4JV5J

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4jv5J00
4LF5J 4JI0J 3JAMU 4DV6J 4LF6J 5A2QU 4DV7J 1HNXJ 4KY3A 4NEZA 4JI5J 4X66J 4AQYJ 2UU9J 2UXDJ 4LF9J 4DR3J 4K0KJ 2KL8A 2UUCJ 4PWWA 4NXMJ 4LFCJ 4JI8J 5AJ3J 4X62J 4NXNJ 3J81U 3R2DJ 2F4VJ 4DR6J 4X65J 4JI7J 1I94J 1XNRJ 4DR5J 4OX9J 4DV0J 1HR0J 2ZM6J 5LM7E 4DV1J 1J5EJ 1HNWJ 4DV4J 4JYAJ 2UXBJ 3D3BJ 4DR7J 5BR8J 4LF4J 2HHHJ 4NEYA 1N33J 4LFBJ 4DV5J 3J80U 2VQEJ 1IBMJ 2E5LJ 2VQFJ 4B3MJ 4GKJJ 2MEWA 4B3SJ 5IT9U 4KHPJ 4JV5J 1HNZJ 1N36J 1IBLJ 4LF8J 3T1YJ 4JI3J 4B3RJ 4JI1J 5LMNJ 4DUYJ 4JI4J 4JI2J 1XNQJ 3IMQJ 4GKKJ 4HHUA 1FJGJ 4DV3J 4DR1J 2UXCJ 4B3TJ 3T1HJ 4DUZJ 4DR2J 4JI6J 4RJVA 4DV2J 4DR4J 4X64J 2KVQE 1XMOJ 4YHHJ 2MTLA 5IWAJ 4YY3J 2MQ8A 2UUAJ 4KYZA 4V1Ak 5FLXU 4LFAJ 5LMUJ 4LF7J 3OTOJ 1XMQJ 3J7AN 3D3CJ 1N32J 2UUBJ 1IBKJ 3R2CJ 3W1YC 1N34J
chains in the Genus database with same CATH superfamily
1CVJA 4Q5VA 4GRSA 4F8RA 1FFGB 1SUQB 4C0HA 1C1BB 2QT7A 3OVAA 1VQLS 2NREA 1NB7A 4ZP8A 1Q53A 1QVFR 1CG2A 4G1QB 1TKZA 2QTWA 5JJBA 2HVZA 2HURA 1J5EJ 3MF5A 4PRFA 1GK8A 5C5JA 1KHWA 1H7XA 3EMTA 1M5KC 4CTAA 4WZQA 3K57A 1C0UA 3C15B 2KG1A 4C8YA 2X1FA 3HM9A 3PXGa 2YBVA 1HFEL 2FIUA 2VBYA 4H54A 2BACA 4DV3J 3MEDA 3VAGA 1BHNA 1QAIA 2ABYA 4QCLA 2HW3A 2EBEA 3MECA 4USJC 2J7WA 2CKWA 3HSZA 3ZO7A 1DLOB 3DLKA 2MMYA 4QWEA 1FFWB 2N4CA 3GIRA 3FZBA 2CPFA 2B6AA 2FTRA 2JEJA 2F4VF 2XS2A 3KNAA 4C9DA 4B9UA 2DYAA 1HWKA 2OD4A 1TK5A 2H9ZA 5F8IA 3NL0A 2BABA 2B4UA 1WI8A 2M8HA 2DR9A 1VQ9S 1HW9A 3DCAA 2V2KA 4ED8A 1HNIB 1RBAA 3LP2B 1Y7PA 3IWXA 1IJFB 3PW0A 4IFYA 4ECUA 2PDAA 4JYAJ 1TL1A 2FVSA 2UUTA 1MWZA 4RKUC 2EVZA 1KHVA 3PVXA 4ERDA 1REVA 2V8VA 1SJ4P 3VV2B 4URSA 1OIAA 2A18A 4UT4A 3Q8VA 2LQJA 4NZ7A 4KGVB 4J37A 4KGKA 4V19J 2LQ5A 3TI0A 4J9QA 1VQSA 4DUZJ 3DU5A 5DDQC 1M0SA 2AGPA 1Q8BA 2RVJA 4LREA 3E8OA 5F3TA 2BANA 3M1VB 4CNZA 1RAEB 3RW7A 5C7PA 1NK4A 2ZFHA 2EFQA 3Q24A 2RSQA 3ENQA 4JI5F 1JWWA 1U6BA 2CQ1A 3K5LA 4Q0BB 3VQSA 4U8YA 1SC1B 4NXMJ 4YUDA 3E51A 5HBMA 3RYLA 5T7LB 5ITHA 3IN5A 4CRJA 1S6OA 2YKAA 4TY8B 1N8RT 2JEFA 2YKQA 2M52A 3MTJA 3RW6A 5DZ7A 3OJUA 2E5LF 1DTTB 3KOAA 2VQEJ 5KOXA 4QIFA 4KTQA 3T1AA 3GV7B 3MCSA 2IM3A 3BGLA 3ELHA 4RNHA 3WHIA 3J80Y 5K5MA 3PV8A 3PYGA 2P5VA 4URGA 1WKKA 5IT9Y 4O0NA 2V4RA 4CH1A 2CPDA 1R31A 1TQLA 4M5LA 4ZCLA 4KR0B 3KK3B 5HK4A 4ECXA 1FHTA 1UVJA 4CLSA 3TARA 2JJ4D 4JP8A 4Y2IA 1HYSA 2OMLA 1NK7A 1GX5A 3J81j 5KFVA 1OPIA 4USTA 2QMWA 5D4NA 4X4SA 2MXYA 2EC2A 1QD1A 3W62A 3D67A 2JVOA 4N7TA 1GAOA 1VQ5S 1HHTP 1UTAA 2GGPB 5D0EA 1LK7A 1VIXA 1UWBA 2NXNA 3M6XA 3SQGA 1RT5A 2ZM6J 2XY6A 4A8XA 2XI2A 4B3OB 2N7YA 2MHEA 4EFAC 1SV5A 4ED0A 1G6BA 1KQFB 4TU7A 1U48A 1RWVB 5CHCB 1WD6A 1QLNA 1TAUA 3PIOQ 1C0TA 5HL7Q 3D7SB 2BQRA 1NJZA 2HVIA 3GR0A 1B3TA 2HBZB 1RT2A 2MKKA 3TVYA 4HT5A 5EDWA 2WBMA 3SSQA 4PYAA 3G4SS 1A6LA 3Q83A 1S7IA 2OEMA 3PX6A 3I5AA 1NZAA 4X64J 5IWAF 4KRWA 5KFAA 3ITHB 1U2FA 4U95A 4J9NA 1NKBA 2CQIA 3T5HA 2P9CA 3FQKA 4LF6J 1VBYA 1S6PB 1HQEA 4K0KF 2W2PP 3GMGA 1TL3A 3UCUP 2YKPA 1LFWA 4P7TA 4DXLA 2ZUAA 5FD1A 2EFOA 2X1GA 3DDNA 1V3RA 4O4GB 4DSLA 3FMBA 2YNIB 1P9YA 2HG4A 2M9KA 1FKPA 2YQ0A 2E29A 1AB8A 3B8HA 1RTZA 2CZ9A 4Q2MA 1Y11A 3KLFB 4I2PA 2IBOA 3BYRA 3W60A 2W8KA 3M32B 2DR7A 3N6NA 2UUAF 1CJUB 4USKA 4ZVEA 4CLZA 2YKNB 4F7VA 1IR0A 3GCXP 5I42A 5DG7A 2XO6A 4FVMA 1WKLA 1N5YA 4Y00A 1FXLA 2JLEA 5KFRA 2PFFB 4LUBA 5I3UB 4ZN1A 3BQ2A 1RHJB 2MQNA 5KFSA 2LU1A 1H6KX 1UVKA 3OR1B 3PO4A 1N54B 3H2VE 1NCLA 3S8SA 3BPDA 2HHQA 3H40A 1X9MA 2I5JA 2EFNA 2CQ0A 4DR3J 3GZ7A 3D1OA 5I4MA 3AA8A 3BH7B 4HTJA 4MIWA 3GYXB 1R8HA 4X65F 4OI6A 1IKWB 2QSWA 1D0EA 4NLRA 2ZHOA 3QAUA 1ZYQA 2YWKA 1RQ0A 1FKOB 1VQPS 1K0TA 4OV6A 4DN9A 4DR1F 4MH8A 2YY3A 4LVNP 3QGGA 1ZA1B 3THTA 4QPXA 1RP5A 2XGQA 1TV6B 1KONA 4HACA 4ICLA 4EGLA 4Y6IA 3QSIA 4M94A 4JI2F 2RS2A 4WIIA 4RNMA 4NLUA 5H9EJ 4UW2A 4MIBA 2V8HA 4OYXA 1YJUA 2MQPA 1NBEB 2CJBA 4FXVA 5AE1A 2QLJB 3Q8QB 3CCLS 4WP3A 3OQ2A 2ZHAA 2XSJA 5C2CA 3DGPA 3V81B 3LO3A 3UDLA 4KGXB 2YQ3A 4RW8A 3H25A 5IT0A 4KY3A 4F0HA 2UU9J 2OPSB 2KI2A 4LT6A 2OD6A 5A6WA 3NGUA 3D5MA 1APSA 1F5BA 4R5PB 2LECA 3TZXA 2Q6BA 2RMLA 4X62J 1JLEB 2RUGA 4FNHA 3QT5A 1TL5A 1FRMA 3ZZRA 1OY9A 2ZBRA 1U1RA 1WJ9A 5LSLA 1L5UA 3V4IA 5BR8F 3KKFA 3FEYB 3J7ZT 4EZ6A 1NSKL 4ID5B 2F3JA 3K7RA 1U1QA 1X4GA 1AZSB 1P1TA 1IBLF 2QO3A 4WFZA 1SIZA 1LKZA 1YRUA 3ILIA 3HI9A 4LIRA 3KJVA 2MSTA 3LUYA 3E2EA 1HMVB 3H90A 2KHCA 3TVZA 5IC4B 3P5BP 5E33A 4TU9A 5EWGA 3G6XA 2OIHA 4NRTA 2L9DA 3MM8A 1PSDA 3ZZOA 2G4BA 8ATCB 1DQ8A 2J0QD 1RA6A 4ED7A 1CULA 5A76A 4L73A 3W1YC 2F7VA 1KD1T 3CEDA 5D77A 1D8YA 1TVRB 4PZVA 1D8ZA 1RXOB 3DOMA 2R2TA 2HLUA 1XBWA 2ADBA 4B3MF 4PR6A 2CNOB 4LR9A 4DCPB 3VAJA 3JAMY 2R8IA 4DSFA 1O0PA 4NZ0A 5G0RB 3NNHA 1YZ6A 2E5HA 2Z0GA 2BBEA 4HH1A 3TUJC 2RAQA 1L3SA 1SJQA 1QAXA 4Q7AA 3FK4A 3G2XA 5MAOA 1VBXA 1HI1A 1SB6A 1FRHA 4BC9A 4KHPJ 1RDRA 2CQHA 2QA4S 4FF3A 2AZ3A 3T41A 1CQMA 5A8RB 4E8UA 3IMQJ 3HO1A 1CS4A 3NGDA 1KOOA 3ILOA 3KLGA 2R2RA 4FPIA 3DOKB 4MYTA 3HFZB 4ZPWR 1GMWA 1T05A 5M2PA 4O44A 1NSPA 3VAFA 5F0WA 3UNYA 5CYQA 2E1CA 4CM2A 2HGMA 4B9NA 4ZPDA 3PR4A 4OZ0A 5J2MA 1WDDA 2CPEA 2Y0BB 3OL8A 4PWWA 3X3UA 4WTOB 3PIPQ 5ETSA 1JKHB 2L41A 2NYHA 4P74A 1S1XB 1SH3A 3OL7A 2K7JA 4K4VA 3VZHA 1C1CB 2VC1A 5LMNF 1FI4A 4KQZA 5EX0A 1RYRA 4NI2A 4LF4J 1G4CA 4OZ3A 1S1TB 5L1IA 3LWMA 3IG1B 3JB9k 1NMEB 1R0AA 4B3SJ 3GCWP 2C2EA 1RT1A 2BW7A 2IRUA 3EDQB 1SJ3P 1QJHA 2K1RB 3M8RA 4NMLA 4HR2A 3SCJE 3VAKA 4NLTA 1RACB 3QLHB 4P73A 5C2GA 3H2LA 3DRSB 3K8WA 3AOCA 5CZXA 3QGPA 3KHRA 1Q81T 4J5OA 4TLQA 1VJWA 3R8YA 2V2QA 1RT7A 1ZM2A 5C42A 1RAIB 3GG1A 1RU1A 2XY5A 5GAHI 1I5OB 3CT9A 4C0OC 2OAUA 5K20B 3IFEA 5F8JA 4PWUA 3I9V9 1NDPA 3HHEA 3D0IE 3V6HA 4GC7A 1SH0A 3J7Z5 1NK5A 4EO6A 2ZDPA 2GIQA 3CTRA 4DPUA 3DXBA 3K58A 1WF0A 3N01A 3S6EA 1EARA 4USIA 2F4VJ 4Y34A 2DR5A 5A2QY 3ET6B 5EWEA 4C8LA 5E41A 3LP0A 3AA9A 4YDXA 5A8WB 3BB5A 1M5SA 4EWTA 5HROB 1H72C 3AOAA 3A8JA 4DL2A 2ZVIA 3OHAA 2IRYA 2W9CB 2DPJA 1S9EB 1WG5A 1N5VA 2FLLA 1Y00A 3M6VA 1GEHA 2MLYA 2V4QA 1UJ4A 4P75A 1W2IA 3LPEA 4EUVA 2XTJP 2HIQA 2MGZA 1UEUA 2XLIA 2FY8A 2C3UA 4NE9C 4YS2A 2M5YA 2G0IA 2DNRA 3BM7A 2YWEA 4GVBB 4FBTA 3OUYA 4UTGA 2LLZA 2VPYB 2G9OA 2NZ4A 4IO9Q 3IC1A 4W90B 5AXLA 4DF4A 2QIFA 2LEBA 3Q8YA 2XNRA 4XDDA 3DLGB 4DEZA 1SL0A 4K59A 2J9EA 3OTDA 2DY1A 2VKZG 1RKIA 1VQYA 1CJVA 1X60A 2AF6A 3QJPA 2XS7A 5HQ8A 2KVIA 1E6VB 3CCWA 4IG0A 2CQ3A 1G3OA 3QT7A 1IKXA 3BO3A 5E3PA 3TANA 2MZSA 2HS4A 2RT3A 3PHEA 2GO8A 5CZVA 1N33J 2QLBB 5DGBA 3DRRB 2D74B 3MD3A 3LTOA 1E6YA 4CO4A 3IAM9 1X9WA 3TR5A 3NMRA 2BJ3A 2R7WA 1QE1B 3D9BA 2ZE2B 1CQNA 2QEXS 3OXGA 3MD1A 3FSYA 2IA6A 3BN7A 5FDLA 1ZZNA 3C2PA 4IH7A 2XY7A 3GFHA 1LWEB 2GVDB 5KFUA 1WC3A 3I5CA 3TA1A 3UW1A 4X2BA 3NOGA 4IYQA 3LP1A 2LA4A 1H98A 3OW2R 2HHUA 3D6TB 4M5MA 2KT2A 2OMOA 3FBCA 2A6OA 2DHXA 4J9MA 1JLCB 3MMAB 1V6HA 2ZH5A 3FVYA 2RDDA 3K59A 3M6UA 3CMES 3IS9B 3RB6A 2J9DE 3DLLQ 5CD4A 2AQ4A 3PRBA 3I32A 2R8KA 1S7HA 2VD3A 3E3XA 2DITA 4RNOA 4P7VA 3BYPA 4PG7A 3Q23A 3GYGA 3QMQA 3W5XA 1AYEA 1TK0A 1VLYA 4GC6A 4PXEA 3D6HB 2PA3A 4WWSA 1DQAA 3QYYA 3PFEA 5HMZA 1U0HA 2O1PA 1Y5LB 1YWXA 1MWQA 4FF1A 4KV8B 4NWBA 2IMWP 4CIOA 2L9WA 2OEJA 4P72A 4RUCA 3GB0A 1ZETA 2FZCB 4IDKB 4OZNA 2AZ1A 1HWUA 2NLWA 3GJRB 2W4CA 3I87A 4P71A 4W98A 4ED1A 5KG6A 4X4PA 2CADA 4WFNQ 1NB2A 3QWUA 4ZVFA 5E3AA 3N5BA 3CD6S 5CA5A 1LQ9A 2MY8A 2E9ZA 5IXUA 3G82A 1N0VC 2HS3A 5HQLA 4FS1A 2PE8A 5IV4A 1U47A 3EZUA 2ZBPA 3LH2S 2IVFB 3H5XA 3PYDA 2GVZB 4K4ZA 3LQVA 1W2BR 1JLBA 2DNQA 2DXFA 2LYVA 3M2UA 5IFMA 4GVLA 3DOLB 5KT2A 4O23A 2UUAJ 2LXIA 4V1Ak 4O3OA 2QLXA 1UA0A 3SYZA 1S9GA 2HK3A 1QSYA 2HMIB 1Q16B 4DV0F 1TKTB 1X5TA 2QV6A 2WB1D 2MKHA 2GIFA 1LXNA 3JSMA 4CCHA 3BS9A 2BOPA 2HFOA 3KHLA 4DSJA 3WX4A 2F65A 1UW4A 4AUKA 3J81Y 2CQBA 1P1LA 3KHHA 3C6TA 2ZBQA 4A48A 1U09A 3O3LA 3GIKA 3VWSA 1VK3A 2G13A 2RB7A 4Q45A 2M4MA 4N5SA 3HHLD 4DPTA 1JLFA 4HHJA 4B3TF 4DR1J 3EJMA 5A8KA 4ZVTB 5FIIA 3C14B 3RB3A 2J0SD 2GA7A 2PGCA 2QA1A 5HVFA 2FHOB 2YWFA 1TUWA 3CCMS 2XMVA 1PCAA 2VG5A 4F25A 2KRRA 2MKYA 3HZGA 3J7AN 2DEJA 4ED6A 5KFJA 1FD8A 1HIYA 4FZVA 1JJHA 2UVRA 2FHJD 1NLKL 3WC2A 5IM0A 1D9AA 3NGRA 3KYLA 2VONA 1N6QA 2NSBA 1YHQS 4RW6A 2ZZNA 2Q79A 4G1IA 1XK8A 2EI5A 1WTBA 3HHLC 2JDJA 2JRSA 4WK3A 4TLRA 4WFBQ 1VISA 3D66A 2KB2A 2CNNB 1Z2ZA 1MWYA 1JLQA 2BE2A 4QQBA 2EW9A 3MUMP 3FKBA 1XMBA 4GKJJ 3QIPB 2E1RA 1KLMB 2KYXA 2XEXA 4IG3A 5ETNA 4KH0B 3CE8A 5B0EA 1IQTA 2HPUA 1GXUA 2V2ZA 1EP4B 1KWMA 