4JV5F

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4jv5F00
1HNZF 2UUAF 1F60B 4DV0F 4JI1F 2B7BB 1RISA 1N36F 1XNQF 1N34F 2BVZA 4JYAF 4LF4F 4LF8F 4OX9F 1B64A 4AQYF 2UU9F 4X64F 3OTOF 1IJEB 1IBKF 4B3SF 4LFCF 1QJHA 1CQMA 4K0KF 1G1XA 1XNRF 4X66F 4LF7F 3T1YF 2B7CB 1IBMF 4JI5F 4DR1F 4DV7F 4DV4F 1HNWF 4JV5F 2J5AA 4JI0F 1N32F 4DUYF 4X65F 4DR5F 4B3TF 4B3RF 2HHHF 2KJVA 1XMQF 5LMUF 1FKAF 5LMNF 1VMBA 3R3TA 2UXDF 4DV5F 4JI3F 2UXCF 4DR3F 5AJ3F 4DV3F 2VQEF 2YY3A 1J5EF 1G7CB 4DV6F 5IWAF 1IJFB 2VQFF 1I94F 4YY3F 4JI6F 4DR2F 1LOUA 4DV1F 1FJGF 4X62F 4GKKF 4LF6F 3ZZPA 4LF9F 2UUCF 4DR7F 4NXNF 1HNXF 1GH8A 1XMOF 4DUZF 4DR4F 2F4VF 4LFAF 4JI8F 4LFBF 5BR8F 4JI7F 1IBLF 1N33F 2UXBF 4GKJF 4YHHF 4JI2F 4JI4F 4KHPF 2KJWA 2ZM6F 4LF5F 2E5LF 1CQNA 2UUBF 2BXJA 3T1HF 1HR0F 4DR6F 4DV2F 4B3MF 2RJZA 4NXMF
chains in the Genus database with same CATH superfamily
2V50A 4C4WA 1NXIA 5K20B 1YRXA 3N6NA 3PV8A 1QUVA 5H9FJ 1S79A 1LWXA 1HNWJ 1VQYA 2RNEA 4QU6A 1NK5A 1VGYA 3LUYA 4FNIA 2ZVIA 5KFMA 1T05A 4JI3J 3MPUB 2RRBA 1PC5A 2BANA 4WE1A 3W63A 1RTJA 3Q8QB 3NGTA 4QYRA 2NSCA 3EPIA 5KT6A 1S12A 1FRXA 5C24A 5FDLA 5HROB 1XJWB 4A8WA 4ECZA 2IMOA 2AGPA 3M1VB 5C2CA 2ZH4A 2YXLA 3SQGA 2K7JA 1IKXB 4PABA 4AT1B 2MDAA 3W3SA 1U1QA 2VFRA 3R1LA 2CQ1A 2BM0A 2JOQA 4B02A 2FJWA 2C2NA 3GIRA 2C2RA 3MEEB 1OYDA 1OWXA 2VA3A 1RISA 1FNOA 4MKBA 4XIUA 1T8EA 4C8LA 2I0XA 1HD1A 4CCHA 4NA2A 1T3OA 2M5YA 4HHUA 2C22A 3MCMA 3S1TA 1N32J 4QWEA 2DY9A 4ATNA 2JL9A 4ZVHA 1VIOA 4MYTA 3N5BA 1J5OB 1RKIA 3KMSA 3M30B 4OJ3A 2H1YA 4DFMA 2DO0A 1NDLA 2ZBPA 5G0RB 1BD6A 1M5VC 4KGXB 3NGKA 2YX7A 2NS1B 3FBEA 2X7IA 4U9RA 3KHRA 1YI2S 2GV1A 5AE3A 2CNKB 3N6MA 4C97A 3OVBA 3SEOA 2BEFA 5IC4B 1OO0B 4RW8B 5L38A 3EXCX 3VAGA 3M30A 2CFXA 1U1MA 2UUBF 2DHSA 3RAMA 1TV6B 2HHWA 1NK0A 5B0CA 2QL5B 4I2PB 2OMOA 4M5LA 4N77A 2W7PA 4DL5A 3WDOA 2O66A 3KTQA 2C3YA 3SCJE 4TY8A 2XS2A 2CUYA 2QLJB 2BABA 3H90A 1ZS6A 2GJ2A 3TA1A 1HHSA 5C25B 3DGVA 4RW8A 3C2PA 4FPRA 1REGX 2FGOA 3CJ2A 2ZNYA 5KFDA 4YOEA 2AJ2A 4HH0A 5DQGA 2ZUGA 5IWAJ 5CYQB 4D3GA 4P52A 3R9LA 1KTVA 4PPDA 4OJ1A 3PNIA 4LQ3A 1A0OB 5U47A 4C8ZA 3HXMA 4DU8A 3WBZA 1VQPS 1FRIA 2HFSA 2RHQB 2DHGA 2BMBA 3DDKA 2N3LA 4EYHB 4WKRA 5A0YA 1N33J 5KFGA 1TKDA 2UU9J 2UVWA 1TKTA 4RW4B 4O3OA 4F3OA 1X9SA 4NXMJ 1S1TB 3CJKB 1VQ4S 5CYQA 4FZVA 1KONA 3HVAA 1QSYA 2Y0BB 3PRDA 2XSJB 4KV8B 3CCZA 4X64F 3UDCA 3MFHA 4ED6A 1NPRA 2KFZA 1ZZFA 3IBCB 1YBAA 2W7AA 4EYIB 3AJDA 5LMNJ 2MB0B 2MQLA 2MJNA 5D15A 3CCVS 2Q79A 1NK9A 4ZHRB 3DHWC 2UXDF 4F2SA 3J7Z5 1ROFA 2PFDA 1RHMB 2P8IA 4F4KA 1YZ7A 2XS5A 3HFVA 5KFCA 2LQBA 3CIMA 2LU2A 1N5SA 1RWNB 5DG8A 3DI6B 2D7SA 2GVZA 4USVA 5E3CA 4DU7A 3DDIA 4LFCJ 2AWZA 4B3MJ 3E8OA 5ADZA 3C46A 2Y1LB 3FGVA 3D66A 1JNRB 4ED3A 2GA7A 4F25A 3HHEA 1Y10A 3PJWA 2R2SA 2HGLA 3QIPA 3W65A 3NS5A 1Y4ZB 3ILLA 3AD7C 1Q16B 2UU9F 4NRUA 2DNYA 1KDNA 4U67Q 1KHWA 2WONB 2JHEA 3HT3A 2XWXA 2DNHA 1Q5VA 3DI6A 1FHTA 3OL6A 3BBCA 1VC0A 1UCNA 4FYVB 4GO7X 5IOLA 1EQ0A 2FDNA 3NNHA 3D4JA 1VK3A 2L9WA 3DLJA 5C42A 1I94J 4HDHA 3H5UA 2W25A 1ZYQA 3GYXB 4KIAA 3ETMA 1JLAA 2WVDA 4WIIA 1FA0A 2WONA 2YKQA 5KG7A 1OYEA 2V34A 2ZDPA 1FE0A 1D8YA 4PZVA 5EX0A 3I9ZA 4ZPBA 1RBOB 5I42A 5KFUA 1BC6A 2W8KA 2QJ3A 3SFUA 2X1FA 2MMYA 4PXEA 1WKJA 3QWPA 2HWHA 1CJTA 1SQEA 4LFCF 1AFJA 1T0TV 1S1UB 2B7CB 1FDDA 3TOQA 4HVZA 3TX0A 2Z57B 2DNMA 5KFJA 2ZUAA 6FD1A 3MURP 4Z37A 3H7HB 5F8LA 4RU9A 4YB1P 1GX5A 4DZDA 1K73T 1ZAXA 5I3PA 3SCIE 5B7WA 3DOLB 4TVAB 3NRBA 1T9WA 1S1UA 1KHVA 3FBBA 3O5TB 5L9NA 1Y5LB 3QJPA 1U48A 1UPPA 1KD1T 2RF2A 4DPUA 3A8IA 2DGWA 3KLHA 1SUQA 4Q2MA 3HZGA 4EMDA 2KVQE 3ITHA 4XAKA 5KG3A 2V9WA 3DOLA 1NKBA 3TO8A 3DLBA 3OR2B 3D1HA 5HMXA 3EWGA 4TXSA 3A3OB 2FLLA 3PFOA 2DIUA 4ER8A 4CIOA 3A4TA 3HJVA 4TU9A 4CM2A 1RT5B 1VK8A 2E5IA 3PR4A 4CH7A 2EFOA 3KK3A 5D4PA 2I8EA 4CO0A 1MN7A 1WEZA 3OTCA 4R8UA 4FN5A 2VG5A 4XDDA 2N4DA 3NOCA 3JSBA 3TEHB 4JI4F 4CM0A 3JS9A 1FEHA 3MM6A 1TVRA 2HAIA 2LQ5A 3V2UC 4F2RA 1K1SA 3W8GA 2X1BA 1U6ZA 5HI7A 5IFMA 4Q0BB 3ZTRA 4P2XA 2XLKA 3W60A 3DRSA 3GONA 4M5DA 3Q0AA 1UZHA 5DDOC 3MR7A 4NCGA 1XNRF 3AFGA 4HACB 2XLIA 1LFPA 1WKLA 1SC3B 1G6BA 1QE1B 1RLDA 5H9EJ 2PMZD 4WK1A 5AJ3J 3AQOA 1SBRA 3H42A 3VAIA 2CPJA 3DU5A 4LBPA 2H5JB 2OD4A 3MEGB 4K8RA 1U1OA 3DYAB 2RSQA 1SI9A 4H4MB 4NLRA 4RLEA 2HBYB 2ATCB 2GIFA 2CPXA 1QE1A 2YH0A 1U09A 4OZNA 2HS4A 3C15A 5KFZA 4P71A 2XZWA 4IFYB 4R5PB 1Q8IA 3VCDA 2PC6A 1YBUA 2GS8A 2DCLA 1DFDA 4UQGA 3CCJS 1VYAA 3ZO7A 8AT1B 3KXDA 3HF5A 2W1BA 2LXFA 1XR7A 4RJVA 1RAFB 4DF4A 5IQ6A 3AXMA 4PUOA 1TK8A 2EPIA 4JI0J 2AYBA 3HT0A 2U2FA 1TQLA 2OPSA 4R5PA 1UVKA 4IO1A 2WVEA 3PX0A 4K4VA 1EKSA 2PN6A 3LO3A 3QJLA 4RNNA 1J5EF 3IAM9 1WOPA 4K50A 4YFUA 3U1NA 1NH8A 1XR5A 1WUUA 1S6PB 4CLLA 1F9FA 4DFJA 2OKQA 4BCAA 1GK8A 1FCAA 2QO3A 2BA9A 1P6TA 1M5SA 1VI7A 1BHNA 4MAKA 3NEKA 3PFEA 3M8PB 3TP2A 1S0MA 1H74A 2WHOA 2UUAF 5F3TA 2HQIA 4USTA 1PYSB 1NHVA 5D4LA 2B43A 4QYZK 1ZH5A 4LF8F 2DJWA 2OMLA 2VJUA 2RB7A 1TL4A 3A3NB 4FBTA 2YKAA 4NLSA 2B4PA 1N5TA 4KT0C 4NPOA 4PRFA 1YHQS 3DXBA 3LAMA 3AOAA 2G2OA 2GVDA 4USWA 2XYHB 2PI4A 2QLFB 3CCWA 3KWMA 5HN0A 4C0HA 5HMZA 