4AQFC 4QXCB 2LKGA 3B57A 4GYRA 4O4JE 1HNWT 2XAJB 4HE8A 1QLBA 3LG7A 3GWHA 4NUVA 4O4IE 4IDPA 4QH5A 3UU5A 3UU3A 3ZC0A 4NXMT 4GYSA 5A1LA 1SA0E 3HKDE 2C5IT 3UUBA 3VHLA 4DV1T 5TAOA 2C5JA 3AEFA 1IBKT 4JI1T 3HL6A 2V6XA 3RLFF 5BMVE 5FXWA 2FJAA 1UURA 1I6ZA 1WYBA 1MMGA 5AQFB 2UUAT 3QK6A 4DO0A 2X67A 3P4WA 2H3RA 2MTQA 4GIWA 2H88A 2QYWA 4UV9B 4GKJT 3TLWA 5C2TA 2M67A 5FXVA 4K0KT 2UXDT 4YFSA 4DUZT 4IREA 3UUMA 2IIUA 1US7B 4PJLA 5IYZE 4CN1A 3IF8B 3P7IA 2VVSA 5H6QB 4YLHA 5EZYE 5FNVE 5FY0A 3RKOA 4DBRA 2WBLA 5L3BB 1M62A 2CLYB 2CRBA 2CWOA 4U31A 5FXXA 4DV0T 5J1GA 3GA8A 3ZC1A 4YSZA 4AXPA 2YDSA 3AEAA 3J7Yq 3X1DA 2CE7A 2EHOA 5ETWA 2WAUA 3EVYA 4I50E 4Z90A 5LBMA 3ZMUB 5L3CB 3FB2A 3W15B 4OX9T 3CX7B 3ZT7A 1SUMB 2LM2A 3VR8A 3AE9A 4IHJE 2VWAA 3UFGA 4B3RT 2X9YA 5LG3A 5JDQA 5FYMA 2LT3A 3H3MA 1AJ3A 2E9XD 4H63H 2J47A 4PJMA 3H37A 4AKHA 2LSIA 1B7TA 4U2YA 2KINB 3AEDA 3AVSA 4U3CA 4X20E 4X5TA 4NXNT 5JH7E 1OEDB 4P1NA 4HFCA 4TUYE 3CVRA 5ABHA 4X65T 2X9HA 2LRKA 3OPCA 3C4ZA 4J2CA 5KDMC 2W0GA 5ABFA 3RX6A 4TX5A 4P0BA 2Q9QB 2IDOB 3PUYF 2SPCA 1D1BA 2LKHA 3CQGB 3T1HT 3HKCE 4H63V 2Y6XA 2WCAA 3FZLB 4DV4T 4O4HE 2CBIA 1KK7A 4MALA 3LFMA 3PUVF 3B5MA 5LJNA 1UX5A 2LSJA 2XAFB 3N9OA 4JI5T 4IE0A 3EDVA 1YKHB 2XSBA 2W62A 5DABA 2G0UA 3MZKB 3Q5WA 5JTGA 3FZHB 2IAKA 5AQQB 5LGNB 4DV2T 4LF6T 1KFYA 2E9XC 2A9UA 3BK9A 2YINA 4QH1A 1T72A 4FI5A 4A98A 4U33A 3T1YT 2ES0A 5JR9B 1T7SA 3VU7H 3P8CD 5AFUL 1IJ6A 1IBLT 4QWNB 3RIUA 3J9X1 1HF8A 1XWMA 3O1IA 3KDSE 5JR9A 2BG9E 3SWHA 4JI4T 2E9XB 4H9NC 4YSYA 4BA9A 1FEWA 1HFAA 3UU8A 5JR9C 4G2AA 4ADZA 3QOFA 1KNRA 3L09A 5LHGB 1MIYA 5AQRB 1W09A 5FL0A 3RQWA 3WI3A 1ZP0A 2C0SA 2DWGA 3EI0A 1SHZC 3ZYKA 3UUNA 4DV5T 4HWDA 3OVUA 1HG2A 1XDPA 2W66A 1D1CA 5LHIB 2X68A 3QUJA 2HHHT 1YQ4A 1FJGT 1UGOA 1WFDA 2J62A 2X0YA 2WP9A 3NZQA 1T8BA 4IE4A 3K1SA 5FL1A 4UIGA 4EAHA 5AQPB 3DJBA 1HR0T 5ABGA 3ZMSB 1WYCA 1KNPA 5KMGP 3CQCB 2LHNA 1E2AA 4HFBA 2K3WA 2X0LB 5DQVA 2Z6EA 5LJMA 1IAPA 2BS2A 5J2TE 5L2LA 1BR0A 3MACA 3MXZA 3RYIE 3T8OA 4IDOA 3SFEA 3ZLIA 4EGWA 4A97A 3BQKA 4KP3C 1HCIA 5J0ZA 5AQLB 5FY1A 3UU6A 4X66T 2E5LT 2XM2A 4YTPA 3CK6A 5JVDE 2DWKA 4TNWA 3ZEFB 1NAFA 1LVFA 1E1HB 4M1PA 4WNKA 4AKIA 2XY8B 3AA6B 2I59A 1YKEB 4AQGA 3Q2MA 2VK9A 4U2ZA 4NIQA 1IJ5A 1W0AA 2YDRA 3JAEA 3GMIA 4O4LE 4E7ZA 2CLYC 2WY2A 2E5VA 2YDQA 2JRKA 2WZHA 5LG4A 2LRLA 4H9SE 4L5GA 3OTOT 2JIWA 3UU4A 2Q9QA 3RGLA 3EABA 2Y8DA 2GK9A 1D0XA 4MFRA 2A3DA 4JI2T 1VCSA 3OYXA 1UX4A 5HXEA 5BR8T 4DV3T 2UU9T 5FVLA 2BS3A 2K48A 3HKEE 5HXSA 4UV8B 2L9QA 3FBLA 2V5DA 2NTXA 2NWBA 3MA9A 1VOMA 4OYJA 2CPTA 3Q9DA 5IWAT 1R8IA 5DQWA 4CXYA 2BBHA 2DI4A 1LKXA 4QX7B 4C90A 4LF7T 2HPJA 4I4TE 4U7YA 4PNIA 4HWCA 4EOZB 3ZMVB 4I55E 1N32T 4LF9T 1DU2A 5AQSB 1MIWA 2V1DB 1H7CA 3FXDB 4YXDA 3CKDA 3UT5E 4LFAT 4JV5T 4DR5T 5LYJE 1J5ET 3D0TA 4ILCA 4ILUA 4HWHA 5JDGA 3K3OA 2LOSA 4YJ2E 2HH7A 1YQ3A 2IHR1 4TV8E 5FXZA 1D1AA 1G73A 1MMAA 2LOPA 2Q9QC 2ACZA 3FBZA 2LHRA 3AEBA 3MK7C 4TN7B 3RYFE 2CEAA 2V7IA 5IUXA 3NRYA 2E8IA 5JDNA 5LMUT 4IT4A 2J4GA 2F4VT 1X9BA 2MBGA 4TV9E 1UCUA 5AQVB 4ZI7E 4ZI3D 2PJQA 3P50A 2XQ9A 4YY3T 1WLXA 2VL0A 1MNEA 2LSGA 3KV6A 4HFEA 4QKNA 2KWHA 2V7MA 4N78D 1NWMX 3AE1A 3ETVA 2X9XA 2BKOA 3JAFA 3NRXA 4HTEA 3A7MA 3TLSA 2BG9C 3UQ4A 1XDOA 2DLRA 3AA7B 3DP7A 3QB5K 4TWFA 3CIRA 2XQ5A 2WM9A 1NENA 4ZS2A 2PFVA 5F5WA 5JDFA 2DCFA 4LF8T 3SRZA 4ZI2D 5JDHA 2EHOD 3ZKRA 3AAAB 1D0ZA 2V8SV 2X9WA 5LNKA 5GONE 2MOZA 5ABFB 4UVCB 2XZEA 5LCYA 2NR4A 4UF0A 4U7IA 4CI1B 5LP6E 1Y01A 2YOEA 2J1DG 3CMLA 4QHOA 4WW0A 4WYVA 4AIUA 5HEJA 3AAEB 1BR4A 2E2AA 3ZMZB 1HS7A 3P4SA 5HCMA 3SS1A 3NVOA 4V1Av 4ZS3A 1VRBA 2RA1A 2IW5B 4Z91A 1GQEA 3N9PA 1XNQT 4IE7A 4ZXLA 4AI6A 4MLKA 3IEEA 3TKLB 2WWVA 5C3JA 2D2SA 3PU3A 4NPPA 4KHZF 4TWDA 1IBMT 5HYAA 3KVBA 3M65A 1ZHCA 2WSSV 1S35A 2ZM2A 3PUZF 1E7PA 3ZJ1A 2UUBT 4ILAA 2BG9A 5HEHA 3JADA 3JCFA 2XSAA 3N2KE 3JC6D 3RF1A 4COFA 4Q25A 3UUXB 2XAQB 2UXXB 2OV9A 3PTRB 3Q5DA 4JEHB 2I0MA 2CHNA 4PAGA 4CI2B 3KFWX 3AE2A 3DTOA 3ZYMA 4ERRA 4ZZCA 3LBXA 2CBJA 2JQ9A 1QUUA 