4JV5J

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4jv5J00
4DR1J 2MTLA 4K0KJ 1J5EJ 4DUZJ 4JI8J 4JI7J 1I94J 1HR0J 4NEYA 4KYZA 4JYAJ 3T1HJ 4DR4J 4YHHJ 3J81U 3D3CJ 3IMQJ 1HNWJ 4JI5J 3R2DJ 4JI3J 2UXCJ 1IBKJ 4X65J 4DR7J 1IBMJ 4JI6J 4JI4J 1XNRJ 4DV6J 2VQFJ 2KL8A 1XMQJ 4LF8J 4DR3J 4JV5J 2E5LJ 1HNXJ 4DV4J 1N34J 4KHPJ 2HHHJ 2MEWA 2UU9J 4OX9J 1XNQJ 4DV1J 5FLXU 1IBLJ 4LF5J 4GKKJ 4DR2J 2F4VJ 4LFCJ 4DV7J 4GKJJ 4LF6J 4JI2J 5IWAJ 2KVQE 3T1YJ 4DR6J 4B3RJ 5LMNJ 4LF7J 4NXNJ 4NXMJ 4DV2J 3D3BJ 4DR5J 4DV3J 4B3SJ 5LM7E 4AQYJ 1FJGJ 4V1Ak 4YY3J 4DV0J 2UUBJ 5A2QU 4X64J 4B3TJ 1N33J 4NEZA 1HNZJ 5LMUJ 4X62J 3R2CJ 1XMOJ 4X66J 1N32J 2ZM6J 2UUCJ 4LFAJ 2VQEJ 4DV5J 4LFBJ 2MQ8A 4JI0J 4JI1J 4RJVA 3W1YC 3J80U 1N36J 3JAMU 2UXDJ 5AJ3J 5BR8J 4LF9J 4PWWA 4B3MJ 4HHUA 4KY3A 3OTOJ 2UXBJ 2UUAJ 5IT9U 4LF4J 3J7AN 4DUYJ
chains in the Genus database with same CATH superfamily
3OXGA 2YKMB 2D3UA 2GVZB 3CCLS 3G8TA 4OQJA 2AEFA 4ZJQA 1BWEA 1KTQA 1HNWJ 2DR5A 4IRCA 1K0TA 1QDUB 3GV8B 1Q5VA 1U6BA 2GA7A 2UU9F 4X65J 3DOLB 4OYWA 2B7CB 5EN1A 3JSMA 3W3SA 1CQNA 2M4MA 4DX8H 2IM2A 2EBEA 3UCZP 1VQKS 2QSFA 1FWLA 3T19A 2OUGA 1SI9A 3Q89A 4TKTA 2J7UA 1OY8A 1M5PC 2NPFA 4TU9A 4NZ7A 1S7IA 4R8UA 1EETB 3OLBA 4ECSA 2VKZG 1CJKA 5B0DA 1O6XA 2DY9A 1X4CA 5D77A 5CAAA 3R6GB 1NK6A 2CKWA 4ICLB 2H3EB 5F8LA 5AE3A 3SYZA 1NB2A 3G8SA 1MMDA 4H4OA 2AGQA 3ILJA 2VU5A 4FF4A 2GMJA 1CJTA 1NJIT 3SCLE 4N77A 4O3QA 4BHQA 1RT1B 1YVFA 1K44A 2J8AA 4KYZA 2L9DA 5T7LB 5CZVA 4DV6F 5H9FJ 1YIJS 3K58A 5H9EJ 5HQLA 3SCJE 4ECTA 4FNIA 3R5DA 3JYTB 4L74A 2E7XA 4LF8J 4RWWA 5EWGA 2HHHJ 1RBAA 1LW2A 5T14A 2W9CB 3W62A 1G3OA 2F4VJ 3GR0A 4UOFA 3PIOQ 3S1TA 4HHJA 4TY8A 1HBOA 4GC6A 3IS9B 3IM9A 3OJUA 2BQ3A 2ZC4A 1VLYA 1YQHA 4V19X 1JKHB 4N8OA 3P5BP 2XLKA 2ZOFA 2Z56B 4USMA 2J6TA 3C15A 3V81B 3VVTA 2OPQB 2MMYA 2F1FA 5J2MA 2HQGA 1P8GA 4EMDA 4C11A 2RKIB 3D67A 1GTEA 3CDAA 4Q0BA 1IUJA 2MTLA 2J0WA 1TL3B 1F9FA 2HHPA 5J1PA 3KDOA 1WF1A 4F4KA 5K14B 2OGUA 4DQIA 2FVCA 5A2QY 2AJ2A 2HNZA 4HI1A 2H5EA 2KRBA 3GB0A 2ZD1A 2EFNA 3M8PB 2HVEA 4J9RA 2P9GA 4LFCF 4M5KA 5DDOC 4F8RA 2BJ1A 5HQMA 2MB0B 1HW9A 2B8QA 2ZJRQ 1IKYB 4NXMJ 2K1RA 2F5GA 3W60A 5DM7Q 4PZVA 3KHHA 2Z57B 4HI2A 5ETOA 2RSQA 4QIEA 1V5IB 2MLXA 4I2PB 1FDNA 3RR7A 4PYDA 2YPYA 3MM5B 3IN5A 4LRAA 4A8FA 3TQEA 2MQOA 2LFVA 3DRSA 1QD1A 2MSTA 2WAQD 1UJ6A 1LOUA 1RJJA 1X4AA 2WW8A 1MW7A 3N01A 1U09A 4W4MA 1KD1T 3PEHA 2W01A 1HI0P 3CCWA 2FHKA 1LK7A 1CJVB 2C3YA 1WHXA 2ZNZA 1TK5A 2JWNA 2ZVIA 4CO3A 1KLMA 1WTBA 4Y2IA 1AA1B 1SC6A 2HHXA 1S1WB 4LF7F 1RB0A 4RO0A 1RU2A 2VF3A 5HVHA 1O0PA 3PJWA 2DH8A 3AODA 1YHQS 2V2VA 1JXLA 1RTIB 2KFYA 3NAHA 3KK2B 4IG0B 4CTAA 3H5SA 2WBRA 2HRYA 3OBIA 3VAKA 2YWFA 5D4LA 4K4UA 5KG0A 2ZKTA 5GMDA 1CVJA 3H98A 4B3MF 1S1UB 3SIPB 4OYZA 3AT1B 3AAWB 4ANCA 1S1XA 4CYUA 1Q82T 3CW2C 1HBNB 1SC4B 2LA6A 5DS7A 3QSYB 1S0MA 4NRTA 1UVLA 1R8CA 3RTVA 4LIRA 2KO1A 3L7OA 4RW7B 4Y0FA 2I6WA 3Q2TC 5HVFA 3K2YA 3CCSS 2DGWA 5F8GA 1WSRA 2MKHA 2R7SA 2E5LF 3Q8VA 4DL0C 4ZVOB 4DV7F 1N5YA 2OD4A 4O3SA 3JAMY 3VZHA 3QWUA 5KFXA 1F6TA 1TVRA 3B4DA 4HACB 2QMUB 4ILRA 4X64F 4OX7A 2JJ4D 3R7SB 4X4OA 4DL2A 3DI6B 4UQGA 4XIUA 4USIA 3Q8RB 1LNQA 5DLFA 4X62J 1VYAA 4ES2A 3TVZA 3ET6A 2WONA 5DG7A 4DMZA 3KJQB 3AA9A 2FJVA 1DBDA 5GAHI 3HHLC 4IQMA 3CDUA 4J9QA 1U1NA 4A8OA 4TQRA 1M5SA 3IBWA 3UD3P 3TVKA 2KVIA 1QLNA 2DHAA 2PGCA 1DTQA 4A8YA 2MZ1A 1S5ZA 4JI4F 4X4PA 2DNOA 4DXLA 2P6SA 1XMQF 3NGRA 3OHBA 2XWXA 3M2UA 3MECA 3VQTA 2KG0A 4P7VA 4WP8A 4LF5F 2D9PA 1FT8A 2VQFJ 2MZRA 2CVEA 4DHVA 2ILYA 3PJ9A 3KDNA 2CZVC 2FGOA 1H6KX 1JLQB 4DWIA 1OSDA 2JLFA 1KKHA 4B3RJ 2VPWB 4UT4A 2SXLA 3GJRB 2U2FA 1KONA 3P6YC 1JMTA 4DL3A 2CQDA 3EICA 2DNLA 2PMHA 3N28A 2DXDA 2C2OB 4X84A 4F50A 3K17A 3T9ZA 2E9RX 4BC7A 3H8YA 2CQBA 2EKYA 2RNEA 4W92B 3PX6A 4KQZA 4DPTA 3KUEA 1L5UA 3BSOA 3DLEB 2CADA 4UZBA 5K8PA 4X4NA 1S9GA 2LU2A 3F0NA 1F2HA 2ZZNA 3W8PA 5AT1B 1HBMA 4C8OA 3IR7B 2RS2A 1WNEA 4PQUB 1RWOB 4UUWA 2YH1A 2YXLA 3BPSP 3PYGA 1NHUA 2XB2D 1PO6A 3MHYA 4KGZB 1ZAXA 4ZIVA 3DFEA 2RHQB 4NYZA 1FEEA 3NLCA 4DLEA 4IO9Q 1LWEB 1RDRA 3TARA 4B9MA 3CDWA 3G6XA 2HAIA 1Y5IB 5E3QA 3LOUA 1GNKA 3FJ2A 2AYMA 2YWWA 2C2KB 3ZFVA 2M52A 3UE2A 2BA9A 4F0KA 1HFEL 2VQFF 4C3MA 3V6DA 4WZMA 5GAEU 1OPIA 5A0YB 1WHVA 5KG7A 1SUQB 2M8HA 2OJ3A 1PG5B 1TMJA 4M5DB 2B5JB 2QN6B 3DXSX 1HD1A 1RAAB 2VB6A 3CCZA 1N56A 1M1GA 4DOZA 2JSXA 4K7QA 1LWFA 1C0TA 4C3KA 5KFNA 4DG1B 2R9LA 4GO7X 2VDIA 1NO8A 5A8KB 1T7PA 2IJFA 1HNXJ 5DG8A 4YQWA 3PR4A 3B82A 2XYPB 2NYIA 2WSFC 3NCRA 3T1YJ 1VFJA 3WIUA 2CQHA 1KNZA 2PIIA 4ZJOA 1WF2A 3NAIA 2GJIA 1JLGB 2WVFA 2VA2A 3MTJA 2C3PA 3HSGA 2HNYB 3OVSA 4KV8A 2MQMA 1KTVA 2DNNA 4MKVA 5KFTA 4M94A 5CABA 3UQSA 1SL1A 4UZCA 2QL7B 1S9EA 3K8VA 3KLGA 3M30A 1NB7A 4LF4J 3H4BA 1PAUB 4WCEQ 1MMLA 5LSLA 2QEXS 1J5EJ 4ZVPB 3TEGA 1R43A 4WYWA 3EMTA 5JVGQ 3ELHA 5KOWA 2Z4PA 4EK2A 1SJ4P 4NPOA 7FDRA 3DRYA 3SMZA 5L39A 2F9DA 2UXCJ 3NMAA 1WEYA 1X0PA 1LEOA 4WPAA 4DL5A 3X3UA 2OLWA 2EBGA 2HS4A 3A8IA 3MM6B 3G6YA 3P96A 5ETNA 1NEEA 2EC0A 1ELOA 2JL9A 3D0GE 2DNGA 1DQ9A 2HRTA 2G2ZA 2KYZA 3W5YA 2ZHOA 5D0RA 3B54A 5C2CA 5AJ3F 3SQGA 2UXBF 4USJC 3VF0B 2W8KA 2WTFA 5B0BA 2A6MA 3MI7X 4Q5VA 2KZMA 4QYRA 1NK8A 2QC3A 4IKAA 2GIQA 1NPRA 3I4HX 5L1JA 1ZA2B 1DRZA 2E29A 4PG7A 2OEKA 5ETSA 4M5LA 1NDPA 2C3MA 1P1LA 4ES1A 5B09A 4QW8A 4USTA 3DU5A 3TJ9A 4WU3A 4FYVB 3NS6A 4YB6A 1R7IA 5AXMA 2MKCA 4K2XA 5E5NA 5LSRA 2OD6A 1T9VA 3PRVA 3D1HA 1P1TA 4ED6A 5H9FK 2K7JA 4ERDA 4NXNF 1RT6A 1ZZFA 4B9LA 5H9EK 2U1AA 3DKDA 3EVMA 5D0HA 3RRGA 1NSAA 2WVBA 3D66A 2ZBCA 4EI2A 3A1YG 2C2EA 4K4SA 2C2ZB 2E1MC 1U1PA 4FF3A 1U47A 4DCPB 3JSYA 2GO9A 2MGZA 2KT2A 2EFGA 2R7UA 4ZITA 5I3UA 1RTDA 3CGIA 4UW2A 4WFYA 1WELA 3DRXA 3N6LA 2MKKA 3PVXA 2FJXA 1S4FA 2H54B 3TAMB 8AT1B 4QIGA 3DM2A 1SVDA 3NY0A 4J9SA 1QY7A 1RTHB 1SV5B 4B3OB 2FHJD 2HVIA 5MAOA 2QA1A 2DR7A 3B6BA 1NK9A 3QGGA 3NXZA 4CH7A 2GHPA 4OYPA 3P3DA 1RHQB 2J76E 1HHQA 2PI5A 2XEXA 4KHMA 1DLOB 4M95A 3DDKA 1D8ZA 4OJGA 2HLUA 3CUNA 3GFXA 4DX6A 2H65B 4ZPAA 4ZPCA 3ZNUA 4RUAA 4ID5B 2RUSA 2OMOA 4CO4A 3LGNA 1FEHA 1D09B 4TY9A 3MAHA 2APOA 2Z2MA 2UUCJ 5IT9Y 1Y4ZB 1AB8A 4RPFA 2Y1JA 1U02A 4KGVB 2BM1A 3MR5A 4X4VA 5IT0A 4FVCA 1DQAA 3O1LA 1UWBA 4I7FA 4JOUA 1FXDA 1ZH5A 3R9LA 3LQVA 1WC5A 2M7SA 2I5JA 2GNKA 5J2QB 2JEFA 4LBPA 2MQNA 2R42A 2VPYB 3C6TB 5KG1A 3IMQJ 2X3DA 1VRQC 1M5KC 2LQBA 4F2RA 1Y5LB 1RI7A 2HVHA 2G0CA 1LWCB 2HIYA 2B0GA 2F7VA 2V9WA 2IC3A 3HMJG 3BZQA 4L75A 3OVBA 1FRXA 2RH3A 2LEPA 5HJYA 1H3DA 3RB0A 1HQUA 2JZ5A 4CO2A 4DPUA 5F8HA 1KS2A 4RKUC 2ALZA 1YRXA 4I4BA 1VQ7S 2DNMA 2MXYA 4X66J 4J9PA 1AZSB 4PWUA 1LV5A 2H4WB 2EFQA 4MFBB 5IT4A 4QQBA 5GAHU 2IJRA 2JC0A 2IA0A 1N36J 5D3GB 2ZE2B 5B08A 2XZTB 3MMCA 1B3TA 4QIWD 1ZAWA 3UVJB 1X9WA 2W7PA 1K73T 1UA0A 3VHQA 1TELA 1X5SA 4KTQA 3EYZA 3I5AA 1RBOB 1RAJA 3D5MA 4NEYA 3BJYA 3KK1B 5C42B 1ZM3A 2NCKL 3G87A 1RT2B 4QIVA 2C42A 3C46A 2PEBA 3FRZA 1IBMJ 1UVKA 3MCNA 3MEEA 3OLAA 2HNDB 2CQ1A 1L3TA 1TUVA 1X4EA 3PYDA 5DJBA 4R0EA 3W65A 2Y0SD 1UW9A 2C28A 2HBQB 2FJBB 2YNHA 3VAHA 1HWKA 1NXIA 3MFIA 3CCQS 1NZAA 4ZN1A 2CQ4A 2I38A 4Q7AA 1U0SA 4JI8F 4CLPA 3VTIA 1B4SA 3OQ2A 2MKIA 1CC7A 4Z7YA 2FC9A 5EHHA 4QZVB 5DZ7A 3KLIB 3V2UC 2B4OA 3G71S 4U8VA 4MKYA 4J9NA 2GW8A 4DR7J 4OMFG 3CJ3A 3Q22A 3EXCX 2ZHAA 4OX9J 4NLWA 4DV2F 4NA1A 4U6PA 2PO4A 1S6UA 3EVOA 2KXFA 3AD8C 2H5IB 5HK4A 3POTA 2VQEF 2AZ3A 1X7VA 1E6VB 5G4DA 1GMWD 4Z7CA 5F3TA 2ZM6J 1Y3KA 2HGNA 1PJ5A 4K4XA 1S97A 1X0FA 2AQ4A 3J7A1 3QT5A 3NNAA 5LXRA 1U0HB 1VHIA 1C1BB 3LH2S 2R2UA 3CCES 1SJ3P 2HSEB 4ANEA 5KT7A 2J0XA 4FYWB 1UAWA 3NGKA 1HWJA 4QWDA 4ZVGA 2XNRA 4YHHJ 3MFHA 2JNJA 2DNYA 2ZH5A 4JI3J 4XPCA 2OPPB 3KHLA 4CP5A 3M6VA 2WBMA 1MROA 1FRKA 2DR6A 1F60B 1U49A 1S7HA 2HKEA 2CDQA 2C1EB 4DR2J 2A0FB 1WI6A 4ZVSB 2KXHA 1FKPB 1TKTB 3RBDA 3OL6A 2IAJA 2RF2A 5D0GA 3GYNA 4ED2A 3OFEA 4RW9A 3HHKA 1CSJA 2YKMA 1WKJA 1X4HA 2OKQA 2D69A 2GVZA 1NKBA 4H4KA 1RCXB 2ZH3A 3QJJA 3PTWA 4CM0A 5F8MA 1OO0B 4O0NA 1CJUB 2IDLA 3HK2A 2B4VA 2GAGC 2I1RA 2L48A 1FDAA 4C8KA 5ETTA 1VRTA 2QMXA 3BDEA 1IM4A 3E51A 1HR0J 3CJ5A 4FN5A 4YR2A 4CM2A 3ZZZA 5HLFA 4ECXA 2A10A 4H4MA 3SQOP 2KFNA 4CWBA 3D54A 4YUDA 2O66A 3UN5A 1EETA 4ZS6A 3PIPQ 1N34J 2V50A 5F9NA 2VFTA 4Y2CA 4Y6IA 2NUUG 1K9MT 5DDRC 2D7SA 3QJPA 1RYSA 2XHWA 2BANA 2DGTA 3WC0A 2DNPA 2CPJA 5K8OA 3HSZA 2ZWOA 1S57A 2XYHB 5ETRA 1JX4A 4P52A 3FBEA 2DNRA 5E7OB 1DFDA 5KFEA 4DN0A 3K5NA 5HROB 3EZ5A 4IOAQ 3JYTA 3H0PA 1IWGA 3OFFA 2Q6CA 4DS5A 1JB0C 3CB4A 4BC9A 3M6UA 3FEXB 2W9CA 3PHEA 5KG6A 4OJ3A 5FDLA 3J81U 2QLJB 3HVRA 2LXIA 4JV5F 2KTQA 1YRTA 4PR6A 2H1YA 5ITHA 3OTBA 1NUEA 5D8HB 1DZ5A 1U1KA 4RW6A 4DPYA 5HL7Q 5B7WA 2DPIA 1S1TB 2PE8A 4DV1J 3BQ1A 3UWTA 2VH7A 1BY9A 4DJBA 4LBHA 2YKPA 3KJVB 2XZDB 3CCMS 1URNA 2RKIA 2MKJA 3UR0A 4U7UK 2EVZA 3G9CA 3GWCA 3AJDA 4QIFA 3OFHA 1IR2A 4RLEA 2V6AA 3DDIA 3HHDA 2AJQA 3MMBB 2BV3A 5K14A 3U02A 2GVDB 2HK2A 4WXWA 3MM8B 4BS2A 3OFGA 4QWBA 3ITHA 3HVWA 4I2QB 3M4XA 4X4RA 3A4TA 2AGPA 1H38A 5IV3A 3BB5A 1HWUA 3RZAA 4ZHRB 3M8PA 2GMHA 1G1XA 2ZH1A 2WZ1A 4PXDA 4DR4F 3PM9A 1SIZA 5LJ5Y 2DPJA 3B8HA 2C2NA 3OUYB 4KPCA 3CJ0A 2DXEA 1VC6A 2VFUA 3MEKA 5DGBA 1KWMA 1IKYA 2DHXA 4F04B 3DLHA 1VQ4S 2VG6A 1ZETA 5IC6B 3BKFA 2NR0A 3DRRA 2PD1A 4OLPA 2J9DA 4QWAA 5KT6A 4PPDA 2QFIA 2YKOA 3BDPA 1NZ8A 2QA4S 4I2PA 4B3SF 3RBEA 4J9KA 4JI2J 3MM5A 3QSIA 2V2KA 1VMBA 2C2MB 3LF0A 2ZBRA 1VRUB 2ZH8A 2HS3A 1W25A 4JV0A 4CCHA 3IWXA 2H5JB 1SJFA 3R5JB 1XQIA 1RCOB 2VG7B 2WSEC 2DGQA 3HFKA 4O44A 3PX0A 1WORA 4DL4A 1XEZA 1CJVA 2AJ0A 2QFJA 1RT4B 2CPZA 4GVBB 1FRIA 2YWEA 2ACMA 1S1WA 3CJ4A 1RZMA 3U1NA 1UPPA 2BUNA 1RWMB 2VC0A 1T03B 3O2IA 3U27A 3I87A 4C97A 1FXRA 4JP8A 2UP1A 2E9TA 1BUXA 1GH8A 1NPKA 1IKWB 3C6UB 1K0VA 1R8HA 1CQMA 1IBLF 4PABA 4AL6A 1LFWA 3E3XA 2CJYB 1FO1A 4YB7A 1D0EA 1QAJA 4F0MA 4TXSA 3RB4A 2HEKA 2E1RA 4QR1A 2ABYA 4NYPA 2G4BA 2RJZA 1HBNA 4O3PA 3U1MA 1FHTA 1KVIA 2O5DA 4Y3CA 1GXTA 3WHIA 1SKUB 2RU9A 2BQUA 3VAFA 2G0IA 2OSQA 3Q8QB 2HHUA 2HGLA 2AYGA 5J2NA 4P9SA 2OPSA 1TL1B 2HMIB 1E6YB 1I94F 1EARA 1JIHA 3QO9B 1IXKA 4WFZA 1Q8BA 3N6NA 3EVWA 3PO5A 2C22A 3WQPA 1BQMA 3I0RB 4UOHA 3H42A 1S6QB 2AF6A 3MAAA 4C9DA 3CD5A 2WSCC 1RAFB 2HFSA 5ETKA 2BEFA 3OV7A 1OY9A 2BMBA 1DAXA 3DLLQ 1NBEB 2HFNA 4WYLA 2FLLA 4DSJA 4OFZA 4KHPJ 1SBRA 1F9EB 1V6HA 5FLXU 3M8RA 2FTRA 1TTHB 1JLCB 3R6LB 3WZ0A 2XMTA 2RT3A 2GAHC 3CDBA 4LQ9A 1JXEA 3PXGa 2I0XA 4LBIA 4U67Q 3GJTB 4CDIA 1VLOA 3F73A 2CQGA 1HKAA 2W2NP 5KTQA 2AJFE 4OHYA 3BN4A 1B0PA 4MKAA 4MK9A 4J9OA 2HFOA 1FWKA 4DN9A 1YJ9S 3KLHB 2DGOA 1NK4A 3T1HF 