3SSRA 3KK1A 4WFYA 2VA2A 1S49A 4PAAA 4RZRA 4OI2A 5GMEA 3HVWA 4DV7F 1W25A 3KJNB 4XPEA 3I56S 2VICA 2LQ8A 1YBAA 4ENOA 4CWBA 1BC6A 3KNGA 1VHIA 4R8UB 2FGOA 1FJCA 4JI0F 5I3UA 4CO3A 2MSSA 1RTDB 2E5JA 2VJVA 3BO4A 3P4UB 2V8GA 3PO5A 1IBMF 3CCRS 2NXEA 1V5IB 5KT6A 4WBFA 3LGHA 4OL8A 2YWGA 4LF1A 4U7UD 1TAQA 3OPKA 1HR0J 3WC0A 3EXYA 2JC1A 4DX8H 3HHNB 4YR0A 3LPYA 4I6WA 1SC3B 1Y4ZB 3KDNA 3IGVA 2YNHA 1D1UA 4B3MJ 2YNGA 2DNPA 2K3IA 1YJTA 3RR7A 2HKEA 2ACYA 2FVQA 3MPVA 2VG6B 4TNOA 1FRJA 4KFBA 2EC0A 1DTQB 2B5JB 1RCXB 2E1MC 4FBUA 3G96A 4N77A 5KFYA 1FF2A 3NCPA 4KHMA 2MPUA 4J9PA 1SKUB 2LU2A 1K44A 4C8MA 2I6WA 4A47A 4PWDA 1T03B 5LT5A 2QE5A 3FJ2A 1LWCA 4YQWA 3P8BB 2CZVC 2IDLA 2X3GA 2HHHF 1IM4A 4LFCF 2CIMA 4F02A 4OLPA 3HHLB 2G2YA 4BWJA 2GQCA 4RW4B 3W9JA 2IJNA 3MFHA 1RTHB 5KFMA 3ETOA 3VVTA 2XWYA 5B0CA 5B0BA 4RLEA 2G2OA 5G4DA 3DN9A 4M1KA 3CXCR 3MM6B 3DLEB 1PJ7A 1RAJA 4BDPA 5FJ4A 5LMNJ 1LW0A 1F0XA 4OJHA 3KWMA 2B4PA 3V4MA 3CD5A 1F1BB 2BRLA 4ILLA 4ZVOB 1SL1A 3MEEA 4DR4F 4OYWA 1U6ZA 2FGCA 3EGWB 2EFGA 2GCFA 3EE3A 1XR7A 3THVA 4TYAA 1TKZB 4AL5A 1CPZA 1LWFA 3I4HX 1T9UA 1WC1A 4CTAB 3ZFVA 1C0UB 2UXDF 2V4JB 4CLPA 1HD1A 5ETKA 1FA0A 4F26A 1DURA 3W7BA 4TN2A 1WHVA 3KHGA 1X4HA 4F04B 3E01A 4OI0A 3M9MB 2CJXB 3MEDB 3JSBA 1WUUA 5L39A 4OX8A 1HBOA 4PYDA 3SMZA 3W8PA 2Z2YB 4B9VA 3DFEA 4OYOA 3MECB 1UAWA 3MPDA 3RB4A 1H73A 3DLKB 2B6AB 1GTEA 1QVGR 1Q8IA 3R6GB 1S5ZA 3MCMA 1WNEA 5I3PA 4ZP9A 2ZBCA 4MT1A 1T9XA 3NCRA 3IR7B 3ICLA 3L4BC 2KJWA 4I56A 3H98A 1M90T 1TL7A 1QAYA 3CJ3A 2QMXA 1RLCL 3I9ZA 3QZ8A 2ZH3A 4ZCIA 2QJ3A 1Q8LA 4IFYB 4MJKA 4DL3A 1Y3JA 1TL1B 3UI3A 2HWTA 3ZNUA 2K8GA 5DLGA 3I82A 1LW2A 1REVB 3DRPB 3KLVA 4JOUA 2QZ8A 2GFFA 1M5VC 4NLQA 2G1HA 3O1LA 3TZZA 1EKRA 2E5GA 1CSJA 4WYLA 4CO1A 1Y9OA 4L75A 3QSYB 3M2RA 1RAAB 3EVMA 5J2PA 5AE2A 2AKWB 3N28A 2VFVA 3NRBA 2QFIA 4HTIA 2QGFB 3GIIA 1S4EA 4B9LA 4B17A 1BY9A 2BXJA 2BANB 3BSAA 3K8VA 5C25A 2WVBA 1FRIA 4EYIB 3R1HA 3NEKA 4ZIVA 1RYSA 3UR0A 2QYGA 1P6TA 2CVEA 3QT8A 1X4FA 3SCLE 3ILJA 3AD7C 1FDBA 4UQTA 2BQ3A 5F8MA 2J5AA 5HBMB 1EX8A 1NNDA 4KH1B 2YX7A 5BYQA 5K8MA 1IR1A 4F3QA 1SKRA 3MOJB 2ZJQQ 5K14A 2M7SA 5HVGA 4FF2A 5ETRA 3QRPA 3RAQA 3CJSA 3W61A 2LEPA 2HFVA 5E5NA 4RBVA 1KC8T 3W2VA 3LALA 3WQPA 2R2UA 4MKBA 2HHVA 3D3BJ 2PA8D 2FB0A 1UJ5A 2DGOA 4C4WA 1MMNA 4ETXA 3AB4B 2AJ0A 4E2FB 5F41A 1SKSA 5K8OA 1O8BA 1YTYA 3FEXB 2RD5C 3IWLA 1S59A 2GO9A 3K5MA 5HANA 1R43A 3VALA 4LBIA 2O66A 2AEMA 3M4XA 3TUZC 1UETA 1F9EB 4EO8A 1UWBB 2VH7A 3SQGB 1B0PA 2HNYA 1RT5B 4KKOA 2KT5A 2WSCC 1EIYB 4DI6A 2E7XA 4YMEA 2B7CB 1SV5B 4IRDA 3VAHA 1X4DA 1UJ6A 1XJWB 4X4NA 1KS2A 2MKJA 2C2MB 3FCHA 1R6VA 3J7A1 1C0TB 2WAQD 4DL5A 1RT2B 4E0DA 2LQBA 3FRYA 3IAS9 1BLUA 4KO0A 1M1HA 3PW5A 2ZNYA 5KFIA 3K5NA 3MR3A 1B0VA 3SQOP 2NXUA 4ZPTR 1NSAA 2I9SA 1Q79A 4Y0FA 4OJ3A 3NCQA 4U6PA 5CABA 4JI3J 2IYIA 3B82A 3GR1A 1KVIA 4F3OA 1ELOA 1HQEB 4OHXA 4JB8B 1BE4A 2QL7B 4OLOA 5H1SV 4WPAA 1TL3B 1Q78A 4FKYA 2EPIA 1FWPA 3VGTA 2M70A 2VBXA 4NA2A 1FKPB 3DDKA 5H9EK 4YR2A 2ZVSA 4P9SA 2KO1A 4M5NA 5F8GA 2IAJA 1VDHA 1FDAA 3PNIA 4I2PB 4F4KA 3OXFA 3EYZA 2YH1A 4HVZA 4NXNJ 2FVRA 3EGNA 3H5UA 5JUMA 3HD2A 3A8KA 3GU0A 3FCWA 4DV0J 2CXEA 1PBAA 5I42B 3NLCA 2JSXA 1RHMB 2WVDA 1HWJA 1KOHA 3FSXA 4B08A 2PMZD 2W4DA 1JLCA 4LFBJ 1N5YB 4B9MA 2LDIA 3UVJA 4NLVA 2JH3A 1XQIA 4EI2A 5E7OB 2DBBA 3QJLA 4C11A 4BBYA 3NGSA 4RUBA 5ADZA 4MK9A 4N8NA 4U7UK 2I5JB 1M5OC 2JLGA 2KH9A 3CJ8A 2DNZA 3GWCA 1NO8A 1N48A 4HI2A 4RW7A 4WE1A 3CIMA 4RUHA 4TU8A 2GHWA 4N47A 2HNZA 3M6WA 2BJ8A 3EDRB 2BKPA 3K5OA 4HACB 2LQ9A 4ICLB 1LNQA 1NH7A 1U49A 2MQQA 1RT3A 4DR5F 3D0HE 2R7XA 3MR7A 3GV5B 3NNCA 1Q82T 5J1EA 4DR7J 3CJ2A 2Q6CA 2DGSA 4F67A 2Q66A 2DGWA 2B51A 4DF8A 4IDKA 1AUSL 3C8YA 1M1KT 2BOAA 1F3VA 1HW8A 4UOFA 2AX0A 2XSJB 2CDQA 1N36J 5HP1A 3DGPB 2OELA 5EWFA 2AIRB 2HFSA 5GMKa 4ZITA 4WCEQ 2ZH8A 3SBMA 4RW8B 1XERA 4L6V3 2HIYA 2EWHA 3IGNA 1L3VA 3G8SA 4ECTA 4K4WA 1X4AA 4NYPA 2MQLA 2DNMA 3AAWB 2HHPA 1S1VA 2AYEA 3U27A 3CDEA 2HNDA 3V4IB 1RCOB 4AL7A 2PSZA 1Q95G 2W2NP 2VA3A 4DV7J 2BDPA 4EBDA 1RI7A 4IQMA 4DOZA 1VQNS 2IVYA 1PKUA 4JI8F 4B9SA 4ILRA 2L3MA 1RSCA 3BH6B 4A4JA 1HHQA 2YH0A 3VF0B 4JV5F 3KJVB 3TX0A 1T3NA 4PUOA 2XM3A 4M5DA 3R27A 3M30A 2R7VA 4OHZA 4NASA 1TELA 1RHKB 5MLCV 3MM8B 4OJGA 3IM9A 3MHYA 1IBMJ 2VQFJ 4NLYA 1VQ7S 2DB1A 5DETA 2FZGB 3MAAA 1K1SA 1CULB 3CVKA 3DRYA 2QLWA 2VKRA 5AE3A 1TFWA 4DL0C 1VC5A 2PIIA 2CNLB 1FKAF 5E3CA 2WHOA 3DOMB 4IRCA 2DGXA 1TUVA 5LOQA 2OPPA 2DHAA 2J76E 2C2DA 1B0TA 2JC0A 3BKFA 1WSRA 5KG1A 1FE0A 4EK2A 4Z7YA 3HHDA 2MYFA 2ZH4A 4F36A 2BEFA 2YXLA 5KTQA 1SJ1A 1MNEA 2D41A 4Y2CA 3N0VA 1ZOTA 3MEGA 2ZZMA 2ATLA 3H20A 2HVHA 5F8LA 1KFSA 4K7QA 2W7OA 1WOPA 2ASYA 1TK8A 1CS4B 4ANEA 1HNWJ 4DV4J 2J7UA 3KLGB 1CC7A 2J0XA 2HHHJ 4RWXA 3DMJA 5GADU 3AJ2A 1T05B 4DV2F 4O44B 5M2UA 2H54B 3Q8UA 5CYQB 2AD9A 3BREA 4ZOSA 2E1PA 3OBIA 2PN6A 5J2MB 1IXKA 2DO0A 2KXNB 2J7KA 5CH7B 2A10A 4U9RA 5T41A 5HATA 5ETLA 2U2FA 3RRGA 4LFAJ 2UUBF 1YI2S 3MDFA 2V68A 4XO0A 5SZTA 2KM8B 1HI8A 2OGUA 3TRGA 4DS4A 4NI2B 2F4FA 2IIHA 1WELA 1R0AB 3WIVA 2UUCJ 1EKSA 3HCXA 1RTDA 3R2DJ 1K1QA 4OIXA 3W9IA 2G0JA 1T94A 4NLSA 3QT6A 1RJJA 3M05A 1VQ4S 4ZCKA 3CSKA 4LRCA 1PBUA 3SCIE 3S1TA 1HLWA 1Y0HA 3H4BA 1RT7B 4PPZA 5C42B 4J9UE 5IQQA 6FD1A 2H5JB 2HQDA 4XTTA 4QWBA 4DQPA 2HBYB 4PXBA 3GFYA 2M2BA 4KC5A 1U0SA 2DO4A 2UV8G 3HSGA 1NM2A 1S0OA 2FJBB 3M8YA 4P2FA 4NCBA 4ZLJA 2R3VA 1QTMA 4OJ1A 5GAEI 1B99A 2AWZA 4ZK7M 5LJ3Y 4Q2LA 4Q8EA 4EBCA 2XS5A 4PQAA 2LP4A 4NL5A 3LP0B 4JV0A 3DHWC 3MWBA 2QRRA 3KLEA 5DJBA 4LF5J 2FUG9 3O2IA 2GHVC 1AXQA 4P2SA 4AQYF 1U24A 4RNNA 3DU6A 4ZVGA 1ITPA 5FLXY 4PG4A 4DLEA 2ZBIA 5HSPA 3KLIA 1R3NA 5LJ5Y 3P5TL 9RUBA 2VDHA 3KMSA 1YBTA 2MGZB 3KLHA 4ECQA 4ZA1A 1F5CA 2CQ2A 4JI4F 2B7BB 3P96A 5GAGI 2UVUA 3QRQA 1GTHA 5ETTA 4Q8FA 3OUYB 4ZJLA 1X4CA 2N7CA 1JNZB 2Z2ZA 5AT1B 2FY1A 4CH0S 1QUPA 1V5VA 2JEGA 1KEKA 3TAPA 4DHVA 1ZS6A 3UO0A 1BQXA 2L48A 2Z30B 4JV2A 3GE9A 3GIMA 2APOA 1K9MT 3AHPA 3M8QA 4USMA 3T9ZA 1CJVB 3KUEA 2A2DA 4OYZA 4MIAA 2VASA 3FSIA 4KHRA 2V5HG 2FHJA 4IG0B 1V9OA 1IKXB 2RHSB 3ZZTA 2FPHX 3K5PA 2NXCA 3LW5C 5K8NA 5IOLA 2OJ3A 1PIEA 1FK9A 4FF4A 3UDEA 1TZ0A 4ECSA 2XMJA 1E6YB 2V4JA 2COLA 3U7JA 3ETMA 2GX8A 1EETA 1CJKA 1ACMB 3MUVP 3Q0AA 3BBFA 4CZCA 4YR3A 4ZKAA 3Q2SC 3CJKB 1S10A 3NXZA 3AH6A 3NY0A 3IR6B 5FDLB 5EN1A 4O3QA 5LMUF 3NS7B 4BWMA 2AEJA 2RF2A 3AB2B 4RBTA 3LP1B 3W65A 3FFIA 3S7RA 3IBCB 4YHHF 4YY3F 2EKNA 3OHBA 3TX8A 2AT1B 3QFHA 4BCAA 3C19A 3EVOA 3NAIA 1GT8A 4HEA9 1ZZFA 1UEKA 1S99A 4K50A 1QTNB 3VGSA 2ILYA 3T5LA 2XYPB 5KAKA 2Y1JA 1FESA 3B6BA 2W8LA 1WC6A 3DRPA 1L3TA 2MZ1A 1J27A 3RAMA 1J5OA 4C8ZA 3JTOA 4FYXB 2ZH7A 4RUAA 2VFSA 2ZC4A 4KSEB 1HPZA 2HGNA 1H38A 3RRHA 3CO0P 3HVRA 1RTIA 3KJFB 1PG5B 2YKOA 4B3RF 2BJDA 2IJRA 2AJFE 3V6JA 3UNGC 4USHA 2EBGA 3NAHA 1U0HB 2UXCJ 2H51B 2RNEA 3SFUA 4H4MA 4ECZA 3PEJA 4DL6A 2R8HA 4WKYA 2G2ZA 4QR0A 2H5EA 5E0OA 2VB6A 3N5FA 5KT3A 2ZH9A 3FBFA 1XNRF 2SXLA 3HT3A 4DMZA 2MLXA 2W2OP 2IBKA 4QW8A 3OV7A 2V6AA 1NAQA 5H9FJ 4G6VB 2W9BA 3TNVA 1YJNS 2JEIA 3RJMB 1RWOB 1OSDA 5AJ3J 2OPQA 1GXLA 4UOGA 3G82B 1DQ9A 1WOSA 4Y2KA 2DHSA 4MKVA 1U45A 4NYZA 2Z4PA 1JLBB 1UEVA 2KHDA 1PYSB 3M2UB 3IR5B 3US5A 3A3NB 2C28A 1HNZJ 4P10A 3M8SA 3PW4A 5B0GA 1S9GB 3O5TB 1SJFA 3RG6A 2ZDOA 3C16A 2DNLA 4IFVA 1P27B 5AXMA 3EUNA 4B02A 3JSMB 2ZKUA 2H48B 4QU6A 2HVEA 1IR2A 1UVIA 1KNZA 7AT1B 2P6TA 3QZ7A 4LR7A 1RWKB 1Y5IB 2XCPA 1FXDA 2D1CA 3SZ2A 4TQRA 1I6JA 4AXJA 3VTIA 5L8RC 4LIWA 2B9XA 2HFUA 3UD3P 1W26A 1B7FA 3OVBA 3C6TB 1WI6A 5GAEU 2CQ4A 4KGMA 4X4VA 1PYTA 1DRZA 2X51A 2OUGA 5BYSA 1FVQA 5B09A 4OQJA 2KFYA 3Q2TC 1JLFB 1QUVA 2LCWA 4DU8A 2W24A 3AQOA 3CCJS 5A8KB 2H65B 2KDOA 3HF5A 4OHWA 1TMMA 2K7KA 3KJQB 1ICEB 2KFNA 2V9WA 1PAUB 1CJTA 4M5JA 5KT4A 2VG5B 3HMJG 2MHNA 3L7OA 2DHHA 2J9DA 4MKAA 4ILMA 2OKQA 5GAGU 2P8IA 4UF4A 5DS7A 4DUZF 3DRXA 4F2SA 3ENVA 5IM0B 5BJRA 3PJXA 1N6QB 2WCXA 1OJ4A 2DXDA 3D6MB 4RW6B 3MM5A 4S0MA 2PMWA 1NRKA 1FRKA 1JXLA 1FWKA 1RLDA 2DGUA 1LXJA 2HQFA 2MQOA 1JLQB 1VQ6S 2BE2B 4L3KA 4CLWA 3A4TA 1M5PC 2HHXA 4I68A 4NXMF 2FVCA 1YVFA 3J7YI 5DM7Q 1UZHA 2E9RX 4IG3B 3QRRA 1NU4A 4F0KA 5K9FA 4WXWA 1U02A 3EXCX 3HD1A 4WP9A 2D9OA 3KK1B 3THPA 2FLOA 5DG8A 1IKVA 1O6XA 4DG1A 5HI7A 3MCNA 2VQEF 4FNIA 1SL2A 1AROP 2YX4A 2RDIA 4NLGA 4JV5J 3QO9A 8AT1B 1ZPVA 4WF9Q 2C2RA 4DSIA 1RWUA 2FJEB 1RBOB 4PQUB 3GG0A 2GJIA 2ILZA 1PGZA 2RIJA 1NDCA 3HFKA 4V19X 3PX4A 1H74A 4K2JA 1VRTA 4J90A 1KTQA 2BJ1A 2EG1A 