4LIWA 3MAAA 4ANEA 2CVEA 2MJUA 2PT0A 2W4DA 4F4WA 1FKPB 5DS7A 3CB4A 5B0GA 1KQGB 4MKAA 1AUSL 1R0BG 3LF0A 3AB4B 2CZ4A 1WG5A 1N5YB 5LJ5Y 1S0VA 5B09A 2FVQA 3SYZA 1TUVA 4JI1J 1NB2A 4UOFA 1PGZA 2OAUA 5J2NA 3GYGA 1RAGB 9RUBA 4C3MA 4LSLB 1S4EA 1FD8A 4X84A 2C2DA 4H4KC 4DG1B 4J5OA 1S1XA 1OQ3A 1IJEB 3LWMA 4PYAA 4NLWA 3KHHA 1U49A 1RHJB 2JJ4D 1NHKL 1KN6A 3RB3A 2FVRA 4FF4A 3CC4S 3PG9A 1BY9A 3DLLQ 1EHWA 3MPWA 2W9BB 2OELA 2AP6A 5D77A 2GW8A 4OL8A 3BBBA 2D9OA 3HZEA 1BXNA 1W2BR 1U1LA 3BDEA 2GQ2A 3NOGA 3KLVA 4DG1A 1NEEA 3LALA 5BR8J 4WYLA 2HWTA 2F63A 1P1LA 4DDFA 5H1SV 2HHVA 4PG5A 3U02A 3HKZD 3UR0A 3WQPA 3QAUA 1D0EA 1KQFB 1T9VA 4U7UD 1EKRA 3H40A 2P9EA 1UJ4A 1SKWA 2EXUA 3NS6A 4XPCA 3M32B 4DV0F 5A8KB 2Q66A 3MI7X 3M8YA 2RE1A 3RW6A 3HP6A 1RQ0A 3EVMA 2DO4A 4CYUA 2IY5B 3R5BA 3W61A 5KFBA 2A10A 1QAIA 3OFHA 2I9SA 3PIOQ 3SMZA 3KDOA 5RUBA 3PW5A 3L3CA 4M8LA 2GMJA 4F50A 3MPVA 1F5CA 1NZ8A 3M32A 2V4JB 2V63A 2DNLA 2CQBA 3I0SB 2UUCJ 5K8MA 1TMJA 2L3MA 1UWBA 2E7VA 2O67A 1RT1A 3SZ2A 5GAHI 2DTJA 4WZMA 2XMWA 3SSRA 3O6QA 3AOBA 2BQRA 3FSXA 5F8HA 2RHSB 3DLHA 1RU1A 1E6YB 2ZH6A 4DR6J 1RA7A 2MLXA 1WD6A 3AJ1A 4YEAA 1N48A 2DR9A 2E44A 3BYPA 5ETTA 3OQ2A 4ZP7A 1SV5B 1UW9A 2V4JA 1QY7A 2QA2A 1XIQA 2JEJA 3DLEA 4P7VA 1R31A 3M8ZA 3O8WA 3QLHB 4WPAA 3L7OA 3H0PA 5A8RA 1S1VB 1RAJA 1ZA2B 3MEKA 4IUFA 4OHVA 4BDPA 4GVBA 3QBCA 2E1MC 4CLYA 2FHOB 1DJ0A 4DR3J 4MTPA 3QT8A 2HVHA 1XC9A 2RVJA 3MMJA 1DAXA 2L08A 1SV5A 4USIA 1KBRA 1WI8A 4DS5A 1XMBA 5B0BA 5KFLA 2MZ1A 4UUWA 2QMUB 4OI6A 2WB4A 2BW2A 5D8HB 2IVMA 2R7VA 2NPFA 2W01A 1NSAA 3OHAA 1S1VA 4CZCA 1HWIA 2MHEA 3FC9A 5FLXU 1NK7A 4LSNB 2ROGA 1F5AA 4NCAA 2GJIA 4EK2A 4HHHA 4HH1A 4UZBA 4YHHF 2HVZA 3CDAA 5HVGA 2AGQA 1JJCB 4PWDA 4WIQA 3GV5B 2XMTA 4EFAC 1HW9A 1N52B 1FKOB 1YJUA 1OJ4A 2DEJA 7FDRA 4ZCLA 1FWPA 4DPXA 2YPZA 3ENAA 4WFBQ 2IJRA 4DUTA 3BO2A 1O0PA 4Y3CA 3SBMA 2C2KB 3TZXA 3FEXB 4X4QA 3VGTA 4ZKAA 1TL1B 1HBNA 1S72S 2XB2D 1HPZB 1FDNA 5DLFA 3BGRB 2GGPB 4NZ7A 3GG0A 1FKOA 4Y2AA 1S6QB 1T9UA 4KFBB 1IXKA 5F8IA 1RABB 1UVNA 3B54A 1FNMA 1PYOB 3OR1A 1RTHB 3DCAA 4I7FA 5GMEA 4B9UA 4UOCA 2DRBA 1ULRA 2CZ9A 2MY7A 1LW2A 3OUYB 3D5MA 3Q8VA 1FXLA 4WKYA 4Z7CA 3CWJA 1FD2A 5D0EA 3CCLS 1IVZA 1S4FA 3HULA 4KFBA 2EFQA 2LQ9A 5E3AA 4O4RA 2K06A 3RTVA 4M63A 3TAMB 4G1PA 1XR6A 2ZZTA 3BJYA 2YKPA 4DV7J 2MKYA 1P9YA 1EQMA 1MROA 1UVMA 4PWUA 3NGRA 3MR5A 5A8WA 3JAMU 1TKXA 4PG4A 2QYCA 2VG7B 4IH6A 3VAKA 3MOZA 3WC0A 1NJYA 4CI0B 1TR0A 2F8MA 1OIAA 5DM6Q 1TAQA 1BE4A 4RUHA 2HSEB 1HNXJ 3R6GB 3EM1A 2R8GA 4YY3F 1B3TA 3HJFA 1XMOJ 3M8SA 5F3ZA 1E6VA 2JWNA 4JI2J 3DLGA 1U0HA 5FIIA 4GKJF 2VG7A 3NY0A 1WC3A 5ETRA 2LMIA 4Q5VA 2V0NA 2RUSA 4M95A 3CJQA 1WWHA 3CDBA 3CXCR 2XSFA 1UA0A 3D3BJ 4KGMA 1AROP 2PDAA 2AX0A 5ETVA 4G1IA 3CCUS 1VC5A 3TW0A 2HRYA 2WBMA 3MUMP 1IBKF 4KC5A 3MTJA 2NXJA 5J1EB 3ENQA 3D1OA 3ILOA 4K4SA 3ISNC 4DQPA 4LIRA 4OYOA 2RDJA 2BKPA 2J5AA 1O5JA 3ZZ0A 3HDSA 2GIQA 4QIGA 1DTTB 2DT9A 2M3DA 3NAHA 4ECUA 1LW0B 5G4DA 3HVRA 3JYTB 2KHCA 2AEJA 3LP0B 2VQEF 3TVYA 3R5CA 3TJ9A 2WCXA 2P6SA 4OZ5A 1SJ4P 1Y11A 4OI2A 3PZPA 3J7ZT 1V5VA 3NLCA 2FJBB 1UA1A 2BRKA 2QG9B 1CSJA 4RWXA 4EZ9A 2E1PA 3DGPB 5E3QA 1LXJA 1UJ5A 2ZHAA 4UY85 3ZTQA 5CHCB 2JFKA 4RO0A 2HGNA 3JYTA 2DVIA 3C14A 2DNPA 4XO0A 1EZZB 1NSKL 4ED7A 3E51A 4UZCA 1X4CA 1T7PA 5F0WA 3NBPA 4KE5A 3IWNC 1QVGR 1X0FA 3IFEA 3A12A 1NSPA 3FFIA 2FJEB 4ENOA 4LBIA 3DGPA 5JVGQ 2B5JA 1KOHA 3OXLA 3PTWA 2J9EA 1S7IA 2AMCB 1WC0A 1W26A 2U1AA 3WHIA 2IM3A 3TQ1A 1YG0A 2UXCF 2MKJA 4F04B 2HNDB 3MMCB 2QLXA 4OI0A 2JNJA 2OSQA 4Y00A 3NNCA 4ZPDA 2HHSA 4PYDA 1GAOA 2RKIB 4DL3A 1H7XA 4OYPA 3ZZPA 5CA5A 2I1RA 1LWFA 3TVKA 1FRMA 2CDQA 1LFWA 3D28A 3W66A 2UXBF 2K3IA 1CS4B 2NCKL 3C8YA 3L4BC 4DV2J 3G6ES 2LDYA 3VWSA 3ULHA 2D3O1 5IZHA 2NZCA 1EP4B 2E1CA 4IRDA 2HNDA 4RL1A 2DH8A 3IM9A 3G4SS 3NWGA 3UNYA 1TZ0A 1RT4B 2JEGA 1WG4A 3IR7B 4QQBA 1XNQF 2OPPB 4TNOA 3P45B 4ECXA 5J2MA 3ZZUA 2YH1A 1CQMA 4F4AA 3LP2A 4Q7AA 3BPSP 1F3FA 3C6TA 1VRTB 1VLYA 1DTQB 2OTLS 1WC6A 4OJHA 1CS4A 1S59A 2YKMB 1HYSB 3HLUA 1U1NA 1DQ8A 4C8OA 3P4UB 2KRRA 4FYYB 3HI9A 2KT5A 4GC7A 1WI6A 1TK5A 1C1CA 4LRDA 1S97A 2F9JA 2CQ3A 2OPPA 3AODA 2PIIA 1IJFB 1AUDA 1HKAA 2PMWA 4B9NA 4GKKF 1UMJA 3R27A 2Q43A 4C3KA 1UEUA 2PE8A 2F4VF 4G3IA 1DTQA 3VF0B 5J2QB 5MAOA 3G6VA 5KOXA 2EBEA 2E9RX 3P6YC 2ASLA 4P73A 1D9DA 2LDIA 4WWSA 2NYIA 3HX9A 3C6UB 5L1JA 2CDRB 1F1BB 3EE3A 3W5YA 5M2UA 4Z2XA 2Q3PA 2H5IB 3JXOA 4WFNQ 2QC3A 5T7LA 4DN9A 3IWXA 1HWLA 3K5NA 1O8BA 1QTMA 2ZD1B 4JV5J 4KJIA 4YR3A 1TUGB 2R7TA 5J2QA 2YNHB 2ACYA 1MWYA 2XY6A 5KG0A 1AT1B 2OPRA 3KJVA 4JP8A 1CJKB 5IT9Y 1X4EA 4TYAA 1C0UA 2CQPA 1M5PC 1X9WA 4X4OA 5JXSA 2ALZA 5DJBA 3NG8A 3BV8A 4C7QA 3SI8A 2IM2A 4FVCA 3AA9A 4I4BA 2BOPA 2EFGA 1RT6B 2D69A 2L9DA 4IOCQ 4DFPA 2HHQA 2XBPA 3N5FA 3RZAA 4Z7YA 1VLOA 3EJMA 2J0XA 5CYJA 1UVIA 1Z1ZA 2QIFA 4GC6A 3KUEA 2L48A 2KHDA 4IR9A 2E5HA 3I31A 1Q7YT 4YDXA 1IM4A 3H5YA 2C2EA 4O4GB 4MJKA 3FRYA 3KLFA 4TU7A 2B4VA 3HSGA 4O44B 1CC8A 1WNEA 4TLRA 2X1AA 3TUIC 3ICLA 4X65J 5ETKA 1FERA 4I69A 3VR1A 1UFWA 2CJBA 3GTYX 4USUA 3L9ZA 3TWZA 4ELTA 1Y5NB 3B8HA 1QLNA 5K8PA 5CCMA 2ZKTA 