2UUTA 1T3NA 4HH0A 4WK1A 5KFZA 3UDVA 1RGVA 3P4UB 4RUCA 3VVUA 4C8LA 2W7AA 2HBZB 4YN3B 4ZIWA 1RT5A 4OZ3A 1UVIA 1HQEA 2IYIA 4ED7A 1QVGR 4DX5A 1FRMA 1FK9B 2W24A 1FFWB 3BGLA 5B0AA 1X5TA 1S49A 3J7YU 3CJSA 3FBBA 4YY3F 3AOAA 2OEMA 4P2MA 2QLWA 3EUNA 2R7RA 3NEKA 1X9MA 1VBYA 3R1LA 3R7NB 3DLEA 1CULB 2HGMA 3D2WA 4LRCA 3MR7A 4OZ1A 3KNAA 1VC5A 4FNHA 3PHTA 1WC1A 3CVKA 4O0IA 2XI3A 4OJHA 2GMLA 3A13A 1R6VA 2ZJQQ 1HYSB 1Z2LA 4ZDNA 2IVYA 4PQUA 3TAPA 1AT1B 2XZWA 1NKCA 2ZDOA 2DEJA 4DUZJ 2RE1A 1TV6B 2BRKA 1YG0A 3HSDA 3HD2A 5LOQA 4PXEA 3RAMA 3DN9A 4RBTA 4RNFA 2CZ4A 4I6AA 3MPVA 3SZ2A 4UF4A 2CQ3A 3OL9A 1LWEA 4PKDB 2HHTA 2ZJPQ 5F0UA 1U2CA 1NH7A 5HBMA 2UV8A 4LF6F 2WK4A 3CJTA 4Z37A 3NS5A 3FK4A 4F26A 2ZH9A 4V19J 1RABB 1SKRA 3TZWA 2W4CA 5LXYA 2RQ4A 1HHSA 2Z8QA 1RHMB 1JK9B 1SUQA 3MM9B 5LMUJ 4JBCA 1RWUA 3BGRB 4M5DA 4IFVA 1WOPA 3QZ7A 1CPZA 1HA1A 4DDFA 2ILZA 4KSEB 5IV4A 1U26A 2YY3A 1I51B 4DG1A 1ZA1B 3KLEA 1D9AA 4PWWA 5KG2A 1QVFR 5DLGA 5A8KA 4IRKA 2F63A 4ZVFA 4M1KA 4QR0A 3ENQA 4JI7J 2IY5B 3NGTA 3PZPA 2DRAA 5CYMB 2X51A 1GEHA 4ZKAA 2GV1A 3K7RA 1X31C 6AT1B 4XO0A 1IR1A 4PXBA 4LJMA 2XULA 5B0FA 2G2OA 3BR8A 2F4FA 1JLGA 4ZLPA 3A8JA 5E33A 1N5TA 3IR6B 3PW7A 3QBCA 2HLTA 1RSCA 4HTJA 2NXJA 4G1QA 3L95X 2XGPA 2E66A 1FJEB 2BR0A 4B9TA 4U96A 1FNOA 3HHLA 3MUVP 1RP5A 4OI3A 5KT3A 4IR9A 2GJFA 5C25B 3W9HA 1NSKL 4K59A 4N47A 5A2QU 4OV1A 4KO0A 4BDPA 1BQXA 3UN2A 1S48A 3KHRA 3L9ZA 5KFHA 4AFFA 1VISA 4JI1J 4J9LA 1YI2S 3LP2A 1R0BG 5D6GA 4PG4A 2XLJA 3ETOA 1FKAF 4GMKA 4PWDA 2M3DA 3PCOB 5HP1B 4FBTA 1TAQA 1N88A 1UA1A 3OVAA 2CFXA 1XIQA 4ITSA 3MM6A 1ZBTA 3G6ES 3TP2A 5HO4A 2H4YB 4MIAA 4FPRA 4DV4F 4N56A 4CLZA 1KBRA 1CJKB 2PA8D 1RWKB 3T9NA 1FI4A 3AHPA 2QT7A 1Q5YA 4ED5A 4WE1B 1QTNB 1FJGF 1YDLA 1NM2A 5LMNJ 4H4OB 1R89A 1WD6A 4HH1A 4DR5J 1NHVA 2VASA 4Q2MA 2QTWA 4HDGA 2H51B 2AZ1A 4B3TJ 1HNZJ 3HT0A 1ITPA 3R97A 5CHCB 3UI3A 4H4KC 2ALYB 3HZGA 3MOZA 1TZ0A 2F8EX 2L08A 2MLZA 3GV5B 3IAS9 4J5OA 3VGUA 1RQ0A 3HF5A 3Q83A 3KK3B 4NOHA 1RAHB 1LW2B 1LKZA 2HVDA 2HHVA 3PRDA 1ICEB 4C0HA 4MJKA 2VPXB 1WC0A 2CUYA 3I5CA 3ISNC 2DT9A 3PV8A 4P6QA 3ONQA 4OI0A 3C15B 4BWMA 5J2MB 4YFUA 1K47A 3GSIA 4KKOA 3RBZA 1ZTTA 2W2PP 2BVZA 1K1QA 3MUTP 3ADAC 4RNHA 2KZZA 4S0MA 1N33J 4RUHA 3IC1A 3SI8A 1X4GA 2F9JA 3TAMA 2NSBA 2FVSA 2XMVA 3UR3C 1WDTA 2CQ0A 5I42A 1RTHA 2NLWA 3TWZA 3JAMU 3BYRA 4B3OA 3VALA 2YQ0A 4Y34A 3QAEA 4BLGA 3TA1A 3BREA 2M2BA 2AGOA 1H7WA 2N4DA 4WIQA 5EWEA 2YKQA 1HBUB 4JV2A 2YWHA 2GO8A 1RUSA 1VQOS 3ZZYA 3LANA 1H72C 4ZLLA 2YH0A 1NK0A 4ZPWR 4ECUA 2DR9A 1RKIA 4G1PA 1RACB 1R8AA 3D28A 3OR2B 1N5SA 1HNZF 4DL6A 4IQXA 2IJNA 2BABA 4IFYA 2LQJA 2HBYB 2YWGA 4N8NA 3R27A 1TKZA 1TR0A 4LR7A 1DY3A 3T3FA 2UU9J 2B51A 2MHNA 1XBWA 3HI9A 3ZTPA 3M8ZA 1H98A 4A47A 5GVQA 1FTRA 1HW8A 2V8PA 2CAJA 1EKSA 3MR3A 1RAGB 2HYIB 2M8DB 5KFPA 1N32F 4Q2LA 1PSDA 2VC1A 4LFAF 2Q79A 5K9FA 4ZPBA 1UMJA 5G0RA 1WEXA 1Q86T 5J2QA 1IKVA 3H20A 4OYOA 5E3PA 3C6TA 4KPYA 3GG0A 2LQ8A 2R2RA 1G2EA 4BWJA 1EQMA 3O44A 1UVNA 2JC1A 1RTJA 2EK6A 1U1LA 2MQLA 4ECQA 2UVVA 3H5YA 2QYCA 3R1HA 2CQIA 3WX8A 3E8OA 4E8UA 1YSJA 4QYZJ 1ZYQA 1DTTB 1H73A 5F0WA 3IM8A 4CTAB 4DFPA 1RTZA 3CJ8A 1NKEA 4DV6J 4HEA9 3BPDA 4QWCA 2DNQA 1RA6A 3CWJA 3NGUA 3QIDA 2GFFA 2V5HG 2B9WA 1JLBB 1XN9A 4X4UA 2OI2A 3BBFA 3LO3A 3G4SS 5D3GA 3M6WA 4AUKA 1S1XB 4CYUB 2COLA 4GC7A 1PIEA 1PILA 4KBIA 3UVJA 4K4VA 3BBBA 4ZVEA 3LGHA 3FCVA 2CWXA 5C42A 1QJHA 4NLGA 2NYHA 2ZH2A 3RJMB 4F25A 1Z2ZA 3PKYA 1VCTA 2IMWP 2ATLA 4NLSA 4Q8FA 3THTA 1EP4A 3GIRA 1N5YB 3HFVA 1UEUA 3DLBA 2IRUA 3FSYA 2BOPA 2W4DA 2FYXA 2HNDA 2R3VA 4DSKA 5F8JA 2JLEA 4RWXA 1QSLA 2JRSA 4JI6F 3NOCA 4OI4A 3ZZOA 2XNQA 1S77D 3J81j 1UTAA 1VJWA 4M5NA 3M9OB 3HKWA 3TX0A 3H59A 3Q23A 1RADB 2R8JA 4X4QA 3EXYA 2FLNA 3LWMA 2BE2B 4DV3F 1OSCA 3EWGA 3CC2S 2DB1A 4LFCJ 5IXUA 3DCAA 2R7WA 2R8KA 5KG4A 2A1BA 3PFEA 3ZXWA 5CCLA 1DTQB 4CQ1A 1L3KA 5E41A 5M2UA 1BC6A 1GX5A 2FY8A 4ZJLA 3M2UB 3MECB 2C3UA 3RAQA 4FYXB 4QJVA 4ECZA 1M5HA 4NMLA 1R0AA 1VJQA 2B6AB 1S6OA 3QZ8A 2LU1A 3J7AN 3PEJA 1SH2A 4KAIA 2HHSA 1F5BA 7FD1A 4QR2A 3B78A 5B0EA 2EG1A 3DOMA 4L76A 3V5RA 3G96A 1F0XA 4OL8A 1PKUA 3SBMA 3IR5B 1YK9A 3VWSA 2CRLA 3Q24A 3MD1A 3SV3A 4XAKA 4G6VB 4O4GB 1E6VA 4TU8A 2M0GB 3KXDA 1GXUA 1U7LA 3NBPA 4NASA 2P6TA 3VQSA 1GX6A 4DV0F 1T9XA 4F4WA 1YJVA 3DLKB 4LF7J 3M9NB 3M8WA 1S99A 3DMJA 1LQ9A 2F40A 4O4RA 3W5ZA 1U0HA 3AJ2A 3A8EA 1VK8A 1C1BA 3D4JA 5E3RA 4DV5F 3V6JA 5IM0B 3UDCA 4M63A 1LW0B 5L9NA 4Y28C 2ZKUA 2WCXA 2CQCA 5HI7A 1HMVB 1TKDA 3H5XA 2OPPA 2EFOA 4B3MJ 4D3HA 4KRWA 4J9VA 1EKRA 5KFJA 2EEYA 1ZTWA 4JI5F 3LP0A 1IBKF 1MU2B 1FNXH 4WFAQ 4HL9A 1TKTA 2ROPA 1M1HA 4ZCIA 2W9AA 3N0VA 2R8HA 3IFEA 2EK1A 4DR3F 1S10A 5FJ4A 4WFXA 4WP3A 1UFKA 3M2VB 1WC4A 4DCJB 3O3LA 4I1TA 1N54B 2E5LJ 5CYQB 2XWYA 3QIPB 3ZZ0A 4I6YA 1Z1ZA 3K5MA 4DV7J 2HQDA 3LW5C 3TQ1A 1BXNA 3V6DB 3FZBA 1UZHA 1BMQB 2ZOMA 3KUHA 1XMOF 1M90T 3RB6A 2NUHA 5I4MA 3CC7S 4X64J 3SCIE 4A48A 2G9OA 2GQ2A 3WC2A 2V9KA 1CS4B 5T41A 2J9EA 2MZTA 5JXSA 1C0TB 2VHGA 3SEOA 1F3VA 1QUVA 4ZA1A 2J8SA 2AYBA 4QCLA 4MYUA 2BKPA 1HHTP 5I3PA 2PMZD 3KLVA 2GHVC 4MT1A 2KKHA 2PT0A 3AD7C 2RILA 3BO4A 2D41A 1S0NA 4ZMMA 5KFOA 2D3O1 2VJUA 5HN0A 2FJAB 2RMLA 1VQYA 4B17A 2OPRA 5ADZA 3I9ZA 4LVOP 2P8IA 4JI4J 3V6KA 1XMQJ 4ZVUB 4C3LA 4A8KA 1BHNA 3L7UA 4LF5J 5FD1A 3I0SA 2YNFA 4KGKA 1S9EB 1OY6A 4LRDA 4DZDA 2ZITA 2V94A 2XO7A 2HZCA 2ZUGA 4RBUA 1VQMS 2HFZA 1U2FA 2AJ4A 2R2TA 4RU2A 2V8GA 2V2QA 5IFMA 3MCMA 1FD2A 3DLJA 2V63A 4QBUA 5CD4A 3PNIA 2V69A 3AQPA 1PJ7A 1RKJA 4RNOA 1SQFA 3LWLA 3LGMA 2GGPB 3ZTSA 2E7WA 3GFZA 3NMRA 4OZLA 4CLYA 1TP7A 3KJVA 1YBTA 4FS2A 2DITA 2QLXA 3TYTA 3DC2A 1IWAA 2LLZA 3T6BA 5IWAF 5BYRA 3MMBA 5A8WB 1S0OA 3LAMA 3QPIA 2MJUA 4OIXA 3G82A 3M8YA 3SQGB 4I2QA 3AB4B 4NYOA 5KFDA 4LR9A 3QAUA 5HATA 2JHEA 2MKYA 1CC8A 4LFBF 4NCAA 2W9BA 3LA0A 2K3IA 2WOMB 1WHYA 3EGZA 2IPOB 4YB5A 3NKYA 3DNCA 4DZ6A 4P72A 1Y5NB 1YJWS 1PAEX 3D0IE 2VD3A 5J1NA 4FF2A 2E5GA 2YNGA 3RW6A 4WBFA 2LDIA 4C4WA 4DPWA 2QSWA 1F3FA 3FRYA 2BYCA 4UQTA 2CYYA 1XNRF 1S79A 3UN3A 2KRRA 3HSJA 4TVAB 2YKAA 3E01B 1B64A 1GAOA 4TNOA 1IQZA 5A6PA 3TZZA 2DNKA 2W8LA 2CNLB 1XNQF 3DYAA 3UO0A 3NGDA 5ETMA 4E2FB 3SXLA 4HKQA 2CNOB 3F56A 3CCJS 3HPOA 2QYGA 1KQFB 2FPHX 2MGZB 1S4EA 2VG7A 1BQNA 3LALA 1T11A 5M2RA 3W66A 1UETA 1Q7YT 1RT4A 4HHHA 3I31A 3RRHA 2CQPA 3MUMP 3BGUA 4OHVA 3QGPA 3IG1A 1JLFB 5SUHA 3C14B 2O67A 4K5RA 3OTOF 3I4PA 1JLEA 1M5OC 4DUTA 2B4UA 1VQ8S 3WIVA 3C6UA 3D1QA 4QOTA 2ZBQA 3N6MA 1HIYA 4J7CA 2OIHA 3OPKA 2CDRB 1REGX 5JVHQ 4RX6A 2QLFB 1PGZA 5HANA 2KT3A 2MPUA 2EFVA 2FVQA 5J2PB 4FS1A 1YX2A 2KG1A 2H48B 2VFSA 4ANDA 4WKYA 2A2DA 3EGWB 3GIIA 2DGVA 3KJFB 1JJCB 2E1AA 2BE9B 3CJKA 4CRJA 2ROGA 1GTHA 3VAGA 2R7TA 1WACA 5HSPA 3M05A 3EGVA 4P71A 1U6ZA 1DURA 4OHZA 5KFAA 3HXMA 2ZEJA 1QTMA 3W9JA 4RZRA 4DSLA 1MSWD 2RVJA 1Q53A 4ZK7M 2JLGA 1X4DA 1UWBB 1VOMA 4OYAA 1JNRB 1G6BA 1TL1A 2CG8A 2B3TB 3G2XA 1QE1A 3FC9A 4DQPA 1U6FA 3N4WA 3I0RA 1WC6A 2H9ZA 1Y7PA 2UXDF 2OFHX 1S6QA 5KT4A 1REVB 5L46A 2I8EA 4UOGA 1RT7A 2KJWA 3MCSA 3W64A 1NK7A 1FJCA 1RHRB 4DR1F 5AJ3J 1N0UA 3CXCR 4TYBA 2UXBJ 3M8QB 4PQAA 3LUYA 2IC3B 3GILA 4IG3A 2LDYA 3BQ2A 2IBOA 2W1BA 3W7BA 4P7TA 4IH6A 4L6V3 2XC9A 2HBRB 1FKOB 4OX8A 3GJQB 1LXJA 1XJWB 4LF1A 4OZNA 3WDOA 1HD0A 1AFJA 4UY85 3B4MA 1Q8IA 4QYZK 4DPOA 5C24A 1TK8A 4LSNA 4AQYF 3GZ7A 1FRLA 3F44A 1QAXA 1OYEA 4NXNJ 2Y1LB 3KLHA 3HDSA 2RDIA 5HMYA 1BGXT 3MEGA 3HO1A 2YNIB 4EYHB 2KFZA 3ENWA 4MIWA 1R31A 3CIMA 2DGUA 4FZVA 2HQCA 2VDHA 1ROFA 2DK2A 1A7GE 2DO4A 1XTZA 3IRXA 4U9RA 1A6LA 4ZCMA 1FK9A 3CD7A 2AKWB 1V5VA 5IQQA 1VQ5S 4MTPA 2PN6A 2AEJA 2C3OA 1RLCL 3DU6A 1TKXB 4ELTA 3S8SA 1DQ8A 3HHEA 1XK8A 1T9UA 4Y65A 3HVTA 5KFWA 2R7VA 2YNHB 3MPDA 1Q4RA 4GKJF 1RYRA 3UDLA 4I56A 2Z2LA 3BM7A 2Y1RI 2OSRA 2UUBF 2NXCA 3HZEA 1RWWB 1JLAA 4YR3A 1NU4A 2QG9B 2R4FA 3I55S 4OZ2A 3NNCA 4K4WA 1C4CA 4JI0F 4DPXA 3OR1B 1SH3A 1TV6A 2YX1A 3DLGA 4QPXA 5HMZA 4DF8A 4WFBQ 4NA2A 2CNKB 1A9NB 5ETPA 4DUYF 2WVCA 3BYPA 4USKA 1ZM4A 1T05A 1B70B 4CO0A 5L38A 4HYKA 5KFIA 4Y2AA 2J7KA 4N7TA 2KH9A 5DGAA 1TK0A 2GIFA 5KFGA 4RNNA 2CPIA 4XDCA 1SXLA 2FZGB 1AYEA 3CE8A 4LVNP 3D6TB 3V6HA 3MMAA 2CPXA 2BJ8A 4GKKF 3VR1A 1PC4A 3ISND 1YTYA 4O3RA 4DR6F 3UPFA 3VAIA 4ZVTB 3M2RA 4PG5A 2Z2YB 1P27B 2PFFB 1KEKA 3KG1A 3P49B 2N7YA 4DSIA 4NLDA 2Z58B 4IDKB 1WG5A 3WBZA 2PSZA 4IYQA 2CQ2A 5E3CA 1U8WA 3MD3A 2HPUA 3GR1A 1C0UB 3T5HA 2RD5C 1UEVA 4GO5X 3KG0A 3NNHA 4LR8A 2HQFA 2HWIA 4C7QA 2B8PA 2IA6A 4ETZA 2EFPA 1FE4A 5CYMA 2OTLS 2XMWA 1GXLA 2WRMA 3JXOA 1SPBP 3LPYA 3L09A 3L3CA 2DNHA 2RAQA 2QO3A 2HZVA 3M32A 3MZIA 2J9CA 3KG4A 2Q66A 1SCJB 4NCGB 1C2PA 3KHGA 2RIJA 3DRPA 3CJRA 2EKNA 1H2UX 2IAJB 3G6VA 1YITS 2RF2B 2FVPA 4RW4B 3P8BB 4DSFA 3K8WA 3QRQA 3DDNA 3D1OA 3MPUB 1FJ7A 2B4PA 3ZO7A 2BJ9A 2BJDA 4NLPA 1RA7A 1ZS6A 3MEDB 1VGYA 1TAUA 3ZZTA 2VBYA 1OJ4A 4IH7A 3OJSA 4PEOA 3QJLA 5AE1A 1Q1KA 1N4LA 1SH0A 1VRTB 5HP1A 1D9FA 5DM6Q 3QLHB 2W2QP 3ZC4A 4CLLA 4DQRA 3PACA 2KM8B 1YZ7A 2FHMA 3BH6B 2V4QA 5BR8F 5HLFB 4LF9F 4H4MB 3TJ8A 1S6PA 4KFBB 4K0KF 1V3RA 1VHFA 4Y2MA 4C8ZA 2CJKA 4ECRA 4F3OA 3EE3A 2ZBIA 1FDDA 3S6EA 4CT8A 4JI8J 2WB1D 2D3OR 4WE1A 4AL5A 2VL1A 4B9NA 3MMJA 2QA2A 2G1HA 1KHVA 2BANB 4J91A 1Q8LA 2G2YA 2ZOGA 3CJ2A 1IJEB 4PAAA 3M9MB 2ADCA 1J5OA 3J80Y 4NE9C 4USHA 1OIAA 3HJVA 2R8GA 4CLTA 3MOJB 3W2VA 3CIZA 2HQIA 2HS0A 1AROP 2V67A 1X5OA 4DV2J 2IYGA 1S59A 3KK3A 1XWLA 2AEMA 3PW4A 9RUBA 5FDLB 1FESA 2VQEJ 3DGPA 1J27A 2UUAF 4NLYA 1NJWA 4K4ZA 2Z0GA 5B0GA 1S1VA 3M1VA 2VUGA 5F41A 3I56S 2FDNA 4RW6B 2CJXB 2VKRA 3KNGA 1KN6A 1HNWF 3TZXA 2XY6A 3FZ2A 4RUBA 1QAYA 4X65F 3KTQA 3IBCB 5AE2A 3PYFA 5ETVA 2D9OA 2J0SD 1VIXA 3FMBA 2JEJA 5KFBA 2GC8A 3SDEB 4URSA 1TMMA 5D4OA 3G8QA 2AHOB 2MEWA 3ITHB 2D1CA 1FD8A 1EB0A 2XMJA 1JJ2R 2E44A 3Q0AA 3C16A 1YJNS 1M5VC 4DF4A 1C1CB 1VQSA 2CIMA 3IP0A 2UV8G 4ED1A 5SZTA 4EBDA 2O01C 2HFVA 4CLFA 1HI1A 1HBUA 2CWKA 4X2BA 2X7IA 3PY8A 2LMIA 1IVZA 4FDFA 4LRFA 5HAOA 2VG6B 4C8NA 5L8RC 1XR6A 3OR2A 3TX8A 3DRRB 1TL7B 3H4DA 4ZPVR 2AP6A 3W61A 1RT3A 3IGVA 2YKNB 3TZYA 4F4ZA 3FUYA 3CPWR 5A6WA 3TA0A 2C2RA 3CMES 3J7YI 4NI2A 4LF8F 1U25A 4KGMA 2CPHA 3R8YA 4M5GA 2HHHF 3BS9A 5BJRA 3DOKA 3C3LA 4TLQA 2F4VF 4R5PB 2GJ2A 1JQGA 3JSRA 3JQJA 5CXTA 2KDOA 3BR9A 4EU0A 3OTDA 3RBXA 4K8RA 1C4AA 4O44B 1UJ5A 4A4JA 3QQCD 4Q44A 3FMWA 1BWVA 3ENVA 3RYLA 3QT7A 1QAIA 2X1AA 5KFKA 2FZCB 2XMUA 1MWQA 2ATCB 2XM3A 2Y1IA 2MZSA 3HCXA 2MQQA 2UUWA 1DARA 2NS1B 3QGIA 3ILOA 3V4IA 3HX9A 1DTTA 4A8XA 1IKXB 3EX7B 2OAUA 4ZP9A 2Q1LA 4HHUA 1RAOA 8ATCB 4GVLA 