2QRXA 2OA5A 5AQMB 5JQGE 4KHPT 2IMLA 3E0ZA 3LDQB 3Q5XA 5HCJA 2ODUA 4QXHB 3F2EA 2P9BA 2KWIB 1N34T 2X0HA 2ZLYA 3AVRA 3ETUA 3LSVA 2W63A 4KI0F 4QH4A 3AE4A 4PK4A 4TNVA 3PUWF 3N5LA 5L4HA 2KLQA 3AE6A 5LA6E 3SOLA 4ASKA 4EZHA 4XBFB 3ZN0B 2KT9A 2MYSA 2YK0A 2W00A 3SFDA 3K3NA 2FUPA 2L3LA 5LMNT 2VKJA 4YT0A 5CJ5A 3M3ZB 2HN1A 2PG8A 5LOVE 5EK2A 2CXFA 3EAMA 3ONXA 2CHOA 2BS4A 4GK0E 2D9DA 2DL1A 3AECA 4HGAA 1U4QA 1OEDE 3KV4A 2M6IA 4L9IA 1XMQT 2XAGB 2MAWA 4BAYB 3AEGA 4TZ4C 1Z0PA 4XZCA 3ZSTA 5LXTE 4DR6T 5JRCB 3PV0F 3I1AA 3E08A 2YN6A 5HAXA 4ZI2C 3KV5A 2ACXA 2XQAA 4ZEYA 2D0TA 2VURA 5DJQC 3HI2A 4IDNA 3ZT5A 4AKLA 3KBUA 4FJOA 4UVAB 2JQHA 2NW7A 3FZFB 4H9OC 5HEUA 1L0VA 3O1JA 5JDMA 5CA1E 4B3TT 2HN2A 4DR7T 3O9XA 5LBQB 1G8XA 1HNZT 3ONLC 3IBPA 4IE5A 5F3JA 3VKHA 4MHCA 1MIVA 2X51A 4IL4A 4X1IE 4BJMA 3ZCJA 4C91A 4UF0B 1JNRA 5FY7A 2IUBA 4LMJA 1KNZA 1FIOA 1X79A 4LMKA 2M6BA 4EB6E 2BG9B 2K24A 4EYUA 4B3MT 3L39A 3EDUA 2IC9A 2V7KA 4I0UA 1KF6A 3ZPOA 4DUYT 3RIFA 3NKZA 1ZV4X 4YHJA 3P4QA 2N9DA 2BDEA 2XJ7A 3F31A 3LJCA 2CXDA 4JBWF 4YJ3E 5L3FB 2RP4A 2VVNA 3N9NA 1BR1A 3PJAA 2CMRA 2XAHB 3LK42 4JEUB 5AQUB 4KX6A 4PJJA 2VASA 2A72A 2V7JA 1WR6A 2BKPA 4P09A 5HWYA 3RC8A 3H3AA 3PUXF 1J1JA 3UQ7A 4IIJE 1V9DA 1NEKA 4JLEA 4L0RA 5CB4E 4AKRB 4X62T 3WAJA 1YW0A 3KVAA 3V5SA 4B3ST 3UULA 2CCQA 5IHYA 4WBNE 4O8SA 3AAIA 3AA0B 2EHOC 3ZSSA 4CQIA 2K9AA 3AE7A 3IHRA 4BJNA 4ZOLE 3U78A 3C51A 1N33T 1XMOT 1MMNA 5L3DB 4DR1T 3Q5EA 1CUNA 1U5PA 1EZ3A 3KINB 4LF4T 2EHOB 4IDQA 3VRBA 1IZNB 1W0BA 2QA7A 4UEMA 3E22E 2CA5A 3PU8A 4HWIB 4Z8XA 3VRAA 2JQQA 5AQKB 4JI3T 2XQ7A 4CI3B 5ADXL 1KEYA 1QSDA 3N2OA 3C64A 1J5WA 3F57A 1YD8G 4OFZA 3L3PA 2LEHA 3JC6C 1D0YA 3HR0A 4OYKA 1XZYA 3B13A 5AQNB 2L8KA 2XQYA 5FVKA 3AA1B 5M4YA 2IC6A 2V26A 3RQUA 2WDVA 3FZKB 4PJNA 4H9PC 2W61A 5L47A 1UK5A 4HFHA 3RYCE 5AQJB 5JREA 3AXJB 2Y48B 3RRWA 1FMVA 2QVAA 2V6YA 3U3IA 1I94T 3G06A 2XQ4A 4PFOA 5AQOB 3LBXB 3PUQA 3AB3B 3RHWA 5CA0E 2JJ9A 4O2BE 1HG5A 2NP9A 1ZEEA 3AE8A 4JI8T 4NUUA 3ANWA 2YEVC 3L8RA 4U74A 3RIAA 3A5XA 3OKQA 2NW9A 3UFEA 4X1YE 4LF5T 2K5BB 3N2GE 2NW8A 4JUYA 1HX1B 4MBQA 3I9YA 3AEEA 3CWZB 3O4XE 4XAXB 3LK2B 4DV6T 2WMNA 4HFVA 2FJBA 5HEGA 4P0AA 2I6HA 4PK6A 4UXNB 2CXLA 2WZIA 3R84B 2YU2A 4EEBA 5ABEA 1OWAA 3C50A 3TLUA 2UXBT 3CQXC 4WBOA 4JYAT 4YHHT 3LK3B 3GN5B 3OYZA 3UTKA 3ZYLA 2KXPB 2D0UA 4I43B 4EXTA 2WS3A 4HKAA 5L3EB 3VKGA 4IE6A 4O2AE 3N9QA 3FXEB 3ANWB 2LSKA
chains in the Genus database with same CATH topology
2CWYA 5H6RB 4DVDA 4HN9A 3RRCA 4KMCA 3WAKA 2XUEA 2VKDA 3NBXX 3OJAA 4IDZA 4ISSA 3C4XA 4HEAA 4OHFA 4PFPA 2LE8A 2E9XA 5KX5E 3PUAA 3R6NA 3I0OA 2VKOA 4G63A 4H9RC 1FMWA 3RPUA 2WMOA 2PBIA 3EUHA 2XASB 2BZBA 2HPLA 4KUMB 5EK3A 3OBVE 2B1EA 4UVBB 3RC3A 1T98A 4IGUA 1LRZA 2DHRA 2BVMA 1Y64B 5JDLA 4OK0A 3O1HA 3S4UA 2H7OA 2KZ7B 2VL8A 3K8PC 1OXZA 2V7LA 4GOUA 3CX8B 3CPZA 5LHHB 3ZJ2A 4H9QC 4AKGA 3C4WA 4PW8A 3PUSA 4B6XA 4CXWA 2ODVA 3HA4A 2N1GA 5E0OA 4GK5E 2LJLA 2LM9A 4XBFB 2DNXA 2WWUA 3NZPA 3ZN1B 4ANJA 1ZKEA 4DMWA 2CM0A 2NTYA 3RH3A 4CXXA 3K3QC 2D5UA 5HWXA 2ZM0A 5JRCA 1BR2A 3ZCIA 4F6RC 3C98B 3V5UA 2XHEB 2ZM8A 5FP3A 2A2FX 3CX6B 3FHNA 3PURA 4QX8B 4PK5A 4ISTA 2KNDA 2JMKA 3PE0A 3MJXA 5LGTB 5HXRA 5HXHA 2X66A 1LVKA 5F8PA 4DNDA 3I0QA 2H7VC 3ESLA 2LSYA 4KBMB 4AQFA 2C5KT 4ZHQE 2BVLA 2N2NA 2XTLA 4EZ4A 4EYYR 3HKBE 1HTJF 2JMHA 3QC9A 3ZMTB 4CZZB 2QGSA 2NOXA 3MKDA 5L3GB 3N9LA 4EIWA 1MMDA 1S94A 5EK4A 4A56A 4U72A 5FMNA 1HX8A 1MNDA 3I9WA 2VB6A 5C8YE 3N9MA 3PDYA 3ZC0A 3BQLA 4X1KE 1O3XA 2UXNB 2KMFA 2Q9QD 4ERRA 2VKHA 2ZMAA 3KV9A 4ZI3C 4UELA 5LGUB 4E7SA 4K0UA 3RYHE 3BQIA 2YU1A 3GN5A 5HXCA 4QXBB 2JPFA 3PUGA 3KBTA 5J2UE 4DBQA 1WRDA 4AQFC 4QXCB 3B57A 4GYRA 4O4JE 2XAJB 4HE8A 3LG7A 4O4IE 3GWHA 4NUVA 4GYSA 5A1LA 1SA0E 3HKDE 2C5IT 3VHLA 5TAOA 2C5JA 3HL6A 5BMVE 5FXWA 1WYBA 1MMGA 3QK6A 4DO0A 2X67A 2H3RA 2MTQA 4GIWA 4UV9B 2M67A 5FXVA 4YFSA 3UUMA 1US7B 4PJLA 5IYZE 3IF8B 3P7IA 5H6QB 4YLHA 5EZYE 5FNVE 5FY0A 3RKOA 4DBRA 2WBLA 5L3BB 2CLYB 2CWOA 5FXXA 5J1GA 3GA8A 3ZC1A 