4JUYA

Crystal structure of the pub domain of e3 ubiquitin ligase rnf31
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
193
structure length
193
Chain Sequence
b'HHHSSGRENLYFQGMPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Crystal structure of the PUB domain of E3 ubiquitin ligase RNF31
rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 64
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4juyA00
2D5UA 2CM0A 2HPLA 4P0BA 5LJMA 4JUYA 4OYJA 4OYKA 2HPJA 4P0AA 2CCQA 5LJNA 4P09A
chains in the Genus database with same CATH superfamily
3CIRA 3CWZB 5CGMA 1IJ5A 4QXHB 2VB6A 2FJEA 2CXFA 2XTLA 4AKIA 2ACXA 5JDGA 3CX6B 3LG7A 2E9XB 3ZKRA 5HWXA 2LE8A 2BZBA 3LSVA 4GYRA 3I1AA 3F31A 3AEFA 1VCSA 2V8SV 1BR1A 5FXWA 2IC9A 3UU8A 1YQ3A 3UU4A 2W4XA 4QHOA 4PK6A 3GMIA 2D2SA 4BAYB 3RHWA 2E8IA 3O1JA 5JR9B 5FMNA 3UTKA 2V7MA 3SOLA 3LFMA 2XQ7A 3PUAA 4CXXA 2DNXA 2X66A 3VR9A 2CWOA 3NWIA 1ZV4X 4I50E 2JPFA 5EK4A 1AJ3A 4QX8B 5C8YE 3UUXB 3G06A 4C91A 2ZM8A 2LT3A 4J2CA 1UX5A 3LK3B 2WWVA 4PK4A 4ZI3D 3PUXF 4ILUA 4U72A 3AAIA 2VKDA 1IJ6A 2VL8A 4WZXA 4DV0T 3KVAA 1O3XA 3KVBA 2WQYA 3J7Yq 4YLHA 1M7KA 4X1KE 4AQGA 1V9DA 1NWMX 2Y8DA 4IREA 3JADA 3ZN0B 2JJ9A 2K5BB 1CUNA 3UUBA 3FHNA 3ZEFB 4HWHA 2E9XD 2IIUA 2BVMA 2E9XA 3UU3A 5L3CB 1GQEA 1M62A 3QNUA 4IIJE 3V5UA 3ZSTA 5HEHA 3T8OA 1MMNA 4ZEYA 5FL0A 2X9XA 4IL9A 5CJ5A 2KMFA 1HX8A 2PTFA 3RQWA 2QVAA 3RRWA 4UIGA 3V5SA 2V7IA 4U74A 2VASA 4I0UA 1WLXA 4QXCB 4DVDA 4OX9T 5JR9A 5HWYA 2LSKA 4JI4T 3EHZA 2JQHA 2BS2A 4TX5A 5A1LA 4DR5T 4FI5A 5J2TE 1YXRA 1KNRA 4CN6A 5L47A 2BG9B 5KDMC 4IDPA 4H9PC 2XQ3A 2HN2A 1FJGT 1OEDC 2CHNA 3PJAJ 2XQ4A 3AECA 4ADZA 2ODUA 5FP3A 3H3AA 3FXEB 3N2KE 1KNPA 5C3JA 2FUPA 5AQOB 5HXRA 5EK2A 3PUVF 4G2AA 5KX5E 1JNZA 5FXXA 4LF6T 3ABVA 2RPAA 5JDMA 2BDEA 2H89A 4AKGA 1UK5A 3KV5A 4WBOA 5LJNA 4N78D 3I0OA 5CB4E 3ANWB 2V7JA 3ZYKA 2V5CA 3ZC0A 3ZYLA 2KWIB 3SFDA 3C98B 4ZI7E 3IA3A 2HPJA 2MOZA 3T1HT 4B3TT 1HS7A 3ZSSA 4U7YA 4DUYT 2YDSA 3H3MA 1ZP0A 4CI3B 5JDLA 1FIOA 5LBMA 3NRXA 3UT5E 2XM1A 5JRCA 1YD8G 3ETUA 4DR3T 4OYJA 2VL0A 4IE4A 4JI3T 1HR0T 3UFGA 4JI6T 1W0BA 4AI6A 1MMGA 3JCFA 1HCIA 4ISSA 3ZCIA 4O4LE 3JC6D 3CKDA 4DIDB 4YTPA 2LJLA 1UX4A 4JEHB 3BQKA 3BQIA 5LOVE 4YTMA 5LYJE 1E7PA 1OWAA 3BQLA 2QRXA 2BKOA 4OHFA 3NVOA 2W62A 3PU3A 2DLRA 4DV4T 4X66T 2X67A 4WNKA 4PFPA 2Q9QA 4AQFC 3OTOT 2ZMAA 2ZM6T 2BKPA 4V1Av 4TNWA 4ISTA 3PUZF 4WBNE 4TZ4C 2I6HA 2XUEA 3ZCJA 4WW0A 2XAGB 2CXLA 3RYFE 4DV6T 2XPKA 2WU2A 5HAXA 3TLUA 5CA0E 1WRDA 3ZPOA 3AA6B 1BR4A 4OYKA 3SRZA 3VKHA 4A97A 4ZZBA 2VK9A 3AE8A 5FXVA 1H7CA 1X9BA 5DABA 1YW0A 4ZI2C 4PK5A 1T98A 3AA7B 2IDOB 4M1PA 5LMUT 3M65A 1ZKEA 3I0QA 1QSDA 4DR2T 1T8BA 3RIFA 3PJAA 4HWCA 2AE9A 4TWDA 5LNKA 4LMKA 2CEAA 3RKGA 2K48A 3CPZA 4GIWA 1YQ4A 4HFBA 1IZNB 3AA0B 4YTNA 1QUUA 3EVYA 4DBQA 4IDQA 3O9XA 4Z90A 3Q5DA 4JUYA 4EEDA 2DWGA 4O2BE 2Y6XA 4GYSA 2LKGA 4EV6A 2FJBA 2UXDT 1SUMB 2XAHB 5LA6E 4HFIA 5AQLB 5H6RB 2WZIA 4EXTA 2N9DA 4G63A 1U4QA 3HA4A 3PUSA 3RI5A 1VOMA 3OYXA 5F8PA 2KSRA 3A5XA 1OEDB 4H9NC 5TAOA 2KT9A 2JIWA 4AQYT 2E2AA 4I55E 1MIYA 2NTXA 3AE4A 2KXPB 2PFVA 2IC6A 3AEGA 1T7SA 2VVSA 3FXDB 4MHCA 4JI0T 2OV9A 2V6XA 3RF1A 3FZHB 2A72A 4PNIA 2FBWA 2E5LT 4ZHQE 5EK3A 3Q2MA 5JH7E 2PJQA 2XQ9A 1HNZT 3AEBA 4DV7T 1LVFA 2H7OA 3RC8A 1VCTA 1NAFA 2LOPA 2NWBA 3N2OA 4IE0A 2FJAA 3OVUA 5BR8T 4MLKA 4BJMA 4Z91A 2XAFB 3RIUC 1D0XA 4DR1T 3LBXB 3ZLIA 2XM2A 5FVKA 3CK6A 4UELA 3TLSA 4YHHT 5LHIB 3QB5K 3PE0A 4O2AE 5F5WA 1MNEA 1KNZA 5FYMA 4LF9T 2VQET 1US7B 3EI0A 3I9YA 5ABFA 3UQ7A 3ZC1A 3CQGB 1ZHCA 4TN7B 4H9RC 4EIWA 4KI0F 3AE1A 3UU5A 3FB2A 1OEDA 5L3BB 3F2EA 2B1EA 5HEOA 2RP4A 3RPUA 5AQVB 4ILCA 2CCQA 2MAWA 4F8HA 2VVNA 3OBVE 3T1YT 3MKDA 2LLYA 2CE7A 4U7IA 1WR0A 2XSBA 2C0SA 2UUBT 2ZLYA 3N9PA 1S35A 2JRKA 4CN1A 2AXDS 1BR0A 1N34T 4LF5T 1HTJF 2LHNA 3BK9A 5CFBA 2BS3A 1XNQT 1XNRT 3NRYA 1MNDA 4XZCA 2CLYC 4P09A 4YXDA 2UXNB 3ZMSB 3C4XA 4KX6A 2WM9A 2NOXA 4UXNB 4DMWA 4MFRA 3H37A 1G8XA 3L09A 1J5WA 3P7IA 3A7MA 2MBGA 4BA9A 4ZZCA 2C5JA 4UVAB 2X51A 2R6GF 2W0GA 3AEAA 1W9RA 2DL1A 1WFDA 2RA1A 4CI2B 1EZ3A 1ZEEA 4EB6E 4WYVA 1WR6A 4IDZA 1D1BA 4KHPT 1UGOA 3MXZA 4B3ST 4JYAT 2ES0A 2N1GA 4EGWA 5AQQB 2XQ5A 3NKZA 3ZN1B 2WSSV 3MZKB 1XDPA 3ONXA 1Z0PA 3AEDA 5JTGA 3PURA 1IBMT 1N36T 3CMLA 4TV9E 2D9DA 4UF0B 5ADXL 4PJNA 1XMOT 4JI5T 3HR0A 5LP6E 