2YVSA 2PMWA 1JLBA 1SKWA 4ZOSA 4JYAJ 1HWIA 4PUOB 3BF4A 4I67A 2VBWA 5KFVA 1RU1A 4M5MA 2PFDA 1BLUA 3NOGA 3BKTA 5CD4H 4CIOA 1L3SA 3A12A 3LP1A 4WP9A 4JV5J 3BN7A 1D3WA 4KH1B 4NXMF 5J2NB 4U8YA 2GS8A 5U47A 2OPSB 1SQEA 3JQKA 3R5CA 4NLQA 3BV8A 4FKXA 4M8LA 1SC3B 3GPAA 4AXJA 1BQMB 3DOLA 2LYVA 5JUMA 5E2QA 3M6XA 3KLFB 1JJ4A 4W90B 3MAAB 4KB7A 1M1KT 1NDKA 3ZZPA 5D78A 2QX0A 1PCAA 2XSJB 4UOCA 2DRBA 3CCUS 3FSIA 2G13A 3FFIB 5F3ZA 3K57A 4J90A 2BE2A 3CEDA 2QV6A 1PC5A 2XY7A 4DR4J 2VFRA 4RBVA 2CXEA 4UTGA 4ICLA 4ZP7A 4H54A 2PEHA 3KFWX 4F67A 1U45A 2VIHA 2X1BA 4C0OC 2DH9A 2AT1B 4E0DA 4ETXA 2NXNA 3CCRS 3TR5A 2V4RA 2VBXA 1RT1A 1TFWA 1QUPA 3GYXB 3CD0A 3IAM9 2V8DA 2WVEA 2YQ3A 2QL9B 5T7LA 2A18A 4B3SJ 2B6AA 2DY1A 3Q86A 3PRBA 4DBQA 2NREA 2VZ9A 1RWPB 1YJRA 4I0WA 1LXNA 4JYAF 2XHCA 2LVWA 2N7CA 2VA3A 2FJEB 2UZAA 1LK5A 2HQ3A 4MIBA 1U8SA 3I5BA 4NZ0A 2VG5B 5J1EB 5KFRA 4F4AA 1RT5B 1HQEB 4O4GA 2I2YA 2O1PA 3UCGA 4X4TA 4B9SA 2ZZTA 3TVYA 4CO1A 5D4NA 1UFWA 2KYXA 3IS9A 3BO2A 4KT0C 3TAQA 1JKHA 3O6QA 4P2FA 3QYYA 1B7FA 3VGSA 3DLKA 3D3CJ 4ECWA 3J7ZT 4G1IA 3V81A 1NPPA 2OPQA 1A0OB 3H2LA 2FQQB 1I5OB 2RRNA 5IM0A 2DVIA 2XS5A 1LW0A 5L1LA 2QIFA 1AUSL 1KOOA 1TL3A 1J2VA 2VV5A 1IBLJ 4C6AA 1TL4A 2QMWA 2GIRA 2KXNB 1HMVA 1CBKA 3BGOP 4X62F 2DTJA 3HHLD 3AJ1A 5EX0A 5GADI 5A8RB 2XS2A 1RK8A 2DHGA 5DDPC 1VQ9S 3VCDA 4ILMA 4B02A 2X1GA 2QZ8A 4OHXA 1MU2A 3TEHB 4ZVHA 2AV5A 1U4BA 4EWTA 2E1PA 2CPYA 4P74A 1D8YA 3OL8A 1VQ6S 5HBMB 3A3NB 2DIVA 3M2VA 1UVJA 1GMVA 5CYQA 3QIPA 2AMCB 5HVGA 1I94J 3W5XA 2KT5A 3D9BA 4QU7A 1HNVB 2BBEA 3N5FA 2YQ1A 4LREA 2FY1A 3UD5A 1AFIA 1X8DA 4P75A 2MDAA 1KFDA 4ED8A 4IFVB 4B3RF 1CS4A 1HNIB 2QA4G 4LIWA 3GMGA 1H7XA 4DEZA 4PXCA 3KWMA 4RW8B 1Y9OA 2KJVA 1U1OA 3Q8SB 3KLEB 2XLIA 2KN4A 2RU3A 1O8BA 1RLDA 3TNVA 3SCKE 3H7HB 3I6PA 4Q45A 2D74B 5K8MA 3ISZA 3TA2A 3GE9A 2VFVA 5KFQA 1NDCA 4MYTA 3RR8A 1VIOA 5C7PA 1FRJA 2MSSA 4ZP8A 2CNNB 2XI2A 3T1AA 3CO0P 1VBZA 1RTIA 2OTJS 3KKFA 2ZZMA 4NLVA 3KK2A 3FSXA 3QNWB 3AFGA 4IG0A 1SC1B 4O3OA 2BKOA 4OYIA 1FFGB 4DFKA 5LL6d 1R8BA 3FGVA 4G1QB 3LAKA 3T1HJ 4I69A 2FGCA 1SQGA 3HFZB 4MKBA 2DIUA 3HHLB 1G7CB 1S1UA 5KAKA 2LXFA 3SFGA 1B0VA 3QMQA 3EDRB 3CMQA 4KO0B 2LA4A 2CPEA 8RUCA 4IOCQ 2ROEA 2PDAA 1FVQA 3JS9A 4RNMA 1N0VC 2Q43A 3LP2B 4URGA 4FF1A 4RW7A 4K4YA 3PKMA 3CO9A 4NLRA 3D3BJ 4PWDB 4DL7A 2V34A 3SFUA 1N6QB 4YY3J 1TUWA 3NG8A 3KJNB 3R2CJ 2GZOA 3W2WB 5C2GA 2V4JB 2GGPA 3MCOA 2B9YA 2EG2A 1RBLA 1UL3A 4HACA 1UJ4A 3BEGB 3Q8PB 3AD9C 2B9EA 3DI6A 1F1BB 1PBUA 2RHSB 1RHJB 1HWLA 3US5A 3OL7A 2IMOA 5A8WA 1Z4UA 2FVRA 1Q8KA 1UEKA 3MTKA 4B9UA 1U1MA 4ENOA 1HNXF 1Y10A 3R5BA 5A76A 1FDBA 4LSLB 2DISA 4XK8C 4WXOA 1F5CA 1N52B 2WOMA 3GLJA 1FE0A 3T1YF 5EGYA 1JWWA 4NRUA 1WHWA 4XPEA 3W9IA 3THVA 4LF6J 2MHEA 2OH2A 4MK7A 1HPZB 4OX6A 9ATCB 2DCLA 3PO4A 3SSRA 1W2IA 1RHKB 3TUZC 4P10A 1HL6A 1Q95G 1H0HB 4M5HA 3THPA 1S72S 2HHWA 2OEJA 4OZJA 3VGTA 4ED4A 4DS4A 4FYDA 2JOQA 2MQ8A 3KMQA 4K5SA 5B0CA 3E01A 2MZJA 4LF4F 1JLQA 4F4YA 2DO0A 1J5EF 2CZ9A 2E5IA 2BJ3A 4WF9Q 4TLRA 5KT5A 2BQRA 1KQGB 1KRPA 3IWNC 2MY7A 4E98A 2UXCF 1NDLA 2A2CA 1NMEB 4KKOB 2CA9A 2BE7D 3I9V9 1R3NA 4WWSA 3SSQA 4FPIA 1NSPA 3A3OB 1I3OB 4TN2A 1Q16B 3OXLA 1EHWA 5GMEA 2MY8A 1VS3A 1UKUA 1JLFA 4EYIB 3C14A 2Y0BB 4IH5A 2EXUA 5I42B 1YJ7A 2ZNYA 1N8RT 4L3KA 2JFDA 5GMKa 1JXVA 1EZZB 1S0VA 2I9SA 3W8GA 2NXEA 3GIJA 2W2MP 3M7VA 4K4TA 1S9FA 4P73A 3TOQA 3N5BA 4A46A 2YBVA 1URRA 5HMWA 3W63A 5J2PA 3UNGC 2BZ2A 2LXUA 1WWHA 1V9OA 3AA8A 4IFYB 3MM7B 1GT8A 4B08A 1WKKA 3TUIC 4FXDA 3IA0A 1TKZB 2J6UA 1F9HA 1VQLS 3EJMA 1WDDA 4ILLA 1WTFA 2LQ5A 2NPIA 3GCWP 2DHSA 4ZLNA 1P6TA 3IRWP 4DLGA 2XSFA 2ACYA 4URQU 2HK3A 3Q8YA 2BKNA 1TFYA 5G0RB 2NZCA 2YPZA 1IKVB 1KVKA 5A0YA 4DV4J 3LTOA 4J37A 1REVA 2MYFA 4ELUA 2B5JA 2P5VA 3F41A 3JTOA 1OWXA 1Q7LB 3UNYA 2XQCA 4RR5A 3HHNB 3OT9A 4FBUA 1FJGJ 1TQLA 1IN0A 3TO8A 3M8QA 1RTJB 2ZFHA 4FYYB 2AX1A 3FCWA 5KOXA 1FKOA 4DCOB 3ZZUA 1NNDA 3VAJA 2DGSA 2BX6A 2NSCA 4DU8A 5IQ6A 3SSSA 4MK8A 1RXOB 3UCUP 3RUBL 2ZBPA 2X3GA 2YWKA 1G4CA 1PYTA 4N5SA 2XTJP 5D4PA 2JEGA 1T9TA 2HNYA 3A3PB 5KFYA 1FRHA 4TYAA 2HFUA 3QRPA 5IS2A 4CLUA 1RAEB 4ER8A 1YBAA 2MKSA 2YNIA 3TUJC 4NX9A 4EZ6A 4WTOB 1BD6A 3C8YA 1V3SA 2P2CB 1D9DA 4F02A 5M2PA 3CNQP 2E5JA 2L3MA 3AOBA 1EP4B 1ACMB 3R3TA 2UUCF 2ERRA 3JSMB 3CD6S 3R5GA 3PG9A 2MZQA 1WG1A 1NH8A 5KFSA 3DHXA 5BYSA 1TKXA 1UVMA 2KHDA 4F7VA 1EX8A 4HVZA 1YKWA 1KOHA 1VQPS 2V8VA 2VPZB 3UD4P 4R8UB 2YX4A 3CTRA 3ZNJ1 5BXIA 2R7QA 1H2VZ 1GK8A 1H74A 2N82B 1VQNS 2M9KA 4USUA 2J6SA 3I82A 1EJ7L 4BCAA 3RG6A 4CNZA 2FC8A 1L3VA 4IO1A 2DHHA 1BE4A 1B7YB 3OR1A 1CJTB 5DRKA 4RL1A 2ZUAA 2IM1A 1YGYA 3Q2SC 5KG3A 3U1LA 1XR5A 1X9SA 5CCMA 1R0AB 5GADU 2W4PA 4PRFA 2V0NA 2ASLA 4X66F 3R5AA 1KR4A 5ETQA 2L41A 4K50A 4CI0B 1N36F 1N32J 4JV1A 2A3JA 1IJFB 3DOMB 3T5LA 3P5TL 3CCTA 4LFAJ 3HM9A 5L1IA 4TQSA 4CLKA 4L3NA 5I3QA 3QT8A 4CZCA 4RJVA 2BDPA 1PYSB 2G1DA 5LJ3Y 3TW0A 1KP6A 2OFGX 2M70A 2LP4A 4WTYA 4TY8B 2NQPA 1HBOB 3MDFA 4HT7A 2CPFA 3NBPB 1XMBA 1OQ6A 3TANA 3D68A 2DXFA 5LSOA 1IBMF 3K89A 4OI1A 4AE5A 3DMJB 2YTCA 3N79A 4IDKA 3HD1A 2FJWA 4C11B 4DU7A 1CLFA 3ULHA 4Q0BB 4J9UE 1C0UA 4YR0A 4Y00A 4ZP6A 4FXWA 5D15A 3GFYA 3BSCA 2FJDB 3QATA 4IR1A 2QLBB 1HLWA 2BOAA 2RUGA 2HNZB 3HKZD 2Y3YA 1NJYA 3T41A 1PYOB 2ZD1B 1T94A 1SV5A 3HULA 1KSPA 2WW4A 2ZH4A 5DQGA 1OYDA 1FTCA 3LP0B 2XMAA 3JSBA 4NCGA 1AXQA 4I68A 4CH0S 4L72B 4WFNQ 3VAMA 1OS5A 1DLOA 4G3IA 2QE5A 2MJNA 4IOBA 3MPYA 1XERA 2IFXA 2CJQA 4RW4A 5CQGA 1WSVA 2K1RB 1Q79A 1YJUA 4DX7A 4F4XA 1YBUA 3KOAA 2HW3A 3GTYX 3FCHA 3MEDA 4ID5A 1UPMB 2B56A 3FBCA 4O23A 1SKSA 2IBKA 4EEYA 1EIYB 3OSPA 4DR7F 3CT9A 1GFWB 2CJAA 5HMXA 2BACA 3IO1A 2J5AA 4OX9F 5KFCA 4JI6J 3K5PA 4YP3A 3QLHA 3DRSB 2RB7A 2IM0A 4HDHA 5E0OA 3MGJA 2NXUA 2XMKA 2IDEA 3KUGA 5IZHA 4A8MP 4KFBA 5EWFA 1W2BR 1TL5A 4DV3J 4R25A 5H1SV 2ZM6F 1ZAVA 3VV2B 3P45B 2AD9A 4U7UD 2B9XA 1UWAA 3T5JA 1KLMB 2ASJA 1LWCA 1IR0A 3SV4A 4EO8A 3BSAA 2DR8A 1VBKA 2HAFA 1N48A 4CO5A 5CA5A 3C2PA 2P9EA 2OPRB 4A8SA 4CLSA 2ZC3A 2E7VA 2R7OA 4LSZB 2B43A 3CULA 2FIUA 3HT3A 4YHHF 1RISA 3M8SA 1UZDA 4JI3F 3I0SB 2YNFB 3U7JA 1AZSA 5LT5A 1XR7A 3ENAA 4MFBA 3RRKA 5DQIA 1PBAA 2JFKA 1T02A 4KHRA 4Y2KA 2FHJA 2ZE2A 1MN9A 4DR2F 4WU2A 2XCAA 2F3JA 2BRLA 1W26A 3GG1A 2HWTA 2AX0A 4UUXA 3OD2A 3PX4A 4PCQA 1D1UA 3JB9k 3KK1A 1L3UA 4YMEA 1RT2A 4ID8A 5HJXA 4NLTA 4DV0J 5KFFA 3TI0A 3AY0A 2VONA 3BGFA 4X4SA 4C8YA 5BYQA 4PG6A 1TVRB 4DV5J 4F36A 1N5VA 3NCPA 4OYXA 5MLCV 3EPGA 4IRDA 1KFSA 1HR0F 4C48A 3SDEA 2G0JA 5HQ8A 2QGFB 4Q43A 3G82B 4DFJA 4Z2XA 4OI2A 3ET6B 2WONB 1RAIB 2K3KA 1NLKL 4OZ0A 1C1CA 4JI5J 1IBKJ 3K59A 1N34F 3L7PA 5EDWA 4ZPTR 4YDXA 2KU7A 3K5OA 3BSNA 3EGNA 2W9BB 1LFPA 2R8IA 2E5HA 5CYJA 4U7CA 4DR3J 1R0CB 1GQEA 1JNZB 3PYEA 3HP6A 2A6OA 1MNEA 2N3LA 5GAGI 3KLIA 4ZCLA 1TL7A 3GFHA 2YNGB 2DD8S 4FXVA 4NEZA 1APSA 2QJ3A 4YB1P 1XMOJ 2OHDA 1NSQA 1MWZA 3FEYB 2YKNA 2VBZA 4JB8B 3ILIA 4QPTA 1SJQA 1HQ2A 1VK3A 2DYAA 3DYAB 1DJ0A 1SJ1A 1YWXA 1NRKA 5CH7B 5K8NA 3H5UA 3GJSB 4R5PA 3NCQA 2RS8A 3K5LA 2XYGB 3HJFA 1T95A 3PW2A 2L9WA 2Y8YA 4OZ5A 2M88A 1BQNB 1FWPA 4AD6A 2NZ4A 1FF2A 4NL5A 3ZTRA 4PPZA 3FDSA 4F0HA 4BBYA 3O8WA 4AYBD 4DV1F 4F3MA 1T8EA 5AXNA 4DI6A 4OI6A 5L9XA 1DHMA 2AYEA 3IG1B 5JMNA 3O5TB 1QM9A 4D3GA 1M0SA 4MMOA 3CSKA 1S9GB 1JLEB 3QT6A 1HBMB 2ZHBA 1IKXA 3NS7B 1R27B 2WB4A 3PDNA 1H2TZ 3DGVA 3CDEA 3N9UC 4O3NA 2AJ1A 3RGIA 4PUOA 1IM6A 1EAYC 2RRAA 1FKPA 3DHWC 3CJKB 4HTIA 2ZVSA 4LT6A 4HR2A 4NA3A 2IVFB 2ZDPA 1RE1B 4ECVA 2XCPA 3H40A 4IUFA 3UFCX 4UY8T 4ALZA 1FA0A 1SB6A 1S76D 1IQTA 3ZZRA 2BW7A 4MAKA 1F2GA 1KVJA 4NLXA 3R2DJ 1QE1B 1T3OA 3NRBA 1CJUA 2UVRA 2OP5A 4CT9A 2EW9A 1K8AT 3KLFA 4DFMA 4JI2F 1YZ6A 4QWEA 5F8IA 1Q0NA 1RT7B 4RU9A 3GU0A 4QU6A 3D7SB 4EGLA 2E1CA 4WKRA 2XSJA 3EPIA 2HURA 5IWAJ 3KMSA 4ED0A 3NGSA 4ELVA 1LWFB 1Q81T 1X4BA 3MXHP 4USWA 3FFIA 2PC6A 4CH1A 4IG3B 4JUZA 1GMWA 2IIHA 3QRRA 5AXKA 1V3ZA 4EZ9A 1B99A 2J9DE 4LFBJ 2E9ZA 2V8HA 4YDDB 6FD1A 3QFWA 2HZAA 3MR6A 1FX2A 5C24B 3FKBA 4LSNB 1Q78A 1NK5A 4TU7A 3PW5A 4KV8B 1KQKA 1MG7A 2UVUA 5DETA 4P2SA 4Q8EA 7AT1B 2JVRA 1T0TV 1NHKL 3KLGB 3MEGB 1XNRJ 3M30B 3GYGA 5HROA 1EQ0A 2HIQA 2JEIA 3CCVS 4A8QA 2KB2A 1YLXA 2N3OA 1XNQJ 1I6JA 4EO6A 1R8PA 1KLNA 2BJ7A 2HWHA 4NMXA 1ZZNA 2CVIA 4C2MA 3TRGA 2VG5A 5K20B 1NJZA 5J1EA 3IRXB 1P9QC 3C19A 1U24A 2JDJA 2VOOA 1SIWB 3H2VE 2F65A 2D3ZA 2EWHA 1TU0B 5KFLA 3LPEA 4DQQA 3UDEA 3OTCA 2O3DA 1U48A 4OLOA 1S1TA 3JQMA 1AUDA 3FQKA 4C8MA 2ZH7A 1WOSA 2VODA 2R7XA 2CJBA 3HVTB 1ZOTA 2RQMA 4G65A 4LRBA 4KY3A 3OTOJ 5IT9U 3X1LB 2KI2A 3I32A 1OMSA 2DGXA 1Y11A 2ASDA 3NL0A 2XO6A 1VBXA 2AU0A 1NCLA 2Z30B 3CF5Q 4EBCA 3EDQB 1JLAB 2GVDA 3E2EA 3MM8A 4KGXB 4P2XA 3S01A 4DSEA 2W7OA 1PJ6A 4KR0B 5A8RA 1NJXA 4KHPF 1JJHA 3HVAA 4OJ1A 3ILLA 4W98A 2F8MA 3BO3A 4ZHRA 3H25A 1I1GA 2Q3PA 1WI8A 2QL5B 3DLGB 4CLWA 3BH7B 4EUVA 2UVWA 3OUYA 3D6FB 1ZM9A 6FDRA 5FIIA 3MWBA 3H2UB 2KVQE 5L1KA 2XG8A 1S12A 1T05B 4ZVRB 4ECYA 2DEIA 3EZUA 1ULRA 5IOLA 2N4CA 1HI8A 5DDQC 1TUGB 5C5JA 4I64A 3J7Z5 3QWPA 3RAXA 2AW0A 1RT6B 3MURP 1HNVA 4OYBA 2XMMA 3MMAB 3J80U 2UXDJ 4ZN3A 2RDJA 3D0HE 4KH0B 2M5YA 2X1FA 3MPWA 3AB2B 1U1QA 4DR1J 1UFLA 1VRUA 3M2RB 1HNIA 2IM3A 1T9YA 4LUBA 4M5JA 2W25A 2FHOB 4RW8A 5KG5A 1W7WA 2IRXA 2F8HA 4PYAA 4AL7A 2GQCA 4KC5A 2EC2A 3GIKA 2DNZA 4B9VA 5I3UB 1RTDB 2LCWA 5IC4B 3BKUA 4OHWA 4GVBA 3FEZA 2BXJA 3AXKA 4FVMA 4CNYA 2V68A 2XS7A 1T03A 4C98A 3DM2B 5DO2A 3GP9A 2GQQA 2DCUB 1VDHA 2RQCA 5E3AA 2EPIA 4AQYJ 1IKWA 3PJXA 3JTPA 2DKOB 2BM0A 3M32B 2C2DA 1OPZA 4HLBA 5EUHA 4NLUA 3H90A 3J81Y 2POKA 3AXMA 3DRPB 1T9WA 1WOOA 3A8KA 3AOCA 3IXQA 4XDDA 2ADBA 1FCAA 1YRUA 3W1YC 3BQ0A 5F9LA 4DUZF 2OMLA 3FNNA 1KC8T 2ASYA 3TUPA 3CC4S 1QSSA 1RWXB 2QRRA 2J0QD 1UCNA 1FFSB 2ZH6A 3RB3A 1ZM2A 1N5QA 3GIMA 3GV7B 1N6QA 1X60A 4I7FB 5EX3A 1WJ9A 4AT1B 2HMIA 1E6YA 4WZQA 3QO9A 3EZOA 3W2WA 2V4JA 2GCFA 2HVZA 5DG9A 1S6PB 2I5JB 3K0JA 4GKJJ 3VGVA 2IHR1 1KDNA 2YX7A 1WUUA 4WK3A 5LMUF 2EI5A 3AQOA 1Y00A 2DH7A 4I6WA 3D6MB 1RHUB 3I96A 2UUBJ 1FNMA 3CMAS 1MMNA 1ZPVA 3G86A 1X4FA 2FLOA 2K06A 2IVMA 1QSYA 2J7WA 1WKLA 3GQCA 4JI0J 4U95A 3CJQA 1JLCA 2FB0A 4M5IA 1P9YA 1HQUB 3GCXP 4JI7F 1SL2A 4LSLA 4DQSA 3KYLA 4KE5A 4LF2A 4N76A 3DXBA 1J5OB 4DUYJ 4LQ3A 4R0JA 2VJVA 4C0BA 3RW7A 4FKYA 4YS2A 3FVYA 3NWRA 2LEBA 3W2VB 2CJ9A 3PFOA 1HPZA 2VICA 3IWLA 4WJBA 1O5JA 1SJRA 4ZPDA 2FLPA 2K2PA 5CZXA 3QGHA 2B7BB 3MMCB 1B0TA 4EBEA 4KIAA 2W2OP 2KL8A 3HLUA 4NLOA 3C66A 3IGNA 3Q8UA 2Q6BA 3DGPB 2KM8C 1WEZA 4GKKJ 1CEZA 3VZIA 2RDDA 5D0EA 3FBFA 5GAGU 1RWVB 1S1VB 4DR6J 3M1VB 1UW4A 4WIIA 3QFHA 2CPDA 3JTNA 1K1SA 5KFUA 4JI1F 2V2ZA 4NCBA 3OXFA 3R7BB 1SL0A 4PG8A 3MEEB 4F2SA 4GRSA 1R6YA 2OELA 1FX4A 1X5PA 2K8GA 1MN7A 2FD2A 2AWZA 3ETMA 1IBCB 3ICLA 4OYMA 4LMZA 1XC9A 4ED3A 4F3QA 3T6JA 1NAQA 2K7KA 1Y3JA 2FZKB 4YOEA 4OV6A 3AH6A 3S7RA 2JVOA 1CULA 3OHAA 4QW9A 3T5KA 3C16B 2JX2A 2Z2ZA 4ZLJA 3NWGA 1VR6A 1KHWA 2DJWA 1FVSA 5KT2A 2HRUA 2RRBA 2RQKA 3ZTOA 1HYSA 2CG4A 2LECA 2DRDA 5LMNF 4KJIA 2R2SA 5ETLA 2AIRB 4L73A 4DR5F 2XY5A 4USVA 4MH8A 2ZWPA 4B3TF 2P9CA 1GMUA 2LEAA 2VOPA 3MM7A 3MR2A 3D6HB 4V1Ak 1U1RA 5AXLA 2MQPA 1KQSR 3L4BC 3WX4A 1VC0A 1ZPWX 1U2RA 3GONA 2Y8WA 3FQLA 1RT3B 1Y0HA 1UP1A 2FUG9 3UW1A 2JH3A 4NWBA 1FERA 2KHCA 4NZ6A 3OW2R 1O51A 4NI2B 3PR5B 1MLAA 5K5MA 3NP5A 3DOKB 5BR8J 4LF9J 5DQHA 5FLXY 1WC3A 2IRYA 1MWYA 3POTB 2GHWA 2WHOA 1LWXA 4K0KJ 3TJAA 3MM9A 2Y9HA 5F8NA 4HT5A 3EM1A 1VI7A 3BGRA 2GX8A 4FP9A 5RUBA 2LKZA 2OO4A 2MLYA 1RWNB 4ATNA 4A8WA 1CG2A 2BJEA 5KFMA 2PI4A 3RU0A 1WF0A 4K2JA 3ZTQA 2HHQA 3PW0A 4ZVQB 4ZCKA 2WVDA 3V4MA 1YJTA 3V4IB 5JJBA 1WG4A 5DZ6A 3IBFB 2XGQA 1F5AA 3GSDA 1N33F 2XBPA 3OTEA 2LQ9A 4N41A 1OQ3A 4XTTA 5LM7E 2DBBA 4ES3A 2PA3A 1MROB 4J9MA 4YEAA 4EFAC 5THWA 3BBCA 2HG4A 3MF5A 3MAQA 1HARA 3OSNA 2L9NA 1AW0A 3LP1B 4AXIA 2UUAJ 5C25A 2BW2A 4RW9B 5GAEI 1FXLA