1N5SA 1N32J 1DAXA 2J8SA 2VBWA 3MR5A 1KTVA 2UXBF 1SC4B 2YNHB 4NCGA 3QJJA 3BSCA 2YNGB 4UUXA 1VGYA 1T9TA 2GAHC 2KJVA 3LWLA 2HAFA 2YX1A 2ZM6F 3C6UA 3BR8A 2R8JA 4O3PA 4KFBB 1H3DA 1X31C 4GKKF 3ZXWA 4J91A 3DHXA 3BJYA 2UUWA 3A12A 1I51B 3DDIA 1PYOB 2FHMA 2ZH2A 3PDNA 2C3PA 4OI1A 1RBLA 2IDEA 1NEEA 5KFOA 3GTYX 2VL1A 5LL6d 4PWDB 5KG7A 3N79A 5THWA 5I3QA 1LWCB 3SV3A 3PRVA 1N56A 3ISND 4QOTA 4XIUA 4DV2J 4DCOB 1T7PA 1S6QA 1OS5A 2UV8A 1OY6A 2B43A 5KOWA 4ATNA 2GAGC 1VBKA 2WZ1A 1C4AA 2RRBA 2B0GA 2VF3A 1V3ZA 3NBPA 1WWHA 2B4OA 3EZOA 4F4XA 3B78A 1RWNB 2C22A 1LW0B 2KU7A 2O5DA 3D2WA 1A9NB 4F4WA 5M2RA 1XR5A 2X7IA 4HDGA 3ISNC 3MEEB 1U8SA 2D3ZA 3MM7A 4DX5A 4LSNA 5EHHA 2DIVA 4USUA 2XULA 1KVKA 1KSPA 2MEWA 2RJZA 2R4FA 4I69A 2HFZA 4DL4A 1S0NA 5KFFA 2MKCA 1LWFB 3HHKA 2LKZA 1EQ0A 2HS0A 2AJ4A 1RWPB 4U96A 3E01B 2KVQE 2R7QA 1T95A 2VC0A 3JQKA 4NX9A 2DPIA 4CNYA 1VQMS 1HI0P 1R7IA 3R7BB 4NLWA 2JOQA 3V6DA 3NOCA 1HBOB 4C3KA 4K5RA 2FC9A 1JJCB 4J9VA 3MAHA 4DR3F 1OPZA 1X0PA 4NMXA 4X66J 4OI3A 1FX4A 3G71S 1U8WA 1HWIA 2PFDA 4M95A 2A6MA 2WONA 4RPFA 1DZ5A 1S1WB 4MMOA 4WU3A 1D09B 4YB1P 1VRQC 1QAJA 2OO4A 1Z1ZA 1KVJA 2HBRB 2AGOA 1AFIA 5HVHA 1TL7B 4CQ1A 3HT0A 3NGTA 3G6VA 1YJWS 3G86A 4C0BA 3UN5A 3HVTA 1RT6A 4JI4J 1OMSA 4MTPA 5HLFA 5CD4H 3DYAA 1FJGJ 1LW2B 3BZQA 1UWAA 2DIUA 2VHGA 1T9WA 2W4PA 2B4VA 2DXEA 3HKWA 3AOBA 2DNOA 3M2RB 1GQEA 4ID8A 2Z58B 2IM0A 1SI9A 5J2PB 2BQUA 4KIAA 2VJUA 2VBZA 1UFKA 2WOMA 3L9ZA 2C2OB 2ASJA 3TA0A 5L1JA 3TQ1A 2UU9F 3OFGA 1RB0A 3RTVA 4PPDA 3ZNJ1 3BO2A 2NZCA 3LANA 5EUHA 3TQEA 3FZ2A 5C25B 5D15A 1G2EA 2R42A 1LV5A 2DH9A 2HBQB 3WZ0A 2F8MA 3CD0A 3OR2A 1EHWA 1P9QC 4JV1A 4XAKA 3HKZD 3F41A 3IXQA 3EPGA 1YBUA 4WP8A 4ED2A 4LSLA 4YDDB 4DR2F 4WYWA 3J7YU 3ZTSA 2YKMA 3BGFA 2M0GB 3BDPA 4URQU 3TYTA 3M8PA 1SH2A 1RA7A 4YB5A 5D3GB 1OSCA 2Z8QA 1EQMA 3AXMA 4Y3CA 5K14B 3KK2A 2ADCA 1XN9A 3DGVA 3OFFA 3O8WA 2XI3A 1ZBTA 5LMUJ 4ZVRB 2HGLA 3W2VB 3M9NB 4HH0A 2F9JA 4RNFA 1GMUA 4QIWD 3EX7B 2Z2MA 3I4PA 5JVHQ 2Y3YA 1BQNA 3V5RA 4IKAA 3T5JA 4KAIA 1YK9A 5KFZA 1WORA 1DFDA 4MYUA 3JTPA 3PACA 3HULA 3G8QA 3L09A 2ZD1A 4K4TA 5EGYA 3CDAA 2CPHA 2ZOFA 3EICA 2X3DA 4NA1A 1PILA 3TJAA 4I2QA 2HHSA 2MZQA 3J80U 4WU2A 4KHPF 1Q7LB 2HNYB 1DBDA 5IT9U 2V50A 3SEOA 4KKOB 1HWLA 5DQIA 3CCUS 3UDVA 2B56A 2MQMA 4X4OA 4LF7F 1VJQA 2NS1B 1S76D 2CFXA 3VCDA 4DZDA 1RAHB 2QC3A 2QA2A 4QYZJ 1ZH5A 2BRKA 5F0UA 1Y3KA 2P9GA 4KO0B 1S48A 3PJWA 1HBUA 3KFWX 1NK8A 3NG8A 3CD7A 2RILA 3NNAA 2QG9B 5L1LA 2E7VA 1JJ2R 3GIJA 2BE7D 5BXIA 3HJFA 1T8EA 5JXSA 4JI5J 2V69A 1T02A 3RBEA 2W7AA 1MG7A 4OYMA 5CXTA 1RAOA 5B08A 5D8HB 2BJ9A 3IO1A 2XHWA 2GC8A 1XNRJ 4O3NA 4ZIWA 4UQGA 4KPYA 2W9AA 3R5AA 4LF4F 4C8OA 2WRMA 2OFGX 2I8EA 1S57A 2E5LJ 4B3SF 3ILLA 3MXHP 4ECVA 5C24A 1NPRA 4FP9A 3LF0A 2JFDA 2XLKA 2OTLS 2A0FB 1VQOS 5HAOA 3CJKA 3MUTP 1S0MA 1RHRB 4GO5X 3GV8B 2RKIA 1YSJA 1FEHA 3W2WA 1SQEA 4NCAA 2IAJB 4PEOA 3IA0A 3D1QA 3C66A 2YNFA 3G87A 1KBRA 4X4QA 1JNRB 3OD2A 4LJMA 1ZTTA 4FPRA 2CNKB 2VU5A 2JHEA 1DJ0A 2R7SA 2V2VA 4DX7A 1WEZA 4YOEA 3MCOA 3VGVA 1I94F 3KUGA 4DFMA 2H4WB 4OI4A 3WX8A 4R0JA 5KFTA 1LK5A 4NZ6A 4ES2A 2JL9A 3UVJB 4HKQA 3RBXA 3MPUB 2HRTA 3BBBA 3R7NB 2XO7A 4C11B 2AU0A 2YPYA 4FYDA 3TWZA 1FFSB 5IC6B 2AP6A 2KG0A 4JI1F 3EPIA 2E7WA 3R1LA 4CP5A 3T1HF 3FMWA 3L7UA 3IRXA 4RW7B 4WE1B 1W7WA 3H59A 2CJYB 4WIQA 3BV8A 1ZAXA 2FLPA 4ZP7A 2HNZB 3JQMA 1RE1B 3EGZA 3T5KA 2RU9A 2CA9A 8RUCA 2FD2A 3NMAA 1MROA 3UE2A 1OQ3A 4NPOA 3POTA 1X4BA 1SXLA 1N4LA 3UPFA 3V6KA 3DM2A 5IWAJ 2LEAA 1ZM4A 4M5IA 1RT3B 2XWXA 3OL9A 2D3UA 4J9KA 4USWA 5J1EB 1N5TA 2E44A 5J1NA 2RQ4A 1YGYA 4K0KJ 2KL8A 1J2VA 3CJ5A 5HP1B 1BWVA 5D78A 3O6QA 5BYRA 2HQCA 3VHQA 2C2ZB 3I0RA 3AFGA 1SIWB 3PRDA 4BC7A 1XNQF 3NS6A 1N33F 4C3LA 3MMCA 3R5CA 1SCJB 2YTCA 4HHHA 2Z56B 5DZ6A 3Q8PB 1S1VB 2VOPA 3D68A 1UVLA 2HNDB 2KN4A 5HJYA 3BKUA 1RTJA 1VS3A 3NP5A 4KGZB 4ECYA 4LMZA 2E1AA 2DISA 3T6JA 2RU3A 4L74A 3JXOA 3OXLA 2DRAA 4KJIA 4PUOB 2C3MA 4M5DB 4DR6F 3M30B 3OT9A 2IMOA 4M5KA 3M9OB 4G3IA 4JI7F 3CUNA 4DN0A 5JVGQ 1Q1KA 4ZPBA 2ZITA 4LRDA 4Y2MA 3L3CA 1YJ7A 3MAAB 4DV5F 2E9TA 1AT1B 2IYGA 3IBWA 4AYBD 2VFRA 1U6FA 4ZHRA 2RE1A 4X65J 4ITSA 2ZC3A 2UXBJ 1K0VA 4BS2A 2E5IA 4AL6A 2KT3A 3D0GE 2OPPB 5KFQA 2VG7A 3A3OB 4ED5A 2KKHA 2FJXA 2ZJPQ 3K17A 3P6YC 1S1UA 2NPIA 3GFXA 1U1MA 3NS5A 4JI2J 3KUHA 2C1EB 4GKKJ 1FNOA 2JLFA 2CPXA 4DV6F 1S97A 3H0PA 3MEGB 4UUWA 2VOOA 2JFKA 1IQZA 3CJRA 1HBNA 1IKYB 2EEYA 3BGRA 4AD6A 4C8KA 1RWWB 3Q8RB 1FRXA 3TJ9A 4N56A 2DHGA 3I96A 4K4YA 3JS9A 3JAMU 3DMJB 4LBHA 1VHFA 5F8NA 1QY7A 4M8LA 3A8EA 3WIUA 2FJDB 3PZPA 3A8IA 4HI1A 1LEOA 2ZEJA 1KLNA 3V2UC 5BR8J 2M8DB 4N76A 4CM0A 2EFPA 4A8FA 1MSWD 1IBLJ 5E2QA 1RUSA 2RRAA 2Q3PA 1YJ9S 4DZ6A 3ZTRA 5IZHA 3R5DA 4QIGA 1N34F 3W64A 3R9LA 1YJVA 1H2UX 1BD6A 3DI6A 4C6AA 4TKTA 2PEBA 4CYUA 2JWNA 1IWGA 3HPOA 3HSJA 3CGIA 4H4OA 4DDFA 4PQUA 1TU0B 2MDAA 5J2QA 3Q89A 2YPZA 1HNVA 1B4SA 3SFGA 3A3PB 5D6GA 2GJ2A 1NKCA 3UCZP 3TUPA 2KFZA 3BPSP 1NJXA 1RWMB 4LRAA 4CH7A 2GMLA 3IBFB 4WTYA 1GFWB 3UD5A 1OWXA 1NKEA 4RW9A 3CJ4A 3M8WA 2OHDA 4LF8F 4ECRA 5HQMA 2DCLA 2V63A 3HP6A 1UW9A 2AW0A 4A8OA 3OTEA 5CYMB 1X5SA 4U8VA 1UPMB 5HO4A 1NJWA 4QR1A 1EJ7L 3DNCA 2YWWA 1RK8A 1OO0B 3LGNA 2Y1IA 3ADAC 3KLEB 1L3UA 5ETMA 4L3NA 5A0YA 1XEZA 2LVWA 3PJ9A 4UZBA 3OLAA 2BJEA 4D3HA 1ZA2B 3KLIB 3OFHA 3M2VA 5KFDA 4ECWA 2V8DA 3X1LB 3KLHB 3ZZ0A 3MI7X 4QPTA 5D0RA 4QU7A 2O3DA 4PKDB 1HQUA 3R5BA 5A2QU 2XMWA 4CO2A 2F40A 1OYEA 1NK6A 4JUZA 2AEFA 4Y65A 3OFEA 4X84A 3FBEA 4ED4A 3TO8A 1TKDA 1FJ7A 6FDRA 2KRBA 1HARA 1Q5YA 4QWDA 1HHSA 3CF5Q 2R7OA 4ED3A 4P52A 3M8QB 4IQXA 5EX3A 2N3LA 2ZOGA 3RAXA 1ROFA 1AA1B 1IJEB 1U7LA 4ER8A 4GKJF 1R27B 1UFLA 1H7WA 3GFZA 5DLFA 4TYBA 4MK8A 3CC2S 2PEHA 1SQFA 1FK9B 2HAIA 2ZJRQ 4UOCA 4PABA 2B9WA 2DGQA 4DR2J 3TVKA 2O67A 1U26A 5KFPA 5LSRA 2YVSA 4WXOA 3LA0A 1EETB 1CJKB 3F0NA 2HHWA 3DLJA 1H2TZ 3I0SA 1YIJS 4NLPA 2C3YA 4P6QA 1C4CA 3Q86A 4EU0A 2WTFA 2QSFA 2XGPA 4QR2A 3T6BA 3U1NA 2FLNA 3TAMA 3VR1A 2J8AA 3I5BA 2RF2B 1HR0F 3CCES 2M3DA 2RQKA 2VUGA 1FDNA 3FFIB 4OZ2A 4USVA 5J2NA 2CPJA 3SIPB 3T19A 1S1WA 2XG8A 3H8YA 3UR3C 3W63A 1G7CB 5H9FK 4J9SA 2IPOB 3OVSA 2QYCA 2W7PA 1JIHA 4DCJB 4HL9A 1SC6A 2R9LA 5F9LA 1JX4A 4K4SA 1H2VZ 1S72S 4H4KA 2MB0B 4DFJA 5KFLA 2DR8A 4DFKA 2BA9A 2EFVA 1J5OB 4FDFA 5CQGA 1HBMA 4LF7J 4PG5A 3HLUA 2W2MP 3D3CJ 2DH8A 3G6ES 1HPZB 1TKXA 1I3OB 3JSYA 1JLGA 2OPRB 4F4ZA 3KG0A 2D7SA 2DY9A 1D9DA 1BMQB 3KG4A 2H3EB 1RTIB 2GQQA 2F8HA 3OSPA 4BLGA 2E66A 3CWJA 2CYYA 4NYOA 1LFPA 3HK2A 1Q86T 4LVOP 4LRBA 4C3MA 4YP3A 3LAMA 2C2KB 4H4MB 1RKJA 4FYWB 5CCLA 4DSKA 3JYTA 2Z2LA 3W66A 2KZZA 2D69A 2IRXA 1ULRA 2CQGA 2YWHA 1IVZA 5KFEA 3CCSS 1IN0A 1VRUA 4DUTA 4OZ5A 1JXEA 1NPKA 3OTOF 2DGTA 2WSEC 2QL5B 2CQCA 2N4DA 3VVUA 2CJQA 3DC2A 2W9BB 5D3GA 2DTJA 4I0WA 4LF9F 2OPQB 4OYPA 1N0UA 4YB7A 2OI2A 1FXRA 1F60B 2CPYA 4IUFA 2RRNA 2I2YA 2IC3A 1T3OA 3SDEA 1ZAWA 2NSCA 3CJTA 3MR6A 3MM9B 5ETOA 2NR0A 5K8PA 4OYAA 2PO4A 2K06A 1P8GA 3PY8A 1RT4A 3NGKA 1PJ6A 1F2GA 2Y1LB 4PCQA 1F9FA 1I94J 3C16B 3B4DA 4IFVB 1U1NA 3C46A 1WF2A 3MMBB 4LRFA 4LBPA 3H2UB 3ZZUA 4X4UA 3D1HA 3EWGA 4JI1J 2FDNA 3MAQA 1AFJA 3RZAA 4QBUA 4ES1A 4MAKA 1PO6A 2V8PA 5RUBA 3P3DA 3T1HJ 3H5SA 1WG1A 1VMBA 1UP1A 2RQMA 3AJ1A 1JQGA 2CDRB 3TA2A 3RUBL 1RADB 4KYZA 3M7VA 1G1XA 1KQGB 5GADI 5L46A 2VZ9A 5L38A 3OTCA 4IR9A 1VOMA 3KMQA 2BR0A 1CJTB 5F3ZA 4EMDA 1FNXH 2B8PA 2DR6A 1BQMA 3J81U 4CLTA 1T11A 4YB6A 2G1DA 5SUHA 2EK1A 2IFXA 2O01C 1URNA 1X8DA 1SUQA 3CDWA 4A8QA 1C1BA 3MM5B 1WEXA 2L08A 2VODA 5DDRC 1ZAVA 3N6LA 1XNQJ 4G1QA 1FVSA 3FRZA 1RWXB 2WB4A 4IH6A 5B0FA 1HQ2A 3WBZA 1HNXF 1BGXT 1R6YA 2BM1A 2RHQB 3C15A 2PI5A 2M88A 3T3FA 2VPZB 2Y1RI 1TMJA 2PI4A 4QZVB 4C97A 1TUGB 2UVVA 1IKVB 2BVZA 3MZIA 5KFKA 1V3SA 4WK1A 3VGUA 4DG1B 2R8GA 4NLOA 2QL9B 2GMJA 3AODA 3VQTA 3QGHA 3OSNA 2DNKA 2CUYA 1WACA 1CLFA 1Y10A 3HFVA 3QO9B 3QQCD 4HDHA 2I1RA 2IM2A 1RAFB 2I0XA 3QATA 1ZPWX 3I55S 4DR6J 2LXFA 3KXDA 1DLOA 4JI7J 2CJKA 1NK9A 4G1PA 2POKA 4GMKA 5HMYA 3GSIA 4DV5J 2W01A 4JI6F 3UN2A 1FTCA 1VRTB 3KG1A 4GO7X 1HNIA 2P6SA 2ALYB 3LAKA 2GQ2A 2W1BA 3LP2A 3ZZPA 3R3TA 4B3TJ 4NCGB 3RU0A 4B9TA 3CJQA 2I38A 2MKIA 1NPPA 4ELUA 1FEEA 3C6UB 3IWNC 3H7HB 3FC9A 3W9HA 3RBZA 4ZVHA 4DV6J 2BV3A 4FKXA 4DS5A 1AW0A 2GNKA 4K8RA 1ZM9A 4AXIA 1TR0A 1B7YB 2CG8A 1TL4A 3R5GA 4IOBA 4ANCA 3SCKE 2KYZA 3M1VA 3TJ8A 2Q43A 4YN3B 4A8YA 5DQHA 4ANDA 4JBCA 7FD1A 4Q0BA 1UFWA 1S6QB 4OX7A 4DQQA 2WSFC 4TY9A 4JI3F 4O0IA 1FDDA 3W5ZA 