1NU4A 2ROEA 1FRJA 1RKJA 1SC6A 1C0TA 2OLWA 2V2QA 4KKOA 3SFGA 4OYXA 1UKUA 2CWKA 3R7BB 2R2RA 1LOUA 3A8EA 1F6TA 2ZBCA 4OLPA 2LEPA 1KFSA 1JLFA 4NXNF 2ZHBA 1UWAA 4AL5A 3OSPA 1WDTA 4KYZA 3Q8RB 3VTIA 1UL3A 1PKUA 4M5MA 3DOMB 4WU2A 3TJAA 3W9HA 2E5LF 3GU0A 3QGIA 4J9MA 4RKUC 4DLGA 3RYLA 3EGZA 1JXVA 3ZZZA 1HNZF 3D9BA 1C1BB 1BMQB 3QT6A 4OV6A 2Y0SD 4JYAF 3KJNB 2GMHA 3J80U 4AQYF 3JTNA 2UVUA 3LQVA 4B3SF 4RNHA 4DX7A 4QPXA 5E3RA 2HNZB 3WIUA 3R6LB 3GFHA 2O01C 3E2EA 2LQ8A 3RBXA 4U95A 3M2RA 2GHWA 4FYXB 4ES1A 1Y3KA 2CRLA 4OYIA 3IA0A 2N7YA 4USKA 1FJGJ 3THPA 3BKFA 2VDIA 5IXUA 1IKWA 1A7GE 3J81Y 5CH7B 1JJHA 1HQEA 3B4MA 4DHVA 2KL8A 3PRBA 4LSZB 1HD0A 1U24A 2RDDA 4ITSA 4ZVOB 2CQGA 3VAJA 2CPHA 1VBYA 3KLGB 2MY8A 4DQRA 4X4VA 1U1PA 4DSKA 1HBUA 2CJ9A 2A0FB 1HIYA 2HQ3A 1VHIA 4WZQA 4WP3A 2ZJRQ 1LWCA 1N36J 5F9LA 1JB0C 3CCQS 1FRHA 2OFHX 2NREA 4NASA 1NJIT 4U7UK 4CNZA 1OY6A 2WOMB 2F9DA 2V8VA 2XCAA 4MIBA 2FLNA 4ZVSB 4FNHA 3PKYA 4YB5A 1IKYB 2Z2ZA 2W9AA 2YWEA 4KB7A 1XEZA 1F9EB 4B3TF 5HK4A 1QAXA 4IYQA 4RU2A 1FF2A 2ERRA 2KT3A 1UZDA 3QO9B 3RUBL 3NMAA 3GCXP 1DLOB 4FYWB 1I6JA 3LANA 3KLIB 1TFWA 1Y0HA 2ZDOA 1KC8T 4KRWA 4NCBA 1NB7A 2YNIA 1RAHB 2XGPA 3DLKA 2GAGC 1IKYA 4EGLA 3T5JA 3MM7A 2HQCA 2XY5A 5F8JA 2HS3A 2LCWA 4PQAA 5KFXA 5AXLA 3WIVA 4CLPA 2VZ9A 5L1KA 3KLEA 4X4NA 4Y2MA 1LWEB 5I3UA 4OYAA 2HG4A 1DURA 4J9RA 1IKVA 1LK5A 3CGIA 3DU6A 1EIYB 1EETB 1T02A 4I0WA 3RBEA 3R2DJ 4ZOSA 2PD1A 1Z2LA 1SJ3P 4JI5J 4DR1J 5E33A 4Q8EA 1V3SA 3IBFB 4MK8A 3TQEA 1RLCL 1QVFR 2JC1A 1TUWA 2BE2A 5CAAA 5KTQA 4J37A 3OXFA 3K5OA 4ECTA 3AY0A 3F0NA 3HK2A 3I96A 4DWIA 2MPUA 2LU1A 1N0VC 1G7CB 5E5NA 3WZ0A 1X0PA 2VPWB 1GNKA 3E01B 3K8WA 1HBOB 4IH7A 4ZVUB 1VQNS 4ED5A 2WSCC 4YDDB 2DIVA 3V5RA 1WHXA 3DM2B 4YB7A 2BJ7A 3W2WA 2WW8A 1NKEA 2HVEA 1FXDA 2DHAA 5IC6B 4A8OA 1TKZB 2W4PA 3PO5A 4RW9A 1K44A 3H4BA 3QPIA 3VZHA 1ZM2A 3WX4A 4DV5J 4DSLA 1DQ9A 3EDQB 5C2GA 1B64A 4J91A 2R8KA 1BQMB 4DL7A 3G87A 4FF3A 4OZ0A 3UD5A 2J9DE 1TKZA 3FK4A 1FX4A 1VQLS 1X4FA 3NGSA 4ICLB 3GSDA 4CRJA 1FK9A 3FKBA 2VU5A 4P72A 4F8RA 2G1HA 4D3HA 1NKCA 1SKSA 2ZZNA 2AD9A 1UETA 2IAJB 1RTDB 1BQMA 2KO1A 2EKNA 4DR4J 3DRYA 4JI7J 3MGJA 4CTAB 4QIEA 5K8OA 4Q8FA 2NQPA 2DNQA 5KFYA 1HWKA 4LFAF 5AXKA 2XTJP 1RGVA 1SJQA 1IBLF 5EGYA 1YQHA 2XZDB 2MKCA 2KXHA 4YN3B 5F8MA 2DB1A 3MFIA 2DISA 2OPQB 4AXIA 4USMA 1VOMA 1T03A 2C42A 2ZKUA 3MWBA 4JV1A 4F7VA 5E3PA 3VQSA 3AXKA 4RW6B 1MU2B 3MEDB 2DNNA 4LF4F 3P5BP 4ID5B 5GAEI 2I2YA 2GNKA 4MKYA 3UN5A 2MSSA 3R1HA 2XWYA 4C0OC 4X66F 1SC1B 3PKMA 1MWQA 1PILA 1TL7A 1QUPA 2DGQA 2QEXS 5DETA 4HDGA 1KTQA 3J80Y 2HBRB 2OPQA 5K5MA 4DV5F 4P10A 1SJFA 3LAKA 4DR2J 1YJ9S 2XZTB 3F41A 4RW6A 1HWJA 1MU2A 4N56A 5AT1B 1RADB 1JLQA 1U47A 4LFBJ 2KVIA 2FVCA 1RWXB 1N6QA 3KG0A 1K9MT 2KZZA 3LP1A 1K1QA 2DR7A 2MGZB 1NH7A 4WFYA 5DDPC 1V6HA 2DNRA 3UQSA 5I3QA 3HVTB 4ANDA 1ZPVA 2LVWA 1IR2A 2KYZA 3DOKB 4PXCA 3I0RA 4H4OB 1S1WB 1D09B 1KNZA 4J9QA 4RUBA 4K2JA 5CZVA 4W4MA 4JV0A 2CQHA 2POKA 4IQMA 3MAQA 5D0RA 4X4SA 1VQ7S 2GO8A 3CEDA 2KB2A 1I5OB 5EN1A 1FT8A 4A8SA 4OX6A 5HANA 2HVDA 4HL9A 4B3RJ 2MHNA 1CULA 3MCOA 4UQTA 4P9SA 2Z4PA 2QLBB 2BDPA 1KLMA 4ETZA 3R3TA 1JXLA 3GP9A 3BEGB 3PW4A 4OI4A 4NX9A 3M8RA 1IR1A 4C9DA 2Q1LA 5HQLA 4ES2A 2BJEA 1WHWA 2OEJA 3V6DB 3KFWX 5FD1A 3JQMA 1R0AB 3JQJA 4HTJA 3TR5A 3C16B 2ZM6F 1RWUA 4IRKA 3BYRA 3LWLA 2PEHA 1L3VA 1PBAA 3G82B 5A6WA 2J0WA 1PCAA 4IQXA 3PDNA 4RUAA 5F41A 2X3DA 2CVIA 3LGNA 1FE4A 3O44A 1RBAA 1U4BA 1WHYA 2WSFC 4QR2A 3I6PA 3RU0A 1CJUB 4A8MP 1D9AA 2NPIA 2EW9A 3QFWA 1Q8LA 3PIPQ 4PXBA 2HQGA 1Q79A 4ZVPB 3CD7A 3HCXA 3K58A 2MZRA 5JVHQ 3TYTA 2VL1A 3M2VA 2NXEA 4IFVA 2DD8S 2G0CA 4ZVTB 4LT6A 2KJVA 4V19X 4DV6J 3OVAA 3KHLA 3OXGA 1JLCB 2FGCA 2YY3A 4LF5J 1HQUB 2FTRA 3HKWA 5HMYA 3R5GA 2G0JA 2HRTA 4HT7A 3V4IB 2E29A 4OX7A 3J81j 1WC5A 4NI2B 4C11B 2DGUA 4B3OB 1CJVA 5A6PA 2WW4A 4WFZA 3I5BA 3CJ5A 2F1FA 5LL6d 5L1LA 4DPOA 2CIMA 1R8PA 3UN2A 3R97A 1QD1A 3VGVA 3GV7B 2BX6A 2G4BA 1KP6A 3R8YA 2QZ8A 4KO0B 3FUYA 3S6EA 3FBFA 4AXJA 4NMLA 4ED4A 4OHXA 1RT2A 1DBDA 3Q8YA 2X51A 2VPXB 1M1KT 4I2QB 4DPTA 3M6XA 3QNWB 3PRVA 2FZKB 2XS7A 3VAFA 1VRQC 2HFUA 2KXNB 4XPEA 4LR9A 4LVNP 4FKYA 1G3OA 2HFZA 2O1PA 2C3OA 4ECWA 5DQIA 4KO0A 1VBZA 3BZQA 2W2NP 1KVKA 2HNYB 3VV2B 3CCMS 3SSSA 4G1QB 1JKHB 3PYGA 7FD1A 4JI6F 4DUZJ 1Q1KA 1RXOB 1WORA 1SH3A 2B3TB 4WJBA 2V9KA 1RUSA 1SL0A 2F8HA 1HNVB 3RBDA 1GFWB 2A18A 2J76E 5HROA 1YK9A 4LF5F 2IRYA 4N5SA 3M1VA 3V6HA 1NMEB 1UP1A 1IKXA 2HNYA 4QIWD 3DDNA 4UY8T 5HSPA 4ECSA 1T3NA 1MG7A 4E98A 3IG1B 4K0KJ 1N88A 4GMKA 3WC2A 1GTHA 3KNAA 2YNFB 2HFNA 4UF4A 3MEEA 2CNOB 2CXEA 1JLEB 3N28A 1HNWF 4LRFA 1JJ4A 4X2BA 4XTTA 3S8SA 2PO4A 1H2UX 1RZMA 1YKWA 4TN2A 2J6SA 4JI3F 4QOTA 1MWZA 2BM1A 2I38A 3Q2SC 4S0MA 2HZVA 3FCVA 2ZH7A 1J5OA 2YNFA 1UAWA 1YJTA 3Q8SB 4RBVA 1F2GA 4QYZJ 4URGA 4OZ1A 5G0RA 3I5CA 2KU7A 4WU3A 1MSWD 5IT4A 3VAHA 4JBCA 3T3FA 1VQ5S 2DR5A 4RW7B 3T1AA 2CQ4A 1VIXA 2M7SA 4ILRA 2WB1D 3PX4A 1NUEA 4CO1A 3OTOJ 3P3DA 4DQQA 4PWWA 2E9ZA 2EWHA 1IBMJ 3QRRA 1TV6A 3KG1A 2YX1A 1PJ6A 3J7A1 1H6KX 3UE2A 2E1RA 4RR5A 1EARA 4RUCA 1UVJA 4I2PA 3S01A 2EC0A 1N32F 1RCOB 