4DO0A 4O4HE 1N33T 2JQKA 3N9MA 4AIUA 4AQFA 2YEVC 3AAEB 2YN6A 1YKHB 1IAPA 2UXCT 3KINB 2J1DG 5LHHB 4X20E 2ZM0A 2W00A 2F4VT 2LSIA 4UEMA 3UU6A 4O8SA 5LB7B 2EHOB 5JDNA 1I6ZA 2IAKA 5BMVE 1SA0E 2C5KT 2LSGA 3K1SA 2LHRA 4MALA 3RH3A 3R6NA 4HN9A 3OPCA 2XQ6A 4GK5E 2V26A 4HWFA 4IHJE 3HL6A 4IDOA 3PTRB 4UVBB 2JQQA 4NUVA 4AKLA 1D0ZA 4ZI2D 3TLVA 2CWYA 5HCMA 3U3IA 5IWAT 2X0LB 3K3QC 3FBLA 4YT0A 4ZS3A 2V5DA 3C4ZA 4JBWF 2H7VC 2X0YA 2I0MA 1ZOYA 1N32T 2G0UA 2X0HA 3AB3B 3PUWF 5JDQA 1B7TA 2BVLA 3AE5A 5JQGE 1G73A 4U3CA 3QOFA 5AQNB 4LFAT 4CQIA 5E0OA 2YU2A 2YKSA 2XY8B 2BG9A 4AKHA 2NR4A 4BJNA 2NTYA 4UF0A 5J2UE 2WDVA 4MBQA 2V6YB 4JI8T 4COFA 2BG9E 4B3RT 1HG5A 1UUSA 3J9X1 4QXBB 3GA8A 3RX6A 3PUQA 2PBIA 2EHOD 2EHOA 4B6XA 4HEAA 3MJXA 5LG4A 4ILBA 2BKNA 5HXSA 3GWHA 2Z6EA 3AVRA 2JMKA 4L5GA 4ERRA 1L0VA 3DJBA 3ANWA 3CQCB 4JI7T 1S94A 2MYSA 4DR4T 1CHUA 2H3RA 4EOZB 1LKXA 4B3MT 4CZZB 1OXZA 2WWUA 1MIWA 1HNXT 3D0TA 3R84B 3RYHE 4LMJA 5LCYA 2X9YA 5HYAA 2CLYB 4X65T 4X62T 4HFHA 1Y64B 3LDQB 4DV3T 2WCAA 1W09A 2NW8A 4QH4A 1W0AA 4X1YE 4O4JE 5EZYE 4ZXLA 4YY3T 3HKCE 2J62A 4HWDA 4IE5A 3ONLC 4U31A 5AQPB 4HWIB 4TWFA 3EABA 4A5XA 1HFAA 3VRAA 3ZMVB 2LRKA 2UUCT 3PUGA 4KUMB 2XZEA 2HPLA 4NUUA 2UXXB 2XQYA 2UXBT 3QC9A 4H63V 4PJJA 3ZYMA 4DBRA 4X5TA 5AQKB 2VURA 1MIVA 4KMCA 2PG8A 3KV4A 3L39A 1XWMA 5LBQB 3RYIE 4QX7B 3OKQA 5AQGB 2A9UA 2BBJA 1LRZA 2CBJA 3UFEA 5L3FB 4LF4T 5H6QB 2J4GA 4CN4A 2L3LA 4H9QC 3C50A 3N9NA 3W15B 3MACA 2LM9A 4DR6T 4AXPA 4CXWA 5JDHA 5GONE 4HGAA 4K0UA 2Q9QC 5AQIB 3KBUA 2IMLA 2XHEB 4UV9B 5HEUA 1J1JA 2D0TA 4EEBA 4JV5T 2OA5A 2W2UA 4L0RA 4QH5A 4DV1T 4U33A 2WB5A 3B13A 4EYYR 4LMLA 5HEGA 4PAGA 2M67A 2NW7A 3RIAA 1XDOA 3GN5B 3QB5A 2WY2A 1MMDA 2Y48B 2XAQB 3ZT5A 3MA9A 4Z8XA 3ZJ1A 4HFVA 4ILAA 3AVSA 1NEKA 1WYBA 4JI2T 3IHRA 1DU2A 2W63A 3QUJA 2YINA 4A98A 5IHYA 3K8PC 3KDSE 3FBZA 4YHJA 3P4RA 3PDYA 5AQTB 2DWKA 2CBIA 3AXJB 3ZMTB 5F3JA 4KBMB 2VKHA 3E22E 3ESLA 3JAEA 3N2GE 3NZPA 4HE8A 3NBXX 2V7LA 2XSAA 3P8CD 3LK2B 1HF8A 4OFZA 3KBTA 4DMVA 2LOSA 1FMVA 3M3ZB 2X9HA 4DUZT 4XAXB 2K3WA 1SE7A 5HXCA 2V7KA 3FZLB 3JAFA 5FXZA 4E7SA 3ZT7A 2N2NA 2WMOA 3Q9DA 5AFUL 4PJMA 4QWNB 4QH1A 2L9QA 4QKNA 5JDFA 1I94T 2W67A 3HKEE 4HFCA 1VRBA 2CRBA 3HI2A 3AA1B 1OEDE 2MPKA 3E08A 1KFYA 2DCFA 4UVCB 2X68A 3FZMB 4P0BA 4HKAA 3IF8B 3O4XE 5LGNB 3NZQA 4IT4A 2VKOA 3GN5A 2BS4A 2IUBA 1HX1B 1E1HB 1E2AA 2XQAA 5FNVE 2LRLA 4YJ3E 3ZMUB 4KP3C 1Y01A 2ACZA 1U5PA 4GK0E 3C64A 3DTOA 3AE3A 5ABHA 4IE6A 3OJAA 5AQJB 3LBXA 4A56A 4UV8B 3ZT6A 3VKGA 3C51A 1LVKA 4EAHA 3CX7B 2UU9T 5FY0A 4C90A 4AISA 2V1DB 2QYWA 5AQHB 2KLQA 4I43B 5J1GA 1WCRA 5DQWA 4P0AA 3AXJA 3L3PA 3RYCE 5CA1E 3HKBE 2YDQA 1D0YA 2VQFT 3UQ4A 3KFWX 5LGTB 3RGLA 3IEEA 3LK42 1IBKT 5L4EA 4HFEA 4TNVA 4U2ZA 5JRCB 3KV9A 1HNWT 2D0UA 4NPPA 4EZ4A 3O1IA 1J5ET 2L8KA 2GK9A 5ABGA 1UCUA 5IUXA 2H88A 4JLEA 2QA7A 3EAMA 3RKOA 3FZKB 2YK0A 3B57A 2LM2A 2I59A 1FMWA 1FEWA 3P4QA 5LHGB 2W61A 4Q25A 4TUYE 2XQ8A 3PV0F 2WDQA 2KINB 5JREA 2VWAA 1T72A 5LXTE 5L3DB 4OK0A 4YSYA 4ZI3C 4H9OC 2WP9A 5HXEA 4K0KT 5HCJA 5HXHA 2Q9QB 1UURA 4H9SE 2WMNA 5FKYA 2E5VA 3C4WA 3UUNA 2MTQA 4YFSA 2HHHT 2JQ9A 2VKJA 4JEUB 3HKDE 4L9IA 4ZOLE 3U78A 2HN1A 4HFDA 1D1CA 3VHLA 2FJDA 2WDRA 2YDRA 2E9XC 3Q5WA 1XZYA 5AQRB 4UR9A 3VR8A 2LSYA 2QGSA 2ODVA 3K3OA 3PUYF 2IHR1 3QK6A 4EYUA 3FZFB 1SHZC 3ZMZB 3CQXC 2DHRA 3LJCA 3UUMA 5FL1A 4GKKT 2XASB 4PFOA 1NENA 3PU8A 5L2LA 1KF6A 4LFBT 3WI3A 3WAJA 5JR9C 3AAAB 3S4UA 4ASKA 1KEYA 2J47A 3EDVA 4TWHA 2K9AA 1R8IA 1WYCA 4P1NA 2NW9A 3ZJ2A 1MMAA 2LEHA 3K3NA 4CI1B 3P4PA 2XAJB 4IL4A 2IW5B 2P9BA 2B76A 3ONJA 2Q9QD 3P4WA 4H63H 3AE9A 4X1IE 3AEEA 4LF8T 4F6RC 5IYZE 4YSXA 3CX8B 5AQSB 3CVRA 3MK7C 3AE2A 1XMQT 4DNDA 3P50A 3AE6A 5JVDE 5DQVA 4DV5T 4LFCT 3RC3A 2JMHA 2M6BA 3P4SA 2CPTA 5FVLA 2KNDA 4CXYA 4X64T 2OLTA 2HH7A 5ABEA 3Q5XA 3B5MA 3TKLB 4GKJT 5C2TA 2WAUA 4U2YA 2NP9A 2A2FX 5L3EB 1HG2A 4ANJA 4LF7T 3EDUA 3RIUA 2D5UA 2KWHA 4KHZF 4TV8E 1QLBA 3AE7A 2SPCA 3RQUA 5M4YA 4YJ2E 1JNRA 2WS3A 5AQUB 5LMNT 2ZM2A 2CA5A 5J0ZA 5LJMA 2XJ7A 3N9QA 3N9LA 3Q5EA 2YU1A 4IDNA 2LSJA 2V6YA 4YSZA 4PJLA 4JI1T 5L3GB 3JC6C 2KZ7B 5KMGP 2CHOA 3SWHA 2WU5A 4EZHA 2BG9C 3SFEA 1D1AA 4DR7T 3A8YC 3KV6A 2YOEA 4DV2T 3L8RA 2X9WA 1YKEB 3OYZA 5LG3A 3RLFF 3I9WA 2CMRA 2A3DA 4GOUA 1KK7A 3RRCA 4NXNT 1Z8UA 1X79A 3SS1A 3E0ZA 5ETWA 3DP7A 4E7ZA 5ABFB 5DJQC 5HEJA 2C5IT 3N5LA 4O4IE 3TLWA 4NIQA 3F57A 4IE7A 5AQFB 5FY7A 2UUAT 3EUHA 3O1HA 1BR2A 3IBPA 2EHOC 5FY1A 3WAKA 2CM0A 4NXMT 2BBHA 4HTEA 4XBFB 4I4TE 2CXDA 3VU7H 2DI4A 2W66A 4PW8A 5LGUB 3VRBA 5L4HA 5KXJA 3N9OA 2K24A 4FJOA 3ETVA 2M6IA 5AQMB 1IBLT 2WZHA 2WBLA 3X1DA 4IGUA 4AKRB 3UULA 2LKHA 3TLTA 4ZS2A