4AXPA 3J7Yq 3ZMUB 2CE7A 2EHOA 5ETWA 2WAUA 3EVYA 4I50E 5LBMA 5L3CB 3FB2A 3W15B 3CX7B 4IHJE 2VWAA 2X9YA 5JDQA 5FYMA 2LT3A 1AJ3A 2E9XD 4H63H 4PJMA 3H37A 4AKHA 2LSIA 1B7TA 2KINB 3AVSA 4X20E 5JH7E 4TUYE 3CVRA 2X9HA 4J2CA 3C4ZA 5KDMC 2W0GA 3RX6A 4TX5A 4P0BA 2Q9QB 2SPCA 1D1BA 3CQGB 3HKCE 4H63V 2Y6XA 4O4HE 1KK7A 4MALA 3LFMA 5LJNA 1UX5A 2LSJA 2XAFB 3N9OA 4IE0A 3EDVA 1YKHB 2W62A 5DABA 2G0UA 3MZKB 3Q5WA 2IAKA 5LGNB 2E9XC 3BK9A 2YINA 4FI5A 2ES0A 5JR9B 3VU7H 3P8CD 5AFUL 1IJ6A 4QWNB 3J9X1 1HF8A 3O1IA 3KDSE 5JR9A 3SWHA 2E9XB 4H9NC 4BA9A 1FEWA 1HFAA 5JR9C 4G2AA 4ADZA 5LHGB 3L09A 1MIYA 3WI3A 3ZYKA 2C0SA 2DWGA 1SHZC 3UUNA 5LHIB 1HG2A 1D1CA 2X68A 3QUJA 3NZQA 4IE4A 4UIGA 4EAHA 3DJBA 3ZMSB 1WYCA 5KMGP 3CQCB 2LHNA 2X0LB 5DQVA 2Z6EA 5LJMA 1IAPA 5L2LA 5J2TE 1BR0A 3MACA 3MXZA 3RYIE 3T8OA 3ZLIA 3BQKA 4KP3C 1HCIA 5FY1A 5JVDE 2DWKA 3ZEFB 1NAFA 1LVFA 1E1HB 4M1PA 4WNKA 4AKIA 3AA6B 2I59A 1YKEB 4AQGA 3Q2MA 2VK9A 4E7ZA 1IJ5A 4O4LE 3GMIA 2CLYC 2JRKA 5LG4A 4L5GA 4H9SE 2Q9QA 2Y8DA 2GK9A 1D0XA 4MFRA 2A3DA 3OYXA 1UX4A 2K48A 3HKEE 5HXSA 4UV8B 2L9QA 3FBLA 2NTXA 2NWBA 3MA9A 1VOMA 4OYJA 3Q9DA 5DQWA 4CXYA 2DI4A 1LKXA 4QX7B 2HPJA 4I4TE 4PNIA 4EOZB 3ZMVB 4I55E 3FXDB 1MIWA 2V1DB 1H7CA 3CKDA 3UT5E 5LYJE 3D0TA 4ILUA 5JDGA 3K3OA 2LOSA 4YJ2E 2HH7A 4TV8E 5FXZA 4BAYB 1D1AA 1G73A 1MMAA 2LOPA 2Q9QC 3FBZA 3MK7C 2LHRA 4TN7B 3RYFE 2CEAA 2V7IA 3NRYA 2E8IA 5JDNA 2MBGA 4TV9E 1UCUA 4ZI7E 4ZI3D 2PJQA 1WLXA 3KV6A 1MNEA 2LSGA 4QKNA 5JQGE 2KWHA 2V7MA 4N78D 1NWMX 3NRXA 3ETVA 2X9XA 5LP6E 4HTEA 2DLRA 3AA7B 3DP7A 4ZS2A 2WM9A 5JDFA 2PFVA 3SRZA 4ZI2D 2DCFA 5JDHA 2EHOD 3AAAB 1D0ZA 2X9WA 5LNKA 5GONE 2MOZA 4UVCB 5LCYA 4UF0A 4CI1B 4WW0A 3CMLA 2J1DG 4QHOA 1HS7A 3AAEB 1BR4A 3ZMZB 3SS1A 4V1Av 4ZS3A 1VRBA 2RA1A 2IW5B 3N9PA 4IE7A 4AI6A 4MLKA 3IEEA 3TKLB 2D2SA 3PU3A 5HYAA 3KVBA 3M65A 1ZHCA 2WSSV 1S35A 2ZM2A 3ZJ1A 3N2KE 3JC6D 3UUXB 2XAQB 2UXXB 3PTRB 4PAGA 4JEHB 4CI2B 3KFWX 3DTOA 3ZYMA 3LBXA 1QUUA 2OA5A 3E0ZA 3Q5XA 2ODUA 4QXHB 3F2EA 2P9BA 2KWIB 2ZLYA 3AVRA 3ETUA 2W63A 4C90A 4PK4A 3SOLA 5HXEA 3N5LA 2KLQA 4ASKA 5LA6E 4EZHA 3ZN0B 2KT9A 2MYSA 2YK0A 2W00A 3K3NA 2L3LA 2VKJA 5LOVE 2PG8A 5EK2A 2CXFA 3ONXA 4GK0E 4HGAA 1U4QA 3KV4A 4L9IA 2XAGB 4TZ4C 1Z0PA 4XZCA 5LXTE 5JRCB 3I1AA 3E08A 5HAXA 4ZI2C 3KV5A 2ACXA 2D0TA 5DJQC 3HI2A 4AKLA 3KBUA 4FJOA 4UVAB 2NW7A 4H9OC 3O1JA 5JDMA 5CA1E 3O9XA 5LBQB 1G8XA 4IE5A 3IBPA 3VKHA 5F3JA 4MHCA 1MIVA 2X51A 4X1IE 4BJMA 3ZCJA 4C91A 4UF0B 5FY7A 1KNZA 1FIOA 1X79A 4EB6E 2K24A 4EYUA 3EDUA 2IC9A 2V7KA 3ZPOA 1ZV4X 4YHJA 2N9DA 2BDEA 3F31A 3LJCA 4YJ3E 2CXDA 5L3FB 2RP4A 3N9NA 1BR1A 2CMRA 2XAHB 3LK42 4JEUB 4DMVA 4PJJA 3RC8A 2VASA 2A72A 2V7JA 1WR6A 5HWYA 4P09A 3H3AA 4IIJE 1V9DA 4JLEA 4L0RA 5CB4E 4AKRB 3WAJA 1YW0A 3KVAA 3V5SA 3UULA 2CCQA 5IHYA 4WBNE 4O8SA 3AAIA 3AA0B 2EHOC 4CQIA 2K9AA 3IHRA 4BJNA 4ZOLE 3U78A 3C51A 1MMNA 5L3DB 1CUNA 1U5PA 1EZ3A 3KINB 2EHOB 1IZNB 2QA7A 4UEMA 3E22E 2CA5A 3PU8A 4Z8XA 2JQQA 4CI3B 5ADXL 3N2OA 1QSDA 3C64A 3F57A 4OFZA 1YD8G 3L3PA 2LEHA 3JC6C 1D0YA 3HR0A 4OYKA 3B13A 2L8KA 2XQYA 3AA1B 5M4YA 2IC6A 2V26A 4PJNA 4H9PC 2W61A 3RYCE 5JREA 2Y48B 3RRWA 1FMVA 3U3IA 4PFOA 3LBXB 3PUQA 3AB3B 5CA0E 2JJ9A 4O2BE 1HG5A 2NP9A 1ZEEA 4NUUA 3ANWA 2YEVC 4U74A 3UFEA 3A5XA 3OKQA 2NW9A 4X1YE 2K5BB 3N2GE 2NW8A 4JUYA 4MBQA 3I9YA 3CWZB 3O4XE 4XAXB 3LK2B 4P0AA 2WMNA 4HFVA 4PK6A 4UXNB 2CXLA 3R84B 2YU2A 1OWAA 3C50A 3CQXC 4WBOA 3LK3B 3GN5B 3OYZA 3UTKA 3ZYLA 2KXPB 2D0UA 4I43B 4EXTA 4HKAA 5L3EB 3VKGA 4IE6A 4O2AE 3N9QA 3FXEB 3ANWB 2LSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJM A;  4P0B A;  4JUY A;  2HPL A;  2CM0 A;  2CCQ A;  4P09 A;  2HPJ A;  2D5U A;  4OYK A;  4P0A A;  4OYJ A;  5LJN A; 
#chains in the Genus database with same CATH topology