2HRYA 5T7LA 2DGVA 3CDUA 3VAIA 1VCTA 9ATCB 4TY8A 3NBPB 2HZVA 1WHWA 1VC0A 3EM1A 3R7SB 1DTTA 2CPIA 2MQ8A 3QBCA 2CAJA 3MR2A 2F1FA 1EZZB 5ETQA 1WG4A 4CLFA 4L72B 2X1AA 2FJVA 1N34J 1KR4A 2DK2A 5ETVA 4JI0J 2QFJA 3MM7B 4LSNB 4CLLA 2DNGA 4WJBA 2KXFA 2WW4A 4DPWA 1SPBP 4NXNF 2HK2A 3MOZA 3KK3A 5E3RA 2GS8A 4L76A 2D9PA 1D9FA 1FD2A 4DU7A 4ZJOA 3BBCA 2HWHA 4KPCA 1NUEA 4LFBF 3VAMA 3UD4P 2ZH1A 1XR6A 1FO1A 3OL6A 2VV5A 4PG6A 1NHKL 1NJYA 1NXIA 5GAHU 2R7RA 1XMOF 2GGPA 2OTJS 4LF8J 3B4MA 4W92B 2A2CA 1JLAB 2DT9A 3V6DB 3KTQA 4K5SA 1IBKF 2HSEB 3ZTPA 1R0BG 3L95X 2XZWA 2DNHA 4B3OA 4DPXA 2QN6B 6AT1B 3AJDA 4EEYA 4NLDA 4NLXA 2DEIA 4OHVA 4ETZA 4I7FB 2DNNA 2P9EA 2WONB 4DPYA 2FQQB 4RX6A 2XMMA 3TAQA 1MU2B 3QGIA 1IKYA 1N88A 4ZLNA 3UDCA 1X4EA 4DV1F 1WOOA 2Y8YA 2HQ3A 3G8TA 1KDNA 1JK9B 1NDKA 1WF1A 3A1YG 3GPAA 4LFCJ 2QA4G 3HVTB 2Y0SD 1GH8A 4J9LA 1RT6B 2IVMA 4MFBB 5HLFB 3ITHA 3DYAB 2Y9HA 1YITS 3AT1B 5L9NA 4DR7F 3G9CA 1X0FA 4Q44A 1SKWA 4BHQA 5KT7A 2U1AA 1S6PA 4P2XA 3QNWB 4DQSA 1U1OA 1N36F 2DKOB 3SSSA 2A1BA 3MFIA 5DDOC 1LWXA 4DLGA 3AD8C 4CT9A 2WOMB 2DRBA 3CMAS 1N52B 4O4GA 2YNIA 1UCNA 4MK7A 2PC6A 1YG0A 2L9NA 4DR4J 2RQCA 5IV3A 3KLFA 3S01A 3PCOB 1IBCB 1YLXA 4CLUA 3OR2B 4C2MA 2HEKA 3M32A 2B9YA 1CJUA 4KT0C 1MMDA 1U1LA 3IP0A 3JSRA 2GIRA 2YKNA 3ONQA 4LSLB 4NEZA 2RUSA 2UXDJ 3JQJA 1F2HA 4QYZK 3EZ5A 2YKMB 2J6TA 1L3KA 1U1KA 2NQPA 2XMAA 4ZLLA 3GLJA 2HQIA 2C3OA 4I6YA 2F8EX 3M8PB 1CEZA 2HQGA 3T1YF 2DJWA 5KG0A 1FERA 3HSDA 5KG4A 2MLZA 3OR1A 3MPYA 2NUHA 1Q0NA 3KK2B 3W5YA 3BGOP 2AYBA 3OTBA 2VQFF 3GJTB 1RGVA 2NPFA 1S6UA 5CYMA 1B64A 5E3QA 5CAAA 2OSRA 4C8NA 1O51A 1BQNB 1IKWA 2JZ5A 4XPCA 1K73T 2BUNA 1FKOA 3U1MA 2BX6A 2FJAB 2G0CA 2AJ1A 1VYAA 1FX2A 2VPXB 3I6PA 4ZVPB 1TV6A 2ZD1B 4DPOA 1ZTWA 2EXUA 3HX9A 5KT5A 4R25A 1DARA 2BM0A 1CBKA 2CZ4A 3ZTOA 4HYKA 1QM9A 4OX9F 4I2QB 1ZM3A 3F44A 3QWPA 1GX6A 4QW9A 4TVAB 2XZTB 2JX2A 3L7PA 3D28A 4NRUA 2ASLA 3B54A 4WZMA 4QWCA 1HNWF 4DV4F 4O3RA 3V81A 4DUYF 2H5IB 3BEGB 4YEAA 2XNQA 2ZOMA 2VFTA 2XYHB 2OPSA 1HBUB 2F63A 2BW2A 5AXNA 4R5PA 3SXLA 1YDLA 3CO9A 1JLEA 1S12A 2XQCA 2EG2A 2V9KA 4IOAQ 4RBUA 1PC4A 4EBEA 1VK8A 1FT8A 3UN3A 3OLBA 3K2YA 5CYJA 4ZS6A 5DQGA 4ID5A 3CIZA 2QX0A 4LFAF 1AZSA 3GQCA 3BDEA 3OTOJ 1M1GA 3F73A 3FEZA 5L9XA 3U1LA 1HMVA 2FYXA 1RAGB 4LF9J 2UUCF 3MPWA 1UPPA 5C24B 4YFUA 3MURP 2K2PA 2XLJA 4HT7A 4I1TA 1NZ8A 4ZPCA 2RKIB 2H4YB 4EYHB 2CJ9A 3PYFA 3W2WB 2KXHA 2XMUA 2CQDA 1VI7A 2AYMA 5ETPA 5DG9A 2YNFB 5B0AA 5A6PA 1Z2LA 2NXJA 1TVRA 1TP7A 2UP1A 1K8AT 1OY8A 3K0JA 2WW8A 1JXVA 1I1GA 3R5JB 2XHCA 1YJRA 2XC9A 4RU2A 2QMUB 3AXKA 1XMQF 1MN9A 2BJ7A 2AX1A 5G0RA 5HMWA 2J6UA 4U7CA 3ZTQA 4A8MP 4RJVA 1UVNA 4UY8T 3ENAA 4Q43A 4A8KA 2DH7A 2MZTA 4I64A 3CJ0A 2J9CA 5GMDA 3U02A 2FJWA 3T9NA 4LF5F 3PTWA 3N4WA 3MTKA 1UMJA 5A8RA 1NSQA 4ELVA 3IRXB 1VQ8S 1VBZA 2N3OA 3TOQA 4AT1B 1F3FA 1UKUA 2OFHX 4E98A 5J1PA 2OPRA 4NOHA 2UZAA 4O4RA 2IA0A 1R8BA 3DOKA 2B9EA 1MN7A 1CC8A 2OH2A 3Q22A 1DHMA 4LQ9A 3HJVA 4Z7CA 2J0WA 2XYGB 4MKYA 4ZPAA 2VFUA 1MROB 4FXDA 3POTB 4ZDNA 4ZCMA 4U67Q 1YRXA 1SBRA 3DM2B 4WFAQ 3MGJA 4QIEA 4IRKA 3EGVA 4DJBA 1YRTA 2LA6A 2AJ2A 2ZUGA 3D54A 3IM8A 1JKHA 1S1XA 1GXTA 2XB2D 3ULHA 1C1CA 1C2PA 7FDRA 5DO2A 1FE4A 3GYNA 2LMIA 1A7GE 1S1TA 2MJNA 2AYGA 3ZZZA 4FS2A 3IG1A 5KG5A 2RDJA 3I0RB 4OX6A 1EAYC 3R2CJ 2AHOB 2K1RA 3NWRA 2D3OR 3MMCB 1Y5NB 4DBQA 1J5EF 1WHYA 3QLHA 1HNXJ 3DRSA 3DXSX 5B7WA 1X7VA 3CCVS 1OQ6A 2V0NA 5IQ6A 1R8PA 4C7QA 3MM9A 2BMBA 4ZMMA 4QJVA 1RTJB 3BF4A 4FVCA 2XMTA 4F4AA 3UQSA 5HN0A 4ZLPA 4DV3F 3TP2A 1WKJA 4F3MA 2FC8A 2A3JA 3PR5B 5D4OA 4CT8A 4CDIA 4I67A 3BSOA 1X9SA 3PFOA 4OV1A 1KKHA 3MMBA 4F0MA 5D0HA 1H0HB 1X5PA 2AJQA 1RHQB 1UZDA 1S4FA 5KFHA 3GILA 5U47A 3PYEA 2JNJA 2LDYA 2R7TA 4J7CA 3ET6A 4HHUA 2HHTA 1KQKA 2ZNZA 3H5YA 1IUJA 2HZCA 5A8WA 2OLWA 4JI6J 5HROA 2R2SA 5GVQA 2VDIA 4CO0A 2MJUA 4CI0B 3GJQB 2W25A 4I4BA 2W9CA 3P45B 2IJFA 1YX2A 3GP9A 1S9EA 4TQSA 4ZHRB 1HYSB 4FN5A 1NH8A 4O3SA 2CJAA 3AY0A 1HD0A 1MW7A 4AE5A 5F9NA 1IM6A 3ZZYA 4DQIA 3FBBA 2VG7B 1HKAA 3Q8SB 4JYAF 4Z2XA 2GJFA 4DSEA 2AV5A 2F9DA 1HL6A 1RZMA 3PM9A 4GVBA 1S1UB 2GZOA 2FHKA 2CVIA 4KB7A 3UCGA 1MMLA 2P2CB 4DR5J 2B8QA 1UVMA 2D3O1 5LM7E 4X4RA 2HLTA 4DFPA 3AD9C 5AXKA 5D0GA 1RABB 2HYIB 3UWTA 4I6AA 1U2CA 2BKNA 2V34A 3DLGA 1NHVA 5F8HA 2GHPA 4UY85 4TXSA 1HBNB 3BGRB 5KFGA 3BKTA 1AUDA 1E6VA 1S77D 2MZJA 4PG8A 3I31A 2HVDA 4WFXA 2ZH6A 2UXCF 1M5HA 1VC6A 4RO0A 4N41A 4W4MA 3NKYA 3BSNA 5B0DA 4ALZA 1TTHB 1HA1A 2VPWB 3DRRA 1R89A 4IO1A 3GONA 3A13A 3WDOA 4ELTA 2CWKA 2EK6A 1YQHA 1U25A 4M5HA 4IH5A 2C2NA 3MMJA 1BWEA 2LFVA 3BN4A 5AJ3F 4ZVSB 4ZVQB 1QE1A 4JI8J 2MKSA 2ZE2A 4K2XA 4ES3A 1EB0A 1REGX 2DNYA 2GV1A 2XMKA 1F6TA 1KFDA 3CCZA 2KZMA 2MZRA 3SI8A 4UZCA 2EKYA 1KQSR 1LWEA 2CPZA 2GVDA 2BZ2A 3DI6B 4CYUB 2GW8A 2JVRA 1FRLA 4H4OB 3RBDA 4R0EA 1HNZF 5J2QB 2K3KA 1Z4UA 1IWAA 3QIDA 1HNVB 4XK8C 4QWAA 2V94A 4X4TA 1QSSA 4NA3A 2PMHA 2ZWOA 3MMAA 4UOHA 4IR1A 1PC5A 2ERRA 5KG2A 3JTNA 3IRWP 3RGIA 4Z37A 3IS9A 4C48A 2ZHBA 1XMOJ 4RW9B 2FVPA 3O44A 1WDTA 5KG3A 2ALZA 2XCAA 1IBKJ 2PT0A 3H4DA 1WC0A 4CO5A 5HMXA 3BGUA 1R0CB 1WC4A 3CPWR 1GMWD 2IHR1 2RS8A 4C98A 3W8GA 2DD8S 1FTRA 1PJ5A 5A0YB 1YKWA 4DV1J 5D4PA 3CCTA 3CB4A 1UA1A 4H4KC 3M2VB 2OSQA 1GMVA 3VZIA 3CMQA 2W2QP 4RWWA 4KV8A 2HZAA 4X64F 4FXWA 3GSDA 1NJIT 4DWIA 2KTQA 2UVWA 2ROPA 2HWIA 1HQUB 3PW7A 3CW2C 1R8AA 2WVCA 1FNMA 2MY7A 1KP6A 4OYIA 2ZWPA 4LF6F 4LR8A 5DM6Q 1SJRA 4F2RA 4RL1A 3FQLA 3D6FB 4KE5A 5FLXU 3DKDA 4J9RA 2UUBJ 1NHUA 1LOUA 1YZ7A 4A8SA 1U4BA 2Y8WA 3EVWA 2DVIA 1QSLA 4DQRA 3M8ZA 2GVZA 3PX0A 1WEYA 4RR5A 4F50A 1S0VA 2OEKA 2ZKTA 3DOLA 4ZN3A 2CRLA 4P2MA 2WK4A 1F9HA 2KM8C 1D3WA 3QAEA 1B70B 1JB0C 2RH3A 5IT4A 2HMIA 1X5OA 1TKTA 1MLAA 1U2RA 5KFNA 5DRKA 2WBRA 3FNNA 4ZVUB 3R6LB 1T9YA 3HZEA 3OJSA 3TW0A 3T1YJ 3I0SB 4HLBA 2FZKB 1S79A 5D4LA 4N8OA 3RR8A 4Y2AA 4WKRA 2WVEA 1JLAA 1KN6A 1K47A 3NWGA 2CQPA 3TAMB 3PG9A 2H1YA 3UFCX 4Y28C 1OYDA 3BR9A 1N32F 1VR6A 5KFWA 1BXNA 1DY3A 2ZZTA 4KBIA 2CWXA 4I7FA 4K4XA 1N5QA 1RU2A 3H42A 1NDLA 5J2NB 5JMNA 1MU2A 1A0OB 4F4YA 2BKOA 4A8WA 1NK0A 4AQYJ 3CULA 3C14A 1FWLA 1O5JA 3PW2A 1WC5A 2AGQA 3DLBA 3FGVA 3TEHB 1SVDA 1VFJA 4FYVB 1JMTA 2N82B 4DL7A 4OX9J 2IY5B 4OZLA 3TZYA 3RB0A 2XZDB 4MFBA 1WHXA 3BQ1A 3HVAA 4LSZB 2C42A 3PEHA 1HBMB 1Q5VA 2HFNA 1R8CA 2WVFA 1TKXB 4DUYJ 4OHYA 1JLGB 5DGAA 2HRUA 5L1KA 5DDPC 1XIQA 3GJSB 1VIOA 4OZJA 3G6YA 3TZWA 5LXYA 2DCUB 4IOCQ 4FYYB 1VQKS 1TFYA 3QIPA 2YQ1A 1KLMA 3FUYA 1URRA 4X62F 5IS2A 3PKMA 5KFBA 3HXMA 3JYTB 1GNKA 1EP4A 5KFCA 2NCKL 1XTZA 3QPIA 4OZ1A 1VRUB 3P49B 1XWLA 4D3GA 4OFZA 1VLOA 1RISA 2XBPA 2ATCB 2GMHA 4XDCA 3N9UC 3DLHA 4LF2A 4R8UA 4DX6A 3PKYA 3CNQP 1RHUB 3CC7S 3LGMA 3ZC4A 1T9VA 3MEKA 2QLFB 1FCAA 4ZP6A 2DRDA 1RT1B 4LQ3A 2AMCB 4J9OA 1S9FA 3RRKA 2PD1A 3N6MA 2NUUG 3CCQS 1U1PA 3LOUA 1KRPA 2BYCA 2BE9B 4ZPVR 3R97A 4QYRA 2IC3B 2Z57B 1Q4RA 3TEGA 3SDEB 1WTFA 4CLYA 1BUXA 3FCVA 1RT4B 4QIVA 4RU9A 4YHHJ 2MTLA 4YY3J 3D4JA 1T0TV 4OMFG 5CCMA 4EZ9A 1XMQJ 3TUIC 1PAEX 4PXCA 1UL3A 3K89A 3QFWA 1F5AA 4CLKA 2V67A 2Q1LA 2R7UA 3AQPA 4X66F 1Q8KA 4M63A 3F56A 2VG6A 2J6SA 1DTQA 2B5JA 5HJXA 1JJ4A 3W3SA 4G65A 3ISZA 3HDSA 3CC4S 2ROEA 2F5GA 1QDUB 2IM1A 2ROGA 3SV4A 2B3TB 3C3LA 3BQ0A 1FJEB 1T03A 4PXDA 5LXRA 3CDBA 2LXUA 4NEYA 3KDOA 2XSFA 3ENWA 1SQGA 4M5GA 5KFXA 4OYBA 2OP5A 4A46A 4B3RJ 1WSVA 1Q7YT 3HHLA 1FJGF 2X1BA 4RW4A 2ASDA 4ZJQA 1XC9A 1RTHA 2CG4A 5LSOA 3FDSA 5T14A 4AFFA 2VIHA 1BQMB 2NYIA 4K4UA 2ACMA 3MM6A 3DLEA 3PHTA
chains in the Genus database with same CATH topology