chains in the Genus database with same CATH topology
3VKHA 3LBXA 2JQQA 4NUVA 4A56A 2VK9A 4UV8B 4AKLA 3VKGA 1D0ZA 3CWZB 5FXVA 1H7CA 3C51A 5DABA 1LVKA 4ZI2D 1IJ5A 2CWYA 4EAHA 3CX7B 1YW0A 5FY0A 3U3IA 4C90A 2X0LB 3K3QC 4QXHB 4ZI2C 2VB6A 2V1DB 4PK5A 1T98A 3AA7B 2CXFA 3FBLA 2XTLA 2KLQA 4I43B 4ZS3A 5J1GA 4M1PA 4AKIA 2ACXA 5DQWA 5JDGA 3CX6B 3LG7A 3C4ZA 3M65A 1ZKEA 3I0QA 1QSDA 2E9XB 2H7VC 4P0AA 3L3PA 3RYCE 5CA1E 5HWXA 2LE8A 2BZBA 4GYRA 3I1AA 5LNKA 3HKBE 3F31A 1D0YA 2G0UA 3AB3B 2CEAA 2K48A 3CPZA 1BR1A 4GIWA 1B7TA 5JDQA 3KFWX 5LGTB 5FXWA 1IZNB 2BVLA 5JQGE 1G73A 3AA0B 1QUUA 2IC9A 4CQIA 3EVYA 5E0OA 4DBQA 3IEEA 2YU2A 3O9XA 3LK42 4JUYA 5JRCB 4QHOA 4PK6A 3KV9A 2DWGA 2D0UA 4O2BE 2Y6XA 4AKHA 4GYSA 4BJNA 4EZ4A 2NTYA 3O1IA 3GMIA 2D2SA 2L8KA 2GK9A 1UCUA 4UF0A 5J2UE 4BAYB 2XAHB 2E8IA 4JLEA 3O1JA 5JR9B 2QA7A 5FMNA 3UTKA 5LA6E 2V7MA 4MBQA 3SOLA 3LFMA 3PUAA 5H6RB 3RKOA 4EXTA 4CXXA 2DNXA 2N9DA 2X66A 1HG5A 4G63A 1U4QA 2CWOA 3HA4A 2YK0A 4QXBB 3J9X1 3B57A 3GA8A 1ZV4X 2I59A 4I50E 1FMWA 3PUSA 3RX6A 2JPFA 1FEWA 3PUQA 2PBIA 5EK4A 2EHOD 4IE6A 2EHOA 4B6XA 1VOMA 3OYXA 5F8PA 5LHGB 2W61A 4HEAA 4TUYE 1AJ3A 3A5XA 3MJXA 4H9NC 4QX8B 5C8YE 5LG4A 3UUXB 4C91A 5TAOA 2KT9A 5HXSA 2ZM8A 2LT3A 4J2CA 1UX5A 3GWHA 2Z6EA 3LK3B 2KINB 4I55E 5JREA 4PK4A 2VWAA 3AVRA 2JMKA 4L5GA 5LXTE 1MIYA 4ERRA 4ZI3D 3DJBA 2NTXA 4ILUA 4U72A 3ANWA 3AAIA 5L3DB 2VKDA 1IJ6A 2VL8A 4OK0A 4ZI3C 4H9OC 2KXPB 2PFVA 5HXEA 2IC6A 3CQCB 1S94A 2MYSA 5HXHA 2Q9QB 3FXDB 4MHCA 2H3RA 4EOZB 3KVAA 4H9SE 2WMNA 1LKXA 1O3XA 3KVBA 3J7Yq 4YLHA 4CZZB 4X1KE 4AQGA 1OXZA 2WWUA 3C4WA 1V9DA 1NWMX 1MIWA 2Y8DA 2A72A 3D0TA 4PNIA 3R84B 3UUNA 2MTQA 3RYHE 4ZHQE 5LCYA 5EK3A 2X9YA 3Q2MA 4YFSA 2PJQA 5JH7E 2VKJA 5HYAA 4JEUB 2CLYB 3HKDE 4L9IA 1LVFA 4ZOLE 2JJ9A 2K5BB 1CUNA 3ZN0B 1Y64B 3FHNA 3ZEFB 2H7OA 3RC8A 2NW8A 4X1YE 3U78A 2E9XD 1D1CA 4O4JE 3VHLA 1NAFA 5EZYE 2BVMA 2E9XA 2LOPA 5L3CB 2NWBA 3N2OA 4IIJE 2E9XC 3Q5WA 3HKCE 4IE0A 3V5UA 4MLKA 2LSYA 4BJMA 2QGSA 4IE5A 2ODVA 2XAFB 3K3OA 3T8OA 1MMNA 1D0XA 1HFAA 3LBXB 3ZLIA 2X9XA 3ZMVB 3QK6A 4EYUA 1SHZC 4UELA 2KMFA 3ZMZB 3CQXC 2DHRA 3LJCA 3UUMA 3PUGA 1HX8A 4KUMB 2XASB 3RRWA 4UIGA 5LHIB 3V5SA 4PFOA 2HPLA 2V7IA 4NUUA 4U74A 2VASA 3PU8A 5L2LA 3PE0A 4O2AE 2UXXB 1WLXA 4QXCB 2XQYA 4DVDA 1MNEA 3QC9A 1KNZA 5JR9A 5HWYA 2LSKA 4H63V 5FYMA 3WI3A 4PJJA 3WAJA 3ZYMA 5JR9C 4DBRA 4TX5A 1US7B 5A1LA 3AAAB 1MIVA 4KMCA 2PG8A 3I9YA 3KV4A 3S4UA 4FI5A 5LBQB 5J2TE 3ZC1A 4ASKA 3RYIE 4QX7B 3OKQA 3CQGB 1ZHCA 4TN7B 4H9RC 4EIWA 3EDVA 1LRZA 2K9AA 3FB2A 1WYCA 3UFEA 5L3FB 5KDMC 5H6QB 4H9PC 2NW9A 5L3BB 3F2EA 2L3LA 1MMAA 2LEHA 2B1EA 4H9QC 2RP4A 3RPUA 3ZJ2A 3C50A 2CCQA 4ADZA 3N9NA 3W15B 3K3NA 4CI1B 2ODUA 3MACA 2LM9A 5FP3A 3H3AA 2XAJB 3OBVE 3FXEB 2IW5B 2P9BA 3N2KE 3MKDA 4AXPA 4CXWA 2CE7A 2Q9QD 2C0SA 5JDHA 2ZLYA 4H63H 5GONE 4HGAA 5HXRA 5EK2A 4K0UA 4X1IE 2Q9QC 3N9PA 1S35A 2JRKA 4G2AA 3KBUA 5KX5E 4F6RC 2XHEB 5FXXA 5IYZE 4UV9B 2D0TA 3CX8B 1BR0A 2OA5A 3CVRA 3MK7C 1HTJF 4L0RA 5JDMA 2BDEA 3B13A 4EYYR 2LHNA 3BK9A 4AKGA 4DNDA 3KV5A 5JVDE 5DQVA 4WBOA 3NRYA 3RC3A 1MNDA 2JMHA 4XZCA 2CLYC 5LJNA 4P09A 2UXNB 4N78D 4PAGA 3I0OA 2M67A 2KNDA 2NW7A 3ZMSB 4CXYA 5CB4E 3ANWB 2V7JA 3ZYKA 3GN5B 3C4XA 2WM9A 2NOXA 1MMDA 2HH7A 2Y48B 3ZC0A 3ZYLA 2XAQB 2KWIB 3C98B 4UXNB 3Q5XA 4DMWA 4MFRA 4ZI7E 3H37A 1G8XA 3TKLB 3MA9A 2HPJA 2MOZA 2WAUA 3L09A 2NP9A 2A2FX 3P7IA 4Z8XA 3ZJ1A 5L3EB 1HG2A 4ANJA 3EDUA 4HFVA 3AVSA 2D5UA 2KWHA 1HS7A 1WYBA 2MBGA 4BA9A 2C5JA 3IHRA 4UVAB 4CI3B 5JDLA 2X51A 4TV8E 2W0GA 1FIOA 2W63A 5LBMA 3NRXA 3QUJA 3UT5E 2SPCA 2YINA 5M4YA 4YJ2E 5IHYA 3K8PC 5JRCA 1YD8G 3KDSE 3ETUA 3FBZA 4YHJA 2ZM2A 4OYJA 3PDYA 4IE4A 2RA1A 4CI2B 2CA5A 1EZ3A 1ZEEA 2DWKA 5LJMA 4EB6E 4AI6A 3N9QA 3N9LA 1MMGA 2YU1A 3ZMTB 1WR6A 4IDZA 5F3JA 1D1BA 1HCIA 4KBMB 3MXZA 2VKHA 3E22E 3ESLA 3N2GE 4HE8A 2LSJA 3NZPA 3NBXX 4ISSA 4O4LE 4PJLA 3ZCIA 3JC6D 2ES0A 2N1GA 2V7LA 3CKDA 3P8CD 5L3GB 2LJLA 3LK2B 3JC6C 1UX4A 1HF8A 2KZ7B 4JEHB 5KMGP 3SWHA 4OFZA 3ZN1B 3KBTA 4DMVA 