2KG0A 4BC7A 3BO3A 5HP1B 3RR8A 1FWKA 2QSFA 4B9MA 2R7QA 3W8PA 5BYQA 4ELUA 5C25A 4LF2A 1QAJA 3SCLE 3TUJC 1O51A 2CADA 4OI1A 5IM0B 4QR0A 2CPIA 2C2OB 3K5LA 2D9PA 2WVCA 5LXRA 1IQZA 1MN9A 3PEJA 2QN6B 5LOQA 5HJYA 1HBMB 4QU7A 1ZTTA 3HO1A 1U6FA 2MKHA 5HP1A 4NL5A 1I3OB 4ILMA 2GHPA 4WFXA 1U2CA 1YRTA 2V69A 3CJ4A 4DX5A 2DGTA 2AEFA 4RW4A 4ZK7M 5IT0A 1AZSB 1HNIB 4KPYA 2VD3A 4LR7A 1S1TA 3HSZA 3CJKA 1GXLA 5ETOA 4MIWA 4IH5A 3T9NA 1CLFA 3CMAS 2HYIB 3VHQA 2HHHJ 4LREA 2QL7B 3R5JB 2XSJA 4KV8A 3GIKA 1Q7LB 1WOSA 3OD2A 3DMJB 1IWGA 4MYUA 4CT8A 1YJWS 1DHMA 2ZE2B 1L3SA 2B51A 3PY8A 1FO1A 2XHWA 4LF9J 2KTQA 3BH6B 3IXQA 5IWAF 4LRAA 4ZHRA 2PA8D 1DY3A 4NLUA 3VGSA 2EK1A 4YS2A 5F8NA 5J1PA 4IO9Q 5T14A 1Q53A 3RRKA 3LH2S 1WEXA 5KFSA 5KFEA 4HT5A 1N33F 3ENWA 2A6MA 3K2YA 2XHCA 3MPYA 3EGNA 4QWBA 5A2QU 3OHBA 2MQNA 3EZUA 1LNQA 1R0CB 4NXMF 5KFKA 2FHMA 1R89A 4FXVA 3GJQB 2B9YA 4IR1A 4QPTA 4ECYA 1R6YA 4IRCA 2HKEA 2FYXA 2ZHOA 3OL7A 4CLWA 5LMNF 3G9CA 3MR3A 4I68A 4OX8A 2V8PA 4W98A 1NNDA 4DV1J 4URQU 2C28A 2K1RB 1H72C 4F3MA 3RW7A 3UFCX 1PAUB 4QIFA 2M0GB 4QWCA 4QJVA 2APOA 2J6UA 2D3OR 4UOHA 1RT3B 3MMAB 2ZH3A 2LQJA 1U7LA 3OFEA 2VV5A 3NGDA 3Q2TC 2IM1A 2EFPA 3I87A 4ZP8A 3I9V9 4DCJB 4B3MF 3PW7A 3POTB 4ILLA 4OX9J 3N6LA 3N01A 2K1RA 4F36A 3SDEB 3AD9C 2CQDA 1KQSR 3HHLC 2EK6A 3UCGA 5CABA 5KT4A 3THTA 4PPZA 1TTHB 1IM6A 5EUHA 3M05A 1ELOA 1P27B 2QA4S 2YKNB 1XBWA 2HHTA 3M2UB 4B9VA 3ONQA 2C2MB 3GYNA 4MFBB 1HHQA 3GLJA 2LXIA 1DARA 2VQFJ 1JNZB 5HO4A 4IDKB 3SDEA 2FHKA 3GIJA 5KG1A 1X5PA 2M2BA 1I94F 4X4PA 3BH7B 3NP5A 4JI8J 1SH2A 1SXLA 2KN4A 4CO3A 2VFUA 2MKKA 2QMXA 2QA1A 2ATLA 4IG0B 2B6AB 5ETPA 2YKNA 3MDFA 1JLBB 5M2PA 2A1BA 3D3CJ 2FJXA 1HI1A 3QMQA 2HK2A 4XK8C 3AJ2A 4ED1A 1FFGB 2AEMA 2JLGA 3ELHA 4KSEB 4KGVB 2RQKA 2E1AA 2XLJA 5HBMB 4LF7J 2IJFA 3G96A 5AXMA 4DV4J 3O1LA 1VR6A 2Y3YA 4L3NA 1MLAA 1Q0NA 2B6AA 4OJGA 3TZYA 1KVJA 1U2RA 3BM7A 4ZN1A 5J2PB 3U1LA 1WKKA 3GWCA 3OFGA 1REVB 3BSCA 3GB0A 3OR2A 4DV3J 3MHYA 4ELVA 4ZLJA 2BJ1A 5LJ3Y 4F0KA 1TU0B 1QM9A 3B82A 1F9HA 1Q8BA 1RT5A 4HYKA 4QWAA 2RILA 4A4JA 3DRRB 5AE2A 1F5BA 2V5HG 1JLGB 4Y65A 2ADBA 4ES3A 5LM7E 1N34J 5KFIA 3OTEA 2ZH8A 2H51B 2JEFA 2OI2A 4PEOA 1LK7A 1H0HB 4U8YA 4ZVRB 5HVFA 5KFNA 4C8KA 2QTWA 2KH9A 3TX8A 4DN0A 3FZBA 3ISND 3O2IA 2BW7A 4B08A 1F60B 4F0HA 1RT7B 1B0TA 3C66A 2DY1A 3BO4A 1WJ9A 1Y7PA 2AT1B 4TQSA 3MMBB 2WTFA 3GPAA 2QMWA 2JDJA 1JLGA 2OSRA 2CA9A 3AAWB 4Y2IA 3J7AN 2M9KA 4Q0BA 2V68A 2EFVA 1Z2ZA 2K3KA 4L3KA 3MECB 4AL7A 5LT5A 1B7FA 2RUGA 3ET6B 5KFFA 2KT2A 2MEWA 4HACA 3OT9A 2YWFA 4PQUB 4FYDA 4DLEA 2IDEA 3MMBA 3EX7B 3RB4A 2J0SD 4ZPVR 2JEIA 5DO2A 3H25A 1V9OA 2KG1A 3MEGA 3JSMB 2XMUA 4KH0B 5GADU 2BKOA 2P9GA 3DYAA 3LA0A 1RK8A 1BWEA 1U02A 3MECA 5D78A 1UJ6A 5GADI 2NXUA 4Y34A 2E5GA 3ET6A 3AT1B 4H4MA 4FS2A 3HSJA 1X4HA 4ZPCA 2DGOA 4C6AA 4M5IA 4EBEA 3THVA 4IG3B 3QYYA 1R8HA 2VASA 4X4TA 2R8HA 1UPMB 2DCUB 4IFYA 1N34F 1GMWD 3UR3C 1WG1A 2F8EX 1J27A 2RH3A 3KNGA 1VC6A 1YZ6A 1Z4UA 2HK3A 3JSMA 1AA1B 4DUYJ 4DR5J 2VUGA 3P8BB 4ZPAA 4V19J 1PG5B 3QZ8A 2R8IA 1SL2A 5LMUJ 4KY3A 3WX8A 1GXUA 2CJYB 4U96A 4A8FA 1NRKA 2HFOA 3LW5C 2W9CB 2HHUA 3VVUA 2QV6A 5AJ3F 2VB6A 2LLZA 3UVJB 2VBYA 4F02A 4DR7J 3I56S 2FY1A 3BQ0A 2BACA 3QQCD 2YPYA 4MT1A 3CT9A 1T94A 1NJXA 4B17A 1GH8A 1YDLA 4E8UA 2VODA 5KFTA 1HWUA 3CC7S 2E7XA 4YB6A 5K9FA 1S6PA 1D8ZA 3FNNA 4HLBA 3BGOP 3HFZB 1V3ZA 3ZFVA 2MSTA 4ZIWA 4I1TA 4O0NA 2XEXA 2BE7D 3NCQA 3GSIA 2OFGX 1FJCA 3SIPB 2QGFB 1RHRB 3M8PA 1R3NA 2DBBA 2NZ4A 1S10A 1N4LA 3W9JA 4C3LA 2L9NA 1LEOA 2HQDA 1YSJA 1S7HA 1Q82T 3MUTP 3T5LA 1B7YB 3TVZA 4JI0F 1RHUB 5KFPA 2YQ0A 3QFHA 2GO9A 1R27B 2GZOA 2FD2A 3B78A 3TI0A 1N54B 2XI2A 2R8JA 1HR0J 2CJAA 5KG6A 4BC9A 1U8SA 4ZJLA 1BQNB 3SV3A 4FPIA 3BGFA 1WEYA 1RWOB 4BWJA 1VRUB 3CJ0A 3D54A 4ZCIA 4BWMA 2IA0A 3W1YC 1HI0P 5BJRA 3DKDA 4KQZA 3CIZA 5LXYA 3IR6B 4CLSA 1SIZA 2BXJA 1YIJS 4OQJA 3GFYA 3FZ2A 1FKPA 4MK9A 1RWMB 1FEEA 4ZITA 2QRRA 1N5YA 4I6YA 2ZC3A 4A48A 3BGUA 2N82B 4NLGA 2BANB 4WE1B 2MQ8A 1RTJB 4LSLA 5CZXA 5T41A 2AJ4A 5C24B 1NPKA 5FDLB 2KM8C 2HS0A 3EPGA 1WTFA 3ZZOA 3MUVP 4ZCKA 1VMBA 2PI5A 4DBQA 3CJTA 2R42A 1HL6A 5ETNA 3SQGB 2HIYA 2XY7A 4GO5X 2W9BA 2O5DA 3A1YG 3BR8A 2B4OA 3Q83A 2QLWA 1NDPA 4I64A 1QAYA 2UUBJ 1BGXT 2BQUA 2D74B 2JX2A 2VBZA 3CJRA 2FJDB 1HR0F 4DSIA 4ED2A 3CF5Q 3RG6A 2YBVA 4JI1F 5B0FA 2KYXA 1XMQJ 1FX2A 3CCES 2UVVA 4QR1A 2VHGA 3I82A 2XCPA 4DXLA 2M70A 2AV5A 2AHOB 1FDAA 5A8KA 4CLTA 4EWTA 4W90B 1Y9OA 3CJSA 4ZS6A 2RRAA 2IC3B 3EICA 2WVBA 2ZFHA 2RS2A 2ZH5A 3V6KA 5ETQA 1KKHA 1QSLA 2DH7A 3N9UC 3BQ2A 1X5SA 1GMUA 3Q86A 3CO9A 3BKTA 4L74A 4NLPA 2ZJPQ 1X4DA 3QRPA 3GV8B 2RAQA 4HTIA 3ETOA 1Y00A 3IM8A 2BJ9A 2CNLB 3I0SA 2IC3A 5BR8F 3IRXB 3UI3A 3AHPA 3TUZC 1H98A 2DHXA 3ZZRA 3KG4A 2DGXA 2BE9B 4H4KA 1TL3B 4TY8B 2KM8B 1E6YA 3CDWA 1SH0A 2IRUA 4X64J 2QYGA 5IV4A 3W62A 2RQMA 1U8WA 3GE9A 2VICA 3MZIA 2KXFA 3OTBA 3QIDA 1G1XA 4KR0B 3CD5A 5F0UA 1NPPA 3IRXA 5D3GB 1B70B 1VQKS 2UXDJ 3QLHA 1XERA 4TU8A 3M6VA 1ZBTA 4LQ9A 3HHNB 1XMQF 1JX4A 4NRTA 2XMKA 2P9CA 2EG1A 4RNMA 5A0YB 1TL3A 4OZLA 1HHTP 2ZBQA 1TKTB 2ZOGA 3UDEA 2UUCF 1V5IB 2CAJA 