4LF5J 4JI0J 3JAMU 4DV6J 4LF6J 5A2QU 4DV7J 1HNXJ 4KY3A 4NEZA 4JI5J 4X66J 4AQYJ 2UU9J 2UXDJ 4LF9J 4DR3J 4K0KJ 2KL8A 2UUCJ 4PWWA 4NXMJ 4LFCJ 4JI8J 5AJ3J 4X62J 4NXNJ 3J81U 3R2DJ 2F4VJ 4DR6J 4X65J 4JI7J 1I94J 1XNRJ 4DR5J 4OX9J 4DV0J 1HR0J 2ZM6J 5LM7E 4DV1J 1J5EJ 1HNWJ 4DV4J 4JYAJ 2UXBJ 3D3BJ 4DR7J 5BR8J 4LF4J 2HHHJ 4NEYA 1N33J 4LFBJ 4DV5J 3J80U 2VQEJ 1IBMJ 2E5LJ 2VQFJ 4B3MJ 4GKJJ 2MEWA 4B3SJ 5IT9U 4KHPJ 4JV5J 1HNZJ 1N36J 1IBLJ 4LF8J 3T1YJ 4JI3J 4B3RJ 4JI1J 5LMNJ 4DUYJ 4JI4J 4JI2J 1XNQJ 3IMQJ 4GKKJ 4HHUA 1FJGJ 4DV3J 4DR1J 2UXCJ 4B3TJ 3T1HJ 4DUZJ 4DR2J 4JI6J 4RJVA 4DV2J 4DR4J 4X64J 2KVQE 1XMOJ 4YHHJ 2MTLA 5IWAJ 4YY3J 2MQ8A 2UUAJ 4KYZA 4V1Ak 5FLXU 4LFAJ 5LMUJ 4LF7J 3OTOJ 1XMQJ 3J7AN 3D3CJ 1N32J 2UUBJ 1IBKJ 3R2CJ 3W1YC 1N34J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 J;  4JI0 J;  3JAM U;  4DV6 J;  4LF6 J;  5A2Q U;  4DV7 J;  1HNX J;  4KY3 A;  4NEZ A;  4JI5 J;  4X66 J;  4AQY J;  2UU9 J;  2UXD J;  4LF9 J;  4DR3 J;  4K0K J;  2KL8 A;  2UUC J;  4PWW A;  4NXM J;  4LFC J;  4JI8 J;  5AJ3 J;  4X62 J;  4NXN J;  3J81 U;  3R2D J;  2F4V J;  4DR6 J;  4X65 J;  4JI7 J;  1I94 J;  1XNR J;  4DR5 J;  4OX9 J;  4DV0 J;  1HR0 J;  2ZM6 J;  5LM7 E;  4DV1 J;  1J5E J;  1HNW J;  4DV4 J;  4JYA J;  2UXB J;  3D3B J;  4DR7 J;  5BR8 J;  4LF4 J;  2HHH J;  4NEY A;  1N33 J;  4LFB J;  4DV5 J;  3J80 U;  2VQE J;  1IBM J;  2E5L J;  2VQF J;  4B3M J;  4GKJ J;  2MEW A;  4B3S J;  5IT9 U;  4KHP J;  4JV5 J;  1HNZ J;  1N36 J;  1IBL J;  4LF8 J;  3T1Y J;  4JI3 J;  4B3R J;  4JI1 J;  5LMN J;  4DUY J;  4JI4 J;  4JI2 J;  1XNQ J;  3IMQ J;  4GKK J;  4HHU A;  1FJG J;  4DV3 J;  4DR1 J;  2UXC J;  4B3T J;  3T1H J;  4DUZ J;  4DR2 J;  4JI6 J;  4RJV A;  4DV2 J;  4DR4 J;  4X64 J;  2KVQ E;  1XMO J;  4YHH J;  2MTL A;  5IWA J;  4YY3 J;  2MQ8 A;  2UUA J;  4KYZ A;  4V1A k;  5FLX U;  4LFA J;  5LMU J;  4LF7 J;  3OTO J;  1XMQ J;  3J7A N;  3D3C J;  1N32 J;  2UUB J;  1IBK J;  3R2C J;  3W1Y C;  1N34 J; 
#chains in the Genus database with same CATH topology
 1CVJ A;  4Q5V A;  4GRS A;  4F8R A;  1FFG B;  1SUQ B;  4C0H A;  1C1B B;  2QT7 A;  3OVA A;  1VQL S;  2NRE A;  1NB7 A;  4ZP8 A;  1Q53 A;  1QVF R;  1CG2 A;  4G1Q B;  1TKZ A;  2QTW A;  5JJB A;  2HVZ A;  2HUR A;  1J5E J;  3MF5 A;  4PRF A;  1GK8 A;  5C5J A;  1KHW A;  1H7X A;  3EMT A;  1M5K C;  4CTA A;  4WZQ A;  3K57 A;  1C0U A;  3C15 B;  2KG1 A;  4C8Y A;  2X1F A;  3HM9 A;  3PXG a;  2YBV A;  1HFE L;  2FIU A;  2VBY A;  4H54 A;  2BAC A;  4DV3 J;  3MED A;  3VAG A;  1BHN A;  1QAI A;  2ABY A;  4QCL A;  2HW3 A;  2EBE A;  3MEC A;  4USJ C;  2J7W A;  2CKW A;  3HSZ A;  3ZO7 A;  1DLO B;  3DLK A;  2MMY A;  4QWE A;  1FFW B;  2N4C A;  3GIR A;  3FZB A;  2CPF A;  2B6A A;  2FTR A;  2JEJ A;  2F4V F;  2XS2 A;  3KNA A;  4C9D A;  4B9U A;  2DYA A;  1HWK A;  2OD4 A;  1TK5 A;  2H9Z A;  5F8I A;  3NL0 A;  2BAB A;  2B4U A;  1WI8 A;  2M8H A;  2DR9 A;  1VQ9 S;  1HW9 A;  3DCA A;  2V2K A;  4ED8 A;  1HNI B;  1RBA A;  3LP2 B;  1Y7P A;  3IWX A;  1IJF B;  3PW0 A;  4IFY A;  4ECU A;  2PDA A;  4JYA J;  1TL1 A;  2FVS A;  2UUT A;  1MWZ A;  4RKU C;  2EVZ A;  1KHV A;  3PVX A;  4ERD A;  1REV A;  2V8V A;  1SJ4 P;  3VV2 B;  4URS A;  1OIA A;  2A18 A;  4UT4 A;  3Q8V A;  2LQJ A;  4NZ7 A;  4KGV B;  4J37 A;  4KGK A;  4V19 J;  2LQ5 A;  3TI0 A;  4J9Q A;  1VQS A;  4DUZ J;  3DU5 A;  5DDQ C;  1M0S A;  2AGP A;  1Q8B A;  2RVJ A;  4LRE A;  3E8O A;  5F3T A;  2BAN A;  3M1V B;  4CNZ A;  1RAE B;  3RW7 A;  5C7P A;  1NK4 A;  2ZFH A;  2EFQ A;  3Q24 A;  2RSQ A;  3ENQ A;  4JI5 F;  1JWW A;  1U6B A;  2CQ1 A;  3K5L A;  4Q0B B;  3VQS A;  4U8Y A;  1SC1 B;  4NXM J;  4YUD A;  3E51 A;  5HBM A;  3RYL A;  5T7L B;  5ITH A;  3IN5 A;  4CRJ A;  1S6O A;  2YKA A;  4TY8 B;  1N8R T;  2JEF A;  2YKQ A;  2M52 A;  3MTJ A;  3RW6 A;  5DZ7 A;  3OJU A;  2E5L F;  1DTT B;  3KOA A;  2VQE J;  5KOX A;  4QIF A;  4KTQ A;  3T1A A;  3GV7 B;  3MCS A;  2IM3 A;  3BGL A;  3ELH A;  4RNH A;  3WHI A;  3J80 Y;  5K5M A;  3PV8 A;  3PYG A;  2P5V A;  4URG A;  1WKK A;  5IT9 Y;  4O0N A;  2V4R A;  4CH1 A;  2CPD A;  1R31 A;  1TQL A;  4M5L A;  4ZCL A;  4KR0 B;  3KK3 B;  5HK4 A;  4ECX A;  1FHT A;  1UVJ A;  4CLS A;  3TAR A;  2JJ4 D;  4JP8 A;  4Y2I A;  1HYS A;  2OML A;  1NK7 A;  1GX5 A;  3J81 j;  5KFV A;  1OPI A;  4UST A;  2QMW A;  5D4N A;  4X4S A;  2MXY A;  2EC2 A;  1QD1 A;  3W62 A;  3D67 A;  2JVO A;  4N7T A;  1GAO A;  1VQ5 S;  1HHT P;  1UTA A;  2GGP B;  5D0E A;  1LK7 A;  1VIX A;  1UWB A;  2NXN A;  3M6X A;  3SQG A;  1RT5 A;  2ZM6 J;  2XY6 A;  4A8X A;  2XI2 A;  4B3O B;  2N7Y A;  2MHE A;  4EFA C;  1SV5 A;  4ED0 A;  1G6B A;  1KQF B;  4TU7 A;  1U48 A;  1RWV B;  5CHC B;  1WD6 A;  1QLN A;  1TAU A;  3PIO Q;  1C0T A;  5HL7 Q;  3D7S B;  2BQR A;  1NJZ A;  2HVI A;  3GR0 A;  1B3T A;  2HBZ B;  1RT2 A;  2MKK A;  3TVY A;  4HT5 A;  5EDW A;  2WBM A;  3SSQ A;  4PYA A;  3G4S S;  1A6L A;  3Q83 A;  1S7I A;  2OEM A;  3PX6 A;  3I5A A;  1NZA A;  4X64 J;  5IWA F;  4KRW A;  5KFA A;  3ITH B;  1U2F A;  4U95 A;  4J9N A;  1NKB A;  2CQI A;  3T5H A;  2P9C A;  3FQK A;  4LF6 J;  1VBY A;  1S6P B;  1HQE A;  4K0K F;  2W2P P;  3GMG A;  1TL3 A;  3UCU P;  2YKP A;  1LFW A;  4P7T A;  4DXL A;  2ZUA A;  5FD1 A;  2EFO A;  2X1G A;  3DDN A;  1V3R A;  4O4G B;  4DSL A;  3FMB A;  2YNI B;  1P9Y A;  2HG4 A;  2M9K A;  1FKP A;  2YQ0 A;  2E29 A;  1AB8 A;  3B8H A;  1RTZ A;  2CZ9 A;  4Q2M A;  1Y11 A;  3KLF B;  4I2P A;  2IBO A;  3BYR A;  3W60 A;  2W8K A;  3M32 B;  2DR7 A;  3N6N A;  2UUA F;  1CJU B;  4USK A;  4ZVE A;  4CLZ A;  2YKN B;  4F7V A;  1IR0 A;  3GCX P;  5I42 A;  5DG7 A;  2XO6 A;  4FVM A;  1WKL A;  1N5Y A;  4Y00 A;  1FXL A;  2JLE A;  5KFR A;  2PFF B;  4LUB A;  5I3U B;  4ZN1 A;  3BQ2 A;  1RHJ B;  2MQN A;  5KFS A;  2LU1 A;  1H6K X;  1UVK A;  3OR1 B;  3PO4 A;  1N54 B;  3H2V E;  1NCL A;  3S8S A;  3BPD A;  2HHQ A;  3H40 A;  1X9M A;  2I5J A;  2EFN A;  2CQ0 A;  4DR3 J;  3GZ7 A;  3D1O A;  5I4M A;  3AA8 A;  3BH7 B;  4HTJ A;  4MIW A;  3GYX B;  1R8H A;  4X65 F;  4OI6 A;  1IKW B;  2QSW A;  1D0E A;  4NLR A;  2ZHO A;  3QAU A;  1ZYQ A;  2YWK A;  1RQ0 A;  1FKO B;  1VQP S;  1K0T A;  4OV6 A;  4DN9 A;  4DR1 F;  4MH8 A;  2YY3 A;  4LVN P;  3QGG A;  1ZA1 B;  3THT A;  4QPX A;  1RP5 A;  2XGQ A;  1TV6 B;  1KON A;  4HAC A;  4ICL A;  4EGL A;  4Y6I A;  3QSI A;  4M94 A;  4JI2 F;  2RS2 A;  4WII A;  4RNM A;  4NLU A;  5H9E J;  4UW2 A;  4MIB A;  2V8H A;  4OYX A;  1YJU A;  2MQP A;  1NBE B;  2CJB A;  4FXV A;  5AE1 A;  2QLJ B;  3Q8Q B;  3CCL S;  4WP3 A;  3OQ2 A;  2ZHA A;  2XSJ A;  5C2C A;  3DGP A;  3V81 B;  3LO3 A;  3UDL A;  4KGX B;  2YQ3 A;  4RW8 A;  3H25 A;  5IT0 A;  4KY3 A;  4F0H A;  2UU9 J;  2OPS B;  2KI2 A;  4LT6 A;  2OD6 A;  5A6W A;  3NGU A;  3D5M A;  1APS A;  1F5B A;  4R5P B;  2LEC A;  3TZX A;  2Q6B A;  2RML A;  4X62 J;  1JLE B;  2RUG A;  4FNH A;  3QT5 A;  1TL5 A;  1FRM A;  3ZZR A;  1OY9 A;  2ZBR A;  1U1R A;  1WJ9 A;  5LSL A;  1L5U A;  3V4I A;  5BR8 F;  3KKF A;  3FEY B;  3J7Z T;  4EZ6 A;  1NSK L;  4ID5 B;  2F3J A;  3K7R A;  1U1Q A;  1X4G A;  1AZS B;  1P1T A;  1IBL F;  2QO3 A;  4WFZ A;  1SIZ A;  1LKZ A;  1YRU A;  3ILI A;  3HI9 A;  4LIR A;  3KJV A;  2MST A;  3LUY A;  3E2E A;  1HMV B;  3H90 A;  2KHC A;  3TVZ A;  5IC4 B;  3P5B P;  5E33 A;  4TU9 A;  5EWG A;  3G6X A;  2OIH A;  4NRT A;  2L9D A;  3MM8 A;  1PSD A;  3ZZO A;  2G4B A;  8ATC B;  1DQ8 A;  2J0Q D;  1RA6 A;  4ED7 A;  1CUL A;  5A76 A;  4L73 A;  3W1Y C;  2F7V A;  1KD1 T;  3CED A;  5D77 A;  1D8Y A;  1TVR B;  4PZV A;  1D8Z A;  1RXO B;  3DOM A;  2R2T A;  2HLU A;  1XBW A;  2ADB A;  4B3M F;  4PR6 A;  2CNO B;  4LR9 A;  4DCP B;  3VAJ A;  3JAM Y;  2R8I A;  4DSF A;  1O0P A;  4NZ0 A;  5G0R B;  3NNH A;  1YZ6 A;  2E5H A;  2Z0G A;  2BBE A;  4HH1 A;  3TUJ C;  2RAQ A;  1L3S A;  1SJQ A;  1QAX A;  4Q7A A;  3FK4 A;  3G2X A;  5MAO A;  1VBX A;  1HI1 A;  1SB6 A;  1FRH A;  4BC9 A;  4KHP J;  1RDR A;  2CQH A;  2QA4 S;  4FF3 A;  2AZ3 A;  3T41 A;  1CQM A;  5A8R B;  4E8U A;  3IMQ J;  3HO1 A;  1CS4 A;  3NGD A;  1KOO A;  3ILO A;  3KLG A;  2R2R A;  4FPI A;  3DOK B;  4MYT A;  3HFZ B;  4ZPW R;  1GMW A;  1T05 A;  5M2P A;  4O44 A;  1NSP A;  3VAF A;  5F0W A;  3UNY A;  5CYQ A;  2E1C A;  4CM2 A;  2HGM A;  4B9N A;  4ZPD A;  3PR4 A;  4OZ0 A;  5J2M A;  1WDD A;  2CPE A;  2Y0B B;  3OL8 A;  4PWW A;  3X3U A;  4WTO B;  3PIP Q;  5ETS A;  1JKH B;  2L41 A;  2NYH A;  4P74 A;  1S1X B;  1SH3 A;  3OL7 A;  2K7J A;  4K4V A;  3VZH A;  1C1C B;  2VC1 A;  5LMN F;  1FI4 A;  4KQZ A;  5EX0 A;  1RYR A;  4NI2 A;  4LF4 J;  1G4C A;  4OZ3 A;  1S1T B;  5L1I A;  3LWM A;  3IG1 B;  3JB9 k;  1NME B;  1R0A A;  4B3S J;  3GCW P;  2C2E A;  1RT1 A;  2BW7 A;  2IRU A;  3EDQ B;  1SJ3 P;  1QJH A;  2K1R B;  3M8R A;  4NML A;  4HR2 A;  3SCJ E;  3VAK A;  4NLT A;  1RAC B;  3QLH B;  4P73 A;  5C2G A;  3H2L A;  3DRS B;  3K8W A;  3AOC A;  5CZX A;  3QGP A;  3KHR A;  1Q81 T;  4J5O A;  4TLQ A;  1VJW A;  3R8Y A;  2V2Q A;  1RT7 A;  1ZM2 A;  5C42 A;  1RAI B;  3GG1 A;  1RU1 A;  2XY5 A;  5GAH I;  1I5O B;  3CT9 A;  4C0O C;  2OAU A;  5K20 B;  3IFE A;  5F8J A;  4PWU A;  3I9V 9;  1NDP A;  3HHE A;  3D0I E;  3V6H A;  4GC7 A;  1SH0 A;  3J7Z 5;  1NK5 A;  4EO6 A;  2ZDP A;  2GIQ A;  3CTR A;  4DPU A;  3DXB A;  3K58 A;  1WF0 A;  3N01 A;  