 2CWY A;  2UXC T;  4HWF A;  5H6R B;  2W4X A;  3P4P A;  2XQ3 A;  4DVD A;  4HN9 A;  3AE3 A;  4KMC A;  3RRC A;  3WAK A;  2XUE A;  2VKD A;  3NBX X;  3OJA A;  2W2U A;  4ZZB A;  4IDZ A;  4ISS A;  3C4X A;  4HEA A;  4A5X A;  2FBW A;  4OHF A;  4PFP A;  2KSR A;  2E9X A;  2LE8 A;  2XPK A;  5KX5 E;  3PUA A;  4YTM A;  3R6N A;  2MPK A;  3I0O A;  2VKO A;  4HFI A;  4DV7 T;  2BKN A;  4G63 A;  4H9R C;  4GKK T;  1FMW A;  2VQF T;  5AQG B;  3RPU A;  3TLV A;  2WMO A;  2PBI A;  2V5C A;  4LFC T;  3EUH A;  2VQE T;  2XAS B;  2BZB A;  4UR9 A;  2WDR A;  2XM1 A;  2HPL A;  4KUM B;  2AXD S;  5EK3 A;  3OBV E;  2B1E A;  4X64 T;  4TWH A;  4UVB B;  3NWI A;  1VCT A;  3RC3 A;  4IL9 A;  4JI7 T;  1T98 A;  3EHZ A;  4IGU A;  1LRZ A;  2DHR A;  2BVM A;  4F8H A;  4DMV A;  5KXJ A;  1Y64 B;  2PTF A;  5JDL A;  4OK0 A;  3O1H A;  3S4U A;  4ILB A;  2WDQ A;  1CHU A;  2H7O A;  3AXJ A;  2KZ7 B;  2VL8 A;  3FZM B;  3K8P C;  1N36 T;  1OXZ A;  2V7L A;  3A8Y C;  3CX8 B;  3CPZ A;  4GOU A;  4HFD A;  4AIS A;  5LHH B;  4DR4 T;  3ZJ2 A;  4H9Q C;  4AKG A;  3C4W A;  1OED A;  3PUS A;  4PW8 A;  4B6X A;  5AQI B;  4CXW A;  3PJA J;  2ODV A;  3HA4 A;  2N1G A;  4JI6 T;  4YTN A;  2JQK A;  3P4R A;  1JNZ A;  5E0O A;  2FJD A;  4LFB T;  3RI5 A;  2WB5 A;  4GK5 E;  2LJL A;  2LM9 A;  4CN6 A;  5HEO A;  4DID B;  2DNX A;  2WWU A;  3NZP A;  3ZN1 B;  4ANJ A;  1M7K A;  1ZKE A;  4DMW A;  2CM0 A;  2NTY A;  2YKS A;  3RH3 A;  3K3Q C;  2R6G F;  4CXX A;  2D5U A;  5HWX A;  2ZM0 A;  5JRC A;  1BR2 A;  3VR9 A;  3ZCI A;  4F6R C;  5LB7 B;  3C98 B;  3V5U A;  2XHE B;  2ZM8 A;  1XNR T;  5FP3 A;  2W67 A;  3RIU C;  2A2F X;  3CX6 B;  3FHN A;  4LML A;  3PUR A;  4QX8 B;  4PK5 A;  4IST A;  2KND A;  1Z8U A;  2JMK A;  3ONJ A;  3PE0 A;  3MJX A;  5CFB A;  5LGT B;  1YXR A;  5AQT B;  5HXR A;  5HXH A;  2WU5 A;  2X66 A;  1LVK A;  5F8P A;  2V6Y B;  4DND A;  3QNU A;  1WCR A;  1OED C;  3I0Q A;  4JI0 T;  2H7V C;  5CGM A;  2ZM6 T;  3ABV A;  3AE5 A;  3ESL A;  2LSY A;  4KBM B;  5AQH B;  4AQF A;  1HNX T;  2C5K T;  4ZHQ E;  2BVL A;  2N2N A;  2XTL A;  4EZ4 A;  2XQ6 A;  4EYY R;  3HKB E;  1HTJ F;  2JMH A;  2AE9 A;  3QC9 A;  4WZX A;  3RKG A;  2QGS A;  2NOX A;  3ZMT B;  4CZZ B;  3MKD A;  4EED A;  2H89 A;  5L3G B;  2BBJ A;  2LLY A;  1MMD A;  3N9L A;  3QB5 A;  4EIW A;  1WR0 A;  1S94 A;  5EK4 A;  4A56 A;  5L4E A;  4U72 A;  5FMN A;  1HX8 A;  4DR3 T;  1MND A;  3I9W A;  2VB6 A;  5C8Y E;  3N9M A;  1ZOY A;  3PDY A;  1SE7 A;  2B76 A;  1O3X A;  2UXN B;  3BQL A;  2KMF A;  2Q9Q D;  4X1K E;  2VKH A;  2ZMA A;  3IA3 A;  2RPA A;  2WQY A;  3KV9 A;  4ZI3 C;  4CN4 A;  4DR2 T;  4AQY T;  2UUC T;  4UEL A;  2FJE A;  2WU2 A;  4E7S A;  4K0U A;  2XQ8 A;  3BQI A;  3RYH E;  2YU1 A;  5LGU B;  3GN5 A;  5HXC A;  4QXB B;  2JPF A;  3PUG A;  1UUS A;  3KBT A;  3TLT A;  4YSX A;  2OLT A;  5J2U E;  1W9R A;  5FKY A;  4EV6 A;  4DBQ A;  1WRD A;  3ZT6 A;  4AQF C;  4QXC B;  2LKG A;  3B57 A;  4GYR A;  4O4J E;  1HNW T;  2XAJ B;  4HE8 A;  1QLB A;  3LG7 A;  3GWH A;  4NUV A;  4O4I E;  4IDP A;  4QH5 A;  3UU5 A;  3UU3 A;  3ZC0 A;  4NXM T;  4GYS A;  5A1L A;  1SA0 E;  3HKD E;  2C5I T;  3UUB A;  3VHL A;  4DV1 T;  5TAO A;  2C5J A;  3AEF A;  1IBK T;  4JI1 T;  3HL6 A;  2V6X A;  3RLF F;  5BMV E;  5FXW A;  2FJA A;  1UUR A;  1I6Z A;  1WYB A;  1MMG A;  5AQF B;  2UUA T;  3QK6 A;  4DO0 A;  2X67 A;  3P4W A;  2H3R A;  2MTQ A;  4GIW A;  2H88 A;  2QYW A;  4UV9 B;  4GKJ T;  3TLW A;  5C2T A;  2M67 A;  5FXV A;  4K0K T;  2UXD T;  4YFS A;  4DUZ T;  4IRE A;  3UUM A;  2IIU A;  1US7 B;  4PJL A;  5IYZ E;  4CN1 A;  3IF8 B;  3P7I A;  2VVS A;  5H6Q B;  4YLH A;  5EZY E;  5FNV E;  5FY0 A;  3RKO A;  4DBR A;  2WBL A;  5L3B B;  1M62 A;  2CLY B;  2CRB A;  2CWO A;  4U31 A;  5FXX A;  4DV0 T;  5J1G A;  3GA8 A;  3ZC1 A;  4YSZ A;  4AXP A;  2YDS A;  3AEA A;  3J7Y q;  3X1D A;  2CE7 A;  2EHO A;  5ETW A;  2WAU A;  3EVY A;  4I50 E;  4Z90 A;  5LBM A;  3ZMU B;  5L3C B;  3FB2 A;  3W15 B;  4OX9 T;  3CX7 B;  3ZT7 A;  1SUM B;  2LM2 A;  3VR8 A;  3AE9 A;  4IHJ E;  2VWA A;  3UFG A;  4B3R T;  2X9Y A;  5LG3 A;  5JDQ A;  5FYM A;  2LT3 A;  3H3M A;  1AJ3 A;  2E9X D;  4H63 H;  2J47 A;  4PJM A;  3H37 A;  4AKH A;  2LSI A;  1B7T A;  4U2Y A;  