2WSSV 3BQKA 2LOSA 3BQIA 3MZKB 4EZHA 3ONXA 5LOVE 1FMVA 1Z0PA 5LYJE 1OWAA 1D1AA 3BQLA 3KV6A 2X9HA 2X9WA 4XAXB 3PURA 1YKEB 3OYZA 5HXCA 2V7KA 3CMLA 3I9WA 4TV9E 2CMRA 2A3DA 4OHFA 5FXZA 4GOUA 4E7SA 1KK7A 3RRCA 4UF0B 5ADXL 4PJNA 1X79A 3SS1A 3E0ZA 2N2NA 5ETWA 2W62A 2WMOA 3HR0A 3Q9DA 3DP7A 3PU3A 5LP6E 2DLRA 5AFUL 4PJMA 4QWNB 4E7ZA 2X67A 5DJQC 2L9QA 4WNKA 4QKNA 5JDFA 2C5IT 4DO0A 3N5LA 4O4IE 4O4HE 3N9MA 3F57A 4AQFA 2YEVC 3AAEB 3HKEE 4IE7A 4PFPA 5FY7A 1VRBA 2Q9QA 4AQFC 1YKHB 3EUHA 3HI2A 1IAPA 3AA1B 3O1HA 3KINB 2J1DG 5LHHB 4X20E 1BR2A 2ZM0A 2ZMAA 3E08A 2W00A 3IBPA 2EHOC 5FY1A 4V1Av 2LSIA 3WAKA 2DCFA 4UEMA 4UVCB 2X68A 4O8SA 2CM0A 4P0BA 4ISTA 2EHOB 4WBNE 4HKAA 4TZ4C 5JDNA 4HTEA 3IF8B 4I4TE 2CXDA 3O4XE 5LGNB 4XBFB 3NZQA 2IAKA 2VKOA 3GN5A 3VU7H 5BMVE 1SA0E 2C5KT 2XUEA 2DI4A 3ZCJA 2LSGA 4WW0A 1E1HB 4PW8A 5LGUB 2XAGB 2CXLA 3RYFE 5FNVE 2LHRA 3N9OA 4MALA 2K24A 4FJOA 3ETVA 5HAXA 3RH3A 3R6NA 2WBLA 4HN9A 4YJ3E 3ZMUB 4IGUA 4AKRB 4GK5E 2V26A 3UULA 5CA0E 4KP3C 1WRDA 4IHJE 3HL6A 1U5PA 4GK0E 3C64A 3PTRB 3ZPOA 3DTOA 3AA6B 1BR4A 4OYKA 3SRZA 3OJAA 4ZS2A 4UVBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5U A;  2CM0 A;  2HPL A;  4P0B A;  5LJM A;  4JUY A;  4OYJ A;  4OYK A;  2HPJ A;  4P0A A;  2CCQ A;  5LJN A;  4P09 A; 
#chains in the Genus database with same CATH topology
 3CIR A;  3CWZ B;  5CGM A;  1IJ5 A;  4QXH B;  2VB6 A;  2FJE A;  2CXF A;  2XTL A;  4AKI A;  2ACX A;  5JDG A;  3CX6 B;  3LG7 A;  2E9X B;  3ZKR A;  5HWX A;  2LE8 A;  2BZB A;  3LSV A;  4GYR A;  3I1A A;  3F31 A;  3AEF A;  1VCS A;  2V8S V;  1BR1 A;  5FXW A;  2IC9 A;  3UU8 A;  1YQ3 A;  3UU4 A;  2W4X A;  4QHO A;  4PK6 A;  3GMI A;  2D2S A;  4BAY B;  3RHW A;  2E8I A;  3O1J A;  5JR9 B;  5FMN A;  3UTK A;  2V7M A;  3SOL A;  3LFM A;  2XQ7 A;  3PUA A;  4CXX A;  2DNX A;  2X66 A;  3VR9 A;  2CWO A;  3NWI A;  1ZV4 X;  4I50 E;  2JPF A;  5EK4 A;  1AJ3 A;  4QX8 B;  5C8Y E;  3UUX B;  3G06 A;  4C91 A;  2ZM8 A;  2LT3 A;  4J2C A;  1UX5 A;  3LK3 B;  2WWV A;  4PK4 A;  4ZI3 D;  3PUX F;  4ILU A;  4U72 A;  3AAI A;  2VKD A;  1IJ6 A;  2VL8 A;  4WZX A;  4DV0 T;  3KVA A;  1O3X A;  3KVB A;  2WQY A;  3J7Y q;  4YLH A;  1M7K A;  4X1K E;  4AQG A;  1V9D A;  1NWM X;  2Y8D A;  4IRE A;  3JAD A;  3ZN0 B;  2JJ9 A;  2K5B B;  1CUN A;  3UUB A;  3FHN A;  3ZEF B;  4HWH A;  2E9X D;  2IIU A;  2BVM A;  2E9X A;  3UU3 A;  5L3C B;  1GQE A;  1M62 A;  3QNU A;  4IIJ E;  3V5U A;  3ZST A;  5HEH A;  3T8O A;  1MMN A;  4ZEY A;  5FL0 A;  2X9X A;  4IL9 A;  5CJ5 A;  2KMF A;  1HX8 A;  2PTF A;  3RQW A;  2QVA A;  3RRW A;  4UIG A;  3V5S A;  2V7I A;  4U74 A;  2VAS A;  4I0U A;  1WLX A;  4QXC B;  4DVD A;  4OX9 T;  5JR9 A;  5HWY A;  2LSK A;  4JI4 T;  3EHZ A;  2JQH A;  2BS2 A;  4TX5 A;  5A1L A;  4DR5 T;  4FI5 A;  5J2T E;  1YXR A;  1KNR A;  4CN6 A;  5L47 A;  2BG9 B;  5KDM C;  4IDP A;  4H9P C;  2XQ3 A;  2HN2 A;  1FJG T;  1OED C;  2CHN A;  3PJA J;  2XQ4 A;  3AEC A;  4ADZ A;  2ODU A;  5FP3 A;  3H3A A;  3FXE B;  3N2K E;  1KNP A;  5C3J A;  2FUP A;  5AQO B;  5HXR A;  5EK2 A;  3PUV F;  4G2A A;  5KX5 E;  1JNZ A;  5FXX A;  4LF6 T;  3ABV A;  2RPA A;  5JDM A;  2BDE A;  2H89 A;  4AKG A;  1UK5 A;  3KV5 A;  4WBO A;  5LJN A;  4N78 D;  3I0O A;  5CB4 E;  3ANW B;  2V7J A;  3ZYK A;  2V5C A;  3ZC0 A;  3ZYL A;  2KWI B;  3SFD A;  3C98 B;  4ZI7 E;  3IA3 A;  2HPJ A;  2MOZ A;  3T1H T;  4B3T T;  1HS7 A;  3ZSS A;  4U7Y A;  4DUY T;  2YDS A;  3H3M A;  1ZP0 A;  4CI3 B;  5JDL A;  1FIO A;  5LBM A;  3NRX A;  3UT5 E;  2XM1 A;  5JRC A;  1YD8 G;  3ETU A;  4DR3 T;  4OYJ A;  2VL0 A;  4IE4 A;  4JI3 T;  1HR0 T;  3UFG A;  4JI6 T;  1W0B A;  4AI6 A;  1MMG A;  3JCF A;  1HCI A;  4ISS A;  3ZCI A;  4O4L E;  3JC6 D;  3CKD A;  4DID B;  4YTP A;  2LJL A;  1UX4 A;  4JEH B;  3BQK A;  3BQI A;  5LOV E;  4YTM A;  5LYJ E;  1E7P A;  1OWA A;  3BQL A;  2QRX A;  2BKO A;  4OHF A;  3NVO A;  2W62 A;  3PU3 A;  2DLR A;  4DV4 T;  4X66 T;  2X67 A;  4WNK A;  4PFP A;  2Q9Q A;  4AQF C;  3OTO T;  2ZMA A;  2ZM6 T;  2BKP A;  4V1A v;  4TNW A;  4IST A;  3PUZ F;  4WBN E;  4TZ4 C;  2I6H A;  2XUE A;  3ZCJ A;  4WW0 A;  2XAG B;  2CXL A;  3RYF E;  4DV6 T;  2XPK A;  2WU2 A;  5HAX A;  3TLU A;  5CA0 E;  1WRD A;  3ZPO A;  3AA6 B;  1BR4 A;  4OYK A;  3SRZ A;  3VKH A;  4A97 A;  4ZZB A;  2VK9 A;  3AE8 