chains in the Genus database with same CATH topology
4DR1J 2MTLA 4K0KJ 1J5EJ 4DUZJ 4JI8J 4JI7J 1I94J 1HR0J 4NEYA 4KYZA 4JYAJ 3T1HJ 4DR4J 4YHHJ 3J81U 3D3CJ 3IMQJ 1HNWJ 4JI5J 3R2DJ 4JI3J 2UXCJ 1IBKJ 4X65J 4DR7J 1IBMJ 4JI6J 4JI4J 1XNRJ 4DV6J 2VQFJ 2KL8A 1XMQJ 4LF8J 4DR3J 4JV5J 2E5LJ 1HNXJ 4DV4J 1N34J 4KHPJ 2HHHJ 2MEWA 2UU9J 4OX9J 1XNQJ 4DV1J 5FLXU 1IBLJ 4LF5J 4GKKJ 4DR2J 2F4VJ 4LFCJ 4DV7J 4GKJJ 4LF6J 4JI2J 5IWAJ 2KVQE 3T1YJ 4DR6J 4B3RJ 5LMNJ 4LF7J 4NXNJ 4NXMJ 4DV2J 3D3BJ 4DR5J 4DV3J 4B3SJ 5LM7E 4AQYJ 1FJGJ 4V1Ak 4YY3J 4DV0J 2UUBJ 5A2QU 4X64J 4B3TJ 1N33J 4NEZA 1HNZJ 5LMUJ 4X62J 3R2CJ 1XMOJ 4X66J 1N32J 2ZM6J 2UUCJ 4LFAJ 2VQEJ 4DV5J 4LFBJ 2MQ8A 4JI0J 4JI1J 4RJVA 3W1YC 3J80U 1N36J 3JAMU 2UXDJ 5AJ3J 5BR8J 4LF9J 4PWWA 4B3MJ 4HHUA 4KY3A 3OTOJ 2UXBJ 2UUAJ 5IT9U 4LF4J 3J7AN 4DUYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 J;  2MTL A;  4K0K J;  1J5E J;  4DUZ J;  4JI8 J;  4JI7 J;  1I94 J;  1HR0 J;  4NEY A;  4KYZ A;  4JYA J;  3T1H J;  4DR4 J;  4YHH J;  3J81 U;  3D3C J;  3IMQ J;  1HNW J;  4JI5 J;  3R2D J;  4JI3 J;  2UXC J;  1IBK J;  4X65 J;  4DR7 J;  1IBM J;  4JI6 J;  4JI4 J;  1XNR J;  4DV6 J;  2VQF J;  2KL8 A;  1XMQ J;  4LF8 J;  4DR3 J;  4JV5 J;  2E5L J;  1HNX J;  4DV4 J;  1N34 J;  4KHP J;  2HHH J;  2MEW A;  2UU9 J;  4OX9 J;  1XNQ J;  4DV1 J;  5FLX U;  1IBL J;  4LF5 J;  4GKK J;  4DR2 J;  2F4V J;  4LFC J;  4DV7 J;  4GKJ J;  4LF6 J;  4JI2 J;  5IWA J;  2KVQ E;  3T1Y J;  4DR6 J;  4B3R J;  5LMN J;  4LF7 J;  4NXN J;  4NXM J;  4DV2 J;  3D3B J;  4DR5 J;  4DV3 J;  4B3S J;  5LM7 E;  4AQY J;  1FJG J;  4V1A k;  4YY3 J;  4DV0 J;  2UUB J;  5A2Q U;  4X64 J;  4B3T J;  1N33 J;  4NEZ A;  1HNZ J;  5LMU J;  4X62 J;  3R2C J;  1XMO J;  4X66 J;  1N32 J;  2ZM6 J;  2UUC J;  4LFA J;  2VQE J;  4DV5 J;  4LFB J;  2MQ8 A;  4JI0 J;  4JI1 J;  4RJV A;  3W1Y C;  3J80 U;  1N36 J;  3JAM U;  2UXD J;  5AJ3 J;  5BR8 J;  4LF9 J;  4PWW A;  4B3M J;  4HHU A;  4KY3 A;  3OTO J;  2UXB J;  2UUA J;  5IT9 U;  4LF4 J;  3J7A N;  4DUY J; 
#chains in the Genus database with same CATH topology
 3OXG A;  2YKM B;  2D3U A;  2GVZ B;  3CCL S;  3G8T A;  4OQJ A;  2AEF A;  4ZJQ A;  1BWE A;  1KTQ A;  1HNW J;  2DR5 A;  4IRC A;  1K0T A;  1QDU B;  3GV8 B;  1Q5V A;  1U6B A;  2GA7 A;  2UU9 F;  4X65 J;  3DOL B;  4OYW A;  2B7C B;  5EN1 A;  3JSM A;  3W3S A;  1CQN A;  2M4M A;  4DX8 H;  2IM2 A;  2EBE A;  3UCZ P;  1VQK S;  2QSF A;  1FWL A;  3T19 A;  2OUG A;  1SI9 A;  3Q89 A;  4TKT A;  2J7U A;  1OY8 A;  1M5P C;  2NPF A;  4TU9 A;  4NZ7 A;  1S7I A;  4R8U A;  1EET B;  3OLB A;  4ECS A;  2VKZ G;  1CJK A;  5B0D A;  1O6X A;  2DY9 A;  1X4C A;  5D77 A;  5CAA A;  3R6G B;  1NK6 A;  2CKW A;  4ICL B;  2H3E B;  5F8L A;  5AE3 A;  3SYZ A;  1NB2 A;  3G8S A;  1MMD A;  4H4O A;  2AGQ A;  3ILJ A;  2VU5 A;  4FF4 A;  2GMJ A;  1CJT A;  1NJI T;  3SCL E;  4N77 A;  4O3Q A;  4BHQ A;  1RT1 B;  1YVF A;  1K44 A;  2J8A A;  4KYZ A;  2L9D A;  5T7L B;  5CZV A;  4DV6 F;  5H9F J;  1YIJ S;  3K58 A;  5H9E J;  5HQL A;  3SCJ E;  4ECT A;  4FNI A;  3R5D A;  3JYT B;  4L74 A;  2E7X A;  4LF8 J;  4RWW A;  5EWG A;  2HHH J;  1RBA A;  1LW2 A;  5T14 A;  2W9C B;  3W62 A;  1G3O A;  2F4V J;  3GR0 A;  4UOF A;  3PIO Q;  3S1T A;  4HHJ A;  4TY8 A;  1HBO A;  4GC6 A;  3IS9 B;  3IM9 A;  3OJU A;  2BQ3 A;  2ZC4 A;  1VLY A;  1YQH A;  4V19 X;  1JKH B;  4N8O A;  3P5B P;  2XLK A;  2ZOF A;  2Z56 B;  4USM A;  2J6T A;  3C15 A;  3V81 B;  3VVT A;  2OPQ B;  2MMY A;  2F1F A;  5J2M A;  2HQG A;  1P8G A;  4EMD A;  4C11 A;  2RKI B;  3D67 A;  1GTE A;  3CDA A;  4Q0B A;  1IUJ A;  2MTL A;  2J0W A;  1TL3 B;  1F9F A;  2HHP A;  5J1P A;  3KDO A;  1WF1 A;  4F4K A;  5K14 B;  2OGU A;  4DQI A;  2FVC A;  5A2Q Y;  2AJ2 A;  2HNZ A;  4HI1 A;  2H5E A;  2KRB A;  3GB0 A;  2ZD1 A;  2EFN A;  3M8P B;  2HVE A;  4J9R A;  2P9G A;  4LFC F;  4M5K A;  5DDO C;  4F8R A;  2BJ1 A;  5HQM A;  2MB0 B;  1HW9 A;  2B8Q A;  2ZJR Q;  1IKY B;  4NXM J;  2K1R A;  2F5G A;  3W60 A;  5DM7 Q;  4PZV A;  3KHH A;  2Z57 B;  4HI2 A;  5ETO A;  2RSQ A;  4QIE A;  1V5I B;  2MLX A;  4I2P B;  1FDN A;  3RR7 A;  4PYD A;  2YPY A;  3MM5 B;  3IN5 A;  4LRA A;  4A8F A;  3TQE A;  2MQO A;  2LFV A;  3DRS A;  1QD1 A;  2MST A;  2WAQ D;  1UJ6 A;  1LOU A;  1RJJ A;  1X4A A;  2WW8 A;  1MW7 A;  3N01 A;  1U09 A;  4W4M A;  1KD1 T;  3PEH A;  2W01 A;  1HI0 P;  3CCW A;  2FHK A;  1LK7 A;  1CJV B;  2C3Y A;  1WHX A;  2ZNZ A;  1TK5 A;  2JWN A;  2ZVI A;  4CO3 A;  1KLM A;  1WTB A;  4Y2I A;  1AA1 B;  1SC6 A;  2HHX A;  1S1W B;  4LF7 F;  1RB0 A;  4RO0 A;  1RU2 A;  2VF3 A;  5HVH A;  1O0P A;  3PJW A;  2DH8 A;  3AOD A;  1YHQ S;  2V2V A;  1JXL A;  1RTI B;  2KFY A;  3NAH A;  3KK2 B;  4IG0 B;  4CTA A;  3H5S A;  2WBR A;  2HRY A;  3OBI A;  3VAK A;  2YWF A;  5D4L A;  4K4U A;  5KG0 A;  2ZKT A;  5GMD A;  1CVJ A;  3H98 A;  4B3M F;  1S1U B;  3SIP B;  4OYZ A;  3AT1 B;  3AAW B;  4ANC A;  1S1X A;  4CYU A;  1Q82 T;  3CW2 C;  1HBN B;  1SC4 B;  2LA6 A;  5DS7 A;  3QSY B;  1S0M A;  4NRT A;  1UVL A;  1R8C A;  3RTV A;  4LIR A;  2KO1 A;  3L7O A;  4RW7 B;  4Y0F A;  2I6W A;  3Q2T C;  5HVF A;  3K2Y A;  3CCS S;  2DGW A;  5F8G A;  1WSR A;  2MKH A;  2R7S A;  2E5L F;  3Q8V A;  4DL0 C;  4ZVO B;  4DV7 F;  1N5Y A;  2OD4 A;  4O3S A;  3JAM Y;  3VZH A;  3QWU A;  5KFX A;  1F6T A;  1TVR A;  3B4D A;  4HAC B;  2QMU B;  4ILR A;  4X64 F;  4OX7 A;  2JJ4 D;  3R7S B;  4X4O A;  4DL2 A;  3DI6 B;  4UQG A;  4XIU A;  4USI A;  3Q8R B;  1LNQ A;  5DLF A;  4X62 J;  1VYA A;  4ES2 A;  3TVZ A;  3ET6 A;  2WON A;  5DG7 A;  4DMZ A;  3KJQ B;  3AA9 A;  2FJV A;  1DBD A;  5GAH I;  3HHL C;  4IQM A;  3CDU A;  4J9Q A;  1U1N A;  4A8O A;  4TQR A;  1M5S A;  3IBW A;  3UD3 P;  3TVK A;  2KVI A;  1QLN A;  2DHA A;  2PGC A;  1DTQ A;  4A8Y A;  2MZ1 A;  1S5Z A;  4JI4 F;  4X4P A;  2DNO A;  4DXL A;  2P6S A;  1XMQ F;  3NGR A;  3OHB A;  2XWX A;  3M2U A;  3MEC A;  3VQT A;  2KG0 A;  4P7V A;  4WP8 A;  4LF5 F;  2D9P A;  1FT8 A;  2VQF J;  2MZR A;  2CVE A;  4DHV A;  2ILY A;  3PJ9 A;  3KDN A;  2CZV C;  2FGO A;  1H6K X;  1JLQ B;  4DWI A;  1OSD A;  2JLF A;  1KKH A;  4B3R J;  2VPW B;  4UT4 A;  2SXL A;  3GJR B;  2U2F A;  1KON A;  3P6Y C;  1JMT A;  4DL3 A;  2CQD A;  3EIC A;  2DNL A;  2PMH A;  3N28 A;  2DXD A;  2C2O B;  4X84 A;  4F50 A;  3K17 A;  3T9Z A;  2E9R X;  4BC7 A;  3H8Y A;  2CQB A;  2EKY A;  2RNE A;  4W92 B;  3PX6 A;  4KQZ A;  4DPT A;  3KUE A;  1L5U A;  3BSO A;  3DLE B;  2CAD A;  4UZB A;  5K8P A;  4X4N A;  1S9G A;  2LU2 A;  3F0N A;  1F2H A;  2ZZN A;  3W8P A;  5AT1 B;  1HBM A;  4C8O A;  3IR7 B;  2RS2 A;  1WNE A;  4PQU B;  1RWO B;  4UUW A;  2YH1 A;  2YXL A;  3BPS P;  3PYG A;  1NHU A;  2XB2 D;  1PO6 A;  3MHY A;  4KGZ B;  1ZAX A;  4ZIV A;  3DFE A;  2RHQ B;  4NYZ A;  1FEE A;  3NLC A;  4DLE A;  4IO9 Q;  1LWE B;  1RDR A;  3TAR A;  4B9M A;  3CDW A;  3G6X A;  2HAI A;  1Y5I B;  5E3Q A;  3LOU A;  1GNK A;  3FJ2 A;  2AYM A;  2YWW A;  2C2K B;  3ZFV A;  2M52 A;  3UE2 A;  2BA9 A;  4F0K A;  1HFE L;  2VQF F;  4C3M A;  3V6D A;  4WZM A;  5GAE U;  1OPI A;  5A0Y B;  1WHV A;  5KG7 A;  1SUQ B;  2M8H A;  2OJ3 A;  1PG5 B;  1TMJ A;  4M5D B;  2B5J B;  2QN6 B;  3DXS X;  1HD1 A;  1RAA B;  2VB6 A;  3CCZ A;  1N56 A;  1M1G A;  4DOZ A;  2JSX A;  4K7Q A;  1LWF A;  1C0T A;  4C3K A;  5KFN A;  4DG1 B;  2R9L A;  4GO7 X;  2VDI A;  1NO8 A;  5A8K B;  1T7P A;  2IJF A;  1HNX J;  5DG8 A;  4YQW A;  3PR4 A;  3B82 A;  2XYP B;  2NYI A;  2WSF C;  3NCR A;  3T1Y J;  1VFJ A;  3WIU A;  2CQH A;  1KNZ A;  2PII A;  4ZJO A;  1WF2 A;  3NAI A;  2GJI A;  1JLG B;  2WVF A;  2VA2 A;  3MTJ A;  2C3P A;  3HSG A;  2HNY B;  3OVS A;  4KV8 A;  2MQM A;  1KTV A;  2DNN A;  4MKV A;  5KFT A;  4M94 A;  5CAB A;  3UQS A;  1SL1 A;  4UZC A;  2QL7 B;  1S9E A;  3K8V A;  3KLG A;  3M30 A;  1NB7 A;  4LF4 J;  3H4B A;  1PAU B;  4WCE Q;  1MML A;  5LSL A;  2QEX S;  1J5E J;  4ZVP B;  3TEG A;  1R43 A;  4WYW A;  3EMT A;  5JVG Q;  3ELH A;  5KOW A;  2Z4P A;  4EK2 A;  1SJ4 P;  4NPO A;  7FDR A;  3DRY A;  3SMZ A;  5L39 A;  2F9D A;  2UXC J;  3NMA A;  1WEY A;  1X0P A;  1LEO A;  4WPA A;  4DL5 A;  3X3U A;  2OLW A;  2EBG A;  2HS4 A;  3A8I A;  3MM6 B;  3G6Y A;  3P96 A;  5ETN A;  1NEE A;  2EC0 A;  1ELO A;  2JL9 A;  3D0G E;  2DNG A;  1DQ9 A;  2HRT A;  2G2Z A;  2KYZ A;  3W5Y A;  2ZHO A;  5D0R A;  3B54 A;  5C2C A;  5AJ3 F;  3SQG A;  2UXB F;  4USJ C;  3VF0 B;  2W8K A;  2WTF A;  5B0B A;  2A6M A;  3MI7 X;  4Q5V A;  2KZM A;  4QYR A;  1NK8 A;  2QC3 A;  4IKA A;  2GIQ A;  1NPR A;  3I4H X;  5L1J A;  1ZA2 B;  1DRZ A;  2E29 A;  4PG7 A;  2OEK A;  5ETS A;  4M5L A;  1NDP A;  2C3M A;  1P1L A;  4ES1 A;  5B09 A;  4QW8 A;  4UST A;  3DU5 A;  3TJ9 A;  4WU3 A;  4FYV B;  3NS6 A;  4YB6 A;  1R7I A;  5AXM A;  2MKC A;  4K2X A;  5E5N A;  5LSR A;  2OD6 A;  1T9V A;  3PRV A;  3D1H A;  1P1T A;  4ED6 A;  5H9F K;  2K7J A;  4ERD A;  4NXN F;  1RT6 A;  1ZZF A;  4B9L A;  5H9E K;  2U1A A;  3DKD A;  3EVM A;  5D0H A;  3RRG A;  1NSA A;  2WVB A;  3D66 A;  2ZBC A;  4EI2 A;  3A1Y G;  2C2E A;  4K4S A;  2C2Z B;  2E1M C;  1U1P A;  4FF3 A;  1U47 A;  4DCP B;  3JSY A;  2GO9 A;  2MGZ A;  2KT2 A;  2EFG