2KIN B;  3AED A;  3AVS A;  4U3C A;  4X20 E;  4X5T A;  4NXN T;  5JH7 E;  1OED B;  4P1N A;  4HFC A;  4TUY E;  3CVR A;  5ABH A;  4X65 T;  2X9H A;  2LRK A;  3OPC A;  3C4Z A;  4J2C A;  5KDM C;  2W0G A;  5ABF A;  3RX6 A;  4TX5 A;  4P0B A;  2Q9Q B;  2IDO B;  3PUY F;  2SPC A;  1D1B A;  2LKH A;  3CQG B;  3T1H T;  3HKC E;  4H63 V;  2Y6X A;  2WCA A;  3FZL B;  4DV4 T;  4O4H E;  2CBI A;  1KK7 A;  4MAL A;  3LFM A;  3PUV F;  3B5M A;  5LJN A;  1UX5 A;  2LSJ A;  2XAF B;  3N9O A;  4JI5 T;  4IE0 A;  3EDV A;  1YKH B;  2XSB A;  2W62 A;  5DAB A;  2G0U A;  3MZK B;  3Q5W A;  5JTG A;  3FZH B;  2IAK A;  5AQQ B;  5LGN B;  4DV2 T;  4LF6 T;  1KFY A;  2E9X C;  2A9U A;  3BK9 A;  2YIN A;  4QH1 A;  1T72 A;  4FI5 A;  4A98 A;  4U33 A;  3T1Y T;  2ES0 A;  5JR9 B;  1T7S A;  3VU7 H;  3P8C D;  5AFU L;  1IJ6 A;  1IBL T;  4QWN B;  3RIU A;  3J9X 1;  1HF8 A;  1XWM A;  3O1I A;  3KDS E;  5JR9 A;  2BG9 E;  3SWH A;  4JI4 T;  2E9X B;  4H9N C;  4YSY A;  4BA9 A;  1FEW A;  1HFA A;  3UU8 A;  5JR9 C;  4G2A A;  4ADZ A;  3QOF A;  1KNR A;  3L09 A;  5LHG B;  1MIY A;  5AQR B;  1W09 A;  5FL0 A;  3RQW A;  3WI3 A;  1ZP0 A;  2C0S A;  2DWG A;  3EI0 A;  1SHZ C;  3ZYK A;  3UUN A;  4DV5 T;  4HWD A;  3OVU A;  1HG2 A;  1XDP A;  2W66 A;  1D1C A;  5LHI B;  2X68 A;  3QUJ A;  2HHH T;  1YQ4 A;  1FJG T;  1UGO A;  1WFD A;  2J62 A;  2X0Y A;  2WP9 A;  3NZQ A;  1T8B A;  4IE4 A;  3K1S A;  5FL1 A;  4UIG A;  4EAH A;  5AQP B;  3DJB A;  1HR0 T;  5ABG A;  3ZMS B;  1WYC A;  1KNP A;  5KMG P;  3CQC B;  2LHN A;  1E2A A;  4HFB A;  2K3W A;  2X0L B;  5DQV A;  2Z6E A;  5LJM A;  1IAP A;  2BS2 A;  5J2T E;  5L2L A;  1BR0 A;  3MAC A;  3MXZ A;  3RYI E;  3T8O A;  4IDO A;  3SFE A;  3ZLI A;  4EGW A;  4A97 A;  3BQK A;  4KP3 C;  1HCI A;  5J0Z A;  5AQL B;  5FY1 A;  3UU6 A;  4X66 T;  2E5L T;  2XM2 A;  4YTP A;  3CK6 A;  5JVD E;  2DWK A;  4TNW A;  3ZEF B;  1NAF A;  1LVF A;  1E1H B;  4M1P A;  4WNK A;  4AKI A;  2XY8 B;  3AA6 B;  2I59 A;  1YKE B;  4AQG A;  3Q2M A;  2VK9 A;  4U2Z A;  4NIQ A;  1IJ5 A;  1W0A A;  2YDR A;  3JAE A;  3GMI A;  4O4L E;  4E7Z A;  2CLY C;  2WY2 A;  2E5V A;  2YDQ A;  2JRK A;  2WZH A;  5LG4 A;  2LRL A;  4H9S E;  4L5G A;  3OTO T;  2JIW A;  3UU4 A;  2Q9Q A;  3RGL A;  3EAB A;  2Y8D A;  2GK9 A;  1D0X A;  4MFR A;  2A3D A;  4JI2 T;  1VCS A;  3OYX A;  1UX4 A;  5HXE A;  5BR8 T;  4DV3 T;  2UU9 T;  5FVL A;  2BS3 A;  2K48 A;  3HKE E;  5HXS A;  4UV8 B;  2L9Q A;  3FBL A;  2V5D A;  2NTX A;  2NWB A;  3MA9 A;  1VOM A;  4OYJ A;  2CPT A;  3Q9D A;  5IWA T;  1R8I A;  5DQW A;  4CXY A;  2BBH A;  2DI4 A;  1LKX A;  4QX7 B;  4C90 A;  4LF7 T;  2HPJ A;  4I4T E;  4U7Y A;  4PNI A;  4HWC A;  4EOZ B;  3ZMV B;  4I55 E;  1N32 T;  4LF9 T;  1DU2 A;  5AQS B;  1MIW A;  2V1D B;  1H7C A;  3FXD B;  4YXD A;  3CKD A;  3UT5 E;  4LFA T;  4JV5 T;  4DR5 T;  5LYJ E;  1J5E T;  3D0T A;  4ILC A;  4ILU A;  4HWH A;  5JDG A;  3K3O A;  2LOS A;  4YJ2 E;  2HH7 A;  1YQ3 A;  2IHR 1;  4TV8 E;  5FXZ A;  1D1A A;  1G73 A;  1MMA A;  2LOP A;  2Q9Q C;  2ACZ A;  3FBZ A;  2LHR A;  3AEB A;  3MK7 C;  4TN7 B;  3RYF E;  2CEA A;  2V7I A;  5IUX A;  3NRY A;  2E8I A;  5JDN A;  5LMU T;  4IT4 A;  2J4G A;  2F4V T;  1X9B A;  2MBG A;  4TV9 E;  1UCU A;  5AQV B;  4ZI7 E;  4ZI3 D;  2PJQ A;  3P50 A;  2XQ9 A;  4YY3 T;  1WLX A;  2VL0 A;  1MNE A;  2LSG A;  3KV6 A;  4HFE A;  4QKN A;  2KWH A;  2V7M A;  4N78 D;  1NWM X;  3AE1 A;  3ETV A;  2X9X A;  2BKO A;  3JAF A;  3NRX A;  4HTE A;  3A7M A;  3TLS A;  2BG9 C;  3UQ4 A;  1XDO A;  2DLR A;  3AA7 B;  3DP7 A;  3QB5 K;  4TWF A;  3CIR A;  2XQ5 A;  2WM9 A;  1NEN A;  4ZS2 A;  2PFV A;  5F5W A;  5JDF A;  2DCF A;  4LF8 T;  3SRZ A;  4ZI2 D;  5JDH A;  2EHO D;  3ZKR A;  3AAA B;  1D0Z A;  2V8S V;  2X9W A;  5LNK A;  5GON E;  2MOZ A;  5ABF B;  4UVC B;  2XZE A;  5LCY A;  2NR4 A;  4UF0 A;  4U7I A;  4CI1 B;  5LP6 E;  1Y01 A;  2YOE A;  2J1D G;  3CML A;  4QHO A;  4WW0 A;  4WYV A;  4AIU A;  5HEJ A;  3AAE B;  1BR4 A;  2E2A A;  3ZMZ B;  