3S6E A;  1EAR A;  4USI A;  2F4V J;  4Y34 A;  2DR5 A;  5A2Q Y;  3ET6 B;  5EWE A;  4C8L A;  5E41 A;  3LP0 A;  3AA9 A;  4YDX A;  5A8W B;  3BB5 A;  1M5S A;  4EWT A;  5HRO B;  1H72 C;  3AOA A;  3A8J A;  4DL2 A;  2ZVI A;  3OHA A;  2IRY A;  2W9C B;  2DPJ A;  1S9E B;  1WG5 A;  1N5V A;  2FLL A;  1Y00 A;  3M6V A;  1GEH A;  2MLY A;  2V4Q A;  1UJ4 A;  4P75 A;  1W2I A;  3LPE A;  4EUV A;  2XTJ P;  2HIQ A;  2MGZ A;  1UEU A;  2XLI A;  2FY8 A;  2C3U A;  4NE9 C;  4YS2 A;  2M5Y A;  2G0I A;  2DNR A;  3BM7 A;  2YWE A;  4GVB B;  4FBT A;  3OUY A;  4UTG A;  2LLZ A;  2VPY B;  2G9O A;  2NZ4 A;  4IO9 Q;  3IC1 A;  4W90 B;  5AXL A;  4DF4 A;  2QIF A;  2LEB A;  3Q8Y A;  2XNR A;  4XDD A;  3DLG B;  4DEZ A;  1SL0 A;  4K59 A;  2J9E A;  3OTD A;  2DY1 A;  2VKZ G;  1RKI A;  1VQY A;  1CJV A;  1X60 A;  2AF6 A;  3QJP A;  2XS7 A;  5HQ8 A;  2KVI A;  1E6V B;  3CCW A;  4IG0 A;  2CQ3 A;  1G3O A;  3QT7 A;  1IKX A;  3BO3 A;  5E3P A;  3TAN A;  2MZS A;  2HS4 A;  2RT3 A;  3PHE A;  2GO8 A;  5CZV A;  1N33 J;  2QLB B;  5DGB A;  3DRR B;  2D74 B;  3MD3 A;  3LTO A;  1E6Y A;  4CO4 A;  3IAM 9;  1X9W A;  3TR5 A;  3NMR A;  2BJ3 A;  2R7W A;  1QE1 B;  3D9B A;  2ZE2 B;  1CQN A;  2QEX S;  3OXG A;  3MD1 A;  3FSY A;  2IA6 A;  3BN7 A;  5FDL A;  1ZZN A;  3C2P A;  4IH7 A;  2XY7 A;  3GFH A;  1LWE B;  2GVD B;  5KFU A;  1WC3 A;  3I5C A;  3TA1 A;  3UW1 A;  4X2B A;  3NOG A;  4IYQ A;  3LP1 A;  2LA4 A;  1H98 A;  3OW2 R;  2HHU A;  3D6T B;  4M5M A;  2KT2 A;  2OMO A;  3FBC A;  2A6O A;  2DHX A;  4J9M A;  1JLC B;  3MMA B;  1V6H A;  2ZH5 A;  3FVY A;  2RDD A;  3K59 A;  3M6U A;  3CME S;  3IS9 B;  3RB6 A;  2J9D E;  3DLL Q;  5CD4 A;  2AQ4 A;  3PRB A;  3I32 A;  2R8K A;  1S7H A;  2VD3 A;  3E3X A;  2DIT A;  4RNO A;  4P7V A;  3BYP A;  4PG7 A;  3Q23 A;  3GYG A;  3QMQ A;  3W5X A;  1AYE A;  1TK0 A;  1VLY A;  4GC6 A;  4PXE A;  3D6H B;  2PA3 A;  4WWS A;  1DQA A;  3QYY A;  3PFE A;  5HMZ A;  1U0H A;  2O1P A;  1Y5L B;  1YWX A;  1MWQ A;  4FF1 A;  4KV8 B;  4NWB A;  2IMW P;  4CIO A;  2L9W A;  2OEJ A;  4P72 A;  4RUC A;  3GB0 A;  1ZET A;  2FZC B;  4IDK B;  4OZN A;  2AZ1 A;  1HWU A;  2NLW A;  3GJR B;  2W4C A;  3I87 A;  4P71 A;  4W98 A;  4ED1 A;  5KG6 A;  4X4P A;  2CAD A;  4WFN Q;  1NB2 A;  3QWU A;  4ZVF A;  5E3A A;  3N5B A;  3CD6 S;  5CA5 A;  1LQ9 A;  2MY8 A;  2E9Z A;  5IXU A;  3G82 A;  1N0V C;  2HS3 A;  5HQL A;  4FS1 A;  2PE8 A;  5IV4 A;  1U47 A;  3EZU A;  2ZBP A;  3LH2 S;  2IVF B;  3H5X A;  3PYD A;  2GVZ B;  4K4Z A;  3LQV A;  1W2B R;  1JLB A;  2DNQ A;  2DXF A;  2LYV A;  3M2U A;  5IFM A;  4GVL A;  3DOL B;  5KT2 A;  4O23 A;  2UUA J;  2LXI A;  4V1A k;  4O3O A;  2QLX A;  1UA0 A;  3SYZ A;  1S9G A;  2HK3 A;  1QSY A;  2HMI B;  1Q16 B;  4DV0 F;  1TKT B;  1X5T A;  2QV6 A;  2WB1 D;  2MKH A;  2GIF A;  1LXN A;  3JSM A;  4CCH A;  3BS9 A;  2BOP A;  2HFO A;  3KHL A;  4DSJ A;  3WX4 A;  2F65 A;  1UW4 A;  4AUK A;  3J81 Y;  2CQB A;  1P1L A;  3KHH A;  3C6T A;  2ZBQ A;  4A48 A;  1U09 A;  3O3L A;  3GIK A;  3VWS A;  1VK3 A;  2G13 A;  2RB7 A;  4Q45 A;  2M4M A;  4N5S A;  3HHL D;  4DPT A;  1JLF A;  4HHJ A;  4B3T F;  4DR1 J;  3EJM A;  5A8K A;  4ZVT B;  5FII A;  3C14 B;  3RB3 A;  2J0S D;  2GA7 A;  2PGC A;  2QA1 A;  5HVF A;  2FHO B;  2YWF A;  1TUW A;  3CCM S;  2XMV A;  1PCA A;  2VG5 A;  4F25 A;  2KRR A;  2MKY A;  3HZG A;  3J7A N;  2DEJ A;  4ED6 A;  5KFJ A;  1FD8 A;  1HIY A;  4FZV A;  1JJH A;  2UVR A;  2FHJ D;  1NLK L;  3WC2 A;  5IM0 A;  1D9A A;  3NGR A;  3KYL A;  2VON A;  1N6Q A;  2NSB A;  1YHQ S;  4RW6 A;  2ZZN A;  2Q79 A;  4G1I A;  1XK8 A;  2EI5 A;  1WTB A;  3HHL C;  2JDJ A;  2JRS A;  4WK3 A;  4TLR A;  4WFB Q;  1VIS A;  3D66 A;  2KB2 A;  2CNN B;  1Z2Z A;  1MWY A;  1JLQ A;  2BE2 A;  4QQB A;  2EW9 A;  3MUM P;  3FKB A;  1XMB A;  4GKJ J;  3QIP B;  2E1R A;  1KLM B;  2KYX A;  2XEX A;  4IG3 A;  5ETN A;  4KH0 B;  3CE8 A;  5B0E A;  1IQT A;  2HPU A;  1GXU A;  2V2Z A;  1EP4 B;  1KWM A;  3SSR A;  3KK1 A;  4WFY A;  2VA2 A;  1S49 A;  4PAA A;  4RZR A;  4OI2 A;  5GME A;  3HVW A;  4DV7 F;  1W25 A;  3KJN B;  4XPE A;  3I56 S;  2VIC A;  2LQ8 A;  1YBA A;  4ENO A;  4CWB A;  1BC6 A;  3KNG A;  1VHI A;  4R8U B;  2FGO A;  1FJC A;  4JI0 F;  5I3U A;  4CO3 A;  2MSS A;  1RTD B;  2E5J A;  2VJV A;  3BO4 A;  3P4U B;  2V8G A;  3PO5 A;  1IBM F;  3CCR S;  2NXE A;  1V5I B;  5KT6 A;  4WBF A;  3LGH A;  4OL8 A;  2YWG A;  4LF1 A;  4U7U D;  1TAQ A;  3OPK A;  1HR0 J;  3WC0 A;  3EXY A;  2JC1 A;  4DX8 H;  3HHN B;  4YR0 A;  3LPY A;  4I6W A;  1SC3 B;  1Y4Z B;  3KDN A;  3IGV A;  2YNH A;  1D1U A;  4B3M J;  2YNG A;  2DNP A;  2K3I A;  1YJT A;  3RR7 A;  2HKE A;  2ACY A;  2FVQ A;  3MPV A;  2VG6 B;  4TNO A;  1FRJ A;  4KFB A;  2EC0 A;  1DTQ B;  2B5J B;  1RCX B;  2E1M C;  4FBU A;  3G96 A;  4N77 A;  5KFY A;  1FF2 A;  3NCP A;  4KHM A;  2MPU A;  4J9P A;  1SKU B;  2LU2 A;  1K44 A;  4C8M A;  2I6W A;  4A47 A;  4PWD A;  1T03 B;  5LT5 A;  2QE5 A;  3FJ2 A;  1LWC A;  4YQW A;  3P8B B;  2CZV C;  2IDL A;  2X3G A;  2HHH F;  1IM4 A;  4LFC F;  2CIM A;  4F02 A;  4OLP A;  3HHL B;  2G2Y A;  4BWJ A;  2GQC A;  4RW4 B;  3W9J A;  2IJN A;  3MFH A;  1RTH B;  5KFM A;  3ETO A;  3VVT A;  2XWY A;  5B0C A;  5B0B A;  4RLE A;  2G2O A;  5G4D A;  3DN9 A;  4M1K A;  3CXC R;  3MM6 B;  3DLE B;  1PJ7 A;  1RAJ A;  4BDP A;  5FJ4 A;  5LMN J;  1LW0 A;  1F0X A;  4OJH A;  3KWM A;  2B4P A;  3V4M A;  3CD5 A;  1F1B B;  2BRL A;  4ILL A;  4ZVO B;  1SL1 A;  3MEE A;  4DR4 F;  4OYW A;  1U6Z A;  2FGC A;  3EGW B;  2EFG A;  2GCF A;  3EE3 A;  1XR7 A;  3THV A;  4TYA A;  1TKZ B;  4AL5 A;  1CPZ A;  1LWF A;  3I4H X;  1T9U A;  1WC1 A;  4CTA B;  3ZFV A;  1C0U B;  2UXD F;  2V4J B;  4CLP A;  1HD1 A;  5ETK A;  1FA0 A;  4F26 A;  1DUR A;  3W7B A;  4TN2 A;  1WHV A;  3KHG A;  1X4H A;  4F04 B;  3E01 A;  4OI0 A;  3M9M B;  2CJX B;  3MED B;  3JSB A;  1WUU A;  5L39 A;  4OX8 A;  1HBO A;  4PYD A;  3SMZ A;  3W8P A;  2Z2Y B;  4B9V A;  3DFE A;  4OYO A;  3MEC B;  1UAW A;  3MPD A;  3RB4 A;  1H73 A;  3DLK B;  2B6A B;  1GTE A;  1QVG R;  1Q8I A;  3R6G B;  1S5Z A;  3MCM A;  1WNE A;  5I3P A;  4ZP9 A;  2ZBC A;  4MT1 A;  1T9X A;  3NCR A;  3IR7 B;  3ICL A;  3L4B C;  2KJW A;  4I56 A;  3H98 A;  1M90 T;  1TL7 A;  1QAY A;  3CJ3 A;  2QMX A;  1RLC L;  3I9Z A;  3QZ8 A;  2ZH3 A;  4ZCI A;  2QJ3 A;  1Q8L A;  4IFY B;  4MJK A;  4DL3 A;  1Y3J A;  1TL1 B;  3UI3 A;  2HWT A;  3ZNU A;  2K8G A;  5DLG A;  3I82 A;  1LW2 A;  1REV B;  3DRP B;  3KLV A;  4JOU A;  2QZ8 A;  2GFF A;  1M5V C;  4NLQ A;  2G1H A;  3O1L A;  3TZZ A;  1EKR A;  2E5G A;  1CSJ A;  4WYL A;  4CO1 A;  1Y9O A;  4L75 A;  3QSY B;  3M2R A;  1RAA B;  3EVM A;  5J2P A;  5AE2 A;  2AKW B;  3N28 A;  2VFV A;  3NRB A;  2QFI A;  4HTI A;  2QGF B;  3GII A;  1S4E A;  4B9L A;  4B17 A;  1BY9 A;  2BXJ A;  2BAN B;  3BSA A;  3K8V A;  5C25 A;  2WVB A;  1FRI A;  4EYI B;  3R1H A;  3NEK A;  4ZIV A;  1RYS A;  3UR0 A;  2QYG A;  1P6T A;  2CVE A;  3QT8 A;  1X4F A;  3SCL E;  3ILJ A;  3AD7 C;  1FDB A;  4UQT A;  2BQ3 A;  5F8M A;  2J5A A;  5HBM B;  1EX8 A;  1NND A;  4KH1 B;  2YX7 A;  5BYQ A;  5K8M A;  1IR1 A;  4F3Q A;  1SKR A;  3MOJ B;  2ZJQ Q;  5K14 A;  2M7S A;  5HVG A;  4FF2 A;  5ETR A;  3QRP A;  3RAQ A;  3CJS A;  3W61 A;  2LEP A;  2HFV A;  5E5N A;  4RBV A;  1KC8 T;  3W2V A;  3LAL A;  3WQP A;  2R2U A;  4MKB A;  2HHV A;  3D3B J;  2PA8 D;  2FB0 A;  1UJ5 A;  2DGO A;  4C4W A;  1MMN A;  4ETX A;  3AB4 B;  2AJ0 A;  4E2F B;  5F41 A;  1SKS A;  5K8O A;  1O8B A;  1YTY A;  3FEX B;  2RD5 C;  3IWL A;  1S59 A;  2GO9 A;  3K5M A;  5HAN A;  1R43 A;  3VAL A;  4LBI A;  2O66 A;  2AEM A;  3M4X A;  3TUZ C;  1UET A;  1F9E B;  4EO8 A;  1UWB B;  2VH7 A;  3SQG B;  1B0P A;  2HNY A;  1RT5 B;  4KKO A;  2KT5 A;  2WSC C;  1EIY B;  4DI6 A;  2E7X A;  4YME A;  2B7C B;  1SV5 B;  4IRD A;  3VAH A;  1X4D A;  1UJ6 A;  1XJW B;  4X4N A;  1KS2 A;  2MKJ A;  2C2M B;  3FCH A;  1R6V A;  3J7A 1;  1C0T B;  2WAQ D;  4DL5 A;  1RT2 B;  4E0D A;  2LQB A;  3FRY A;  3IAS 9;  1BLU A;  4KO0 A;  1M1H A;  3PW5 A;  2ZNY A;  5KFI A;  3K5N A;  3MR3 A;  1B0V A;  3SQO P;  2NXU A;  4ZPT R;  1NSA A;  2I9S A;  1Q79 A;  4Y0F A;  4OJ3 A;  3NCQ A;  4U6P A;  5CAB A;  4JI3 J;  2IYI A;  3B82 A;  3GR1 A;  1KVI A;  4F3O A;  1ELO A;  1HQE B;  4OHX A;  4JB8 B;  1BE4 A;  2QL7 B;  4OLO A;  5H1S V;  4WPA A;  1TL3 B;  1Q78 A;  4FKY A;  2EPI A;  1FWP A;  3VGT A;  2M70 A;  2VBX A;  4NA2 A;  1FKP B;  3DDK A;  5H9E K;  4YR2 A;  2ZVS A;  4P9S A;  2KO1 A;  4M5N A;  5F8G A;  2IAJ A;  1VDH A;  1FDA A;  3PNI A;  4I2P B;  4F4K A;  3OXF A;  3EYZ A;  2YH1 A;  4HVZ A;  4NXN J;  2FVR A;  3EGN A;  3H5U A;  5JUM A;  3HD2 A;  3A8K A;  3GU0 A;  3FCW A;  4DV0 J;  2CXE A;  1PBA A;  5I42 B;  3NLC A;  2JSX A;  1RHM B;  2WVD A;  1HWJ A;  1KOH A;  3FSX A;  4B08 A;  2PMZ D;  2W4D A;  1JLC A;  4LFB J;  1N5Y B;  4B9M A;  2LDI A;  3UVJ A;  4NLV A;  2JH3 A;  1XQI A;  4EI2 A;  5E7O B;  2DBB A;  3QJL A;  4C11 A;  4BBY A;  3NGS A;  4RUB A;  5ADZ A;  4MK9 A;  4N8N A;  4U7U K;  2I5J B;  1M5O C;  2JLG A;  2KH9 A;  3CJ8 A;  2DNZ A;  3GWC A;  1NO8 A;  1N48 A;  4HI2 A;  4RW7 A;  4WE1 A;  3CIM A;  4RUH A;  4TU8 A;  2GHW A;  4N47 A;  2HNZ A;  3M6W A;  2BJ8 A;  3EDR B;  2BKP A;  3K5O A;  4HAC B;  2LQ9 A;  4ICL B;  1LNQ A;  1NH7 A;  1U49 A;  2MQQ A;  1RT3 A;  4DR5 F;  3D0H E;  2R7X A;  3MR7 A;  3GV5 B;  3NNC A;  1Q82 T;  5J1E A;  4DR7 J;  3CJ2 A;  2Q6C A;  2DGS A;  4F67 A;  2Q66 A;  2DGW A;  2B51 A;  4DF8 A;  4IDK A;  1AUS L;  3C8Y A;  1M1K T;  2BOA A;  1F3V A;  1HW8 A;  4UOF A;  2AX0 A;  2XSJ B;  2CDQ A;  1N36 J;  5HP1 A;  3DGP B;  2OEL A;  5EWF A;  2AIR B;  2HFS A;  5GMK a;  4ZIT A;  4WCE Q;  2ZH8 A;  3SBM A;  4RW8 B;  1XER A;  4L6V 3;  2HIY A;  2EWH A;  3IGN A;  1L3V A;  3G8S A;  4ECT A;  4K4W A;  1X4A A;  4NYP A;  2MQL A;  2DNM A;  3AAW B;  2HHP A;  1S1V A;  2AYE A;  3U27 A;  3CDE A;  2HND A;  3V4I B;  1RCO B;  4AL7 A;  2PSZ A;  1Q95 G;  2W2N P;  2VA3 A;  4DV7 J;  2BDP A;  4EBD A;  1RI7 A;  4IQM A;  4DOZ A;  1VQN S;  2IVY A;  1PKU A;  4JI8 F;  4B9S A;  4ILR A;  2L3M A;  1RSC A;  3BH6 B;  4A4J A;  1HHQ A;  2YH0 A;  3VF0 B;  4JV5 F;  3KJV B;  3TX0 A;  1T3N A;  4PUO A;  2XM3 A;  4M5D A;  3R27 A;  3M30 A;  2R7V A;  4OHZ A;  4NAS A;  1TEL A;  1RHK B;  5MLC V;  3MM8 B;  4OJG A;  3IM9 A;  3MHY A;  1IBM J;  2VQF J;  4NLY A;  1VQ7 S;  2DB1 A;  5DET A;  2FZG B;  3MAA A;  1K1S A;  1CUL B;  3CVK A;  3DRY A;  2QLW A;  2VKR A;  5AE3 A;  1TFW A;  4DL0 C;  1VC5 A;  2PII A;  2CNL B;  1FKA F;  5E3C A;  2WHO A;  3DOM B;  4IRC A;  2DGX A;  1TUV A;  5LOQ A;  2OPP A;  2DHA A;  2J76 E;  2C2D A;  1B0T A;  2JC0 A;  3BKF A;  1WSR A;  5KG1 A;  1FE0 A;  4EK2 A;  4Z7Y A;  3HHD A;  2MYF A;  2ZH4 A;  4F36 A;  2BEF A;  2YXL A;  5KTQ A;  1SJ1 A;  1MNE A;  2D41 A;  4Y2C A;  3N0V A;  1ZOT A;  3MEG A;  2ZZM A;  2ATL A;  3H20 A;  2HVH A;  5F8L A;  1KFS A;  4K7Q A;  2W7O A;  1WOP A;  2ASY A;  1TK8 A;  1CS4 B;  4ANE A;  1HNW J;  4DV4 J;  2J7U A;  3KLG B;  1CC7 A;  2J0X A;  2HHH J;  4RWX A;  3DMJ A;  5GAD U;  3AJ2 A;  1T05 B;  4DV2 F;  4O44 B;  5M2U A;  2H54 B;  3Q8U A;  5CYQ B;  2AD9 A;  3BRE A;  4ZOS A;  2E1P A;  3OBI A;  2PN6 A;  5J2M B;  1IXK A;  2DO0 A;  2KXN B;  2J7K A;  5CH7 B;  2A10 A;  4U9R A;  5T41 A;  5HAT A;  5ETL A;  2U2F A;  3RRG A;  4LFA J;  2UUB F;  1YI2 S;  3MDF A;  2V68 A;  4XO0 A;  5SZT A;  2KM8 B;  1HI8 A;  2OGU A;  3TRG A;  4DS4 A;  4NI2 B;  2F4F A;  2IIH A;  1WEL A;  1R0A B;  3WIV A;  2UUC J;  1EKS A;  3HCX A;  1RTD A;  3R2D J;  1K1Q A;  4OIX A;  3W9I A;  2G0J A;  1T94 A;  4NLS A;  3QT6 A;  1RJJ A;  3M05 A;  1VQ4 S;  4ZCK A;  3CSK A;  4LRC A;  1PBU A;  3SCI E;  3S1T A;  1HLW A;  1Y0H A;  3H4B A;  1RT7 B;  4PPZ A;  5C42 B;  4J9U E;  5IQQ A;  6FD1 A;  2H5J B;  2HQD A;  4XTT A;  4QWB A;  4DQP A;  2HBY B;  4PXB A;  3GFY A;  2M2B A;  4KC5 A;  1U0S A;  2DO4 A;  2UV8 G;  3HSG A;  1NM2 A;  1S0O A;  2FJB B;  3M8Y A;  4P2F A;  4NCB A;  4ZLJ A;  2R3V A;  1QTM A;  4OJ1 A;  5GAE I;  1B99 A;  2AWZ A;  4ZK7 M;  5LJ3 Y;  4Q2L A;  4Q8E A;  4EBC A;  2XS5 A;  4PQA A;  2LP4 A;  4NL5 A;  3LP0 B;  4JV0 A;  3DHW C;  3MWB A;  2QRR A;  3KLE A;  5DJB A;  4LF5 J;  2FUG 9;  3O2I A;  2GHV C;  1AXQ A;  4P2S A;  4AQY F;  1U24 A;  4RNN A;  3DU6 A;  4ZVG A;  1ITP A;  5FLX Y;  4PG4 A;  4DLE A;  2ZBI A;  5HSP A;  3KLI A;  1R3N A;  5LJ5 Y;  3P5T L;  9RUB A;  2VDH A;  3KMS A;  1YBT A;  2MGZ B;  3KLH A;  4ECQ A;  4ZA1 A;  1F5C A;  2CQ2 A;  4JI4 F;  2B7B B;  3P96 A;  5GAG I;  2UVU A;  3QRQ A;  1GTH A;  5ETT A;  4Q8F A;  3OUY B;  4ZJL A;  1X4C A;  2N7C A;  1JNZ B;  2Z2Z A;  5AT1 B;  2FY1 A;  4CH0 S;  1QUP A;  1V5V A;  2JEG A;  1KEK A;  3TAP A;  4DHV A;  1ZS6 A;  3UO0 A;  1BQX A;  2L48 A;  2Z30 B;  4JV2 A;  3GE9 A;  3GIM A;  2APO A;  1K9M T;  3AHP A;  3M8Q A;  4USM A;  3T9Z A;  1CJV B;  3KUE A;  2A2D A;  4OYZ A;  4MIA A;  2VAS A;  3FSI A;  4KHR A;  2V5H G;  2FHJ A;  4IG0 B;  1V9O A;  1IKX B;  2RHS B;  3ZZT A;  2FPH X;  3K5P A;  2NXC A;  3LW5 C;  5K8N A;  5IOL A;  2OJ3 A;  1PIE A;  1FK9 A;  4FF4 A;  3UDE A;  1TZ0 A;  4ECS A;  2XMJ A;  1E6Y B;  2V4J A;  2COL A;  3U7J A;  3ETM A;  2GX8 A;  1EET A;  1CJK A;  1ACM B;  3MUV P;  3Q0A A;  3BBF A;  4CZC A;  4YR3 A;  4ZKA A;  3Q2S C;  3CJK B;  1S10 A;  3NXZ A;  3AH6 A;  3NY0 A;  3IR6 B;  5FDL B;  5EN1 A;  4O3Q A;  5LMU F;  3NS7 B;  4BWM A;  2AEJ A;  2RF2 A;  3AB2 B;  4RBT A;  3LP1 B;  3W65 A;  3FFI A;  3S7R A;  3IBC B;  4YHH F;  4YY3 F;  2EKN A;  3OHB A;  3TX8 A;  2AT1 B;  3QFH A;  4BCA A;  3C19 A;  3EVO A;  3NAI A;  1GT8 A;  4HEA 9;  1ZZF A;  1UEK A;  1S99 A;  4K50 A;  1QTN B;  3VGS A;  2ILY A;  3T5L A;  2XYP B;  5KAK A;  2Y1J A;  1FES A;  3B6B A;  2W8L A;  1WC6 A;  3DRP A;  1L3T A;  2MZ1 A;  1J27 A;  3RAM A;  1J5O A;  4C8Z A;  3JTO A;  4FYX B;  2ZH7 A;  4RUA A;  2VFS A;  2ZC4 A;  4KSE B;  1HPZ A;  2HGN A;  1H38 A;  3RRH A;  3CO0 P;  3HVR A;  1RTI A;  3KJF B;  1PG5 B;  2YKO A;  4B3R F;  2BJD A;  2IJR A;  2AJF E;  3V6J A;  3UNG C;  4USH A;  2EBG A;  3NAH A;  1U0H B;  2UXC J;  2H51 B;  2RNE A;  3SFU A;  4H4M A;  4ECZ A;  3PEJ A;  4DL6 A;  2R8H A;  4WKY A;  2G2Z A;  4QR0 A;  2H5E A;  5E0O A;  2VB6 A;  3N5F A;  5KT3 A;  2ZH9 A;  3FBF A;  1XNR F;  2SXL A;  3HT3 A;  4DMZ A;  2MLX A;  2W2O P;  2IBK A;  4QW8 A;  3OV7 A;  2V6A A;  1NAQ A;  5H9F J;  4G6V B;  2W9B A;  3TNV A;  1YJN S;  2JEI A;  3RJM B;  1RWO B;  1OSD A;  5AJ3 J;  2OPQ A;  1GXL A;  4UOG A;  3G82 B;  1DQ9 A;  1WOS A;  4Y2K A;  2DHS A;  4MKV A;  1U45 A;  4NYZ A;  2Z4P A;  1JLB B;  1UEV A;  2KHD A;  1PYS B;  3M2U B;  3IR5 B;  3US5 A;  3A3N B;  2C28 A;  1HNZ J;  4P10 A;  3M8S A;  3PW4 A;  5B0G A;  1S9G B;  3O5T B;  1SJF A;  3RG6 A;  2ZDO A;  3C16 A;  2DNL A;  4IFV A;  1P27 B;  5AXM A;  3EUN A;  4B02 A;  3JSM B;  2ZKU A;  2H48 B;  4QU6 A;  2HVE A;  1IR2 A;  1UVI A;  1KNZ A;  7AT1 B;  2P6T A;  3QZ7 A;  4LR7 A;  1RWK B;  1Y5I B;  2XCP A;  1FXD A;  2D1C A;  3SZ2 A;  4TQR A;  1I6J A;  4AXJ A;  3VTI A;  5L8R C;  4LIW A;  2B9X A;  2HFU A;  3UD3 P;  1W26 A;  1B7F A;  3OVB A;  3C6T B;  1WI6 A;  5GAE U;  2CQ4 A;  4KGM A;  4X4V A;  1PYT A;  1DRZ A;  2X51 A;  2OUG A;  5BYS A;  1FVQ A;  5B09 A;  4OQJ A;  2KFY A;  3Q2T C;  1JLF B;  1QUV A;  2LCW A;  4DU8 A;  2W24 A;  3AQO A;  3CCJ S;  5A8K B;  2H65 B;  2KDO A;  3HF5 A;  4OHW A;  1TMM A;  2K7K A;  3KJQ B;  1ICE B;  2KFN A;  2V9W A;  1PAU B;  1CJT A;  4M5J A;  5KT4 A;  2VG5 B;  3HMJ G;  2MHN A;  3L7O A;  2DHH A;  2J9D A;  4MKA A;  4ILM A;  2OKQ A;  5GAG U;  2P8I A;  4UF4 A;  5DS7 A;  4DUZ F;  3DRX A;  4F2S A;  3ENV A;  5IM0 B;  5BJR A;  3PJX A;  1N6Q B;  2WCX A;  1OJ4 A;  2DXD A;  3D6M B;  4RW6 B;  3MM5 A;  4S0M A;  2PMW A;  1NRK A;  1FRK A;  1JXL A;  1FWK A;  1RLD A;  2DGU A;  1LXJ A;  2HQF A;  2MQO A;  1JLQ B;  1VQ6 S;  2BE2 B;  4L3K A;  4CLW A;  3A4T A;  1M5P C;  2HHX A;  4I68 A;  4NXM F;  2FVC A;  1YVF A;  3J7Y I;  5DM7 Q;  1UZH A;  2E9R X;  4IG3 B;  3QRR A;  1NU4 A;  4F0K A;  5K9F A;  4WXW A;  1U02 A;  3EXC X;  3HD1 A;  4WP9 A;  2D9O A;  3KK1 B;  3THP A;  2FLO A;  5DG8 A;  1IKV A;  1O6X A;  4DG1 A;  5HI7 A;  3MCN A;  2VQE F;  4FNI A;  1SL2 A;  1ARO P;  2YX4 A;  2RDI A;  4NLG A;  4JV5 J;  3QO9 A;  8AT1 B;  1ZPV A;  4WF9 Q;  2C2R A;  4DSI A;  1RWU A;  2FJE B;  1RBO B;  4PQU B;  3GG0 A;  2GJI A;  2ILZ A;  1PGZ A;  2RIJ A;  1NDC A;  3HFK A;  4V19 X;  3PX4 A;  1H74 A;  4K2J A;  1VRT A;  4J90 A;  1KTQ A;  2BJ1 A;  2EG1 A;  1N5S A;  1N32 J;  1DAX A;  2J8S A;  2VBW A;  3MR5 A;  1KTV A;  2UXB F;  1SC4 B;  2YNH B;  4NCG A;  3QJJ A;  3BSC A;  2YNG B;  4UUX A;  1VGY A;  1T9T A;  2GAH C;  2KJV A;  3LWL A;  2HAF A;  2YX1 A;  2ZM6 F;  3C6U A;  