A;  2R7U A;  4ZIT A;  5I3U A;  1RTD A;  3CGI A;  4UW2 A;  4WFY A;  1WEL A;  3DRX A;  3N6L A;  2MKK A;  3PVX A;  2FJX A;  1S4F A;  2H54 B;  3TAM B;  8AT1 B;  4QIG A;  3DM2 A;  1SVD A;  3NY0 A;  4J9S A;  1QY7 A;  1RTH B;  1SV5 B;  4B3O B;  2FHJ D;  2HVI A;  5MAO A;  2QA1 A;  2DR7 A;  3B6B A;  1NK9 A;  3QGG A;  3NXZ A;  4CH7 A;  2GHP A;  4OYP A;  3P3D A;  1RHQ B;  2J76 E;  1HHQ A;  2PI5 A;  2XEX A;  4KHM A;  1DLO B;  4M95 A;  3DDK A;  1D8Z A;  4OJG A;  2HLU A;  3CUN A;  3GFX A;  4DX6 A;  2H65 B;  4ZPA A;  4ZPC A;  3ZNU A;  4RUA A;  4ID5 B;  2RUS A;  2OMO A;  4CO4 A;  3LGN A;  1FEH A;  1D09 B;  4TY9 A;  3MAH A;  2APO A;  2Z2M A;  2UUC J;  5IT9 Y;  1Y4Z B;  1AB8 A;  4RPF A;  2Y1J A;  1U02 A;  4KGV B;  2BM1 A;  3MR5 A;  4X4V A;  5IT0 A;  4FVC A;  1DQA A;  3O1L A;  1UWB A;  4I7F A;  4JOU A;  1FXD A;  1ZH5 A;  3R9L A;  3LQV A;  1WC5 A;  2M7S A;  2I5J A;  2GNK A;  5J2Q B;  2JEF A;  4LBP A;  2MQN A;  2R42 A;  2VPY B;  3C6T B;  5KG1 A;  3IMQ J;  2X3D A;  1VRQ C;  1M5K C;  2LQB A;  4F2R A;  1Y5L B;  1RI7 A;  2HVH A;  2G0C A;  1LWC B;  2HIY A;  2B0G A;  2F7V A;  2V9W A;  2IC3 A;  3HMJ G;  3BZQ A;  4L75 A;  3OVB A;  1FRX A;  2RH3 A;  2LEP A;  5HJY A;  1H3D A;  3RB0 A;  1HQU A;  2JZ5 A;  4CO2 A;  4DPU A;  5F8H A;  1KS2 A;  4RKU C;  2ALZ A;  1YRX A;  4I4B A;  1VQ7 S;  2DNM A;  2MXY A;  4X66 J;  4J9P A;  1AZS B;  4PWU A;  1LV5 A;  2H4W B;  2EFQ A;  4MFB B;  5IT4 A;  4QQB A;  5GAH U;  2IJR A;  2JC0 A;  2IA0 A;  1N36 J;  5D3G B;  2ZE2 B;  5B08 A;  2XZT B;  3MMC A;  1B3T A;  4QIW D;  1ZAW A;  3UVJ B;  1X9W A;  2W7P A;  1K73 T;  1UA0 A;  3VHQ A;  1TEL A;  1X5S A;  4KTQ A;  3EYZ A;  3I5A A;  1RBO B;  1RAJ A;  3D5M A;  4NEY A;  3BJY A;  3KK1 B;  5C42 B;  1ZM3 A;  2NCK L;  3G87 A;  1RT2 B;  4QIV A;  2C42 A;  3C46 A;  2PEB A;  3FRZ A;  1IBM J;  1UVK A;  3MCN A;  3MEE A;  3OLA A;  2HND B;  2CQ1 A;  1L3T A;  1TUV A;  1X4E A;  3PYD A;  5DJB A;  4R0E A;  3W65 A;  2Y0S D;  1UW9 A;  2C28 A;  2HBQ B;  2FJB B;  2YNH A;  3VAH A;  1HWK A;  1NXI A;  3MFI A;  3CCQ S;  1NZA A;  4ZN1 A;  2CQ4 A;  2I38 A;  4Q7A A;  1U0S A;  4JI8 F;  4CLP A;  3VTI A;  1B4S A;  3OQ2 A;  2MKI A;  1CC7 A;  4Z7Y A;  2FC9 A;  5EHH A;  4QZV B;  5DZ7 A;  3KLI B;  3V2U C;  2B4O A;  3G71 S;  4U8V A;  4MKY A;  4J9N A;  2GW8 A;  4DR7 J;  4OMF G;  3CJ3 A;  3Q22 A;  3EXC X;  2ZHA A;  4OX9 J;  4NLW A;  4DV2 F;  4NA1 A;  4U6P A;  2PO4 A;  1S6U A;  3EVO A;  2KXF A;  3AD8 C;  2H5I B;  5HK4 A;  3POT A;  2VQE F;  2AZ3 A;  1X7V A;  1E6V B;  5G4D A;  1GMW D;  4Z7C A;  5F3T A;  2ZM6 J;  1Y3K A;  2HGN A;  1PJ5 A;  4K4X A;  1S97 A;  1X0F A;  2AQ4 A;  3J7A 1;  3QT5 A;  3NNA A;  5LXR A;  1U0H B;  1VHI A;  1C1B B;  3LH2 S;  2R2U A;  3CCE S;  1SJ3 P;  2HSE B;  4ANE A;  5KT7 A;  2J0X A;  4FYW B;  1UAW A;  3NGK A;  1HWJ A;  4QWD A;  4ZVG A;  2XNR A;  4YHH J;  3MFH A;  2JNJ A;  2DNY A;  2ZH5 A;  4JI3 J;  4XPC A;  2OPP B;  3KHL A;  4CP5 A;  3M6V A;  2WBM A;  1MRO A;  1FRK A;  2DR6 A;  1F60 B;  1U49 A;  1S7H A;  2HKE A;  2CDQ A;  2C1E B;  4DR2 J;  2A0F B;  1WI6 A;  4ZVS B;  2KXH A;  1FKP B;  1TKT B;  3RBD A;  3OL6 A;  2IAJ A;  2RF2 A;  5D0G A;  3GYN A;  4ED2 A;  3OFE A;  4RW9 A;  3HHK A;  1CSJ A;  2YKM A;  1WKJ A;  1X4H A;  2OKQ A;  2D69 A;  2GVZ A;  1NKB A;  4H4K A;  1RCX B;  2ZH3 A;  3QJJ A;  3PTW A;  4CM0 A;  5F8M A;  1OO0 B;  4O0N A;  1CJU B;  2IDL A;  3HK2 A;  2B4V A;  2GAG C;  2I1R A;  2L48 A;  1FDA A;  4C8K A;  5ETT A;  1VRT A;  2QMX A;  3BDE A;  1IM4 A;  3E51 A;  1HR0 J;  3CJ5 A;  4FN5 A;  4YR2 A;  4CM2 A;  3ZZZ A;  5HLF A;  4ECX A;  2A10 A;  4H4M A;  3SQO P;  2KFN A;  4CWB A;  3D54 A;  4YUD A;  2O66 A;  3UN5 A;  1EET A;  4ZS6 A;  3PIP Q;  1N34 J;  2V50 A;  5F9N A;  2VFT A;  4Y2C A;  4Y6I A;  2NUU G;  1K9M T;  5DDR C;  2D7S A;  3QJP A;  1RYS A;  2XHW A;  2BAN A;  2DGT A;  3WC0 A;  2DNP A;  2CPJ A;  5K8O A;  3HSZ A;  2ZWO A;  1S57 A;  2XYH B;  5ETR A;  1JX4 A;  4P52 A;  3FBE A;  2DNR A;  5E7O B;  1DFD A;  5KFE A;  4DN0 A;  3K5N A;  5HRO B;  3EZ5 A;  4IOA Q;  3JYT A;  3H0P A;  1IWG A;  3OFF A;  2Q6C A;  4DS5 A;  1JB0 C;  3CB4 A;  4BC9 A;  3M6U A;  3FEX B;  2W9C A;  3PHE A;  5KG6 A;  4OJ3 A;  5FDL A;  3J81 U;  2QLJ B;  3HVR A;  2LXI A;  4JV5 F;  2KTQ A;  1YRT A;  4PR6 A;  2H1Y A;  5ITH A;  3OTB A;  1NUE A;  5D8H B;  1DZ5 A;  1U1K A;  4RW6 A;  4DPY A;  5HL7 Q;  5B7W A;  2DPI A;  1S1T B;  2PE8 A;  4DV1 J;  3BQ1 A;  3UWT A;  2VH7 A;  1BY9 A;  4DJB A;  4LBH A;  2YKP A;  3KJV B;  2XZD B;  3CCM S;  1URN A;  2RKI A;  2MKJ A;  3UR0 A;  4U7U K;  2EVZ A;  3G9C A;  3GWC A;  3AJD A;  4QIF A;  3OFH A;  1IR2 A;  4RLE A;  2V6A A;  3DDI A;  3HHD A;  2AJQ A;  3MMB B;  2BV3 A;  5K14 A;  3U02 A;  2GVD B;  2HK2 A;  4WXW A;  3MM8 B;  4BS2 A;  3OFG A;  4QWB A;  3ITH A;  3HVW A;  4I2Q B;  3M4X A;  4X4R A;  3A4T A;  2AGP A;  1H38 A;  5IV3 A;  3BB5 A;  1HWU A;  3RZA A;  4ZHR B;  3M8P A;  2GMH A;  1G1X A;  2ZH1 A;  2WZ1 A;  4PXD A;  4DR4 F;  3PM9 A;  1SIZ A;  5LJ5 Y;  2DPJ A;  3B8H A;  2C2N A;  3OUY B;  4KPC A;  3CJ0 A;  2DXE A;  1VC6 A;  2VFU A;  3MEK A;  5DGB A;  1KWM A;  1IKY A;  2DHX A;  4F04 B;  3DLH A;  1VQ4 S;  2VG6 A;  1ZET A;  5IC6 B;  3BKF A;  2NR0 A;  3DRR A;  2PD1 A;  4OLP A;  2J9D A;  4QWA A;  5KT6 A;  4PPD A;  2QFI A;  2YKO A;  3BDP A;  1NZ8 A;  2QA4 S;  4I2P A;  4B3S F;  3RBE A;  4J9K A;  4JI2 J;  3MM5 A;  3QSI A;  2V2K A;  1VMB A;  2C2M B;  3LF0 A;  2ZBR A;  1VRU B;  2ZH8 A;  2HS3 A;  1W25 A;  4JV0 A;  4CCH A;  3IWX A;  2H5J B;  1SJF A;  3R5J B;  1XQI A;  1RCO B;  2VG7 B;  2WSE C;  2DGQ A;  3HFK A;  4O44 A;  3PX0 A;  1WOR A;  4DL4 A;  1XEZ A;  1CJV A;  2AJ0 A;  2QFJ A;  1RT4 B;  2CPZ A;  4GVB B;  1FRI A;  2YWE A;  2ACM A;  1S1W A;  3CJ4 A;  1RZM A;  3U1N A;  1UPP A;  2BUN A;  1RWM B;  2VC0 A;  1T03 B;  3O2I A;  3U27 A;  3I87 A;  4C97 A;  1FXR A;  4JP8 A;  2UP1 A;  2E9T A;  1BUX A;  1GH8 A;  1NPK A;  1IKW B;  3C6U B;  1K0V A;  1R8H A;  1CQM A;  1IBL F;  4PAB A;  4AL6 A;  1LFW A;  3E3X A;  2CJY B;  1FO1 A;  4YB7 A;  1D0E A;  1QAJ A;  4F0M A;  4TXS A;  3RB4 A;  2HEK A;  2E1R A;  4QR1 A;  2ABY A;  4NYP A;  2G4B A;  2RJZ A;  1HBN A;  4O3P A;  3U1M A;  1FHT A;  1KVI A;  2O5D A;  4Y3C A;  1GXT A;  3WHI A;  1SKU B;  2RU9 A;  2BQU A;  3VAF A;  2G0I A;  2OSQ A;  3Q8Q B;  2HHU A;  2HGL A;  2AYG A;  5J2N A;  4P9S A;  2OPS A;  1TL1 B;  2HMI B;  1E6Y B;  1I94 F;  1EAR A;  1JIH A;  3QO9 B;  1IXK A;  4WFZ A;  1Q8B A;  3N6N A;  3EVW A;  3PO5 A;  2C22 A;  3WQP A;  1BQM A;  3I0R B;  4UOH A;  3H42 A;  1S6Q B;  2AF6 A;  3MAA A;  4C9D A;  3CD5 A;  2WSC C;  1RAF B;  2HFS A;  5ETK A;  2BEF A;  3OV7 A;  1OY9 A;  2BMB A;  1DAX A;  3DLL Q;  1NBE B;  2HFN A;  4WYL A;  2FLL A;  4DSJ A;  4OFZ A;  4KHP J;  1SBR A;  1F9E B;  1V6H A;  5FLX U;  3M8R A;  2FTR A;  1TTH B;  1JLC B;  3R6L B;  3WZ0 A;  2XMT A;  2RT3 A;  2GAH C;  3CDB A;  4LQ9 A;  1JXE A;  3PXG a;  2I0X A;  4LBI A;  4U67 Q;  3GJT B;  4CDI A;  1VLO A;  3F73 A;  2CQG A;  1HKA A;  2W2N P;  5KTQ A;  2AJF E;  4OHY A;  3BN4 A;  1B0P A;  4MKA A;  4MK9 A;  4J9O A;  2HFO A;  1FWK A;  4DN9 A;  1YJ9 S;  3KLH B;  2DGO A;  1NK4 A;  3T1H F;  2UUT A;  1T3N A;  4HH0 A;  4WK1 A;  5KFZ A;  3UDV A;  1RGV A;  3P4U B;  4RUC A;  3VVU A;  4C8L A;  2W7A A;  2HBZ B;  4YN3 B;  4ZIW A;  1RT5 A;  4OZ3 A;  1UVI A;  1HQE A;  2IYI A;  4ED7 A;  1QVG R;  4DX5 A;  1FRM A;  1FK9 B;  2W24 A;  1FFW B;  3BGL A;  5B0A A;  1X5T A;  1S49 A;  3J7Y U;  3CJS A;  3FBB A;  4YY3 F;  3AOA A;  2OEM A;  4P2M A;  2QLW A;  3EUN A;  2R7R A;  3NEK A;  1X9M A;  1VBY A;  3R1L A;  3R7N B;  3DLE A;  1CUL B;  2HGM A;  3D2W A;  4LRC A;  3MR7 A;  4OZ1 A;  3KNA A;  1VC5 A;  4FNH A;  3PHT A;  1WC1 A;  3CVK A;  4O0I A;  2XI3 A;  4OJH A;  2GML A;  3A13 A;  1R6V A;  2ZJQ Q;  1HYS B;  1Z2L A;  4ZDN A;  2IVY A;  4PQU A;  3TAP A;  1AT1 B;  2XZW A;  1NKC A;  2ZDO A;  2DEJ A;  4DUZ J;  2RE1 A;  1TV6 B;  2BRK A;  1YG0 A;  3HSD A;  3HD2 A;  5LOQ A;  4PXE A;  3RAM A;  3DN9 A;  4RBT A;  4RNF A;  2CZ4 A;  4I6A A;  3MPV A;  3SZ2 A;  4UF4 A;  2CQ3 A;  3OL9 A;  1LWE A;  4PKD B;  2HHT A;  2ZJP Q;  5F0U A;  1U2C A;  1NH7 A;  5HBM A;  2UV8 A;  4LF6 F;  2WK4 A;  3CJT A;  4Z37 A;  3NS5 A;  3FK4 A;  4F26 A;  2ZH9 A;  4V19 J;  1RAB B;  1SKR A;  3TZW A;  2W4C A;  5LXY A;  2RQ4 A;  1HHS A;  2Z8Q A;  1RHM B;  1JK9 B;  1SUQ A;  3MM9 B;  5LMU J;  4JBC A;  1RWU A;  3BGR B;  4M5D A;  4IFV A;  1WOP A;  3QZ7 A;  1CPZ A;  1HA1 A;  4DDF A;  2ILZ A;  4KSE B;  5IV4 A;  1U26 A;  2YY3 A;  1I51 B;  4DG1 A;  1ZA1 B;  3KLE A;  1D9A A;  4PWW A;  5KG2 A;  1QVF R;  5DLG A;  5A8K A;  4IRK A;  2F63 A;  4ZVF A;  4M1K A;  4QR0 A;  3ENQ A;  4JI7 J;  2IY5 B;  3NGT A;  3PZP A;  2DRA A;  5CYM B;  2X51 A;  1GEH A;  4ZKA A;  2GV1 A;  3K7R A;  1X31 C;  6AT1 B;  4XO0 A;  1IR1 A;  4PXB A;  4LJM A;  2XUL A;  5B0F A;  2G2O A;  3BR8 A;  2F4F A;  1JLG A;  4ZLP A;  3A8J A;  5E33 A;  1N5T A;  3IR6 B;  3PW7 A;  3QBC A;  2HLT A;  1RSC A;  4HTJ A;  2NXJ A;  4G1Q A;  3L95 X;  2XGP A;  2E66 A;  1FJE B;  2BR0 A;  4B9T A;  4U96 A;  1FNO A;  3HHL A;  3MUV P;  1RP5 A;  4OI3 A;  5KT3 A;  4IR9 A;  2GJF A;  5C25 B;  3W9H A;  1NSK L;  4K59 A;  4N47 A;  5A2Q U;  4OV1 A;  4KO0 A;  4BDP A;  1BQX A;  3UN2 A;  1S48 A;  3KHR A;  3L9Z A;  5KFH A;  4AFF A;  1VIS A;  4JI1 J;  4J9L A;  1YI2 S;  3LP2 A;  1R0B G;  5D6G A;  4PG4 A;  2XLJ A;  3ETO A;  1FKA F;  4GMK A;  4PWD A;  2M3D A;  3PCO B;  5HP1 B;  4FBT A;  1TAQ A;  1N88 A;  1UA1 A;  3OVA A;  2CFX A;  1XIQ A;  4ITS A;  3MM6 A;  1ZBT A;  3G6E S;  3TP2 A;  5HO4 A;  2H4Y B;  4MIA A;  4FPR A;  4DV4 F;  4N56 A;  4CLZ A;  1KBR A;  1CJK B;  2PA8 D;  1RWK B;  3T9N A;  1FI4 A;  3AHP A;  2QT7 A;  1Q5Y A;  4ED5 A;  4WE1 B;  1QTN B;  1FJG F;  1YDL A;  1NM2 A;  5LMN J;  4H4O B;  1R89 A;  1WD6 A;  4HH1 A;  4DR5 J;  1NHV A;  2VAS A;  4Q2M A;  2QTW A;  4HDG A;  2H51 B;  2AZ1 A;  4B3T J;  1HNZ J;  3HT0 A;  1ITP A;  3R97 A;  5CHC B;  3UI3 A;  4H4K C;  2ALY B;  3HZG A;  3MOZ A;  1TZ0 A;  2F8E X;  2L08 A;  2MLZ A;  3GV5 B;  3IAS 9;  4J5O A;  3VGU A;  1RQ0 A;  3HF5 A;  3Q83 A;  3KK3 B;  4NOH A;  1RAH B;  1LW2 B;  1LKZ A;  2HVD A;  2HHV A;  3PRD A;  1ICE B;  4C0H A;  4MJK A;  2VPX B;  1WC0 A;  2CUY A;  3I5C A;  3ISN C;  2DT9 A;  3PV8 A;  4P6Q A;  3ONQ A;  4OI0 A;  3C15 B;  4BWM