1HS7 A;  3P4S A;  5HCM A;  3SS1 A;  3NVO A;  4V1A v;  4ZS3 A;  1VRB A;  2RA1 A;  2IW5 B;  4Z91 A;  1GQE A;  3N9P A;  1XNQ T;  4IE7 A;  4ZXL A;  4AI6 A;  4MLK A;  3IEE A;  3TKL B;  2WWV A;  5C3J A;  2D2S A;  3PU3 A;  4NPP A;  4KHZ F;  4TWD A;  1IBM T;  5HYA A;  3KVB A;  3M65 A;  1ZHC A;  2WSS V;  1S35 A;  2ZM2 A;  3PUZ F;  1E7P A;  3ZJ1 A;  2UUB T;  4ILA A;  2BG9 A;  5HEH A;  3JAD A;  3JCF A;  2XSA A;  3N2K E;  3JC6 D;  3RF1 A;  4COF A;  4Q25 A;  3UUX B;  2XAQ B;  2UXX B;  2OV9 A;  3PTR B;  3Q5D A;  4JEH B;  2I0M A;  2CHN A;  4PAG A;  4CI2 B;  3KFW X;  3AE2 A;  3DTO A;  3ZYM A;  4ERR A;  4ZZC A;  3LBX A;  2CBJ A;  2JQ9 A;  1QUU A;  2QRX A;  2OA5 A;  5AQM B;  5JQG E;  4KHP T;  2IML A;  3E0Z A;  3LDQ B;  3Q5X A;  5HCJ A;  2ODU A;  4QXH B;  3F2E A;  2P9B A;  2KWI B;  1N34 T;  2X0H A;  2ZLY A;  3AVR A;  3ETU A;  3LSV A;  2W63 A;  4KI0 F;  4QH4 A;  3AE4 A;  4PK4 A;  4TNV A;  3PUW F;  3N5L A;  5L4H A;  2KLQ A;  3AE6 A;  5LA6 E;  3SOL A;  4ASK A;  4EZH A;  4XBF B;  3ZN0 B;  2KT9 A;  2MYS A;  2YK0 A;  2W00 A;  3SFD A;  3K3N A;  2FUP A;  2L3L A;  5LMN T;  2VKJ A;  4YT0 A;  5CJ5 A;  3M3Z B;  2HN1 A;  2PG8 A;  5LOV E;  5EK2 A;  2CXF A;  3EAM A;  3ONX A;  2CHO A;  2BS4 A;  4GK0 E;  2D9D A;  2DL1 A;  3AEC A;  4HGA A;  1U4Q A;  1OED E;  3KV4 A;  2M6I A;  4L9I A;  1XMQ T;  2XAG B;  2MAW A;  4BAY B;  3AEG A;  4TZ4 C;  1Z0P A;  4XZC A;  3ZST A;  5LXT E;  4DR6 T;  5JRC B;  3PV0 F;  3I1A A;  3E08 A;  2YN6 A;  5HAX A;  4ZI2 C;  3KV5 A;  2ACX A;  2XQA A;  4ZEY A;  2D0T A;  2VUR A;  5DJQ C;  3HI2 A;  4IDN A;  3ZT5 A;  4AKL A;  3KBU A;  4FJO A;  4UVA B;  2JQH A;  2NW7 A;  3FZF B;  4H9O C;  5HEU A;  1L0V A;  3O1J A;  5JDM A;  5CA1 E;  4B3T T;  2HN2 A;  4DR7 T;  3O9X A;  5LBQ B;  1G8X A;  1HNZ T;  3ONL C;  3IBP A;  4IE5 A;  5F3J A;  3VKH A;  4MHC A;  1MIV A;  2X51 A;  4IL4 A;  4X1I E;  4BJM A;  3ZCJ A;  4C91 A;  4UF0 B;  1JNR A;  5FY7 A;  2IUB A;  4LMJ A;  1KNZ A;  1FIO A;  1X79 A;  4LMK A;  2M6B A;  4EB6 E;  2BG9 B;  2K24 A;  4EYU A;  4B3M T;  3L39 A;  3EDU A;  2IC9 A;  2V7K A;  4I0U A;  1KF6 A;  3ZPO A;  4DUY T;  3RIF A;  3NKZ A;  1ZV4 X;  4YHJ A;  3P4Q A;  2N9D A;  2BDE A;  2XJ7 A;  3F31 A;  3LJC A;  2CXD A;  4JBW F;  4YJ3 E;  5L3F B;  2RP4 A;  2VVN A;  3N9N A;  1BR1 A;  3PJA A;  2CMR A;  2XAH B;  3LK4 2;  4JEU B;  5AQU B;  4KX6 A;  4PJJ A;  2VAS A;  2A72 A;  2V7J A;  1WR6 A;  2BKP A;  4P09 A;  5HWY A;  3RC8 A;  3H3A A;  3PUX F;  1J1J A;  3UQ7 A;  4IIJ E;  1V9D A;  1NEK A;  4JLE A;  4L0R A;  5CB4 E;  4AKR B;  4X62 T;  3WAJ A;  1YW0 A;  3KVA A;  3V5S A;  4B3S T;  3UUL A;  2CCQ A;  5IHY A;  4WBN E;  4O8S A;  3AAI A;  3AA0 B;  2EHO C;  3ZSS A;  4CQI A;  2K9A A;  3AE7 A;  3IHR A;  4BJN A;  4ZOL E;  3U78 A;  3C51 A;  1N33 T;  1XMO T;  1MMN A;  5L3D B;  4DR1 T;  3Q5E A;  1CUN A;  1U5P A;  1EZ3 A;  3KIN B;  4LF4 T;  2EHO B;  4IDQ A;  3VRB A;  1IZN B;  1W0B A;  2QA7 A;  4UEM A;  3E22 E;  2CA5 A;  3PU8 A;  4HWI B;  4Z8X A;  3VRA A;  2JQQ A;  5AQK B;  4JI3 T;  2XQ7 A;  4CI3 B;  5ADX L;  1KEY A;  1QSD A;  3N2O A;  3C64 A;  1J5W A;  3F57 A;  1YD8 G;  4OFZ A;  3L3P A;  2LEH A;  3JC6 C;  1D0Y A;  3HR0 A;  4OYK A;  1XZY A;  3B13 A;  5AQN B;  2L8K A;  2XQY A;  5FVK A;  3AA1 B;  5M4Y A;  2IC6 A;  2V26 A;  3RQU A;  2WDV A;  3FZK B;  4PJN A;  4H9P C;  2W61 A;  5L47 A;  1UK5 A;  4HFH A;  3RYC E;  5AQJ B;  5JRE A;  3AXJ B;  2Y48 B;  3RRW A;  1FMV A;  2QVA A;  2V6Y A;  3U3I A;  1I94 T;  3G06 A;  2XQ4 A;  4PFO A;  5AQO B;  3LBX B;  3PUQ A;  3AB3 B;  3RHW A;  5CA0 E;  2JJ9 A;  4O2B E;  1HG5 A;  2NP9 A;  1ZEE A;  3AE8 A;  4JI8 T;  4NUU A;  3ANW A;  2YEV C;  3L8R A;  4U74 A;  3RIA A;  3A5X A;  3OKQ A;  2NW9 A;  3UFE A;  4X1Y E;  4LF5 T;  2K5B B;  3N2G E;  2NW8 A;  4JUY A;  1HX1 B;  4MBQ A;  3I9Y A;  3AEE A;  3CWZ B;  3O4X E;  4XAX B;  3LK2 B;  4DV6 T;  2WMN A;  4HFV A;  2FJB A;  5HEG A;  4P0A A;  2I6H A;  4PK6 A;  4UXN B;  2CXL A;  2WZI A;  3R84 B;  2YU2 A;  4EEB A;  5ABE A;  1OWA A;  3C50 A;  3TLU A;  2UXB T;  3CQX C;  4WBO A;  4JYA T;  4YHH T;  3LK3 B;  3GN5 B;  3OYZ A;  3UTK A;  3ZYL A;  2KXP B;  2D0U A;  4I43 B;  4EXT A;  2WS3 A;  4HKA A;  5L3E B;  3VKG A;  4IE6 A;  4O2A E;  3N9Q A;  3FXE B;  3ANW B;  2LSK A; 