5D3GA 1N0UA 4CLUA 4K4UA 2LECA 4ZN3A 5JJBA 2XYPB 4WF9Q 2XG8A 1KRPA 4CLFA 1J2VA 5BXIA 3L95X 4DQIA 2OUGA 4C8YA 2W2OP 2MLZA 4DR6F 5GMKa 1OQ6A 1GX6A 3TA2A 4LSNA 2GMLA 4KTQA 3W2VB 2OO4A 2R7WA 4J9VA 1BLUA 1AW0A 2LXUA 4DQSA 2H3EB 2WBRA 1SCJB 5DM7Q 1H2TZ 2DITA 1N56A 1NK4A 5KFOA 3OJUA 1W25A 3PJ9A 2C2ZB 3PO4A 1YJNS 1UW4A 3LTOA 1XK8A 4ZMMA 2K8GA 3QGHA 4DR3F 3D6FB 3W2VA 4PCQA 3KK1B 3TAPA 3GR0A 1TL1A 1X5OA 3PR5B 2GVZB 1YITS 2A6OA 1HPZA 4M5JA 3Q89A 3BGRA 3OLBA 2GGPA 4JV2A 3UDLA 3TAQA 4B9TA 2M88A 1S6QA 4KH1B 2VG6B 4DF8A 3QIPB 3AOCA 2UV8A 5EWEA 1L5UA 3CW2C 1Q78A 3K59A 4KHMA 3QSIA 1SQGA 5DDRC 1RTHA 1EAYC 4EI2A 4O23A 3KK1A 1RACB 2RJZA 3TUPA 3OUYA 2HHPA 4K5RA 3ZXWA 2A3JA 3M6UA 1NBEB 5BYSA 3T19A 2VG6A 4K5SA 3OLAA 1U6BA 5C42B 3GQCA 3UWTA 2WVFA 3LOUA 3TAMA 4L76A 2CQ0A 5DQHA 3IS9B 1JLAB 3MOJB 2QE5A 4P6QA 3KMQA 4KHPJ 3QJJA 4C8MA 5KOWA 5ETLA 2BV3A 2XC9A 2CKWA 1S6UA 1NZAA 3ZTOA 2G13A 1RJJA 1ZAVA 3NGUA 2Z8QA 1R8CA 1U25A 1G2EA 2J9DA 5I42B 2IBOA 3MPDA 1V3RA 1MMDA 2FVPA 3IS9A 4YR2A 3BB5A 1I51B 5L39A 1CJTB 2UVRA 3BPDA 5EWGA 1S9GB 1WC4A 3OBIA 1X7VA 3FEZA 2B9XA 3GMGA 2I6WA 2G1DA 2QA4G 5JMNA 3BGLA 1RTZA 3H8YA 4LRBA 3OL9A 2BUNA 1X8DA 4USHA 2D3UA 4N76A 3SQOP 4CWBA 1FVSA 4DV7F 2VOOA 1D9FA 2HQFA 4AFFA 2ZBRA 5J1EA 4IOAQ 4N7TA 4HR2A 3MR6A 2E5JA 1S9GA 2Z2YB 2F5GA 2GQQA 4OIXA 4ID8A 3PHEA 1DTTA 2R4FA 3PVXA 4WFAQ 1P1TA 3I4HX 1JWWA 4A8YA 1LW0A 4TYBA 3JB9k 2GX8A 2IMWP 1HNXF 4O3PA 2RF2B 3ZTPA 4Q43A 3LP0A 1XMOF 3KLHB 1EB0A 4JI4J 2CZVC 1BUXA 1SUQB 5AE1A 3KK2B 2XGQA 4JI2F 4KHPF 2KKHA 3EZ5A 3F73A 1WF0A 3ITHB 2J8SA 3EXYA 1GQEA 3M9OB 4EBCA 1I1GA 1WSVA 2CPYA 4HHJA 2ILYA 3HPOA 2W8LA 3FSIA 2X1GA 4DFKA 3DN9A 2YKOA 3LPEA 3KHGA 2Y1JA 5E7OB 3VQTA 3CUNA 2QT7A 2VKZG 1XNRJ 3C3LA 5JUMA 1GTEA 3BF4A 3H2UB 1TAUA 3AH6A 3HM9A 3UD4P 3KK2A 3ZZTA 4J7CA 3KK3B 2AJ0A 3QZ7A 4NLDA 4R8UB 1W7WA 4P7TA 7AT1B 2VG5B 2FIUA 1SB6A 1TFYA 1S9FA 5DGAA 5ITHA 2B0GA 1M5KC 4M5NA 3PCOB 4ZVFA 5A76A 3MM6B 1TVRB 2RQCA 2B4UA 3MMCA 4RNFA 5FLXY 6FDRA 3BDPA 3PACA 1NDCA 2RKIA 2R3VA 1RWWB 3GZ7A 5D4NA 2VC1A 1N5VA 2ZEJA 3L7PA 3DRSB 1IWAA 4M5DB 4AYBD 3R2CJ 2NXNA 1LXNA 2GIRA 4NCGB 2YWKA 2ASYA 3K57A 1KWMA 5EDWA 1EP4A 4KAIA 4DMZA 3W7BA 1NDKA 5ETMA 1RT4A 1K47A 5K14B 3MCSA 3RGIA 1RHQB 2D41A 3UN3A 5KFQA 4CH1A 1VHFA 2VPZB 2MQQA 3G6YA 2H65B 2BJ3A 4DOZA 1FTRA 3FQLA 3ILJA 1J5EJ 2OD6A 1BWVA 5H9FK 1S5ZA 1VRTA 1X60A 3EDRB 2R2TA 5HAOA 1S77D 1F3VA 2YKMA 1HYSA 2J7WA 1Y3JA 2X3GA 3MR2A 2XULA 3D6TB 4FKXA 3C15B 3QSYB 5D6GA 5HVHA 2V8HA 5K14A 1VJQA 4NLXA 3HSDA 1NJZA 2DPJA 2IM0A 1HI8A 3IBWA 2UUAJ 2GCFA 4GVLA 5K8NA 4DV2F 3C19A 2B9WA 3VZIA 5E0OA 4PUOB 4LF8J 3EYZA 3DC2A 3C6UA 4TLQA 2DXEA 2JH3A 2OPSB 2DNZA 2YQ3A 1M90T 5LSLA 3I32A 3JAMY 1GMWA 3KYLA 2ZD1A 3M7VA 3KJFB 3IC1A 2V94A 2WRMA 2YNHA 3HHDA 3KJQB 3OL8A 2OHDA 2GC8A 5FJ4A 3HMJG 2BRLA 4KGZB 4JOUA 2Z2LA 2Y1IA 5E2QA 1CJKA 2P2CB 4LR8A 5THWA 4MK7A 1WF2A 2HMIB 4CT9A 3CNQP 4FXDA 2ZH9A 2JZ5A 3D0HE 2G0IA 3G71S 1GEHA 3K7RA 3ZTSA 3K89A 2QX0A 4ZP9A 4HI2A 1PSDA 1RT6A 1P8GA 3ZNUA 4EBDA 2J7UA 4ZPWR 1FTCA 3CDEA 3DXSX 2V2VA 1IBCB 2Q6BA 2E9TA 3T9ZA 3G8QA 1RAEB 1C2PA 4HI1A 2BBEA 3FDSA 4AD6A 2IJNA 2PFFB 2WZ1A 2HMIA 3CVKA 3ISZA 4O4GA 2GVDB 2Y8WA 4YMEA 4JV5F 1H3DA 4O44A 3TNVA 3UCUP 1YLXA 3MAAB 4KGKA 2CQCA 3D2WA 4LRCA 3HFKA 4OZ2A 3NS7B 1RYSA 1K0TA 2HZAA 2MQOA 4ZLNA 4OYMA 2ZWOA 3R7SB 2DRAA 2CQIA 2VPYB 2VBXA 3G8SA 5J2NB 1B4SA 3EMTA 3DRPB 3X3UA 2ZNZA 2VOPA 5KAKA 2WAQD 3W5XA 4KBIA 3T1YJ 1S1XB 4DV0J 3I55S 3NCPA 2H9ZA 2OEMA 3G6XA 4NYPA 2ADCA 5LSRA 3DOMA 1U1KA 2VJVA 1N5QA 3K0JA 1AYEA 2XNRA 1AFIA 2DGSA 3K5MA 2NXCA 3GILA 1C1BA 3U1MA 2PGCA 4OHWA 3DRPA 2N3OA 1RP5A 5IS2A 5B0AA 1VQMS 1T9TA 3IAS9 4FF1A 4X65F 1K0VA 4PXDA 2CG8A 3UW1A 4NEYA 4WXOA 2HNZA 3BSOA 2DH9A 1VCTA 2CJKA 3SV4A 2ZOMA 1VFJA 4OYZA 4PG8A 3AD8C 2VKRA 3UD3P 5EHHA 2JVOA 1H7WA 1H38A 4DPWA 2YX4A 2HIQA 2AYMA 3W64A 4B9LA 2V6AA 1OS5A 2CJQA 4CQ1A 2DXDA 3JQKA 3T5KA 4ZP6A 4MH8A 4ALZA 1R8AA 4MKVA 2VONA 4DL2A 4O3QA 1NAQA 2AZ1A 4CNYA 4OV1A 3RJMB 3KLGA 3MM5B 1PJ5A 4CYUB 3G8TA 4ECQA 3BN7A 2BVZA 1OPIA 1HARA 2IFXA 4K7QA 2OJ3A 2DEIA 3OFFA 5B0EA 1X9MA 2VDHA 1LQ9A 2GAHC 3T1YF 1KQKA 2WOMA 4NA3A 4BHQA 2FJAB 1WC1A 2UV8G 4J9UE 1UWBB 4YQWA 5L8RC 2BJDA 2JLFA 3CTRA 1RT1B 4NLTA 2KFNA 4F0MA 5I4MA 3MM5A 1ZTWA 1RSCA 2V2ZA 1VISA 3BR9A 2R2UA 3I5AA 3PX6A 2FHJD 1FJGF 1Q5YA 3V6JA 3IMQJ 3QO9A 1M0SA 1DLOA 3OW2R 2Z2MA 3KLIA 4YHHJ 3BSAA 1VS3A 4LMZA 1NJWA 5GAHU 1ZETA 3DLEB 2OIHA 4F4YA 2FVSA 2ILZA 1MMLA 2GHVC 1S0NA 5HJXA 1SJRA 2BOAA 1F0XA 4Y6IA 9ATCB 5A8RB 2FB0A 3F56A 4DX8H 1LWEA 1TK0A 5KG5A 4GVBB 1N36F 5L9XA 4YR0A 1RYRA 3EVWA 4N8OA 1APSA 2FC8A 2RS8A 1HFEL 1U45A 3TEGA 4C98A 2J0QD 1EETA 1SL1A 3LGMA 2IPOB 2HGMA 3K5PA 2R7XA 4UOGA 3HVWA 1F2HA 2XNQA 1XQIA 3B4DA 3RB6A 5HLFB 2Q6CA 4ZCMA 3KDNA 4MIAA 4ED0A 4J9NA 3OVSA 4CO5A 4Q44A 1OY9A 3TZZA 4I6WA 1FESA 4DJBA 1RCXB 2MKIA 4FXWA 2CQ2A 4F3QA 2FPHX 2ZITA 4PWDB 1SKRA 1ZM3A 2V4QA 2VH7A 3E01A 1HBOA 3RB0A 4ECVA 3KKFA 1KEKA 1HQ2A 3M9NB 4DCPB 5HLFA 3DM2A 2AU0A 3M6WA 5HATA 1YTYA 1PBUA 4X4RA 2QFIA 3D0GE 1ACMB 2VFVA 1HBNB 4GRSA 4LUBA 2ZWPA 4UTGA 