A;  5J2M B;  4YFU A;  1K47 A;  3GSI A;  4KKO A;  3RBZ A;  1ZTT A;  2W2P P;  2BVZ A;  1K1Q A;  3MUT P;  3ADA C;  4RNH A;  2KZZ A;  4S0M A;  1N33 J;  4RUH A;  3IC1 A;  3SI8 A;  1X4G A;  2F9J A;  3TAM A;  2NSB A;  2FVS A;  2XMV A;  3UR3 C;  1WDT A;  2CQ0 A;  5I42 A;  1RTH A;  2NLW A;  3TWZ A;  3JAM U;  3BYR A;  4B3O A;  3VAL A;  2YQ0 A;  4Y34 A;  3QAE A;  4BLG A;  3TA1 A;  3BRE A;  2M2B A;  2AGO A;  1H7W A;  2N4D A;  4WIQ A;  5EWE A;  2YKQ A;  1HBU B;  4JV2 A;  2YWH A;  2GO8 A;  1RUS A;  1VQO S;  3ZZY A;  3LAN A;  1H72 C;  4ZLL A;  2YH0 A;  1NK0 A;  4ZPW R;  4ECU A;  2DR9 A;  1RKI A;  4G1P A;  1RAC B;  1R8A A;  3D28 A;  3OR2 B;  1N5S A;  1HNZ F;  4DL6 A;  4IQX A;  2IJN A;  2BAB A;  4IFY A;  2LQJ A;  2HBY B;  2YWG A;  4N8N A;  3R27 A;  1TKZ A;  1TR0 A;  4LR7 A;  1DY3 A;  3T3F A;  2UU9 J;  2B51 A;  2MHN A;  1XBW A;  3HI9 A;  3ZTP A;  3M8Z A;  1H98 A;  4A47 A;  5GVQ A;  1FTR A;  1HW8 A;  2V8P A;  2CAJ A;  1EKS A;  3MR3 A;  1RAG B;  2HYI B;  2M8D B;  5KFP A;  1N32 F;  4Q2L A;  1PSD A;  2VC1 A;  4LFA F;  2Q79 A;  5K9F A;  4ZPB A;  1UMJ A;  5G0R A;  1WEX A;  1Q86 T;  5J2Q A;  1IKV A;  3H20 A;  4OYO A;  5E3P A;  3C6T A;  4KPY A;  3GG0 A;  2LQ8 A;  2R2R A;  1G2E A;  4BWJ A;  1EQM A;  3O44 A;  1UVN A;  2JC1 A;  1RTJ A;  2EK6 A;  1U1L A;  2MQL A;  4ECQ A;  2UVV A;  3H5Y A;  2QYC A;  3R1H A;  2CQI A;  3WX8 A;  3E8O A;  4E8U A;  1YSJ A;  4QYZ J;  1ZYQ A;  1DTT B;  1H73 A;  5F0W A;  3IM8 A;  4CTA B;  4DFP A;  1RTZ A;  3CJ8 A;  1NKE A;  4DV6 J;  4HEA 9;  3BPD A;  4QWC A;  2DNQ A;  1RA6 A;  3CWJ A;  3NGU A;  3QID A;  2GFF A;  2V5H G;  2B9W A;  1JLB B;  1XN9 A;  4X4U A;  2OI2 A;  3BBF A;  3LO3 A;  3G4S S;  5D3G A;  3M6W A;  4AUK A;  1S1X B;  4CYU B;  2COL A;  4GC7 A;  1PIE A;  1PIL A;  4KBI A;  3UVJ A;  4K4V A;  3BBB A;  4ZVE A;  3LGH A;  3FCV A;  2CWX A;  5C42 A;  1QJH A;  4NLG A;  2NYH A;  2ZH2 A;  3RJM B;  4F25 A;  1Z2Z A;  3PKY A;  1VCT A;  2IMW P;  2ATL A;  4NLS A;  4Q8F A;  3THT A;  1EP4 A;  3GIR A;  1N5Y B;  3HFV A;  1UEU A;  3DLB A;  2IRU A;  3FSY A;  2BOP A;  2W4D A;  2FYX A;  2HND A;  2R3V A;  4DSK A;  5F8J A;  2JLE A;  4RWX A;  1QSL A;  2JRS A;  4JI6 F;  3NOC A;  4OI4 A;  3ZZO A;  2XNQ A;  1S77 D;  3J81 j;  1UTA A;  1VJW A;  4M5N A;  3M9O B;  3HKW A;  3TX0 A;  3H59 A;  3Q23 A;  1RAD B;  2R8J A;  4X4Q A;  3EXY A;  2FLN A;  3LWM A;  2BE2 B;  4DV3 F;  1OSC A;  3EWG A;  3CC2 S;  2DB1 A;  4LFC J;  5IXU A;  3DCA A;  2R7W A;  2R8K A;  5KG4 A;  2A1B A;  3PFE A;  3ZXW A;  5CCL A;  1DTQ B;  4CQ1 A;  1L3K A;  5E41 A;  5M2U A;  1BC6 A;  1GX5 A;  2FY8 A;  4ZJL A;  3M2U B;  3MEC B;  2C3U A;  3RAQ A;  4FYX B;  4QJV A;  4ECZ A;  1M5H A;  4NML A;  1R0A A;  1VJQ A;  2B6A B;  1S6O A;  3QZ8 A;  2LU1 A;  3J7A N;  3PEJ A;  1SH2 A;  4KAI A;  2HHS A;  1F5B A;  7FD1 A;  4QR2 A;  3B78 A;  5B0E A;  2EG1 A;  3DOM A;  4L76 A;  3V5R A;  3G96 A;  1F0X A;  4OL8 A;  1PKU A;  3SBM A;  3IR5 B;  1YK9 A;  3VWS A;  2CRL A;  3Q24 A;  3MD1 A;  3SV3 A;  4XAK A;  4G6V B;  4O4G B;  1E6V A;  4TU8 A;  2M0G B;  3KXD A;  1GXU A;  1U7L A;  3NBP A;  4NAS A;  2P6T A;  3VQS A;  1GX6 A;  4DV0 F;  1T9X A;  4F4W A;  1YJV A;  3DLK B;  4LF7 J;  3M9N B;  3M8W A;  1S99 A;  3DMJ A;  1LQ9 A;  2F40 A;  4O4R A;  3W5Z A;  1U0H A;  3AJ2 A;  3A8E A;  1VK8 A;  1C1B A;  3D4J A;  5E3R A;  4DV5 F;  3V6J A;  5IM0 B;  3UDC A;  4M63 A;  1LW0 B;  5L9N A;  4Y28 C;  2ZKU A;  2WCX A;  2CQC A;  5HI7 A;  1HMV B;  1TKD A;  3H5X A;  2OPP A;  2EFO A;  4B3M J;  4D3H A;  4KRW A;  4J9V A;  1EKR A;  5KFJ A;  2EEY A;  1ZTW A;  4JI5 F;  3LP0 A;  1IBK F;  1MU2 B;  1FNX H;  4WFA Q;  4HL9 A;  1TKT A;  2ROP A;  1M1H A;  4ZCI A;  2W9A A;  3N0V A;  2R8H A;  3IFE A;  2EK1 A;  4DR3 F;  1S10 A;  5FJ4 A;  4WFX A;  4WP3 A;  1UFK A;  3M2V B;  1WC4 A;  4DCJ B;  3O3L A;  4I1T A;  1N54 B;  2E5L J;  5CYQ B;  2XWY A;  3QIP B;  3ZZ0 A;  4I6Y A;  1Z1Z A;  3K5M A;  4DV7 J;  2HQD A;  3LW5 C;  3TQ1 A;  1BXN A;  3V6D B;  3FZB A;  1UZH A;  1BMQ B;  2ZOM A;  3KUH A;  1XMO F;  1M90 T;  3RB6 A;  2NUH A;  5I4M A;  3CC7 S;  4X64 J;  3SCI E;  4A48 A;  2G9O A;  2GQ2 A;  3WC2 A;  2V9K A;  1CS4 B;  5T41 A;  2J9E A;  2MZT A;  5JXS A;  1C0T B;  2VHG A;  3SEO A;  1F3V A;  1QUV A;  4ZA1 A;  2J8S A;  2AYB A;  4QCL A;  4MYU A;  2BKP A;  1HHT P;  5I3P A;  2PMZ D;  3KLV A;  2GHV C;  4MT1 A;  2KKH A;  2PT0 A;  3AD7 C;  2RIL A;  3BO4 A;  2D41 A;  1S0N A;  4ZMM A;  5KFO A;  2D3O 1;  2VJU A;  5HN0 A;  2FJA B;  2RML A;  1VQY A;  4B17 A;  2OPR A;  5ADZ A;  3I9Z A;  4LVO P;  2P8I A;  4JI4 J;  3V6K A;  1XMQ J;  4ZVU B;  4C3L A;  4A8K A;  1BHN A;  3L7U A;  4LF5 J;  5FD1 A;  3I0S A;  2YNF A;  4KGK A;  1S9E B;  1OY6 A;  4LRD A;  4DZD A;  2ZIT A;  2V94 A;  2XO7 A;  2HZC A;  2ZUG A;  4RBU A;  1VQM S;  2HFZ A;  1U2F A;  2AJ4 A;  2R2T A;  4RU2 A;  2V8G A;  2V2Q A;  5IFM A;  3MCM A;  1FD2 A;  3DLJ A;  2V63 A;  4QBU A;  5CD4 A;  3PNI A;  2V69 A;  3AQP A;  1PJ7 A;  1RKJ A;  4RNO A;  1SQF A;  3LWL A;  3LGM A;  2GGP B;  3ZTS A;  2E7W A;  3GFZ A;  3NMR A;  4OZL A;  4CLY A;  1TP7 A;  3KJV A;  1YBT A;  4FS2 A;  2DIT A;  2QLX A;  3TYT A;  3DC2 A;  1IWA A;  2LLZ A;  3T6B A;  5IWA F;  5BYR A;  3MMB A;  5A8W B;  1S0O A;  3LAM A;  3QPI A;  2MJU A;  4OIX A;  3G82 A;  3M8Y A;  3SQG B;  4I2Q A;  3AB4 B;  4NYO A;  5KFD A;  4LR9 A;  3QAU A;  5HAT A;  2JHE A;  2MKY A;  1CC8 A;  4LFB F;  4NCA A;  2W9B A;  3LA0 A;  2K3I A;  2WOM B;  1WHY A;  3EGZ A;  2IPO B;  4YB5 A;  3NKY A;  3DNC A;  4DZ6 A;  4P72 A;  1Y5N B;  1YJW S;  1PAE X;  3D0I E;  2VD3 A;  5J1N A;  4FF2 A;  2E5G A;  2YNG A;  3RW6 A;  4WBF A;  2LDI A;  4C4W A;  4DPW A;  2QSW A;  1F3F A;  3FRY A;  2BYC A;  4UQT A;  2CYY A;  1XNR F;  1S79 A;  3UN3 A;  2KRR A;  3HSJ A;  4TVA B;  2YKA A;  3E01 B;  1B64 A;  1GAO A;  4TNO A;  1IQZ A;  5A6P A;  3TZZ A;  2DNK A;  2W8L A;  2CNL B;  1XNQ F;  3DYA A;  3UO0 A;  3NGD A;  5ETM A;  4E2F B;  3SXL A;  4HKQ A;  2CNO B;  3F56 A;  3CCJ S;  3HPO A;  2QYG A;  1KQF B;  2FPH X;  2MGZ B;  1S4E A;  2VG7 A;  1BQN A;  3LAL A;  1T11 A;  5M2R A;  3W66 A;  1UET A;  1Q7Y T;  1RT4 A;  4HHH A;  3I31 A;  3RRH A;  2CQP A;  3MUM P;  3BGU A;  4OHV A;  3QGP A;  3IG1 A;  1JLF B;  5SUH A;  3C14 B;  2O67 A;  4K5R A;  3OTO F;  3I4P A;  1JLE A;  1M5O C;  4DUT A;  2B4U A;  1VQ8 S;  3WIV A;  3C6U A;  3D1Q A;  4QOT A;  2ZBQ A;  3N6M A;  1HIY A;  4J7C A;  2OIH A;  3OPK A;  2CDR B;  1REG X;  5JVH Q;  4RX6 A;  2QLF B;  1PGZ A;  5HAN A;  2KT3 A;  2MPU A;  2EFV A;  2FVQ A;  5J2P B;  4FS1 A;  1YX2 A;  2KG1 A;  2H48 B;  2VFS A;  4AND A;  4WKY A;  2A2D A;  3EGW B;  3GII A;  2DGV A;  3KJF B;  1JJC B;  2E1A A;  2BE9 B;  3CJK A;  4CRJ A;  2ROG A;  1GTH A;  3VAG A;  2R7T A;  1WAC A;  5HSP A;  3M05 A;  3EGV A;  4P71 A;  1U6Z A;  1DUR A;  4OHZ A;  5KFA A;  3HXM A;  2ZEJ A;  1QTM A;  3W9J A;  4RZR A;  4DSL A;  1MSW D;  2RVJ A;  1Q53 A;  4ZK7 M;  2JLG A;  1X4D A;  1UWB B;  1VOM A;  4OYA A;  1JNR B;  1G6B A;  1TL1 A;  2CG8 A;  2B3T B;  3G2X A;  1QE1 A;  3FC9 A;  4DQP A;  1U6F A;  3N4W A;  3I0R A;  1WC6 A;  2H9Z A;  1Y7P A;  2UXD F;  2OFH X;  1S6Q A;  5KT4 A;  1REV B;  5L46 A;  2I8E A;  4UOG A;  1RT7 A;  2KJW A;  3MCS A;  3W64 A;  1NK7 A;  1FJC A;  1RHR B;  4DR1 F;  5AJ3 J;  1N0U A;  3CXC R;  4TYB A;  2UXB J;  3M8Q B;  4PQA A;  3LUY A;  2IC3 B;  3GIL A;  4IG3 A;  2LDY A;  3BQ2 A;  2IBO A;  2W1B A;  3W7B A;  4P7T A;  4IH6 A;  4L6V 3;  2XC9 A;  2HBR B;  1FKO B;  4OX8 A;  3GJQ B;  1LXJ A;  1XJW B;  4LF1 A;  4OZN A;  3WDO A;  1HD0 A;  1AFJ A;  4UY8 5;  3B4M A;  1Q8I A;  4QYZ K;  4DPO A;  5C24 A;  1TK8 A;  4LSN A;  4AQY F;  3GZ7 A;  1FRL A;  3F44 A;  1QAX A;  1OYE A;  4NXN J;  2Y1L B;  3KLH A;  3HDS A;  2RDI A;  5HMY A;  1BGX T;  3MEG A;  3HO1 A;  2YNI B;  4EYH B;  2KFZ A;  3ENW A;  4MIW A;  1R31 A;  3CIM A;  2DGU A;  4FZV A;  2HQC A;  2VDH A;  1ROF A;  2DK2 A;  1A7G E;  2DO4 A;  1XTZ A;  3IRX A;  4U9R A;  1A6L A;  4ZCM A;  1FK9 A;  3CD7 A;  2AKW B;  1V5V A;  5IQQ A;  1VQ5 S;  4MTP A;  2PN6 A;  2AEJ A;  2C3O A;  1RLC L;  3DU6 A;  1TKX B;  4ELT A;  3S8S A;  1DQ8 A;  3HHE A;  1XK8 A;  1T9U A;  4Y65 A;  3HVT A;  5KFW A;  2R7V A;  2YNH B;  3MPD A;  1Q4R A;  4GKJ F;  1RYR A;  3UDL A;  4I56 A;  2Z2L A;  3BM7 A;  2Y1R I;  2OSR A;  2UUB F;  2NXC A;  3HZE A;  1RWW B;  1JLA A;  4YR3 A;  1NU4 A;  2QG9 B;  2R4F A;  3I55 S;  4OZ2 A;  3NNC A;  4K4W A;  1C4C A;  4JI0 F;  4DPX A;  3OR1 B;  1SH3 A;  1TV6 A;  2YX1 A;  3DLG A;  4QPX A;  5HMZ A;  4DF8 A;  4WFB Q;  4NA2 A;  2CNK B;  1A9N B;  5ETP A;  4DUY F;  2WVC A;  3BYP A;  4USK A;  1ZM4 A;  1T05 A;  1B70 B;  4CO0 A;  5L38 A;  4HYK A;  5KFI A;  4Y2A A;  2J7K A;  4N7T A;  2KH9 A;  5DGA A;  1TK0 A;  2GIF A;  5KFG A;  4RNN A;  2CPI A;  4XDC A;  1SXL A;  2FZG B;  1AYE A;  3CE8 A;  4LVN P;  3D6T B;  3V6H A;  3MMA A;  2CPX A;  2BJ8 A;  4GKK F;  3VR1 A;  1PC4 A;  3ISN D;  1YTY A;  4O3R A;  4DR6 F;  3UPF A;  3VAI A;  4ZVT B;  3M2R A;  4PG5 A;  2Z2Y B;  1P27 B;  2PFF B;  1KEK A;  3KG1 A;  3P49 B;  2N7Y A;  4DSI A;  4NLD A;  2Z58 B;  4IDK B;  1WG5 A;  3WBZ A;  2PSZ A;  4IYQ A;  2CQ2 A;  5E3C A;  1U8W A;  3MD3 A;  2HPU A;  3GR1 A;  1C0U B;  3T5H A;  2RD5 C;  1UEV A;  4GO5 X;  3KG0 A;  3NNH A;  4LR8 A;  2HQF A;  2HWI A;  4C7Q A;  2B8P A;  2IA6 A;  4ETZ A;  2EFP A;  1FE4 A;  5CYM A;  2OTL S;  2XMW A;  1GXL A;  2WRM A;  3JXO A;  1SPB P;  3LPY A;  3L09 A;  3L3C A;  2DNH A;  2RAQ A;  2QO3 A;  2HZV A;  3M32 A;  3MZI A;  2J9C A;  3KG4 A;  2Q66 A;  1SCJ B;  4NCG B;  1C2P A;  3KHG A;  2RIJ A;  3DRP A;  3CJR A;  2EKN A;  1H2U X;  2IAJ B;  3G6V A;  1YIT S;  2RF2 B;  2FVP A;  4RW4 B;  3P8B B;  4DSF A;  3K8W A;  3QRQ A;  3DDN A;  3D1O A;  3MPU B;  1FJ7 A;  2B4P A;  3ZO7 A;  2BJ9 A;  2BJD A;  4NLP A;  1RA7 A;  1ZS6 A;  3MED B;  1VGY A;  1TAU A;  3ZZT A;  2VBY A;  1OJ4 A;  4IH7 A;  3OJS A;  4PEO A;  3QJL A;  5AE1 A;  1Q1K A;  1N4L A;  1SH0 A;  1VRT B;  5HP1 A;  1D9F A;  5DM6 Q;  3QLH B;  2W2Q P;  3ZC4 A;  4CLL A;  4DQR A;  3PAC A;  2KM8 B;  1YZ7 A;  2FHM A;  3BH6 B;  2V4Q A;  5BR8 F;  5HLF B;  4LF9 F;  4H4M B;  3TJ8 A;  1S6P A;  4KFB B;  4K0K F;  1V3R A;  1VHF A;  4Y2M A;  4C8Z A;  2CJK A;  4ECR A;  4F3O A;  3EE3 A;  2ZBI A;  1FDD A;  3S6E A;  4CT8 A;  4JI8 J;  2WB1 D;  2D3O R;  4WE1 A;  4AL5 A;  2VL1 A;  4B9N A;  3MMJ A;  2QA2 A;  2G1H A;  1KHV A;  2BAN B;  4J91 A;  1Q8L A;  2G2Y A;  2ZOG A;  3CJ2 A;  1IJE B;  4PAA A;  3M9M B;  2ADC A;  1J5O A;  3J80 Y;  4NE9 C;  4USH A;  1OIA A;  3HJV A;  2R8G A;  4CLT A;  3MOJ B;  3W2V A;  3CIZ A;  2HQI A;  2HS0 A;  1ARO P;  2V67 A;  1X5O A;  4DV2 J;  2IYG A;  1S59 A;  3KK3 A;  1XWL A;  2AEM A;  3PW4 A;  9RUB A;  5FDL B;  1FES A;  2VQE J;  3DGP A;  1J27 A;  2UUA F;  4NLY A;  1NJW A;  4K4Z A;  2Z0G A;  5B0G A;  1S1V A;  3M1V A;  2VUG A;  5F41 A;  3I56 S;  2FDN A;  4RW6 B;  2CJX B;  2VKR A;  3KNG A;  1KN6 A;  1HNW F;  3TZX A;  2XY6 A;  3FZ2 A;  4RUB A;  1QAY A;  4X65 F;  3KTQ A;  3IBC B;  5AE2 A;  3PYF A;  5ETV A;  2D9O A;  2J0S D;  1VIX A;  3FMB A;  2JEJ A;  5KFB A;  2GC8 A;  3SDE B;  4URS A;  1TMM A;  5D4O A;  3G8Q A;  2AHO B;  2MEW A;  3ITH B;  2D1C A;  1FD8 A;  1EB0 A;  2XMJ A;  1JJ2 R;  2E44 A;  3Q0A A;  3C16 A;  1YJN S;  1M5V C;  4DF4 A;  1C1C B;  1VQS A;  2CIM A;  3IP0 A;  2UV8 G;  4ED1 A;  5SZT A;  4EBD A;  2O01 C;  2HFV A;  4CLF A;  1HI1 A;  1HBU A;  2CWK A;  4X2B A;  2X7I A;  3PY8 A;  2LMI A;  1IVZ A;  4FDF A;  4LRF A;  5HAO A;  2VG6 B;  4C8N A;  5L8R C;  1XR6 A;  3OR2 A;  3TX8 A;  3DRR B;  1TL7 B;  3H4D A;  4ZPV R;  2AP6 A;  3W61 A;  1RT3 A;  3IGV A;  2YKN B;  3TZY A;  4F4Z A;  3FUY A;  3CPW R;  5A6W A;  3TA0 A;  2C2R A;  3CME S;  3J7Y I;  4NI2 A;  4LF8 F;  1U25 A;  4KGM A;  2CPH A;  3R8Y A;  4M5G A;  2HHH F;  3BS9 A;  5BJR A;  3DOK A;  3C3L A;  4TLQ A;  2F4V F;  4R5P B;  2GJ2 A;  1JQG A;  3JSR A;  3JQJ A;  5CXT A;  2KDO A;  3BR9 A;  4EU0 A;  3OTD A;  3RBX A;  4K8R A;  1C4A A;  4O44 B;  1UJ5 A;  4A4J A;  3QQC D;  4Q44 A;  3FMW A;  1BWV A;  3ENV A;  3RYL A;  3QT7 A;  1QAI A;  2X1A A;  5KFK A;  2FZC B;  2XMU A;  1MWQ A;  2ATC B;  2XM3 A;  2Y1I A;  2MZS A;  3HCX A;  2MQQ A;  2UUW A;  1DAR A;  2NS1 B;  3QGI A;  3ILO A;  3V4I A;  3HX9 A;  1DTT A;  4A8X A;  1IKX B;  3EX7 B;  2OAU A;  4ZP9 A;  2Q1L A;  4HHU A;  1RAO A;  8ATC B;  4GVL A;  2YVS A;  2PMW A;  1JLB A;  1SKW A;  4ZOS A;  4JYA J;  1HWI A;  4PUO B;  3BF4 A;  4I67 A;  2VBW A;  5KFV A;  1RU1 A;  4M5M A;  2PFD A;  1BLU A;  3NOG A;  3BKT A;  5CD4 H;  4CIO A;  1L3S A;  3A12 A;  3LP1 A;  4WP9 A;  4JV5 J;  3BN7 A;  1D3W A;  4KH1 B;  4NXM F;  5J2N B;  4U8Y A;  2GS8 A;  5U47 A;  2OPS B;  1SQE A;  3JQK A;  3R5C A;  4NLQ A;  3BV8 A;  4FKX A;  4M8L A;  1SC3 B;  3GPA A;  4AXJ A;  1BQM B;  3DOL A;  2LYV A;  5JUM A;  5E2Q A;  3M6X A;  3KLF B;  1JJ4 A;  4W90 B;  3MAA B;  4KB7 A;  1M1K T;  1NDK A;  3ZZP A;  5D78 A;  2QX0 A;  1PCA A;  2XSJ B;  4UOC A;  2DRB A;  3CCU S;  3FSI A;  2G13 A;  3FFI B;  5F3Z A;  3K57 A;  4J90 A;  2BE2 A;  3CED A;  2QV6 A;  1PC5 A;  2XY7 A;  4DR4 J;  2VFR A;  4RBV A;  2CXE A;  4UTG A;  4ICL A;  4ZP7 A;  4H54 A;  2PEH A;  3KFW X;  4F67 A;  1U45 A;  2VIH A;  2X1B A;  4C0O C;  2DH9 A;  2AT1 B;  4E0D A;  4ETX A;  2NXN A;  3CCR S;  3TR5 A;  2V4R A;  2VBX A;  1RT1 A;  1TFW A;  1QUP A;  3GYX B;  3CD0 A;  3IAM 9;  2V8D A;  2WVE A;  2YQ3 A;  2QL9 B;  5T7L A;  2A18 A;  4B3S J;  2B6A A;  2DY1 A;  3Q86 A;  3PRB A;  4DBQ A;  2NRE A;  2VZ9 A;  1RWP B;  1YJR A;  4I0W A;  1LXN A;  4JYA F;  2XHC A;  2LVW A;  2N7C A;  2VA3 A;  2FJE B;  2UZA A;  1LK5 A;  2HQ3 A;  4MIB A;  1U8S A;  3I5B A;  4NZ0 A;  2VG5 B;  5J1E B;  5KFR A;  4F4A A;  1RT5 B;  1HQE B;  4O4G A;  2I2Y A;  2O1P A;  3UCG A;  4X4T A;  4B9S A;  2ZZT A;  3TVY A;  4CO1 A;  5D4N A;  1UFW A;  2KYX A;  3IS9 A;  3BO2 A;  4KT0 C;  3TAQ A;  1JKH A;  3O6Q A;  4P2F A;  3QYY A;  1B7F A;  3VGS A;  3DLK A;  3D3C J;  4ECW A;  3J7Z T;  4G1I A;  3V81 A;  1NPP A;  2OPQ A;  1A0O B;  3H2L A;  2FQQ B;  1I5O B;  2RRN A;  5IM0 A;  2DVI A;  2XS5 A;  1LW0 A;  5L1L A;  2QIF A;  1AUS L;  1KOO A;  1TL3 A;  1J2V A;  2VV5 A;  1IBL J;  4C6A A;  1TL4 A;  2QMW A;  2GIR A;  2KXN B;  1HMV A;  1CBK A;  3BGO P;  4X62 F;  2DTJ A;  3HHL D;  3AJ1 A;  5EX0 A;  5GAD I;  5A8R B;  2XS2 A;  1RK8 A;  2DHG A;  5DDP C;  1VQ9 S;  3VCD A;  4ILM A;  4B02 A;  2X1G A;  2QZ8 A;  4OHX A;  1MU2 A;  3TEH B;  4ZVH A;  2AV5 A;  1U4B A;  4EWT A;  2E1P A;  2CPY A;  4P74 A;  1D8Y A;  3OL8 A;  1VQ6 S;  5HBM B;  3A3N B;  2DIV A;  3M2V A;  1UVJ A;  1GMV A;  5CYQ A;  3QIP A;  2AMC B;  5HVG A;  1I94 J;  3W5X A;  2KT5 A;  3D9B A;  4QU7 A;  1HNV B;  2BBE A;  3N5F A;  2YQ1 A;  4LRE A;  2FY1 A;  3UD5 A;  1AFI A;  1X8D A;  4P75 A;  2MDA A;  1KFD A;  4ED8 A;  4IFV B;  4B3R F;  1CS4 A;  1HNI B;  2QA4 G;  4LIW A;  3GMG A;  1H7X A;  4DEZ A;  4PXC A;  3KWM A;  4RW8 B;  1Y9O A;  2KJV A;  1U1O A;  3Q8S B;  3KLE B;  2XLI A;  2KN4 A;  2RU3 A;  1O8B A;  1RLD A;  3TNV A;  3SCK E;  3H7H B;  3I6P A;  4Q45 A;  2D74 B;  5K8M A;  3ISZ A;  3TA2 A;  3GE9 A;  2VFV A;  5KFQ A;  1NDC A;  4MYT A;  3RR8 A;  1VIO A;  5C7P A;  1FRJ A;  2MSS A;  4ZP8 A;  2CNN B;  2XI2 A;  3T1A A;  3CO0 P;  1VBZ A;  1RTI A;  2OTJ S;  3KKF A;  2ZZM A;  4NLV A;  3KK2 A;  3FSX A;  3QNW B;  3AFG A;  4IG0 A;  1SC1 B;  4O3O A;  2BKO A;  4OYI A;  1FFG B;  4DFK A;  5LL6 d;  1R8B A;  3FGV A;  4G1Q B;  3LAK A;  3T1H J;  4I69 A;  2FGC A;  1SQG A;  3HFZ B;  4MKB A;  2DIU A;  3HHL B;  1G7C B;  1S1U A;  5KAK A;  2LXF A;  3SFG A;  1B0V A;  3QMQ A;  3EDR B;  3CMQ A;  4KO0 B;  2LA4 A;  2CPE A;  8RUC A;  4IOC Q;  2ROE A;  2PDA A;  1FVQ A;  3JS9 A;  4RNM A;  1N0V C;  2Q43 A;  3LP2 B;  4URG A;  4FF1 A;  4RW7 A;  4K4Y A;  3PKM A;  3CO9 A;  4NLR A;  3D3B J;  4PWD B;  4DL7 A;  2V34 A;  3SFU A;  1N6Q B;  4YY3 J;  1TUW A;  3NG8 A;  3KJN B;  3R2C J;  2GZO A;  3W2W B;  5C2G A;  2V4J B;  2GGP A;  3MCO A;  2B9Y A;  2EG2 A;  1RBL A;  1UL3 A;  4HAC A;  1UJ4 A;  3BEG B;  3Q8P B;  3AD9 C;  2B9E A;  3DI6 A;  1F1B B;  1PBU A;  2RHS B;  1RHJ B;  1HWL A;  3US5 A;  3OL7 A;  2IMO A;  5A8W A;  1Z4U A;  2FVR A;  1Q8K A;  1UEK A;  3MTK A;  4B9U A;  1U1M A;  4ENO A;  1HNX F;  1Y10 A;  3R5B A;  5A76 A;  1FDB A;  4LSL B;  2DIS A;  4XK8 C;  4WXO A;  1F5C A;  1N52 B;  2WOM A;  3GLJ A;  1FE0 A;  3T1Y F;  5EGY A;  1JWW A;  4NRU A;  1WHW A;  4XPE A;  3W9I A;  3THV A;  4LF6 J;  2MHE A;  2OH2 A;  4MK7 A;  1HPZ B;  4OX6 A;  9ATC B;  2DCL A;  3PO4 A;  3SSR A;  1W2I A;  1RHK B;  3TUZ C;  4P10 A;  1HL6 A;  1Q95 G;  1H0H B;  4M5H A;  3THP A;  1S72 S;  2HHW A;  2OEJ A;  4OZJ A;  3VGT A;  4ED4 A;  4DS4 A;  4FYD A;  2JOQ A;  2MQ8 A;  3KMQ A;  4K5S A;  5B0C A;  3E01 A;  2MZJ A;  4LF4 F;  1JLQ A;  4F4Y A;  2DO0 A;  1J5E F;  2CZ9 A;  2E5I A;  2BJ3 A;  4WF9 Q;  4TLR A;  5KT5 A;  2BQR A;  1KQG B;  1KRP A;  3IWN C;  2MY7 A;  4E98 A;  2UXC F;  1NDL A;  2A2C A;  1NME B;  4KKO B;  2CA9 A;  2BE7 D;  3I9V 9;  1R3N A;  4WWS A;  3SSQ A;  4FPI A;  1NSP A;  3A3O B;  1I3O B;  4TN2 A;  1Q16 B;  3OXL A;  1EHW A;  5GME A;  2MY8 A;  1VS3 A;  1UKU A;  1JLF A;  4EYI B;  3C14 A;  2Y0B B;  4IH5 A;  2EXU A;  5I42 B;  1YJ7 A;  2ZNY A;  1N8R T;  4L3K A;  2JFD A;  5GMK a;  1JXV A;  1EZZ B;  1S0V A;  2I9S A;  3W8G A;  2NXE A;  3GIJ A;  2W2M P;  3M7V A;  4K4T A;  1S9F A;  4P73 A;  3TOQ A;  3N5B A;  4A46 A;  2YBV A;  1URR A;  5HMW A;  3W63 A;  5J2P A;  3UNG C;  2BZ2 A;  2LXU A;  1WWH A;  1V9O A;  3AA8 A;  4IFY B;  3MM7 B;  1GT8 A;  4B08 A;  1WKK A;  3TUI C;  4FXD A;  3IA0 A;  1TKZ B;  2J6U A;  1F9H A;  1VQL S;  3EJM A;  1WDD A;  4ILL A;  1WTF A;  2LQ5 A;  2NPI A;  3GCW P;  2DHS A;  4ZLN A;  1P6T A;  3IRW P;  4DLG A;  2XSF A;  2ACY A;  4URQ U;  2HK3 A;  3Q8Y A;  2BKN A;  1TFY A;  5G0R B;  2NZC A;  2YPZ A;  1IKV B;  1KVK A;  5A0Y A;  4DV4 J;  3LTO A;  4J37 A;  1REV A;  2MYF A;  4ELU A;  2B5J A;  2P5V A;  3F41 A;  3JTO A;  1OWX A;  1Q7L B;  3UNY A;  2XQC A;  4RR5 A;  3HHN B;  3OT9 A;  4FBU A;  1FJG J;  1TQL A;  1IN0 A;  3TO8 A;  3M8Q A;  1RTJ B;  2ZFH A;  4FYY B;  2AX1 A;  3FCW A;  5KOX A;  1FKO A;  4DCO B;  3ZZU A;  1NND A;  3VAJ A;  2DGS A;  2BX6 A;  2NSC A;  4DU8 A;  5IQ6 A;  3SSS A;  4MK8 A;  1RXO B;  3UCU P;  3RUB L;  2ZBP A;  2X3G A;  2YWK A;  1G4C A;  1PYT A;  4N5S A;  2XTJ P;  5D4P A;  2JEG A;  1T9T A;  2HNY A;  3A3P B;  5KFY A;  1FRH A;  4TYA A;  2HFU A;  3QRP A;  5IS2 A;  4CLU A;  1RAE B;  4ER8 A;  1YBA A;  2MKS A;  2YNI A;  3TUJ C;  4NX9 A;  4EZ6 A;  4WTO B;  1BD6 A;  3C8Y A;  1V3S A;  2P2C B;  1D9D A;  4F02 A;  5M2P A;  3CNQ P;  2E5J A;  2L3M A;  3AOB A;  1EP4 B;  1ACM B;  3R3T A;  2UUC F;  2ERR A;  3JSM B;  3CD6 S;  3R5G A;  3PG9 A;  2MZQ A;  1WG1 A;  1NH8 A;  5KFS A;  3DHX A;  5BYS A;  1TKX A;  1UVM A;  2KHD A;  4F7V A;  1EX8 A;  4HVZ A;  1YKW A;  1KOH A;  1VQP S;  2V8V A;  2VPZ B;  3UD4 P;  4R8U B;  2YX4 A;  3CTR A;  3ZNJ 1;  5BXI A;  2R7Q A;  1H2V Z;  1GK8 A;  1H74 A;  2N82 B;  1VQN S;  2M9K A;  4USU A;  2J6S A;  3I82 A;  1EJ7 L;  4BCA A;  3RG6 A;  4CNZ A;  2FC8 A;  1L3V A;  4IO1 A;  2DHH A;  1BE4 A;  1B7Y B;  3OR1 A;  1CJT B;  5DRK A;  4RL1 A;  2ZUA A;  2IM1 A;  1YGY A;  3Q2S C;  5KG3 A;  3U1L A;  1XR5 A;  1X9S A;  5CCM A;  1R0A B;  5GAD U;  2W4P A;  4PRF A;  2V0N A;  2ASL A;  4X66 F;  3R5A A;  1KR4 A;  5ETQ A;  2L41 A;  4K50 A;  4CI0 B;  1N36 F;  1N32 J;  4JV1 A;  2A3J A;  1IJF B;  3DOM B;  3T5L A;  3P5T L;  3CCT A;  4LFA J;  3HM9 A;  5L1I A;  4TQS A;  4CLK A;  4L3N A;  5I3Q A;  3QT8 A;  4CZC A;  4RJV A;  2BDP A;  1PYS B;  2G1D A;  5LJ3 Y;  3TW0 A;  1KP6 A;  2OFG X;  2M70 A;  2LP4 A;  4WTY A;  4TY8 B;  2NQP A;  1HBO B;  3MDF A;  4HT7 A;  2CPF A;  3NBP B;  1XMB A;  1OQ6 A;  3TAN A;  3D68 A;  2DXF A;  5LSO A;  1IBM F;  3K89 A;  4OI1 A;  4AE5 A;  3DMJ B;  2YTC A;  3N79 A;  4IDK A;  3HD1 A;  2FJW A;  4C11 B;  4DU7 A;  1CLF A;  3ULH A;  4Q0B B;  4J9U E;  1C0U A;  4YR0 A;  4Y00 A;  4ZP6 A;  4FXW A;  5D15 A;  3GFY A;  3BSC A;  2FJD B;  3QAT A;  4IR1 A;  2QLB B;  1HLW A;  2BOA A;  2RUG A;  2HNZ B;  3HKZ D;  2Y3Y A;  1NJY A;  3T41 A;  1PYO B;  2ZD1 B;  1T94 A;  1SV5 A;  3HUL A;  1KSP A;  2WW4 A;  2ZH4 A;  5DQG A;  1OYD A;  1FTC A;  3LP0 B;  2XMA A;  3JSB A;  4NCG A;  1AXQ A;  4I68 A;  4CH0 S;  4L72 B;  4WFN Q;  3VAM A;  1OS5 A;  1DLO A;  4G3I A;  2QE5 A;  2MJN A;  4IOB A;  3MPY A;  1XER A;  2IFX A;  2CJQ A;  4RW4 A;  5CQG A;  1WSV A;  2K1R B;  1Q79 A;  1YJU A;  4DX7 A;  4F4X A;  1YBU A;  3KOA A;  2HW3 A;  3GTY X;  3FCH A;  3MED A;  4ID5 A;  1UPM B;  2B56 A;  3FBC A;  4O23 A;  1SKS A;  2IBK A;  4EEY A;  1EIY B;  3OSP A;  4DR7 F;  3CT9 A;  1GFW B;  2CJA A;  5HMX