#chains in the Genus database with same CATH homology
 2CWY A;  5H6R B;  4DVD A;  4HN9 A;  3RRC A;  4KMC A;  3WAK A;  2XUE A;  2VKD A;  3NBX X;  3OJA A;  4IDZ A;  4ISS A;  3C4X A;  4HEA A;  4OHF A;  4PFP A;  2LE8 A;  2E9X A;  5KX5 E;  3PUA A;  3R6N A;  3I0O A;  2VKO A;  4G63 A;  4H9R C;  1FMW A;  3RPU A;  2WMO A;  2PBI A;  3EUH A;  2XAS B;  2BZB A;  2HPL A;  4KUM B;  5EK3 A;  3OBV E;  2B1E A;  4UVB B;  3RC3 A;  1T98 A;  4IGU A;  1LRZ A;  2DHR A;  2BVM A;  1Y64 B;  5JDL A;  4OK0 A;  3O1H A;  3S4U A;  2H7O A;  2KZ7 B;  2VL8 A;  3K8P C;  1OXZ A;  2V7L A;  4GOU A;  3CX8 B;  3CPZ A;  5LHH B;  3ZJ2 A;  4H9Q C;  4AKG A;  3C4W A;  4PW8 A;  3PUS A;  4B6X A;  4CXW A;  2ODV A;  3HA4 A;  2N1G A;  5E0O A;  4GK5 E;  2LJL A;  2LM9 A;  4XBF B;  2DNX A;  2WWU A;  3NZP A;  3ZN1 B;  4ANJ A;  1ZKE A;  4DMW A;  2CM0 A;  2NTY A;  3RH3 A;  4CXX A;  3K3Q C;  2D5U A;  5HWX A;  2ZM0 A;  5JRC A;  1BR2 A;  3ZCI A;  4F6R C;  3C98 B;  3V5U A;  2XHE B;  2ZM8 A;  5FP3 A;  2A2F X;  3CX6 B;  3FHN A;  3PUR A;  4QX8 B;  4PK5 A;  4IST A;  2KND A;  2JMK A;  3PE0 A;  3MJX A;  5LGT B;  5HXR A;  5HXH A;  2X66 A;  1LVK A;  5F8P A;  4DND A;  3I0Q A;  2H7V C;  3ESL A;  2LSY A;  4KBM B;  4AQF A;  2C5K T;  4ZHQ E;  2BVL A;  2N2N A;  2XTL A;  4EZ4 A;  4EYY R;  3HKB E;  1HTJ F;  2JMH A;  3QC9 A;  3ZMT B;  4CZZ B;  2QGS A;  2NOX A;  3MKD A;  5L3G B;  3N9L A;  4EIW A;  1MMD A;  1S94 A;  5EK4 A;  4A56 A;  4U72 A;  5FMN A;  1HX8 A;  1MND A;  3I9W A;  2VB6 A;  5C8Y E;  3N9M A;  3PDY A;  3ZC0 A;  3BQL A;  4X1K E;  1O3X A;  2UXN B;  2KMF A;  2Q9Q D;  4ERR A;  2VKH A;  2ZMA A;  3KV9 A;  4ZI3 C;  4UEL A;  5LGU B;  4E7S A;  4K0U A;  3RYH E;  3BQI A;  2YU1 A;  3GN5 A;  5HXC A;  4QXB B;  2JPF A;  3PUG A;  3KBT A;  5J2U E;  4DBQ A;  1WRD A;  4AQF C;  4QXC B;  3B57 A;  4GYR A;  4O4J E;  2XAJ B;  4HE8 A;  3LG7 A;  4O4I E;  3GWH A;  4NUV A;  4GYS A;  5A1L A;  1SA0 E;  3HKD E;  2C5I T;  3VHL A;  5TAO A;  2C5J A;  3HL6 A;  5BMV E;  5FXW A;  1WYB A;  1MMG A;  3QK6 A;  4DO0 A;  2X67 A;  2H3R A;  2MTQ A;  4GIW A;  4UV9 B;  2M67 A;  5FXV A;  4YFS A;  3UUM A;  1US7 B;  4PJL A;  5IYZ E;  3IF8 B;  3P7I A;  5H6Q B;  4YLH A;  5EZY E;  5FNV E;  5FY0 A;  3RKO A;  4DBR A;  2WBL A;  5L3B B;  2CLY B;  2CWO A;  5FXX A;  5J1G A;  3GA8 A;  3ZC1 A;  4AXP A;  3J7Y q;  3ZMU B;  2CE7 A;  2EHO A;  5ETW A;  2WAU A;  3EVY A;  4I50 E;  5LBM A;  5L3C B;  3FB2 A;  3W15 B;  3CX7 B;  4IHJ E;  2VWA A;  2X9Y A;  5JDQ A;  5FYM A;  2LT3 A;  1AJ3 A;  2E9X D;  4H63 H;  4PJM A;  3H37 A;  4AKH A;  2LSI A;  1B7T A;  2KIN B;  3AVS A;  4X20 E;  5JH7 E;  4TUY E;  3CVR A;  2X9H A;  4J2C A;  3C4Z A;  5KDM C;  2W0G A;  3RX6 A;  4TX5 A;  4P0B A;  2Q9Q B;  2SPC A;  1D1B A;  3CQG B;  3HKC E;  4H63 V;  2Y6X A;  4O4H E;  1KK7 A;  4MAL A;  3LFM A;  5LJN A;  1UX5 A;  2LSJ A;  2XAF B;  3N9O A;  4IE0 A;  3EDV A;  1YKH B;  2W62 A;  5DAB A;  2G0U A;  3MZK B;  3Q5W A;  2IAK A;  5LGN B;  2E9X C;  3BK9 A;  2YIN A;  4FI5 A;  2ES0 A;  5JR9 B;  3VU7 H;  3P8C D;  5AFU L;  1IJ6 A;  4QWN B;  3J9X 1;  1HF8 A;  3O1I A;  3KDS E;  5JR9 A;  3SWH A;  2E9X B;  4H9N C;  4BA9 A;  1FEW A;  1HFA A;  5JR9 C;  4G2A A;  4ADZ A;  5LHG B;  3L09 A;  1MIY A;  3WI3 A;  3ZYK A;  2C0S A;  2DWG A;  1SHZ C;  3UUN A;  5LHI B;  1HG2 A;  1D1C A;  2X68 A;  3QUJ A;  3NZQ A;  4IE4 A;  4UIG A;  4EAH A;  3DJB A;  3ZMS B;  1WYC A;  5KMG P;  3CQC B;  2LHN A;  2X0L B;  5DQV A;  2Z6E A;  5LJM A;  1IAP A;  5L2L A;  5J2T E;  1BR0 A;  3MAC A;  3MXZ A;  3RYI E;  3T8O A;  3ZLI A;  3BQK A;  4KP3 C;  1HCI A;  5FY1 A;  5JVD E;  2DWK A;  3ZEF B;  1NAF A;  1LVF A;  1E1H B;  4M1P