A;  5FXV A;  1H7C A;  1X9B A;  5DAB A;  1YW0 A;  4ZI2 C;  4PK5 A;  1T98 A;  3AA7 B;  2IDO B;  4M1P A;  5LMU T;  3M65 A;  1ZKE A;  3I0Q A;  1QSD A;  4DR2 T;  1T8B A;  3RIF A;  3PJA A;  4HWC A;  2AE9 A;  4TWD A;  5LNK A;  4LMK A;  2CEA A;  3RKG A;  2K48 A;  3CPZ A;  4GIW A;  1YQ4 A;  4HFB A;  1IZN B;  3AA0 B;  4YTN A;  1QUU A;  3EVY A;  4DBQ A;  4IDQ A;  3O9X A;  4Z90 A;  3Q5D A;  4JUY A;  4EED A;  2DWG A;  4O2B E;  2Y6X A;  4GYS A;  2LKG A;  4EV6 A;  2FJB A;  2UXD T;  1SUM B;  2XAH B;  5LA6 E;  4HFI A;  5AQL B;  5H6R B;  2WZI A;  4EXT A;  2N9D A;  4G63 A;  1U4Q A;  3HA4 A;  3PUS A;  3RI5 A;  1VOM A;  3OYX A;  5F8P A;  2KSR A;  3A5X A;  1OED B;  4H9N C;  5TAO A;  2KT9 A;  2JIW A;  4AQY T;  2E2A A;  4I55 E;  1MIY A;  2NTX A;  3AE4 A;  2KXP B;  2PFV A;  2IC6 A;  3AEG A;  1T7S A;  2VVS A;  3FXD B;  4MHC A;  4JI0 T;  2OV9 A;  2V6X A;  3RF1 A;  3FZH B;  2A72 A;  4PNI A;  2FBW A;  2E5L T;  4ZHQ E;  5EK3 A;  3Q2M A;  5JH7 E;  2PJQ A;  2XQ9 A;  1HNZ T;  3AEB A;  4DV7 T;  1LVF A;  2H7O A;  3RC8 A;  1VCT A;  1NAF A;  2LOP A;  2NWB A;  3N2O A;  4IE0 A;  2FJA A;  3OVU A;  5BR8 T;  4MLK A;  4BJM A;  4Z91 A;  2XAF B;  3RIU C;  1D0X A;  4DR1 T;  3LBX B;  3ZLI A;  2XM2 A;  5FVK A;  3CK6 A;  4UEL A;  3TLS A;  4YHH T;  5LHI B;  3QB5 K;  3PE0 A;  4O2A E;  5F5W A;  1MNE A;  1KNZ A;  5FYM A;  4LF9 T;  2VQE T;  1US7 B;  3EI0 A;  3I9Y A;  5ABF A;  3UQ7 A;  3ZC1 A;  3CQG B;  1ZHC A;  4TN7 B;  4H9R C;  4EIW A;  4KI0 F;  3AE1 A;  3UU5 A;  3FB2 A;  1OED A;  5L3B B;  3F2E A;  2B1E A;  5HEO A;  2RP4 A;  3RPU A;  5AQV B;  4ILC A;  2CCQ A;  2MAW A;  4F8H A;  2VVN A;  3OBV E;  3T1Y T;  3MKD A;  2LLY A;  2CE7 A;  4U7I A;  1WR0 A;  2XSB A;  2C0S A;  2UUB T;  2ZLY A;  3N9P A;  1S35 A;  2JRK A;  4CN1 A;  2AXD S;  1BR0 A;  1N34 T;  4LF5 T;  1HTJ F;  2LHN A;  3BK9 A;  5CFB A;  2BS3 A;  1XNQ T;  1XNR T;  3NRY A;  1MND A;  4XZC A;  2CLY C;  4P09 A;  4YXD A;  2UXN B;  3ZMS B;  3C4X A;  4KX6 A;  2WM9 A;  2NOX A;  4UXN B;  4DMW A;  4MFR A;  3H37 A;  1G8X A;  3L09 A;  1J5W A;  3P7I A;  3A7M A;  2MBG A;  4BA9 A;  4ZZC A;  2C5J A;  4UVA B;  2X51 A;  2R6G F;  2W0G A;  3AEA A;  1W9R A;  2DL1 A;  1WFD A;  2RA1 A;  4CI2 B;  1EZ3 A;  1ZEE A;  4EB6 E;  4WYV A;  1WR6 A;  4IDZ A;  1D1B A;  4KHP T;  1UGO A;  3MXZ A;  4B3S T;  4JYA T;  2ES0 A;  2N1G A;  4EGW A;  5AQQ B;  2XQ5 A;  3NKZ A;  3ZN1 B;  2WSS V;  3MZK B;  1XDP A;  3ONX A;  1Z0P A;  3AED A;  5JTG A;  3PUR A;  1IBM T;  1N36 T;  3CML A;  4TV9 E;  2D9D A;  4UF0 B;  5ADX L;  4PJN A;  1XMO T;  4JI5 T;  3HR0 A;  5LP6 E;  4DO0 A;  4O4H E;  1N33 T;  2JQK A;  3N9M A;  4AIU A;  4AQF A;  2YEV C;  3AAE B;  2YN6 A;  1YKH B;  1IAP A;  2UXC T;  3KIN B;  2J1D G;  5LHH B;  4X20 E;  2ZM0 A;  2W00 A;  2F4V T;  2LSI A;  4UEM A;  3UU6 A;  4O8S A;  5LB7 B;  2EHO B;  5JDN A;  1I6Z A;  2IAK A;  5BMV E;  1SA0 E;  2C5K T;  2LSG A;  3K1S A;  2LHR A;  4MAL A;  3RH3 A;  3R6N A;  4HN9 A;  3OPC A;  2XQ6 A;  4GK5 E;  2V26 A;  4HWF A;  4IHJ E;  3HL6 A;  4IDO A;  3PTR B;  4UVB B;  2JQQ A;  4NUV A;  4AKL A;  1D0Z A;  4ZI2 D;  3TLV A;  2CWY A;  5HCM A;  3U3I A;  5IWA T;  2X0L B;  3K3Q C;  3FBL A;  4YT0 A;  4ZS3 A;  2V5D A;  3C4Z A;  4JBW F;  2H7V C;  2X0Y A;  2I0M A;  1ZOY A;  1N32 T;  2G0U A;  2X0H A;  3AB3 B;  3PUW F;  5JDQ A;  1B7T A;  2BVL A;  3AE5 A;  5JQG E;  1G73 A;  4U3C A;  3QOF A;  5AQN B;  4LFA T;  4CQI A;  5E0O A;  2YU2 A;  2YKS A;  2XY8 B;  2BG9 A;  4AKH A;  2NR4 A;  4BJN A;  2NTY A;  4UF0 A;  5J2U E;  2WDV A;  4MBQ A;  2V6Y B;  4JI8 T;  4COF A;  2BG9 E;  4B3R T;  1HG5 A;  1UUS A;  3J9X 1;  4QXB B;  3GA8 A;  3RX6 A;  3PUQ A;  2PBI A;  2EHO D;  2EHO A;  4B6X A;  4HEA A;  3MJX A;  5LG4 A;  4ILB A;  2BKN A;  5HXS A;  3GWH A;  2Z6E A;  3AVR A;  2JMK A;  4L5G A;  4ERR A;  1L0V A;  3DJB A;  3ANW A;  3CQC B;  4JI7 T;  1S94 A;  2MYS A;  4DR4 T;  1CHU A;  2H3R A;  4EOZ B;  1LKX A;  4B3M T;  4CZZ B;  1OXZ A;  2WWU A;  1MIW A;  1HNX T;  3D0T A;  3R84 B;  3RYH E;  4LMJ A;  5LCY A;  2X9Y A;  5HYA A;  2CLY B;  4X65 T;  4X62 T;  4HFH A;  1Y64 B;  3LDQ B;  4DV3 T;  2WCA A;  1W09 A;  2NW8 A;  4QH4 A;  1W0A A;  4X1Y E;  4O4J E;  5EZY E;  4ZXL A;  4YY3 T;  3HKC E;  2J62 A;  4HWD A;  4IE5 A;  3ONL C;  4U31 A;  5AQP B;  