A;  2BAC A;  3IO1 A;  2J5A A;  4OX9 F;  5KFC A;  4JI6 J;  3K5P A;  4YP3 A;  3QLH A;  3DRS B;  2RB7 A;  2IM0 A;  4HDH A;  5E0O A;  3MGJ A;  2NXU A;  2XMK A;  2IDE A;  3KUG A;  5IZH A;  4A8M P;  4KFB A;  5EWF A;  1W2B R;  1TL5 A;  4DV3 J;  4R25 A;  5H1S V;  2ZM6 F;  1ZAV A;  3VV2 B;  3P45 B;  2AD9 A;  4U7U D;  2B9X A;  1UWA A;  3T5J A;  1KLM B;  2ASJ A;  1LWC A;  1IR0 A;  3SV4 A;  4EO8 A;  3BSA A;  2DR8 A;  1VBK A;  2HAF A;  1N48 A;  4CO5 A;  5CA5 A;  3C2P A;  2P9E A;  2OPR B;  4A8S A;  4CLS A;  2ZC3 A;  2E7V A;  2R7O A;  4LSZ B;  2B43 A;  3CUL A;  2FIU A;  3HT3 A;  4YHH F;  1RIS A;  3M8S A;  1UZD A;  4JI3 F;  3I0S B;  2YNF B;  3U7J A;  1AZS A;  5LT5 A;  1XR7 A;  3ENA A;  4MFB A;  3RRK A;  5DQI A;  1PBA A;  2JFK A;  1T02 A;  4KHR A;  4Y2K A;  2FHJ A;  2ZE2 A;  1MN9 A;  4DR2 F;  4WU2 A;  2XCA A;  2F3J A;  2BRL A;  1W26 A;  3GG1 A;  2HWT A;  2AX0 A;  4UUX A;  3OD2 A;  3PX4 A;  4PCQ A;  1D1U A;  3JB9 k;  3KK1 A;  1L3U A;  4YME A;  1RT2 A;  4ID8 A;  5HJX A;  4NLT A;  4DV0 J;  5KFF A;  3TI0 A;  3AY0 A;  2VON A;  3BGF A;  4X4S A;  4C8Y A;  5BYQ A;  4PG6 A;  1TVR B;  4DV5 J;  4F36 A;  1N5V A;  3NCP A;  4OYX A;  5MLC V;  3EPG A;  4IRD A;  1KFS A;  1HR0 F;  4C48 A;  3SDE A;  2G0J A;  5HQ8 A;  2QGF B;  4Q43 A;  3G82 B;  4DFJ A;  4Z2X A;  4OI2 A;  3ET6 B;  2WON B;  1RAI B;  2K3K A;  1NLK L;  4OZ0 A;  1C1C A;  4JI5 J;  1IBK J;  3K59 A;  1N34 F;  3L7P A;  5EDW A;  4ZPT R;  4YDX A;  2KU7 A;  3K5O A;  3BSN A;  3EGN A;  2W9B B;  1LFP A;  2R8I A;  2E5H A;  5CYJ A;  4U7C A;  4DR3 J;  1R0C B;  1GQE A;  1JNZ B;  3PYE A;  3HP6 A;  2A6O A;  1MNE A;  2N3L A;  5GAG I;  3KLI A;  4ZCL A;  1TL7 A;  3GFH A;  2YNG B;  2DD8 S;  4FXV A;  4NEZ A;  1APS A;  2QJ3 A;  4YB1 P;  1XMO J;  2OHD A;  1NSQ A;  1MWZ A;  3FEY B;  2YKN A;  2VBZ A;  4JB8 B;  3ILI A;  4QPT A;  1SJQ A;  1HQ2 A;  1VK3 A;  2DYA A;  3DYA B;  1DJ0 A;  1SJ1 A;  1YWX A;  1NRK A;  5CH7 B;  5K8N A;  3H5U A;  3GJS B;  4R5P A;  3NCQ A;  2RS8 A;  3K5L A;  2XYG B;  3HJF A;  1T95 A;  3PW2 A;  2L9W A;  2Y8Y A;  4OZ5 A;  2M88 A;  1BQN B;  1FWP A;  4AD6 A;  2NZ4 A;  1FF2 A;  4NL5 A;  3ZTR A;  4PPZ A;  3FDS A;  4F0H A;  4BBY A;  3O8W A;  4AYB D;  4DV1 F;  4F3M A;  1T8E A;  5AXN A;  4DI6 A;  4OI6 A;  5L9X A;  1DHM A;  2AYE A;  3IG1 B;  5JMN A;  3O5T B;  1QM9 A;  4D3G A;  1M0S A;  4MMO A;  3CSK A;  1S9G B;  1JLE B;  3QT6 A;  1HBM B;  2ZHB A;  1IKX A;  3NS7 B;  1R27 B;  2WB4 A;  3PDN A;  1H2T Z;  3DGV A;  3CDE A;  3N9U C;  4O3N A;  2AJ1 A;  3RGI A;  4PUO A;  1IM6 A;  1EAY C;  2RRA A;  1FKP A;  3DHW C;  3CJK B;  4HTI A;  2ZVS A;  4LT6 A;  4HR2 A;  4NA3 A;  2IVF B;  2ZDP A;  1RE1 B;  4ECV A;  2XCP A;  3H40 A;  4IUF A;  3UFC X;  4UY8 T;  4ALZ A;  1FA0 A;  1SB6 A;  1S76 D;  1IQT A;  3ZZR A;  2BW7 A;  4MAK A;  1F2G A;  1KVJ A;  4NLX A;  3R2D J;  1QE1 B;  1T3O A;  3NRB A;  1CJU A;  2UVR A;  2OP5 A;  4CT9 A;  2EW9 A;  1K8A T;  3KLF A;  4DFM A;  4JI2 F;  1YZ6 A;  4QWE A;  5F8I A;  1Q0N A;  1RT7 B;  4RU9 A;  3GU0 A;  4QU6 A;  3D7S B;  4EGL A;  2E1C A;  4WKR A;  2XSJ A;  3EPI A;  2HUR A;  5IWA J;  3KMS A;  4ED0 A;  3NGS A;  4ELV A;  1LWF B;  1Q81 T;  1X4B A;  3MXH P;  4USW A;  3FFI A;  2PC6 A;  4CH1 A;  4IG3 B;  4JUZ A;  1GMW A;  2IIH A;  3QRR A;  5AXK A;  1V3Z A;  4EZ9 A;  1B99 A;  2J9D E;  4LFB J;  2E9Z A;  2V8H A;  4YDD B;  6FD1 A;  3QFW A;  2HZA A;  3MR6 A;  1FX2 A;  5C24 B;  3FKB A;  4LSN B;  1Q78 A;  1NK5 A;  4TU7 A;  3PW5 A;  4KV8 B;  1KQK A;  1MG7 A;  2UVU A;  5DET A;  4P2S A;  4Q8E A;  7AT1 B;  2JVR A;  1T0T V;  1NHK L;  3KLG B;  3MEG B;  1XNR J;  3M30 B;  3GYG A;  5HRO A;  1EQ0 A;  2HIQ A;  2JEI A;  3CCV S;  4A8Q A;  2KB2 A;  1YLX A;  2N3O A;  1XNQ J;  1I6J A;  4EO6 A;  1R8P A;  1KLN A;  2BJ7 A;  2HWH A;  4NMX A;  1ZZN A;  2CVI A;  4C2M A;  3TRG A;  2VG5 A;  5K20 B;  1NJZ A;  5J1E A;  3IRX B;  1P9Q C;  3C19 A;  1U24 A;  2JDJ A;  2VOO A;  1SIW B;  3H2V E;  2F65 A;  2D3Z A;  2EWH A;  1TU0 B;  5KFL A;  3LPE A;  4DQQ A;  3UDE A;  3OTC A;  2O3D A;  1U48 A;  4OLO A;  1S1T A;  3JQM A;  1AUD A;  3FQK A;  4C8M A;  2ZH7 A;  1WOS A;  2VOD A;  2R7X A;  2CJB A;  3HVT B;  1ZOT A;  2RQM A;  4G65 A;  4LRB A;  4KY3 A;  3OTO J;  5IT9 U;  3X1L B;  2KI2 A;  3I32 A;  1OMS A;  2DGX A;  1Y11 A;  2ASD A;  3NL0 A;  2XO6 A;  1VBX A;  2AU0 A;  1NCL A;  2Z30 B;  3CF5 Q;  4EBC A;  3EDQ B;  1JLA B;  2GVD A;  3E2E A;  3MM8 A;  4KGX B;  4P2X A;  3S01 A;  4DSE A;  2W7O A;  1PJ6 A;  4KR0 B;  5A8R A;  1NJX A;  4KHP F;  1JJH A;  3HVA A;  4OJ1 A;  3ILL A;  4W98 A;  2F8M A;  3BO3 A;  4ZHR A;  3H25 A;  1I1G A;  2Q3P A;  1WI8 A;  2QL5 B;  3DLG B;  4CLW A;  3BH7 B;  4EUV A;  2UVW A;  3OUY A;  3D6F B;  1ZM9 A;  6FDR A;  5FII A;  3MWB A;  3H2U B;  2KVQ E;  5L1K A;  2XG8 A;  1S12 A;  1T05 B;  4ZVR B;  4ECY A;  2DEI A;  3EZU A;  1ULR A;  5IOL A;  2N4C A;  1HI8 A;  5DDQ C;  1TUG B;  5C5J A;  4I64 A;  3J7Z 5;  3QWP A;  3RAX A;  2AW0 A;  1RT6 B;  3MUR P;  1HNV A;  4OYB A;  2XMM A;  3MMA B;  3J80 U;  2UXD J;  4ZN3 A;  2RDJ A;  3D0H E;  4KH0 B;  2M5Y A;  2X1F A;  3MPW A;  3AB2 B;  1U1Q A;  4DR1 J;  1UFL A;  1VRU A;  3M2R B;  1HNI A;  2IM3 A;  1T9Y A;  4LUB A;  4M5J A;  2W25 A;  2FHO B;  4RW8 A;  5KG5 A;  1W7W A;  2IRX A;  2F8H A;  4PYA A;  4AL7 A;  2GQC A;  4KC5 A;  2EC2 A;  3GIK A;  2DNZ A;  4B9V A;  5I3U B;  1RTD B;  2LCW A;  5IC4 B;  3BKU A;  4OHW A;  4GVB A;  3FEZ A;  2BXJ A;  3AXK A;  4FVM A;  4CNY A;  2V68 A;  2XS7 A;  1T03 A;  4C98 A;  3DM2 B;  5DO2 A;  3GP9 A;  2GQQ A;  2DCU B;  1VDH A;  2RQC A;  5E3A A;  2EPI A;  4AQY J;  1IKW A;  3PJX A;  3JTP A;  2DKO B;  2BM0 A;  3M32 B;  2C2D A;  1OPZ A;  4HLB A;  5EUH A;  4NLU A;  3H90 A;  3J81 Y;  2POK A;  3AXM A;  3DRP B;  1T9W A;  1WOO A;  3A8K A;  3AOC A;  3IXQ A;  4XDD A;  2ADB A;  1FCA A;  1YRU A;  3W1Y C;  3BQ0 A;  5F9L A;  4DUZ F;  2OML A;  3FNN A;  1KC8 T;  2ASY A;  3TUP A;  3CC4 S;  1QSS A;  1RWX B;  2QRR A;  2J0Q D;  1UCN A;  1FFS B;  2ZH6 A;  3RB3 A;  1ZM2 A;  1N5Q A;  3GIM A;  3GV7 B;  1N6Q A;  1X60 A;  4I7F B;  5EX3 A;  1WJ9 A;  4AT1 B;  2HMI A;  1E6Y A;  4WZQ A;  3QO9 A;  3EZO A;  3W2W A;  2V4J A;  2GCF A;  2HVZ A;  5DG9 A;  1S6P B;  2I5J B;  3K0J A;  4GKJ J;  3VGV A;  2IHR 1;  1KDN A;  2YX7 A;  1WUU A;  4WK3 A;  5LMU F;  2EI5 A;  3AQO A;  1Y00 A;  2DH7 A;  4I6W A;  3D6M B;  1RHU B;  3I96 A;  2UUB J;  1FNM A;  3CMA S;  1MMN A;  1ZPV A;  3G86 A;  1X4F A;  2FLO A;  2K06 A;  2IVM A;  1QSY A;  2J7W A;  1WKL A;  3GQC A;  4JI0 J;  4U95 A;  3CJQ A;  1JLC A;  2FB0 A;  4M5I A;  1P9Y A;  1HQU B;  3GCX P;  4JI7 F;  1SL2 A;  4LSL A;  4DQS A;  3KYL A;  4KE5 A;  4LF2 A;  4N76 A;  3DXB A;  1J5O B;  4DUY J;  4LQ3 A;  4R0J A;  2VJV A;  4C0B A;  3RW7 A;  4FKY A;  4YS2 A;  3FVY A;  3NWR A;  2LEB A;  3W2V B;  2CJ9 A;  3PFO A;  1HPZ A;  2VIC A;  3IWL A;  4WJB A;  1O5J A;  1SJR A;  4ZPD A;  2FLP A;  2K2P A;  5CZX A;  3QGH A;  2B7B B;  3MMC B;  1B0T A;  4EBE A;  4KIA A;  2W2O P;  2KL8 A;  3HLU A;  4NLO A;  3C66 A;  3IGN A;  3Q8U A;  2Q6B A;  3DGP B;  2KM8 C;  1WEZ A;  4GKK J;  1CEZ A;  3VZI A;  2RDD A;  5D0E A;  3FBF A;  5GAG U;  1RWV B;  1S1V B;  4DR6 J;  3M1V B;  1UW4 A;  4WII A;  3QFH A;  2CPD A;  3JTN A;  1K1S A;  5KFU A;  4JI1 F;  2V2Z A;  4NCB A;  3OXF A;  3R7B B;  1SL0 A;  4PG8 A;  3MEE B;  4F2S A;  4GRS A;  1R6Y A;  2OEL A;  1FX4 A;  1X5P A;  2K8G A;  1MN7 A;  2FD2 A;  2AWZ A;  3ETM A;  1IBC B;  3ICL A;  4OYM A;  4LMZ A;  1XC9 A;  4ED3 A;  4F3Q A;  3T6J A;  1NAQ A;  2K7K A;  1Y3J A;  2FZK B;  4YOE A;  4OV6 A;  3AH6 A;  3S7R A;  2JVO A;  1CUL A;  3OHA A;  4QW9 A;  3T5K A;  3C16 B;  2JX2 A;  2Z2Z A;  4ZLJ A;  3NWG A;  1VR6 A;  1KHW A;  2DJW A;  1FVS A;  5KT2 A;  2HRU A;  2RRB A;  2RQK A;  3ZTO A;  1HYS A;  2CG4 A;  2LEC A;  2DRD A;  5LMN F;  4KJI A;  2R2S A;  5ETL A;  2AIR B;  4L73 A;  4DR5 F;  2XY5 A;  4USV A;  4MH8 A;  2ZWP A;  4B3T F;  2P9C A;  1GMU A;  2LEA A;  2VOP A;  3MM7 A;  3MR2 A;  3D6H B;  4V1A k;  1U1R A;  5AXL A;  2MQP A;  1KQS R;  3L4B C;  3WX4 A;  1VC0 A;  1ZPW X;  1U2R A;  3GON A;  2Y8W A;  3FQL A;  1RT3 B;  1Y0H A;  1UP1 A;  2FUG 9;  3UW1 A;  2JH3 A;  4NWB A;  1FER A;  2KHC A;  4NZ6 A;  3OW2 R;  1O51 A;  4NI2 B;  3PR5 B;  1MLA A;  5K5M A;  3NP5 A;  3DOK B;  5BR8 J;  4LF9 J;  5DQH A;  5FLX Y;  1WC3 A;  2IRY A;  1MWY A;  3POT B;  2GHW A;  2WHO A;  1LWX A;  4K0K J;  3TJA A;  3MM9 A;  2Y9H A;  5F8N A;  4HT5 A;  3EM1 A;  1VI7 A;  3BGR A;  2GX8 A;  4FP9 A;  5RUB A;  2LKZ A;  2OO4 A;  2MLY A;  1RWN B;  4ATN A;  4A8W A;  1CG2 A;  2BJE A;  5KFM A;  2PI4 A;  3RU0 A;  1WF0 A;  4K2J A;  3ZTQ A;  2HHQ A;  3PW0 A;  4ZVQ B;  4ZCK A;  2WVD A;  3V4M A;  1YJT A;  3V4I B;  5JJB A;  1WG4 A;  5DZ6 A;  3IBF B;  2XGQ A;  1F5A A;  3GSD A;  1N33 F;  2XBP A;  3OTE A;  2LQ9 A;  4N41 A;  1OQ3 A;  4XTT A;  5LM7 E;  2DBB A;  4ES3 A;  2PA3 A;  1MRO B;  4J9M A;  4YEA A;  4EFA C;  5THW A;  3BBC A;  2HG4 A;  3MF5 A;  3MAQ A;  1HAR A;  3OSN A;  2L9N A;  1AW0 A;  3LP1 B;  4AXI A;  2UUA J;  5C25 A;  2BW2 A;  4RW9 B;  5GAE I;  1FXL A; 
#chains in the Genus database with same CATH homology
 4DR1 J;  2MTL A;  4K0K J;  1J5E J;  4DUZ J;  4JI8 J;  4JI7 J;  1I94 J;  1HR0 J;  4NEY A;  4KYZ A;  4JYA J;  3T1H J;  4DR4 J;  4YHH J;  3J81 U;  3D3C J;  3IMQ J;  1HNW J;  4JI5 J;  3R2D J;  4JI3 J;  2UXC J;  1IBK J;  4X65 J;  4DR7 J;  1IBM J;  4JI6 J;  4JI4 J;  1XNR J;  4DV6 J;  2VQF J;  2KL8 A;  1XMQ J;  4LF8 J;  4DR3 J;  4JV5 J;  2E5L J;  1HNX J;  4DV4 J;  1N34 J;  4KHP J;  2HHH J;  2MEW A;  2UU9 J;  4OX9 J;  1XNQ J;  4DV1 J;  5FLX U;  1IBL J;  4LF5 J;  4GKK J;  4DR2 J;  2F4V J;  4LFC J;  4DV7 J;  4GKJ J;  4LF6 J;  4JI2 J;  5IWA J;  2KVQ E;  3T1Y J;  4DR6 J;  4B3R J;  5LMN J;  4LF7 J;  4NXN J;  4NXM J;  4DV2 J;  3D3B J;  4DR5 J;  4DV3 J;  4B3S J;  5LM7 E;  4AQY J;  1FJG J;  4V1A k;  4YY3 J;  4DV0 J;  2UUB J;  5A2Q U;  4X64 J;  4B3T J;  1N33 J;  4NEZ A;  1HNZ J;  5LMU J;  4X62 J;  3R2C J;  1XMO J;  4X66 J;  1N32 J;  2ZM6 J;  2UUC J;  4LFA J;  2VQE J;  4DV5 J;  4LFB J;  2MQ8 A;  4JI0 J;  4JI1 J;  4RJV A;  3W1Y C;  3J80 U;  1N36 J;  3JAM U;  2UXD J;  5AJ3 J;  5BR8 J;  4LF9 J;  4PWW A;  4B3M J;  4HHU A;  4KY3 A;  3OTO J;  2UXB J;  2UUA J;  5IT9 U;  4LF4 J;  3J7A N;  4DUY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...