A;  4WNK A;  4AKI A;  3AA6 B;  2I59 A;  1YKE B;  4AQG A;  3Q2M A;  2VK9 A;  4E7Z A;  1IJ5 A;  4O4L E;  3GMI A;  2CLY C;  2JRK A;  5LG4 A;  4L5G A;  4H9S E;  2Q9Q A;  2Y8D A;  2GK9 A;  1D0X A;  4MFR A;  2A3D A;  3OYX A;  1UX4 A;  2K48 A;  3HKE E;  5HXS A;  4UV8 B;  2L9Q A;  3FBL A;  2NTX A;  2NWB A;  3MA9 A;  1VOM A;  4OYJ A;  3Q9D A;  5DQW A;  4CXY A;  2DI4 A;  1LKX A;  4QX7 B;  2HPJ A;  4I4T E;  4PNI A;  4EOZ B;  3ZMV B;  4I55 E;  3FXD B;  1MIW A;  2V1D B;  1H7C A;  3CKD A;  3UT5 E;  5LYJ E;  3D0T A;  4ILU A;  5JDG A;  3K3O A;  2LOS A;  4YJ2 E;  2HH7 A;  4TV8 E;  5FXZ A;  4BAY B;  1D1A A;  1G73 A;  1MMA A;  2LOP A;  2Q9Q C;  3FBZ A;  3MK7 C;  2LHR A;  4TN7 B;  3RYF E;  2CEA A;  2V7I A;  3NRY A;  2E8I A;  5JDN A;  2MBG A;  4TV9 E;  1UCU A;  4ZI7 E;  4ZI3 D;  2PJQ A;  1WLX A;  3KV6 A;  1MNE A;  2LSG A;  4QKN A;  5JQG E;  2KWH A;  2V7M A;  4N78 D;  1NWM X;  3NRX A;  3ETV A;  2X9X A;  5LP6 E;  4HTE A;  2DLR A;  3AA7 B;  3DP7 A;  4ZS2 A;  2WM9 A;  5JDF A;  2PFV A;  3SRZ A;  4ZI2 D;  2DCF A;  5JDH A;  2EHO D;  3AAA B;  1D0Z A;  2X9W A;  5LNK A;  5GON E;  2MOZ A;  4UVC B;  5LCY A;  4UF0 A;  4CI1 B;  4WW0 A;  3CML A;  2J1D G;  4QHO A;  1HS7 A;  3AAE B;  1BR4 A;  3ZMZ B;  3SS1 A;  4V1A v;  4ZS3 A;  1VRB A;  2RA1 A;  2IW5 B;  3N9P A;  4IE7 A;  4AI6 A;  4MLK A;  3IEE A;  3TKL B;  2D2S A;  3PU3 A;  5HYA A;  3KVB A;  3M65 A;  1ZHC A;  2WSS V;  1S35 A;  2ZM2 A;  3ZJ1 A;  3N2K E;  3JC6 D;  3UUX B;  2XAQ B;  2UXX B;  3PTR B;  4PAG A;  4JEH B;  4CI2 B;  3KFW X;  3DTO A;  3ZYM A;  3LBX A;  1QUU A;  2OA5 A;  3E0Z A;  3Q5X A;  2ODU A;  4QXH B;  3F2E A;  2P9B A;  2KWI B;  2ZLY A;  3AVR A;  3ETU A;  2W63 A;  4C90 A;  4PK4 A;  3SOL A;  5HXE A;  3N5L A;  2KLQ A;  4ASK A;  5LA6 E;  4EZH A;  3ZN0 B;  2KT9 A;  2MYS A;  2YK0 A;  2W00 A;  3K3N A;  2L3L A;  2VKJ A;  5LOV E;  2PG8 A;  5EK2 A;  2CXF A;  3ONX A;  4GK0 E;  4HGA A;  1U4Q A;  3KV4 A;  4L9I A;  2XAG B;  4TZ4 C;  1Z0P A;  4XZC A;  5LXT E;  5JRC B;  3I1A A;  3E08 A;  5HAX A;  4ZI2 C;  3KV5 A;  2ACX A;  2D0T A;  5DJQ C;  3HI2 A;  4AKL A;  3KBU A;  4FJO A;  4UVA B;  2NW7 A;  4H9O C;  3O1J A;  5JDM A;  5CA1 E;  3O9X A;  5LBQ B;  1G8X A;  4IE5 A;  3IBP A;  3VKH A;  5F3J A;  4MHC A;  1MIV A;  2X51 A;  4X1I E;  4BJM A;  3ZCJ A;  4C91 A;  4UF0 B;  5FY7 A;  1KNZ A;  1FIO A;  1X79 A;  4EB6 E;  2K24 A;  4EYU A;  3EDU A;  2IC9 A;  2V7K A;  3ZPO A;  1ZV4 X;  4YHJ A;  2N9D A;  2BDE A;  3F31 A;  3LJC A;  4YJ3 E;  2CXD A;  5L3F B;  2RP4 A;  3N9N A;  1BR1 A;  2CMR A;  2XAH B;  3LK4 2;  4JEU B;  4DMV A;  4PJJ A;  3RC8 A;  2VAS A;  2A72 A;  2V7J A;  1WR6 A;  5HWY A;  4P09 A;  3H3A A;  4IIJ E;  1V9D A;  4JLE A;  4L0R A;  5CB4 E;  4AKR B;  3WAJ A;  1YW0 A;  3KVA A;  3V5S A;  3UUL A;  2CCQ A;  5IHY A;  4WBN E;  4O8S A;  3AAI A;  3AA0 B;  2EHO C;  4CQI A;  2K9A A;  3IHR A;  4BJN A;  4ZOL E;  3U78 A;  3C51 A;  1MMN A;  5L3D B;  1CUN A;  1U5P A;  1EZ3 A;  3KIN B;  2EHO B;  1IZN B;  2QA7 A;  4UEM A;  3E22 E;  2CA5 A;  3PU8 A;  4Z8X A;  2JQQ A;  4CI3 B;  5ADX L;  3N2O A;  1QSD A;  3C64 A;  3F57 A;  4OFZ A;  1YD8 G;  3L3P A;  2LEH A;  3JC6 C;  1D0Y A;  3HR0 A;  4OYK A;  3B13 A;  2L8K A;  2XQY A;  3AA1 B;  5M4Y A;  2IC6 A;  2V26 A;  4PJN A;  4H9P C;  2W61 A;  3RYC E;  5JRE A;  2Y48 B;  3RRW A;  1FMV A;  3U3I A;  4PFO A;  3LBX B;  3PUQ A;  3AB3 B;  5CA0 E;  2JJ9 A;  4O2B E;  1HG5 A;  2NP9 A;  1ZEE A;  4NUU A;  3ANW A;  2YEV C;  4U74 A;  3UFE A;  3A5X A;  3OKQ A;  2NW9 A;  4X1Y E;  2K5B B;  3N2G E;  2NW8 A;  4JUY A;  4MBQ A;  3I9Y A;  3CWZ B;  3O4X E;  4XAX B;  3LK2 B;  4P0A A;  2WMN A;  4HFV A;  4PK6 A;  4UXN B;  2CXL A;  3R84 B;  2YU2 A;  1OWA A;  3C50 A;  3CQX C;  4WBO A;  3LK3 B;  3GN5 B;  3OYZ A;  3UTK A;  3ZYL A;  2KXP B;  2D0U A;  4I43 B;  4EXT A;  4HKA A;  5L3E B;  3VKG A;  4IE6 A;  4O2A E;  3N9Q A;  3FXE B;  3ANW B;  2LSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...