1FDBA 1VJWA 3NKYA 4JI5F 4DR1F 4ANCA 3L09A 2K2PA 2Y8YA 2RU3A 8RUCA 2KZMA 3QT5A 1OSCA 2F7VA 2NYHA 1LKZA 1KLNA 4EUVA 2MXYA 3OR1B 4Y2KA 4I7FB 1CC7A 5BYRA 4YY3J 2V8DA 1RE1B 3MCNA 2AJ1A 1LW2B 3BREA 1VDHA 3OV7A 3UCZP 4ICLA 2RD5C 4RBUA 3VALA 4IKAA 2XMAA 2EBGA 2G2ZA 4ZVGA 4J90A 2CWXA 4GKJJ 2XYGB 3CCTA 2IAJA 1RTDA 4UUXA 1FI4A 3PYFA 2FLOA 2DRDA 3HHLD 4QW9A 3D6MB 4NWBA 4CTAA 3JTOA 4C0BA 3GFZA 3PJXA 2IYGA 1IUJA 1X4AA 3PW0A 1NCLA 3IWLA 3H59A 4DPYA 1MROB 4HKQA 2ASJA 1IBKJ 5A8WB 2H4YB 4WTYA 1TKXB 5IV3A 4A46A 4UT4A 1KR4A 4URSA 4NLVA 4OHYA 3N4WA 4O3NA 2DKOB 2HLUA 3MEDA 1ZAWA 4ID5A 3JSRA 5B08A 4ZLLA 4FBUA 4X4UA 3GFXA 4RBTA 5CD4A 5F9NA 4RX6A 2VQEJ 2XMMA 2F4FA 2HW3A 5IT9U 4OYWA 2ZH2A 2G9OA 1E6VB 4DL4A 5KT3A 3DLGB 3T1HJ 1U0HB 1WACA 3A3PB 2KI2A 1NSQA 5H9EK 2Z30B 1ZZNA 4J9KA 3K17A 1RWVB 4DR4F 4JI7F 4ZJQA 4AUKA 1U2FA 1M5HA 1YRUA 2G2YA 1OPZA 4YP3A 4J9LA 1VQ6S 1X4BA 3D67A 4JB8B 5KFWA 2LA6A 2MGZA 5KT7A 3DFEA 1PJ7A 2IRXA 3HVTA 3ADAC 2B7BB 3PM9A 3T5HA 3NAIA 3H4DA 4O3RA 3M9MB 3DOKA 3TA0A 4TKTA 4H4OA 1TP7A 1U0SA 1S1WA 3N79A 2DR6A 1FNXH 5KT5A 1RBLA 2OTJS 5E41A 1ITPA 1FRLA 3BKUA 2ZBIA 4V1Ak 2F3JA 5DLGA 2UXCJ 5EX3A 4RNOA 3CCRS 3CMES 3H5SA 3BSNA 1PO6A 1S0OA 3D0IE 4E2FB 1HLWA 3H2VE 1B99A 3GCWP 1KSPA 2OEKA 3RAQA 2A2DA 3Q22A 1JJ2R 1UEVA 5DZ6A 3Q24A 4DR2F 8ATCB 4FS1A 3M8QB 1L3KA 2O3DA 2UXBJ 2ZH1A 4WBFA 4LFBF 4Y0FA 3FCWA 2AW0A 3C14B 3V6DA 3G86A 2WSEC 1KS2A 1R0AA 1AXQA 3T1HF 3MM8B 3NBPB 3N0VA 3RAXA 4N41A 1XNQJ 3RRGA 2UUTA 2IA6A 3FFIB 3C16A 4PG6A 2JC0A 3FBCA 2M8DB 4ZJOA 1A9NB 2B5JB 5D0GA 3HHKA 3MTKA 5C7PA 3X1LB 3G82A 3M8QA 3AB2B 4F4ZA 1KVIA 3CD6S 2B56A 2IVYA 3CDUA 1OSDA 3R5AA 2CG4A 3PYDA 2VF3A 4C2MA 4W92B 2MTLA 4M5KA 1XN9A 1KFDA 4B3RF 2J8AA 3M4XA 1RB0A 4K59A 1CJUA 3MM8A 1LWFB 2HRUA 2V4RA 1B0PA 2AYGA 4QIVA 4GKKJ 2W2PP 1K8AT 2AYEA 2AJFE 3J81U 4L73A 3OPKA 3MD3A 2F4VJ 2YQ1A 3NMRA 3LPYA 1JLCA 2OGUA 1S49A 1HQUA 2QSWA 4XDCA 3HD2A 2COLA 4CP5A 2MQPA 3V4IA 4WYWA 4NI2A 3E3XA 4C11A 1FFWB 4B3OA 5J2MB 2MZSA 3JTPA 3VAMA 4JUZA 4I6AA 1BQXA 3LP2B 1R43A 3C6TB 3T41A 4DCOB 2MZJA 2EKYA 3A13A 3ZZYA 1W2IA 3G2XA 2LA4A 3L7UA 2HAFA 3QT7A 1HA1A 1VQSA 5C5JA 4ED8A 1C1CB 2XO6A 5GMDA 4G65A 2MKSA 3IO1A 4WXWA 5IQQA 3KOAA 1JMTA 1U1RA 2NLWA 4I2QA 4ERDA 3FEYB 2NSBA 1H2VZ 3J7YU 2HWIA 2CPEA 3UNGC 4LBHA 1R7IA 4A8KA 3J7YI 4DZ6A 1SPBP 3ILIA 4AE5A 4DV6F 4A8QA 4FDFA 4J9OA 2V2KA 5HL7Q 3PHTA 2AIRB 1WELA 4KPCA 2IHR1 1YJVA 2HURA 2GJFA 4G1QA 1JKHA 2JVRA 4WP8A 5T7LB 5AXNA 1CG2A 1S48A 4I67A 3FRZA 3BQ1A 4L75A 1NM2A 5KG4A 1HNVA 3NNAA 3QGPA 2IBKA 4BS2A 5MLCV 3QATA 4P2FA 2F65A 3NWRA 1SC4B 5KT2A 3M8WA 2OPRB 2VC0A 4NMXA 5ETSA 2ASDA 2FZGB 3KJVB 2JLEA 4WCEQ 1C0UB 2UP1A 4KHRA 4C48A 3MXHP 4WP9A 3IG1A 1EX8A 1QTNB 4M5HA 1QSSA 3PEHA 2KRBA 2XMJA 4OZJA 2YWWA 2E7WA 4PAAA 4DSEA 1JLEA 3R7NB 1WOOA 2LYVA 4NYOA 4NXNJ 5B0DA 1S9EB 1DZ5A 3PW2A 4OZ3A 3H2LA 1D3WA 2ZC4A 5GVQA 3D68A 5KFAA 3FJ2A 1T9YA 2VFSA 4DUZF 2UZAA 4BBYA 3TZWA 2E5LJ 2RDIA 1FRKA 2DNOA 3GIIA 1A6LA 3QAEA 3KLFB 1HNZJ 2DXFA 3MAHA 3NL0A 1ICEB 4NLQA 2HVIA 2J7KA 4A8XA 5D4OA 2AF6A 4UW2A 1YWXA 2AGOA 4JYAJ 4NLYA 4AQYJ 2Z56B 2RRNA 1S9EA 4LF1A 4B3SJ 4C8NA 1CBKA 4RW7A 1QJHA 4K0KF 2GFFA 1SJ1A 2EG2A 1C0TB 4PG7A 2W4CA 4KKOB 2W7OA 1RAOA 1QDUB 2KFYA 4RPFA 2WK4A 4O0IA 4DSJA 4FVMA 1JLFB 3CD0A 2RIJA 4M94A 4OI3A 1CVJA 1Q81T 3OTDA 2VA2A 3R5DA 2B8QA 2V67A 1Y5IB 4U6PA 2FY8A 4R0EA 1UTAA 2AQ4A 1UVLA 3UO0A 4NE9C 1VBKA 1ZOTA 4NA1A 4OYBA 2CNNB 1Q4RA 5DRKA 2R9LA 5IM0A 4N8NA 3EUNA 1RAIB 2XI3A 3D6HB 1SIWB 3GIMA 3SSQA 5KG2A 2LP4A 2DNGA 5DDQC 4QW8A 1DRZA 1HBMA 4R25A 2LEAA 1UEKA 2EEYA 1FFSB 4P75A 2ALYB 3UPFA 2MZQA 1YVFA 5L1IA 4PR6A 3OTOF 2RMLA 3VVTA 1PAEX 1S99A 3M2RB 2HHXA 1YJRA 1CEZA 2HZCA 2HPUA 3IGVA 4Y28C 1AZSA 1HNIA 4B3TJ 1IBMF 2GQCA 1JQGA 1RI7A 3DNCA 2OP5A 1GT8A 1IKWB 2YTCA 1TMMA 3CC2S 1HQEB 2MQMA 2JFDA 3W5ZA 2H48B 2Y9HA 3EZOA 4CDIA 1S76D 3CJ3A 2Z0GA 3SCKE 1RWKB 2HFVA 2BJ8A 3DMJA 1C4CA 2H54B 5GAGU 4EO8A 2ZE2A 4TY9A 4G6VB 1HBUB 4ZPTR 1SKUB 5GAGI 3ENVA 2W2MP 1LWCB 4EO6A 2M52A 4QCLA 1AB8A 2MLYA 4EU0A 4QZVB 2DYAA 3CJ8A 1RAAB 2KJWA 2CPDA 4TQRA 4RWWA 4CLZA 2MYFA 2LFVA 2BZ2A 3KUHA 1RU2A 4P2SA 5SZTA 4M1KA 2AZ3A 4IOBA 2SXLA 3LGHA 2J6TA 3O3LA 2B9EA 3RR7A 1FXRA 2NR0A 1DQAA 3FVYA 4Q45A 1HMVB 1M1GA 2W24A 3CULA 2FQQB 2NUUG 3V81B 5D0HA 2NUHA 2EVZA 3UDVA 3P49B 1ZA1B 3V4MA 2OH2A 1SQFA 4K4TA 2PA3A 4FP9A 2HHHF 3GJTB 4R0JA 2YNIB 4NYZA 1TL5A 2DHHA 1VQ8S 3GJRB 3DLKB 1YJ7A 3MM7B 1URRA 1FWLA 3KLEB 4MMOA 5I3UB 3JSYA 4LF9F 1HMVA 4DL0C 3V81A 3QGGA 1Q95G 5CYMB 2CJXB 1R6VA 1IKVB 5KFHA 1XWLA 1Q8KA 5DGBA 2FHJA 1X5TA 3U27A 1KOOA 3RBZA 5EWFA 5J1NA 4OFZA 4U7CA 4OLOA 4DL6A 2DPIA 3D7SB 1RT3A 4J9PA 3MMAA 2EFNA 2BE2B 2IYIA 3FCHA 3MD1A 4N47A 5HMWA 4B9SA 2ZVSA 3POTA 4ZDNA 2BKNA 1WF1A 5CYMA 2ACMA 2CPFA 2R7RA 4ZIVA 1FVQA 2RU9A 2C1EB 3K8VA 3D1QA 2QL9B 3US5A 3CO0P 1P9QC 2I5JB 4E0DA 3TANA 2HEKA 3FMBA 1YGYA 4WK3A 4Y2CA 3DRXA 3VGUA 1M1HA 2IVFB 2BYCA 3S7RA 3W2WB 1NHUA 3H98A 3M2UA 3EGWB 1OY8A 4DV1F 4LFAJ 4MFBA 1U26A 4RW9B 1IBLJ 4CO4A 4IDKA 3IR5B 2ZOFA 2FLPA 3W9IA 2ROPA 4U8VA 2PSZA 3CE8A 3IRWP 4ZVEA 2I5JA 3RRHA 