4HWI B;  4TWF A;  3EAB A;  4A5X A;  1HFA A;  3VRA A;  3ZMV B;  2LRK A;  2UUC T;  3PUG A;  4KUM B;  2XZE A;  2HPL A;  4NUU A;  2UXX B;  2XQY A;  2UXB T;  3QC9 A;  4H63 V;  4PJJ A;  3ZYM A;  4DBR A;  4X5T A;  5AQK B;  2VUR A;  1MIV A;  4KMC A;  2PG8 A;  3KV4 A;  3L39 A;  1XWM A;  5LBQ B;  3RYI E;  4QX7 B;  3OKQ A;  5AQG B;  2A9U A;  2BBJ A;  1LRZ A;  2CBJ A;  3UFE A;  5L3F B;  4LF4 T;  5H6Q B;  2J4G A;  4CN4 A;  2L3L A;  4H9Q C;  3C50 A;  3N9N A;  3W15 B;  3MAC A;  2LM9 A;  4DR6 T;  4AXP A;  4CXW A;  5JDH A;  5GON E;  4HGA A;  4K0U A;  2Q9Q C;  5AQI B;  3KBU A;  2IML A;  2XHE B;  4UV9 B;  5HEU A;  1J1J A;  2D0T A;  4EEB A;  4JV5 T;  2OA5 A;  2W2U A;  4L0R A;  4QH5 A;  4DV1 T;  4U33 A;  2WB5 A;  3B13 A;  4EYY R;  4LML A;  5HEG A;  4PAG A;  2M67 A;  2NW7 A;  3RIA A;  1XDO A;  3GN5 B;  3QB5 A;  2WY2 A;  1MMD A;  2Y48 B;  2XAQ B;  3ZT5 A;  3MA9 A;  4Z8X A;  3ZJ1 A;  4HFV A;  4ILA A;  3AVS A;  1NEK A;  1WYB A;  4JI2 T;  3IHR A;  1DU2 A;  2W63 A;  3QUJ A;  2YIN A;  4A98 A;  5IHY A;  3K8P C;  3KDS E;  3FBZ A;  4YHJ A;  3P4R A;  3PDY A;  5AQT B;  2DWK A;  2CBI A;  3AXJ B;  3ZMT B;  5F3J A;  4KBM B;  2VKH A;  3E22 E;  3ESL A;  3JAE A;  3N2G E;  3NZP A;  4HE8 A;  3NBX X;  2V7L A;  2XSA A;  3P8C D;  3LK2 B;  1HF8 A;  4OFZ A;  3KBT A;  4DMV A;  2LOS A;  1FMV A;  3M3Z B;  2X9H A;  4DUZ T;  4XAX B;  2K3W A;  1SE7 A;  5HXC A;  2V7K A;  3FZL B;  3JAF A;  5FXZ A;  4E7S A;  3ZT7 A;  2N2N A;  2WMO A;  3Q9D A;  5AFU L;  4PJM A;  4QWN B;  4QH1 A;  2L9Q A;  4QKN A;  5JDF A;  1I94 T;  2W67 A;  3HKE E;  4HFC A;  1VRB A;  2CRB A;  3HI2 A;  3AA1 B;  1OED E;  2MPK A;  3E08 A;  1KFY A;  2DCF A;  4UVC B;  2X68 A;  3FZM B;  4P0B A;  4HKA A;  3IF8 B;  3O4X E;  5LGN B;  3NZQ A;  4IT4 A;  2VKO A;  3GN5 A;  2BS4 A;  2IUB A;  1HX1 B;  1E1H B;  1E2A A;  2XQA A;  5FNV E;  2LRL A;  4YJ3 E;  3ZMU B;  4KP3 C;  1Y01 A;  2ACZ A;  1U5P A;  4GK0 E;  3C64 A;  3DTO A;  3AE3 A;  5ABH A;  4IE6 A;  3OJA A;  5AQJ B;  3LBX A;  4A56 A;  4UV8 B;  3ZT6 A;  3VKG A;  3C51 A;  1LVK A;  4EAH A;  3CX7 B;  2UU9 T;  5FY0 A;  4C90 A;  4AIS A;  2V1D B;  2QYW A;  5AQH B;  2KLQ A;  4I43 B;  5J1G A;  1WCR A;  5DQW A;  4P0A A;  3AXJ A;  3L3P A;  3RYC E;  5CA1 E;  3HKB E;  2YDQ A;  1D0Y A;  2VQF T;  3UQ4 A;  3KFW X;  5LGT B;  3RGL A;  3IEE A;  3LK4 2;  1IBK T;  5L4E A;  4HFE A;  4TNV A;  4U2Z A;  5JRC B;  3KV9 A;  1HNW T;  2D0U A;  4NPP A;  4EZ4 A;  3O1I A;  1J5E T;  2L8K A;  2GK9 A;  5ABG A;  1UCU A;  5IUX A;  2H88 A;  4JLE A;  2QA7 A;  3EAM A;  3RKO A;  3FZK B;  2YK0 A;  3B57 A;  2LM2 A;  2I59 A;  1FMW A;  1FEW A;  3P4Q A;  5LHG B;  2W61 A;  4Q25 A;  4TUY E;  2XQ8 A;  3PV0 F;  2WDQ A;  2KIN B;  5JRE A;  2VWA A;  1T72 A;  5LXT E;  5L3D B;  4OK0 A;  4YSY A;  4ZI3 C;  4H9O C;  2WP9 A;  5HXE A;  4K0K T;  5HCJ A;  5HXH A;  2Q9Q B;  1UUR A;  4H9S E;  2WMN A;  5FKY A;  2E5V A;  3C4W A;  3UUN A;  2MTQ A;  4YFS A;  2HHH T;  2JQ9 A;  2VKJ A;  4JEU B;  3HKD E;  4L9I A;  4ZOL E;  3U78 A;  2HN1 A;  4HFD A;  1D1C A;  3VHL A;  2FJD A;  2WDR A;  2YDR A;  2E9X C;  3Q5W A;  1XZY A;  5AQR B;  4UR9 A;  3VR8 A;  2LSY A;  2QGS A;  2ODV A;  3K3O A;  3PUY F;  2IHR 1;  3QK6 A;  4EYU A;  3FZF B;  1SHZ C;  3ZMZ B;  3CQX C;  2DHR A;  3LJC A;  3UUM A;  5FL1 A;  4GKK T;  2XAS B;  4PFO A;  1NEN A;  3PU8 A;  5L2L A;  1KF6 A;  4LFB T;  3WI3 A;  3WAJ A;  5JR9 C;  3AAA B;  3S4U A;  4ASK A;  1KEY A;  2J47 A;  3EDV A;  4TWH A;  2K9A A;  1R8I A;  1WYC A;  4P1N A;  2NW9 A;  3ZJ2 A;  1MMA A;  2LEH A;  3K3N A;  4CI1 B;  3P4P A;  2XAJ B;  4IL4 A;  2IW5 B;  2P9B A;  2B76 A;  3ONJ A;  2Q9Q D;  3P4W A;  4H63 H;  3AE9 A;  4X1I E;  3AEE A;  4LF8 T;  4F6R C;  5IYZ E;  4YSX A;  3CX8 B;  5AQS B;  3CVR A;  3MK7 C;  3AE2 A;  1XMQ T;  4DND A;  3P50 A;  3AE6 A;  5JVD E;  5DQV A;  4DV5 T;  4LFC T;  3RC3 A;  2JMH A;  2M6B A;  3P4S A;  2CPT A;  5FVL A;  2KND A;  4CXY A;  4X64 T;  2OLT A;  2HH7 A;  5ABE A;  3Q5X A;  3B5M A;  3TKL B;  4GKJ T;  5C2T A;  2WAU A;  4U2Y A;  2NP9 A;  2A2F X;  5L3E B;  1HG2 A;  4ANJ A;  4LF7 T;  3EDU A;  3RIU A;  2D5U A;  2KWH A;  4KHZ F;  4TV8 E;  1QLB A;  3AE7 A;  2SPC A;  3RQU A;  5M4Y A;  4YJ2 E;  1JNR A;  2WS3 A;  5AQU B;  5LMN T;  2ZM2 A;  2CA5 A;  5J0Z A;  5LJM A;  