4DS4A 3DHXA 4M5GA 4IG0A 2W2QP 3MM9B 4LF4J 1JLBA 4NLOA 1S6OA 2KDOA 3U7JA 1PIEA 2R7UA 2Y1RI 2D3ZA 3OSNA 4OX9F 4X66J 2BQ3A 4O3SA 1C4AA 1FK9B 2CYYA 4L6V3 5L46A 2MZTA 2LKZA 5HBMA 3CSKA 4Q2LA 2QFJA 3TARA 4J9SA 1NK6A 4K4ZA 3BBFA 1FKAF 2AKWB 1RWPB 3IP0A 1UFKA 2FJVA 3MM9A 4DI6A 5LSOA 4CO2A 5J2PA 4CLKA 4ECRA 5CCLA 2YNGB 1WDDA 3HHLB 1REVA 2B8PA 3GG1A 4OMFG 2VQFF 4K4XA 2A2CA 5M2RA 5CD4H 3MF5A 1IQTA 4BLGA 1L3UA 4JI8F 1NK8A 3PXGa 1T03B 3AQPA 2VBWA 2H4WB 4P2MA 1ZM9A 2DR8A 3DRRA 4K4WA 4A47A 4K2XA 2EC2A 4EEYA 2E66A 4AL6A 3FQKA 1G4CA 3EGVA 3QWUA 3F44A 2IDLA 1LV5A 2YNGA 4DX6A 3HHLA 1RHKB 4ZVQB 5F8GA 1TL7B 1NLKL 3EVOA 3QRQA 2R7OA 2ZJQQ 3A8KA 1RT7A 2VIHA 4LF7F 2N7CA 1RTIB 1WTBA 4LF6J 1VQOS 4DV4F 5GAEU 2M8HA 1VBXA 2N4CA 2XM3A 1JLQB 1N6QB 2L41A 4QWDA 3A8JA 2JRSA 4DV3F 3BN4A 3LP1B 2PEBA 1D1UA 1FJ7A 4NZ6A 1IR0A 2Z58B 2FZCB 3I0RB 1FJEB 2AJQA 4PQUA 3BS9A 4ZA1A 1RTIA 2F40A 2H5EA 2ZM6J 2C3PA 2DGVA 4USJC 5A2QY 1CQNA 5CXTA 4QBUA 1N8RT 1NO8A 1ZPWX 1PC4A 5HQMA 4RZRA 3ZC4A 5DG7A 3KUGA 1IN0A 1H73A 1MNEA 1CULB 4F4XA 2YWHA 3CMQA 4EZ6A 1T95A 3FMWA 2J9CA 4IG3A 2BR0A 1KLMB 2ABYA 1OMSA 2YVSA 4F67A 4X62J 3ZNJ1 3GR1A 4K4YA 2P6TA 2XMVA 2LEBA 1T9XA 1B0VA 4CH0S 3T6BA 2DK2A 1HW8A 2UUWA 2XQCA 3HD1A 3H20A 3SXLA 3TJ8A 3NCRA 2R7SA 1RA6A 5DZ7A 1VQ9S 2W9CA 4LF6F 1TELA 3IN5A 5KFRA 2P5VA 2EI5A 1T11A 3UVJA 1WSRA 2FC9A 1XTZA 4L72B 3I4PA 2CPZA 3GJSB 2ZZMA 3CCSS 5DG9A 1L3TA 2RT3A 4I56A 4PKDB 1EJ7L 2AX1A 4NOHA 3OJSA 2C3UA 1R8BA 1S57A 1YBTA 3NXZA 3FSYA 1JK9B 3TRGA 5CQGA 4OHZA 4LVOP 4WTOB 3T6JA 4YUDA 1MW7A 3P96A 1WHVA 1Q86T 3H5XA 4P74A 2C3MA 1CPZA 3PYEA 2FUG9 1UFLA 3M2VB 3P5TL 4IFVB 2PMHA 3Q8UA 4NEZA 5SUHA 1RDRA 2HBQB 3Q23A 2D1CA 1PYTA 2RQ4A 1JIHA 4FF2A 1GXTA 3AA8A 4NZ0A 2V8GA 2DNKA 3B6BA 2K7KA 4DEZA 4DUYF 4DR5F 4F26A 5LMUF 3Q8PB 2HLTA 3IGNA 1O6XA 1M5OC 1CJVB 2JSXA 4JI6J 5KFVA 2HBZB 4HEA9 1X4GA 1SVDA 4X62F 1ZM4A 4H54A 2XO7A 4ETXA 2M4MA 4DR7F 1JXEA 1X31C 3CPWR 4ZLPA 5HQ8A 1BQNA 1GMVA 4DSFA 1URNA 1T05B 1MMNA 2IIHA 4LJMA 2VFTA 2YWGA 1RT2B 6AT1B 1VRUA 1YX2A
chains in the Genus database with same CATH topology
4CNYA 4OV1A 2DNPA 3KLGA 4XO0A 3MM5B 3N6LA 4C4WA 3N01A 2K1RA 3SDEB 3G8TA 1YRXA 4ECQA 3N6NA 3PV8A 3BN7A 4ED7A 3E51A 1QUVA 2BVZA 5H9FJ 1OPIA 2CQDA 1X4CA 1T7PA 1HARA 1KQSR 3HHLC 2IFXA 5F0WA 2EK6A 3NBPA 3UCGA 2OJ3A 4KE5A 1S79A 3IWNC 5KT4A 1QVGR 1X0FA 3IFEA 3OFFA 3THTA 5B0EA 1VQYA 3FFIA 2RNEA 4QU6A 4PPZA 2FJEB 5EUHA 1X9MA 1NK5A 1LQ9A 3DGPA 1VGYA 3T1YF 3LUYA 5JVGQ 2B5JA 1KOHA 3M05A 1KQKA 4FNIA 1ELOA 2WOMA 1P27B 3OXLA 4NA3A 2QA4S 2J9EA 5KFMA 2YKNB 1XBWA 4BHQA 1T05A 2FJAB 2UV8G 2HHTA 3M2UB 4B9VA 1UWBB 2RRBA 3ONQA 4YQWA 1PC5A 5L8RC 2BJDA 2JLFA 3CTRA 2U1AA 2BANA 3GYNA 1RT1B 4WE1A 2IM3A 4NLTA 4MFBB 3TQ1A 2KFNA 1YG0A 2UXCF 1RTJA 2MKJA 2LXIA 3Q8QB 2HNDB 1DARA 4QYRA 2NSCA 5I4MA 3MMCB 2QLXA 3MM5A 3EPIA 4OI0A 5KT6A 1ZTWA 1JNZB 5HO4A 1FRXA 4IDKB 5C24A 2OSQA 3SDEA 5FDLA 4Y00A 2FHKA 3NNCA 3GIJA 4ZPDA 5KG1A 1X5PA 2M2BA 2HHSA 1GAOA 1I94F 2RKIB 3BR9A 5HROB 2R2UA 4A8WA 3I5AA 4ECZA 4DL3A 4X4PA 3PX6A 2FHJD 1H7XA 1FJGF 2IMOA 3NP5A 3ZZPA 5CA5A 3V6JA 2I1RA 1LWFA 3TVKA 2AGPA 3QO9A 1FRMA 1SH2A 2CDQA 1SXLA 2KN4A 1M0SA 3M1VB 4CO3A 1DLOA 3OW2R 2Z2MA 2ZH4A 1LFWA 3SQGA 3KLIA 2K7JA 2VFUA 2MKKA 2QMXA 2QA1A 3BSAA 2ATLA 1IKXB 4IG0B 1VS3A 2B6AB 3D28A 2YKNA 4LMZA 2MDAA 3MDFA 1JLBB 5M2PA 2A1BA 3W3SA 2UXBF 2K3IA 1NJWA 5GAHU 1ZETA 3C8YA 3DLEB 3G6ES 2FJXA 4F4YA 2OIHA 1U1QA 2LDYA 3VWSA 1HI1A 2FVSA 3QMQA 2ILZA 3ULHA 1MMLA 2GHVC 2VFRA 3R1LA 2CQ1A 2BM0A 5IZHA 1S0NA 2JOQA 4B02A 1EP4B 4XK8C 1SJRA 2E1CA 2FJWA 3AJ2A 4IRDA 2HNDA 2DH8A 3G4SS 1F0XA 4Y6IA 5A8RB 4ED1A 2FB0A 3NWGA 2C2RA 1TZ0A 1RT4B 3F56A 2JEGA 3MEEB 1WG4A 2JLGA 1OWXA 4DX8H 2VA3A 1LWEA 3IR7B 1RISA 1TK0A 1FNOA 5KG5A 4KSEB 4MKBA 4QQBA 4XIUA 1N36F 5L9XA 1T8EA 1XNQF 2RQKA 2OPPB 2E1AA 4YR0A 4C8LA 2XLJA 4TNOA 1RYRA 5HBMB 4ECXA 5J2MA 2I0XA 1HD1A 2IJFA 3G96A 3ZZUA 4N8OA 4NA2A 5AXMA 2YH1A 4CCHA 1T3OA 2FC8A 1CQMA 2M5YA 2RS8A 1APSA 3O1LA 1HFEL 2C22A 3LP2A 4Q7AA 1U45A 4L3NA 3S1TA 3C6TA 4QWEA 4C98A 4ATNA 2J0QD 1EETA 1VRTB 2B6AA 4OJGA 1SL1A 2JL9A 1KVJA 1VLYA 3LGMA 1DTQB 1U2RA 4ZVHA 2OTLS 1VIOA 3BM7A 4OJHA 5J2PB 2YKMB 4MYTA 1HYSB 3HLUA 2HGMA 3K5PA 3U1LA 1U1NA 3GWCA 2R7XA 1DQ8A 3OFGA 4C8OA 3HVWA 1REVB 3BSCA 3GB0A 3N5BA 3OR2A 1J5OB 1RKIA 2KRRA 3KMSA 3M30B 2XNQA 4OJ3A 3HI9A 2KT5A 3MHYA 3B4DA 4GC7A 3RB6A 4ELVA 5HLFB 4DFMA 2Q6CA 4ZCMA 1WI6A 1TK5A 1C1CA 4MIAA 4ED0A 2DO0A 5LJ3Y 1S97A 2F9JA 4J9NA 5G0RB 2CQ3A 3OVSA 1BD6A 2OPPA 1QM9A 3B82A 2PIIA 1IJFB 1M5VC 1AUDA 1Q8BA 1RT5A 4HYKA 4CO5A 3NGKA 2YX7A 4QWAA 2RILA 4Q44A 2NS1B 4B9NA 4GKKF 4A4JA 3DRRB 5AE2A 1UMJA 4U9RA 3KHRA 1YI2S 4I6WA 1FESA 3R27A 2Q43A 1F5BA 2V5HG 1JLGB 4Y65A 2GV1A 4DJBA 4C3KA 2MKIA 4ES3A 2ADBA 5AE3A 4FXWA 2CQ2A 4F3QA 2FPHX 2ZITA 1UEUA 2PE8A 3N6MA 5KFIA 4C97A 2F4VF 4PWDB 4G3IA 1DTQA 3VF0B 3OTEA 5J2QB 1SKRA 3OVBA 5MAOA 2ZH8A 3G6VA 5KOXA 3SEOA 2EBEA 1ZM3A 2E9RX 3P6YC 2V4QA 2VH7A 2ASLA 1OO0B 2JEFA 1D9DA 4RW8B 2LDIA 3E01A 5L38A 1LK7A 1H0HB 1HBOA 2NYIA 3RB0A 3EXCX 3HX9A 3VAGA 3M30A 3C6UB 3KKFA 5L1JA 1KEKA 4ECVA 5KFNA 2CFXA 3M9NB 1U1MA 2UUBF 4C8KA 2KH9A 3TX8A 4DN0A 5M2UA 5HLFA 3FZBA 2DHSA 3DM2A 3RAMA 2AU0A 3ISND 2Q3PA 4Z2XA 3O2IA 1TV6B 2HHWA 3M6WA 4B08A 1F60B 4WFNQ 1NK0A 5T7LA 1RT7B 1YTYA 5B0CA 4DN9A 1B0TA 3C66A 3IWXA 4X4RA 3D0GE 3BO4A 1Y7PA 1HWLA 3K5NA 4I2PB 4TQSA 3MMBB 2WTFA 2OMOA 4N77A 2VFVA 2QMWA 2W7PA 1O8BA 1HBNB 4DL5A 2JDJA 1JLGA 1QTMA 4LUBA 3WDOA 2ZD1B 2OSRA 2O66A 3KTQA 4KJIA 3AAWB 4X62F 4YR3A 2C3YA 3SCJE 4TY8A 2XS2A 4Y2IA 5J2QA 2YNHB 2R7TA 1FDBA 2M9KA 1VJWA 2BABA 4Q0BA 3NKYA 4JI5F 4DR1F 2GJ2A 3TA1A 3L09A 2ACYA 1HHSA 1MWYA 1Z2ZA 2K2PA 2EFVA 2K3KA 4RW8A 5C25B 2XY6A 5KG0A 2RU3A 3MECB 3C2PA 4FPRA 2FGOA 3CJ2A 2KZMA 2ZNYA 4AL7A 5KFDA 5LT5A 1B7FA 2OPRA 2RUGA 1OSCA 5KFFA 3KJVA 4YOEA 2F7VA 2KT2A 4HH0A 5IT9Y 1X4EA 1KLNA 1LKZA 4EUVA 4TYAA 1C0UA 2MXYA 3OR1B 5DQGA 2ZUGA 4Y2KA 4I7FB 5CYQB 1CC7A 2YWFA 4D3GA 4PQUB 5BYRA 4FYDA 2CQPA 4DLEA 2V8DA 1M5PC 1KTVA 1X9WA 4PPDA 4OJ1A 3PNIA 4LQ3A 2AJ1A 1LW2B 5U47A 4X4OA 3BREA 5JXSA 3MMBA 3EX7B 3RB4A 4C8ZA 3OV7A 3UCZP 2ALZA 5DJBA 3HXMA 2J0SD 3NG8A 4ICLA 4C7QA 3SI8A 2IM2A 2RD5C 4RBUA 4ZPVR 2JEIA 3VALA 3WBZA 4IKAA 4FVCA 5DO2A 1VQPS 1FRIA 2EBGA 3AA9A 2DHGA 3DDKA 3H25A 2N3LA 4EYHB 4I4BA 2BOPA 4WKRA 4ZVGA 5A0YA 1V9OA 5KFGA 2KG1A 2EFGA 1RT6B 3MEGA 3JSMB 1TKDA 2XMUA 5GADU 2P9GA 3CCTA 3DYAA 2IAJA 2L9DA 1RTDA 1RK8A 4IOCQ 4DFPA 2UVWA 2HHQA 1BWEA 2XBPA 3N5FA 3MECA 1TKTA 5D78A 4RW4B 4O3OA 3RZAA 1UJ6A 4UUXA 5GADI 4F3OA 2FLOA 2J0XA 2E5GA 2NXUA 4Y34A 1X9SA 3HHLD 5CYJA 4QW9A 1UVIA 4H4MA 1S1TB 4NWBA 1Z1ZA 4CTAA 4FS2A 3JTOA 4C0BA 3CJKB 2QIFA 3GFZA 4GC6A 1X4HA 4ZPCA 1VQ4S 2DGOA 2L48A 5CYQA 4EBEA 3PJXA 2IYGA 2KHDA 3THVA 4IR9A 2E5HA 1KONA 4FZVA 3HVAA 4IG3B 1IUJA 1QSYA 3I31A 1Q7YT 1X4AA 1IM4A 4YDXA 3H5YA 2C2EA 3PW0A 3IWLA 3H59A 3QYYA 1MROB 4HKQA 4O4GB 3PRDA 2ASJA 4MJKA 1R8HA 2VASA 4X4TA 2R8HA 3FRYA 5A8WB 2DCUB 4IFYA 2XSJB 3KLFA 1N34F 4KV8B 4WTYA 4TU7A 3CCZA 2B4VA 1TKXB 3UR3C 1WG1A 2F8EX 4X64F 3UDCA 2RH3A 4A46A 4O44B 3KNGA 3MFHA 1CC8A 1KR4A 4URSA 1VC6A 4NLVA 1Z4UA 3JSMA 4ED6A 1WNEA 4TLRA 2KFZA 2X1AA 1ZZFA 4OHYA 3TUIC 3ICLA 2VUGA 1FERA 1YBAA 3N4WA 4ZPAA 4O3NA 4I69A 2W7AA 4V19J 2R8IA 3QZ8A 2HLUA 3VR1A 1UFWA 3MEDA 1ZAWA 2CJBA 4EYIB 1SL2A 2MB0B 4ID5A 2MQLA 3JSRA 5B08A 1GXUA 4ELTA 2MJNA 4FBUA 1Y5NB 3CCVS 4X4UA 3B8HA 3GFXA 1QLNA 2Q79A 4RBTA 4A8FA 5F9NA 4RX6A 2XMMA 1NK9A 4ZHRB 3DHWC 5K8PA 2HW3A 5CCMA 1NRKA 2HFOA 3LW5C 2W9CB 2ZKTA 2UXDF 2HHUA 1NU4A 2ROEA 4F2SA 1FRJA 3J7Z5 1ROFA 2QV6A 5AJ3F 1RKJA 2ZH2A 1SC6A 2G9OA 1C0TA 1E6VB 2VB6A 4DL4A 2LLZA 5KT3A 2VBYA 2OLWA 4KKOA 4F02A 3SFGA 4F4KA 3DLGB 3I56S 2FY1A 2XS5A 1WACA 1UKUA 2KI2A 3BQ0A 2R2RA 2BACA 1LOUA 3A8EA 4OLPA 2ZBCA 2LEPA 5KFCA 2LQBA 1KFSA 1JLFA 4NXNF 1ZZNA 2ZHBA 3CIMA 3CT9A 1T94A 4J9KA 1NJXA 2LU2A 1N5SA 4B17A 5DG8A 4AL5A 3OSPA 1GH8A 4E8UA 4DR4F 3DI6B 3Q8RB 2VODA 3VTIA 2D7SA 1UL3A 4JI7F 5KFTA 5E3CA 1HWUA 3CC7S 2E7XA 4WU2A 4YB6A 5K9FA 1S6PA 4AUKA 2AWZA 1D8ZA 1U2FA 1M5HA 1YRUA 3E8OA 5ADZA 2E5LF 3C46A 3FNNA 3FGVA 3QGIA 1JNRB 1OPZA 4HLBA 4RKUC 4J9MA 4DLGA 2GA7A 3RYLA 4YP3A 4F25A 4ED3A 3HHEA 4J9LA 3EGZA 1VQ6S 1X4BA 1V3ZA 5KFWA 2LA6A 3PJWA 2MSTA 3ZFVA 2R2SA 2HGLA 3QIPA 3ZZZA 2MGZA 1HNZF 3NS5A 1C1BB 5KT7A 3DFEA 1Y4ZB 2IRXA 4I1TA 2XEXA 3HVTA 2B7BB 3NCQA 3PM9A 3T5HA 3NAIA 3H4DA 4O3RA 3M9MB 3DOKA 3TA0A 2Y0SD 2OFGX 4TKTA 1FJCA 4H4OA 4JYAF 1TP7A 2GMHA 1Q16B 1S1WA 4AQYF 3M8PA 1R3NA 2DBBA 2UU9F 4NRUA 2DNYA 3N79A 3JTNA 4U67Q 1KHWA 2NZ4A 1S10A 2UVUA 3LQVA 1N4LA 4B3SF 1FNXH 2WONB 4RNHA 2JHEA 4C3LA 5KT5A 3HT3A 2XWXA 2OTJS 2DNHA 3DI6A 2L9NA 4QPXA 5E3RA 1FHTA 3OL6A 2HNZB 5E41A 1VC0A 1YSJA 1S7HA 1FRLA 1Q82T 3MUTP 3T5LA 2ZBIA 2F3JA 3GFHA 3TVZA 4JI0F 5DLGA 5KFPA 2O01C 5EX3A 3E2EA 4RNOA 3CCRS 3M2RA 2GHWA 4GO7X 3CMES 3H5SA 3BSNA 1PO6A 2GO9A 1S0OA 2FDNA 3NNHA 1R27B 1VK3A 3D0IE 4ES1A 2L9WA 1Y3KA 3DLJA 2CRLA 2FD2A 3B78A 3H2VE 5C42A 1KSPA 3TI0A 3RAQA 3IA0A 4HDHA 2N7YA 1N54B 3H5UA 2W25A 3THPA 2XI2A 1ZYQA 3GYXB 2R8JA 2A2DA 4KIAA 3Q22A 1JJ2R 2CJAA 5KG6A 1UEVA 1U8SA 4BC9A 5IXUA 1IKWA 1A7GE 1BQNB 1JLAA 3J81Y 3Q24A 3SV3A 4DR2F 4WIIA 3BGFA 5CH7B 1JJHA 1HQEA 1FA0A 1WEYA 3B4MA 4DHVA 3PRBA 4FS1A 2WONA 3M8QB 1L3KA 2O3DA 1HD0A 2YKQA 5KG7A 4BWJA 1U24A 1VRUB 3CJ0A 3D54A 4ITSA 2ZH1A 4ZCIA 4BWMA 2IA0A 4LFBF 2CQGA 4Y0FA 2ZDPA 1FE0A 2AW0A 3VAJA 1D8YA 2CPHA 1HI0P 1VBYA 3KLGB 2MY8A 5BJRA 4DQRA 4X4VA 4KQZA 1U1PA 3CIZA 5LXYA 4DSKA 3V6DA 3G86A 5EX0A 2WSEC 3IR6B 1HBUA 2CJ9A 3I9ZA 1KS2A 1SIZA 1R0AA 1AXQA 4ZPBA 2HQ3A 2BXJA 3T1HF 1YIJS 4WZQA 4OQJA 3GFYA 2ZJRQ 3FZ2A 3MM8B 1FKPA 3NBPB 5I42A 5KFUA 3N0VA 1LWCA 4MK9A 3RAXA 1BC6A 4N41A 5F9LA 3RRGA 2UUTA 2IA6A 1JB0C 3FFIB 1FEEA 3CCQS 1FRHA 2OFHX 2NREA 4PG6A 2JC0A 1NJIT 2QRRA 1N5YA 4I6YA 2W8KA 2ZC3A 4U7UK 2M8DB 3SFUA 4A48A 2B5JB 4CNZA 1A9NB 2X1FA 3HHKA 2MMYA 2WOMB 3BGUA 2F9DA 3MTKA 4PXEA 2V8VA 3QWPA 3X1LB 2XCAA 4MIBA 2HWHA 3M8QA 3AB2B 2N82B 2FLNA 1SQEA 4FNHA 4F4ZA 4NLGA 4LFCF 2B56A 3PKYA 3CD6S 1KVIA 2IVYA 1AFJA 3CDUA 1OSDA 2BANB 4WE1B 4YB5A 3R5AA 1IKYB 2CG4A 1RTJB 4LSLA 2W9AA 1S1UB 2B7CB 5CZXA 2YWEA 1FDDA 5T41A 2AJ4A 4C2MA 3TOQA 4W92B 4KB7A