2XJ7 A;  3N9Q A;  3N9L A;  3Q5E A;  2YU1 A;  4IDN A;  2LSJ A;  2V6Y A;  4YSZ A;  4PJL A;  4JI1 T;  5L3G B;  3JC6 C;  2KZ7 B;  5KMG P;  2CHO A;  3SWH A;  2WU5 A;  4EZH A;  2BG9 C;  3SFE A;  1D1A A;  4DR7 T;  3A8Y C;  3KV6 A;  2YOE A;  4DV2 T;  3L8R A;  2X9W A;  1YKE B;  3OYZ A;  5LG3 A;  3RLF F;  3I9W A;  2CMR A;  2A3D A;  4GOU A;  1KK7 A;  3RRC A;  4NXN T;  1Z8U A;  1X79 A;  3SS1 A;  3E0Z A;  5ETW A;  3DP7 A;  4E7Z A;  5ABF B;  5DJQ C;  5HEJ A;  2C5I T;  3N5L A;  4O4I E;  3TLW A;  4NIQ A;  3F57 A;  4IE7 A;  5AQF B;  5FY7 A;  2UUA T;  3EUH A;  3O1H A;  1BR2 A;  3IBP A;  2EHO C;  5FY1 A;  3WAK A;  2CM0 A;  4NXM T;  2BBH A;  4HTE A;  4XBF B;  4I4T E;  2CXD A;  3VU7 H;  2DI4 A;  2W66 A;  4PW8 A;  5LGU B;  3VRB A;  5L4H A;  5KXJ A;  3N9O A;  2K24 A;  4FJO A;  3ETV A;  2M6I A;  5AQM B;  1IBL T;  2WZH A;  2WBL A;  3X1D A;  4IGU A;  4AKR B;  3UUL A;  2LKH A;  3TLT A;  4ZS2 A; 
#chains in the Genus database with same CATH homology
 3VKH A;  3LBX A;  2JQQ A;  4NUV A;  4A56 A;  2VK9 A;  4UV8 B;  4AKL A;  3VKG A;  1D0Z A;  3CWZ B;  5FXV A;  1H7C A;  3C51 A;  5DAB A;  1LVK A;  4ZI2 D;  1IJ5 A;  2CWY A;  4EAH A;  3CX7 B;  1YW0 A;  5FY0 A;  3U3I A;  4C90 A;  2X0L B;  3K3Q C;  4QXH B;  4ZI2 C;  2VB6 A;  2V1D B;  4PK5 A;  1T98 A;  3AA7 B;  2CXF A;  3FBL A;  2XTL A;  2KLQ A;  4I43 B;  4ZS3 A;  5J1G A;  4M1P A;  4AKI A;  2ACX A;  5DQW A;  5JDG A;  3CX6 B;  3LG7 A;  3C4Z A;  3M65 A;  1ZKE A;  3I0Q A;  1QSD A;  2E9X B;  2H7V C;  4P0A A;  3L3P A;  3RYC E;  5CA1 E;  5HWX A;  2LE8 A;  2BZB A;  4GYR A;  3I1A A;  5LNK A;  3HKB E;  3F31 A;  1D0Y A;  2G0U A;  3AB3 B;  2CEA A;  2K48 A;  3CPZ A;  1BR1 A;  4GIW A;  1B7T A;  5JDQ A;  3KFW X;  5LGT B;  5FXW A;  1IZN B;  2BVL A;  5JQG E;  1G73 A;  3AA0 B;  1QUU A;  2IC9 A;  4CQI A;  3EVY A;  5E0O A;  4DBQ A;  3IEE A;  2YU2 A;  3O9X A;  3LK4 2;  4JUY A;  5JRC B;  4QHO A;  4PK6 A;  3KV9 A;  2DWG A;  2D0U A;  4O2B E;  2Y6X A;  4AKH A;  4GYS A;  4BJN A;  4EZ4 A;  2NTY A;  3O1I A;  3GMI A;  2D2S A;  2L8K A;  2GK9 A;  1UCU A;  4UF0 A;  5J2U E;  4BAY B;  2XAH B;  2E8I A;  4JLE A;  3O1J A;  5JR9 B;  2QA7 A;  5FMN A;  3UTK A;  5LA6 E;  2V7M A;  4MBQ A;  3SOL A;  3LFM A;  3PUA A;  5H6R B;  3RKO A;  4EXT A;  4CXX A;  2DNX A;  2N9D A;  2X66 A;  1HG5 A;  4G63 A;  1U4Q A;  2CWO A;  3HA4 A;  2YK0 A;  4QXB B;  3J9X 1;  3B57 A;  3GA8 A;  1ZV4 X;  2I59 A;  4I50 E;  1FMW A;  3PUS A;  3RX6 A;  2JPF A;  1FEW A;  3PUQ A;  2PBI A;  5EK4 A;  2EHO D;  4IE6 A;  2EHO A;  4B6X A;  1VOM A;  3OYX A;  5F8P A;  5LHG B;  2W61 A;  4HEA A;  4TUY E;  1AJ3 A;  3A5X A;  3MJX A;  4H9N C;  4QX8 B;  5C8Y E;  5LG4 A;  3UUX B;  4C91 A;  5TAO A;  2KT9 A;  5HXS A;  2ZM8 A;  2LT3 A;  4J2C A;  1UX5 A;  3GWH A;  2Z6E A;  3LK3 B;  2KIN B;  4I55 E;  5JRE A;  4PK4 A;  2VWA A;  3AVR A;  2JMK A;  4L5G A;  5LXT E;  1MIY A;  4ERR A;  4ZI3 D;  3DJB A;  2NTX A;  4ILU A;  4U72 A;  3ANW A;  3AAI A;  5L3D B;  2VKD A;  1IJ6 A;  2VL8 A;  4OK0 A;  4ZI3 C;  4H9O C;  2KXP B;  2PFV A;  5HXE A;  2IC6 A;  3CQC B;  1S94 A;  2MYS A;  5HXH A;  2Q9Q B;  3FXD B;  4MHC A;  2H3R A;  4EOZ B;  3KVA A;  4H9S E;  2WMN A;  1LKX A;  1O3X A;  3KVB A;  3J7Y q;  4YLH A;  4CZZ B;  4X1K E;  4AQG A;  1OXZ A;  2WWU A;  3C4W A;  1V9D A;  1NWM X;  1MIW A;  2Y8D A;  2A72 A;  3D0T A;  4PNI A;  3R84 B;  3UUN A;  2MTQ A;  3RYH E;  4ZHQ E;  5LCY A;  5EK3 A;  2X9Y A;  3Q2M A;  4YFS A;  2PJQ A;  5JH7 E;  2VKJ A;  5HYA A;  4JEU B;  2CLY B;  3HKD E;  4L9I A;  1LVF A;  4ZOL E;  2JJ9 A;  2K5B B;  1CUN A;  3ZN0 B;  1Y64 B;  3FHN A;  3ZEF B;  2H7O A;  3RC8 A;  2NW8 A;  4X1Y E;  3U78 A;  2E9X D;  1D1C A;  4O4J E;  3VHL A;  1NAF A;  5EZY E;  2BVM A;  2E9X A;  2LOP A;  5L3C B;  2NWB A;  3N2O A;  4IIJ E;  2E9X C;  3Q5W A;  3HKC E;  4IE0 A;  3V5U A;  4MLK A;  2LSY A;  4BJM A;  2QGS A;  4IE5 A;  2ODV A;  2XAF B;  3K3O A;  3T8O A;  1MMN A;  1D0X A;  1HFA A;  3LBX B;  3ZLI A;  2X9X A;  3ZMV B;  3QK6 A;  4EYU A;  1SHZ C;  4UEL A;  2KMF A;  3ZMZ B;  3CQX C;  2DHR A;  3LJC A;  3UUM A;  3PUG A;  1HX8 A;  4KUM B;  2XAS B;  3RRW A;  4UIG A;  5LHI B;  3V5S A;  4PFO A;  2HPL A;  2V7I A;  4NUU A;  4U74 A;  2VAS A;  3PU8 A;  5L2L A;  3PE0 A;  4O2A E;  2UXX B;  1WLX A;  4QXC B;  2XQY A;  4DVD A;  1MNE A;  3QC9 A;  1KNZ A;  5JR9 A;  5HWY A;  2LSK A;  4H63 V;  5FYM A;  3WI3 A;  4PJJ A;  3WAJ A;  3ZYM A;  5JR9 C;  4DBR A;  4TX5 A;  1US7 B;  5A1L A;  3AAA B;  1MIV A;  4KMC A;  2PG8 A;  3I9Y A;  3KV4 A;  3S4U A;  4FI5 A;  5LBQ B;  5J2T E;  3ZC1 A;  4ASK A;  3RYI E;  4QX7 B;  3OKQ A;  3CQG B;  1ZHC A;  4TN7 B;  4H9R C;  4EIW A;  3EDV A;  1LRZ A;  2K9A A;  3FB2 A;  1WYC A;  3UFE A;  5L3F B;  5KDM C;  5H6Q B;  4H9P C;  2NW9 A;  5L3B B;  3F2E A;  2L3L A;  1MMA A;  2LEH A;  2B1E A;  4H9Q C;  2RP4 A;  3RPU A;  3ZJ2 A;  3C50 A;  2CCQ A;  4ADZ A;  3N9N A;  3W15 B;  3K3N A;  4CI1 B;  2ODU A;  3MAC A;  2LM9 A;  5FP3 A;  3H3A A;  2XAJ B;  3OBV E;  3FXE B;  2IW5 B;  2P9B A;  3N2K E;  3MKD A;  4AXP A;  4CXW A;  2CE7 A;  2Q9Q D;  2C0S A;  5JDH A;  2ZLY A;  4H63 H;  5GON E;  4HGA A;  5HXR A;  5EK2 A;  4K0U A;  4X1I E;  2Q9Q C;  3N9P A;  1S35 A;  2JRK A;  4G2A A;  3KBU A;  5KX5 E;  4F6R C;  2XHE B;  5FXX A;  5IYZ E;  4UV9 B;  2D0T A;  3CX8 B;  1BR0 A;  2OA5 A;  3CVR A;  3MK7 C;  1HTJ F;  4L0R A;  5JDM A;  2BDE A;  3B13 A;  4EYY R;  2LHN A;  3BK9 A;  4AKG A;  4DND A;  3KV5 A;  5JVD E;  5DQV A;  4WBO A;  3NRY A;  3RC3 A;  1MND A;  2JMH A;  4XZC A;  2CLY C;  5LJN A;  4P09 A;  2UXN B;  4N78 D;  4PAG A;  3I0O A;  2M67 A;  2KND A;  2NW7 A;  3ZMS B;  4CXY A;  5CB4 E;  3ANW B;  2V7J A;  3ZYK A;  3GN5 B;  3C4X A;  2WM9 A;  2NOX A;  1MMD A;  2HH7 A;  2Y48 B;  3ZC0 A;  3ZYL A;  2XAQ B;  2KWI B;  3C98 B;  4UXN B;  3Q5X A;  4DMW A;  4MFR A;  4ZI7 E;  3H37 A;  1G8X A;  3TKL B;  3MA9 A;  2HPJ A;  2MOZ A;  2WAU A;  3L09 A;  2NP9 A;  2A2F X;  3P7I A;  4Z8X A;  3ZJ1 A;  5L3E B;  1HG2 A;  4ANJ A;  3EDU A;  4HFV A;  3AVS A;  2D5U A;  2KWH A;  1HS7 A;  1WYB A;  2MBG A;  4BA9 A;  2C5J A;  3IHR A;  4UVA B;  4CI3 B;  5JDL A;  2X51 A;  4TV8 E;  2W0G A;  1FIO A;  2W63 A;  5LBM A;  3NRX A;  3QUJ A;  3UT5 E;  2SPC A;  2YIN A;  5M4Y A;  4YJ2 E;  5IHY A;  3K8P C;  5JRC A;  1YD8 G;  3KDS E;  3ETU A;  3FBZ A;  4YHJ A;  2ZM2 A;  4OYJ A;  3PDY A;  4IE4 A;  2RA1 A;  4CI2 B;  2CA5 A;  1EZ3 A;  1ZEE A;  2DWK A;  5LJM A;  4EB6 E;  4AI6 A;  3N9Q A;  3N9L A;  1MMG A;  2YU1 A;  3ZMT B;  1WR6 A;  4IDZ A;  5F3J A;  1D1B A;  1HCI A;  4KBM B;  3MXZ A;  2VKH A;  3E22 E;  3ESL A;  3N2G E;  4HE8 A;  2LSJ A;  3NZP A;  3NBX X;  4ISS A;  4O4L E;  4PJL A;  3ZCI A;  3JC6 D;  2ES0 A;  2N1G A;  2V7L A;  3CKD A;  3P8C D;  5L3G B;  2LJL A;  3LK2 B;  3JC6 C;  1UX4 A;  1HF8 A;  2KZ7 B;  4JEH B;  5KMG P;  3SWH A;  4OFZ A;  3ZN1 B;  3KBT A;  4DMV A;  2WSS V;  3BQK A;  2LOS A;  3BQI A;  3MZK B;  4EZH A;  3ONX A;  5LOV E;  1FMV A;  1Z0P A;  5LYJ E;  1OWA A;  1D1A A;  3BQL A;  3KV6 A;  2X9H A;  2X9W A;  4XAX B;  3PUR A;  1YKE B;  3OYZ A;  5HXC A;  2V7K A;  3CML A;  3I9W A;  4TV9 E;  2CMR A;  2A3D A;  4OHF A;  5FXZ A;  4GOU A;  4E7S A;  1KK7 A;  3RRC A;  4UF0 B;  5ADX L;  4PJN A;  1X79 A;  3SS1 A;  3E0Z A;  2N2N A;  5ETW A;  2W62 A;  2WMO A;  3HR0 A;  3Q9D A;  3DP7 A;  3PU3 A;  5LP6 E;  2DLR A;  5AFU L;  4PJM A;  4QWN B;  4E7Z A;  2X67 A;  5DJQ C;  2L9Q A;  4WNK A;  4QKN A;  5JDF A;  2C5I T;  4DO0 A;  3N5L A;  4O4I E;  4O4H E;  3N9M A;  3F57 A;  4AQF A;  2YEV C;  3AAE B;  3HKE E;  4IE7 A;  4PFP A;  5FY7 A;  1VRB A;  2Q9Q A;  4AQF C;  1YKH B;  3EUH A;  3HI2 A;  1IAP A;  3AA1 B;  3O1H A;  3KIN B;  2J1D G;  5LHH B;  4X20 E;  1BR2 A;  2ZM0 A;  2ZMA A;  3E08 A;  2W00 A;  3IBP A;  2EHO C;  5FY1 A;  4V1A v;  2LSI A;  3WAK A;  2DCF A;  4UEM A;  4UVC B;  2X68 A;  4O8S A;  2CM0 A;  4P0B A;  4IST A;  2EHO B;  4WBN E;  4HKA A;  4TZ4 C;  5JDN A;  4HTE A;  3IF8 B;  4I4T E;  2CXD A;  3O4X E;  5LGN B;  4XBF B;  3NZQ A;  2IAK A;  2VKO A;  3GN5 A;  3VU7 H;  5BMV E;  1SA0 E;  2C5K T;  2XUE A;  2DI4 A;  3ZCJ A;  2LSG A;  4WW0 A;  1E1H B;  4PW8 A;  5LGU B;  2XAG B;  2CXL A;  3RYF E;  5FNV E;  2LHR A;  3N9O A;  4MAL A;  2K24 A;  4FJO A;  3ETV A;  5HAX A;  3RH3 A;  3R6N A;  2WBL A;  4HN9 A;  4YJ3 E;  3ZMU B;  4IGU A;  4AKR B;  4GK5 E;  2V26 A;  3UUL A;  5CA0 E;  4KP3 C;  1WRD A;  4IHJ E;  3HL6 A;  1U5P A;  4GK0 E;  3C64 A;  3PTR B;  3ZPO A;  3DTO A;  3AA6 B;  1BR4 A;  4OYK A;  3SRZ A;  3OJA A;  4ZS2 A;  4UVB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...