3BR8 A;  2R8J A;  4O3P A;  4KFB B;  1H3D A;  1X31 C;  4GKK F;  3ZXW A;  4J91 A;  3DHX A;  3BJY A;  2UUW A;  3A12 A;  1I51 B;  3DDI A;  1PYO B;  2FHM A;  2ZH2 A;  3PDN A;  2C3P A;  4OI1 A;  1RBL A;  2IDE A;  1NEE A;  5KFO A;  3GTY X;  2VL1 A;  5LL6 d;  4PWD B;  5KG7 A;  3N79 A;  5THW A;  5I3Q A;  1LWC B;  3SV3 A;  3PRV A;  1N56 A;  3ISN D;  4QOT A;  4XIU A;  4DV2 J;  4DCO B;  1T7P A;  1S6Q A;  1OS5 A;  2UV8 A;  1OY6 A;  2B43 A;  5KOW A;  4ATN A;  2GAG C;  1VBK A;  2WZ1 A;  1C4A A;  2RRB A;  2B0G A;  2VF3 A;  1V3Z A;  3NBP A;  1WWH A;  2B4O A;  3EZO A;  4F4X A;  3B78 A;  1RWN B;  2C22 A;  1LW0 B;  2KU7 A;  2O5D A;  3D2W A;  1A9N B;  4F4W A;  5M2R A;  1XR5 A;  2X7I A;  4HDG A;  3ISN C;  3MEE B;  1U8S A;  2D3Z A;  3MM7 A;  4DX5 A;  4LSN A;  5EHH A;  2DIV A;  4USU A;  2XUL A;  1KVK A;  1KSP A;  2MEW A;  2RJZ A;  2R4F A;  4I69 A;  2HFZ A;  4DL4 A;  1S0N A;  5KFF A;  2MKC A;  1LWF B;  3HHK A;  2LKZ A;  1EQ0 A;  2HS0 A;  2AJ4 A;  1RWP B;  4U96 A;  3E01 B;  2KVQ E;  2R7Q A;  1T95 A;  2VC0 A;  3JQK A;  4NX9 A;  2DPI A;  4CNY A;  1VQM S;  1HI0 P;  1R7I A;  3R7B B;  4NLW A;  2JOQ A;  3V6D A;  3NOC A;  1HBO B;  4C3K A;  4K5R A;  2FC9 A;  1JJC B;  4J9V A;  3MAH A;  4DR3 F;  1OPZ A;  1X0P A;  4NMX A;  4X66 J;  4OI3 A;  1FX4 A;  3G71 S;  1U8W A;  1HWI A;  2PFD A;  4M95 A;  2A6M A;  2WON A;  4RPF A;  1DZ5 A;  1S1W B;  4MMO A;  4WU3 A;  1D09 B;  4YB1 P;  1VRQ C;  1QAJ A;  2OO4 A;  1Z1Z A;  1KVJ A;  2HBR B;  2AGO A;  1AFI A;  5HVH A;  1TL7 B;  4CQ1 A;  3HT0 A;  3NGT A;  3G6V A;  1YJW S;  3G86 A;  4C0B A;  3UN5 A;  3HVT A;  1RT6 A;  4JI4 J;  1OMS A;  4MTP A;  5HLF A;  5CD4 H;  3DYA A;  1FJG J;  1LW2 B;  3BZQ A;  1UWA A;  2DIU A;  2VHG A;  1T9W A;  2W4P A;  2B4V A;  2DXE A;  3HKW A;  3AOB A;  2DNO A;  3M2R B;  1GQE A;  4ID8 A;  2Z58 B;  2IM0 A;  1SI9 A;  5J2P B;  2BQU A;  4KIA A;  2VJU A;  2VBZ A;  1UFK A;  2WOM A;  3L9Z A;  2C2O B;  2ASJ A;  3TA0 A;  5L1J A;  3TQ1 A;  2UU9 F;  3OFG A;  1RB0 A;  3RTV A;  4PPD A;  3ZNJ 1;  3BO2 A;  2NZC A;  3LAN A;  5EUH A;  3TQE A;  3FZ2 A;  5C25 B;  5D15 A;  1G2E A;  2R42 A;  1LV5 A;  2DH9 A;  2HBQ B;  3WZ0 A;  2F8M A;  3CD0 A;  3OR2 A;  1EHW A;  1P9Q C;  4JV1 A;  4XAK A;  3HKZ D;  3F41 A;  3IXQ A;  3EPG A;  1YBU A;  4WP8 A;  4ED2 A;  4LSL A;  4YDD B;  4DR2 F;  4WYW A;  3J7Y U;  3ZTS A;  2YKM A;  3BGF A;  2M0G B;  3BDP A;  4URQ U;  3TYT A;  3M8P A;  1SH2 A;  1RA7 A;  4YB5 A;  5D3G B;  1OSC A;  2Z8Q A;  1EQM A;  3AXM A;  4Y3C A;  5K14 B;  3KK2 A;  2ADC A;  1XN9 A;  3DGV A;  3OFF A;  3O8W A;  2XI3 A;  1ZBT A;  5LMU J;  4ZVR B;  2HGL A;  3W2V B;  3M9N B;  4HH0 A;  2F9J A;  4RNF A;  1GMU A;  4QIW D;  3EX7 B;  2Z2M A;  3I4P A;  5JVH Q;  2Y3Y A;  1BQN A;  3V5R A;  4IKA A;  3T5J A;  4KAI A;  1YK9 A;  5KFZ A;  1WOR A;  1DFD A;  4MYU A;  3JTP A;  3PAC A;  3HUL A;  3G8Q A;  3L09 A;  2ZD1 A;  4K4T A;  5EGY A;  3CDA A;  2CPH A;  2ZOF A;  3EIC A;  2X3D A;  4NA1 A;  1PIL A;  3TJA A;  4I2Q A;  2HHS A;  2MZQ A;  3J80 U;  4WU2 A;  4KHP F;  1Q7L B;  2HNY B;  1DBD A;  5IT9 U;  2V50 A;  3SEO A;  4KKO B;  1HWL A;  5DQI A;  3CCU S;  3UDV A;  2B56 A;  2MQM A;  4X4O A;  4LF7 F;  1VJQ A;  2NS1 B;  1S76 D;  2CFX A;  3VCD A;  4DZD A;  1RAH B;  2QC3 A;  2QA2 A;  4QYZ J;  1ZH5 A;  2BRK A;  5F0U A;  1Y3K A;  2P9G A;  4KO0 B;  1S48 A;  3PJW A;  1HBU A;  3KFW X;  1NK8 A;  3NG8 A;  3CD7 A;  2RIL A;  3NNA A;  2QG9 B;  5L1L A;  2E7V A;  1JJ2 R;  3GIJ A;  2BE7 D;  5BXI A;  3HJF A;  1T8E A;  5JXS A;  4JI5 J;  2V69 A;  1T02 A;  3RBE A;  2W7A A;  1MG7 A;  4OYM A;  5CXT A;  1RAO A;  5B08 A;  5D8H B;  2BJ9 A;  3IO1 A;  2XHW A;  2GC8 A;  1XNR J;  4O3N A;  4ZIW A;  4UQG A;  4KPY A;  2W9A A;  3R5A A;  4LF4 F;  4C8O A;  2WRM A;  2OFG X;  2I8E A;  1S57 A;  2E5L J;  4B3S F;  3ILL A;  3MXH P;  4ECV A;  5C24 A;  1NPR A;  4FP9 A;  3LF0 A;  2JFD A;  2XLK A;  2OTL S;  2A0F B;  1VQO S;  5HAO A;  3CJK A;  3MUT P;  1S0M A;  1RHR B;  4GO5 X;  3GV8 B;  2RKI A;  1YSJ A;  1FEH A;  3W2W A;  1SQE A;  4NCA A;  2IAJ B;  4PEO A;  3IA0 A;  3D1Q A;  3C66 A;  2YNF A;  3G87 A;  1KBR A;  4X4Q A;  1JNR B;  3OD2 A;  4LJM A;  1ZTT A;  4FPR A;  2CNK B;  2VU5 A;  2JHE A;  1DJ0 A;  2R7S A;  2V2V A;  4DX7 A;  1WEZ A;  4YOE A;  3MCO A;  3VGV A;  1I94 F;  3KUG A;  4DFM A;  2H4W B;  4OI4 A;  3WX8 A;  4R0J A;  5KFT A;  1LK5 A;  4NZ6 A;  4ES2 A;  2JL9 A;  3UVJ B;  4HKQ A;  3RBX A;  3MPU B;  2HRT A;  3BBB A;  3R7N B;  2XO7 A;  4C11 B;  2AU0 A;  2YPY A;  4FYD A;  3TWZ A;  1FFS B;  5IC6 B;  2AP6 A;  2KG0 A;  4JI1 F;  3EPI A;  2E7W A;  3R1L A;  4CP5 A;  3T1H F;  3FMW A;  3L7U A;  3IRX A;  4RW7 B;  4WE1 B;  1W7W A;  3H59 A;  2CJY B;  4WIQ A;  3BV8 A;  1ZAX A;  2FLP A;  4ZP7 A;  2HNZ B;  3JQM A;  1RE1 B;  3EGZ A;  3T5K A;  2RU9 A;  2CA9 A;  8RUC A;  2FD2 A;  3NMA A;  1MRO A;  3UE2 A;  1OQ3 A;  4NPO A;  3POT A;  1X4B A;  1SXL A;  1N4L A;  3UPF A;  3V6K A;  3DM2 A;  5IWA J;  2LEA A;  1ZM4 A;  4M5I A;  1RT3 B;  2XWX A;  3OL9 A;  2D3U A;  4J9K A;  4USW A;  5J1E B;  1N5T A;  2E44 A;  5J1N A;  2RQ4 A;  1YGY A;  4K0K J;  2KL8 A;  1J2V A;  3CJ5 A;  5HP1 B;  1BWV A;  5D78 A;  3O6Q A;  5BYR A;  2HQC A;  3VHQ A;  2C2Z B;  3I0R A;  3AFG A;  1SIW B;  3PRD A;  4BC7 A;  1XNQ F;  3NS6 A;  1N33 F;  4C3L A;  3MMC A;  3R5C A;  1SCJ B;  2YTC A;  4HHH A;  2Z56 B;  5DZ6 A;  3Q8P B;  1S1V B;  2VOP A;  3D68 A;  1UVL A;  2HND B;  2KN4 A;  5HJY A;  3BKU A;  1RTJ A;  1VS3 A;  3NP5 A;  4KGZ B;  4ECY A;  4LMZ A;  2E1A A;  2DIS A;  3T6J A;  2RU3 A;  4L74 A;  3JXO A;  3OXL A;  2DRA A;  4KJI A;  4PUO B;  2C3M A;  4M5D B;  4DR6 F;  3M30 B;  3OT9 A;  2IMO A;  4M5K A;  3M9O B;  4G3I A;  4JI7 F;  3CUN A;  4DN0 A;  5JVG Q;  1Q1K A;  4ZPB A;  2ZIT A;  4LRD A;  4Y2M A;  3L3C A;  1YJ7 A;  3MAA B;  4DV5 F;  2E9T A;  1AT1 B;  2IYG A;  3IBW A;  4AYB D;  2VFR A;  1U6F A;  4ZHR A;  2RE1 A;  4X65 J;  4ITS A;  2ZC3 A;  2UXB J;  1K0V A;  4BS2 A;  2E5I A;  4AL6 A;  2KT3 A;  3D0G E;  2OPP B;  5KFQ A;  2VG7 A;  3A3O B;  4ED5 A;  2KKH A;  2FJX A;  2ZJP Q;  3K17 A;  3P6Y C;  1S1U A;  2NPI A;  3GFX A;  1U1M A;  3NS5 A;  4JI2 J;  3KUH A;  2C1E B;  4GKK J;  1FNO A;  2JLF A;  2CPX A;  4DV6 F;  1S97 A;  3H0P A;  3MEG B;  4UUW A;  2VOO A;  2JFK A;  1IQZ A;  3CJR A;  1HBN A;  1IKY B;  2EEY A;  3BGR A;  4AD6 A;  4C8K A;  1RWW B;  3Q8R B;  1FRX A;  3TJ9 A;  4N56 A;  2DHG A;  3I96 A;  4K4Y A;  3JS9 A;  3JAM U;  3DMJ B;  4LBH A;  1VHF A;  5F8N A;  1QY7 A;  4M8L A;  3A8E A;  3WIU A;  2FJD B;  3PZP A;  3A8I A;  4HI1 A;  1LEO A;  2ZEJ A;  1KLN A;  3V2U C;  5BR8 J;  2M8D B;  4N76 A;  4CM0 A;  2EFP A;  4A8F A;  1MSW D;  1IBL J;  5E2Q A;  1RUS A;  2RRA A;  2Q3P A;  1YJ9 S;  4DZ6 A;  3ZTR A;  5IZH A;  3R5D A;  4QIG A;  1N34 F;  3W64 A;  3R9L A;  1YJV A;  1H2U X;  1BD6 A;  3DI6 A;  4C6A A;  4TKT A;  2PEB A;  4CYU A;  2JWN A;  1IWG A;  3HPO A;  3HSJ A;  3CGI A;  4H4O A;  4DDF A;  4PQU A;  1TU0 B;  2MDA A;  5J2Q A;  3Q89 A;  2YPZ A;  1HNV A;  1B4S A;  3SFG A;  3A3P B;  5D6G A;  2GJ2 A;  1NKC A;  3UCZ P;  3TUP A;  2KFZ A;  3BPS P;  1NJX A;  1RWM B;  4LRA A;  4CH7 A;  2GML A;  3IBF B;  4WTY A;  1GFW B;  3UD5 A;  1OWX A;  1NKE A;  4RW9 A;  3CJ4 A;  3M8W A;  2OHD A;  4LF8 F;  4ECR A;  5HQM A;  2DCL A;  2V63 A;  3HP6 A;  1UW9 A;  2AW0 A;  4A8O A;  3OTE A;  5CYM B;  1X5S A;  4U8V A;  1UPM B;  5HO4 A;  1NJW A;  4QR1 A;  1EJ7 L;  3DNC A;  2YWW A;  1RK8 A;  1OO0 B;  3LGN A;  2Y1I A;  3ADA C;  3KLE B;  1L3U A;  5ETM A;  4L3N A;  5A0Y A;  1XEZ A;  2LVW A;  3PJ9 A;  4UZB A;  3OLA A;  2BJE A;  4D3H A;  1ZA2 B;  3KLI B;  3OFH A;  3M2V A;  5KFD A;  4ECW A;  2V8D A;  3X1L B;  3KLH B;  3ZZ0 A;  3MI7 X;  4QPT A;  5D0R A;  4QU7 A;  2O3D A;  4PKD B;  1HQU A;  3R5B A;  5A2Q U;  2XMW A;  4CO2 A;  2F40 A;  1OYE A;  1NK6 A;  4JUZ A;  2AEF A;  4Y65 A;  3OFE A;  4X84 A;  3FBE A;  4ED4 A;  3TO8 A;  1TKD A;  1FJ7 A;  6FDR A;  2KRB A;  1HAR A;  1Q5Y A;  4QWD A;  1HHS A;  3CF5 Q;  2R7O A;  4ED3 A;  4P52 A;  3M8Q B;  4IQX A;  5EX3 A;  2N3L A;  2ZOG A;  3RAX A;  1ROF A;  1AA1 B;  1IJE B;  1U7L A;  4ER8 A;  4GKJ F;  1R27 B;  1UFL A;  1H7W A;  3GFZ A;  5DLF A;  4TYB A;  4MK8 A;  3CC2 S;  2PEH A;  1SQF A;  1FK9 B;  2HAI A;  2ZJR Q;  4UOC A;  4PAB A;  2B9W A;  2DGQ A;  4DR2 J;  3TVK A;  2O67 A;  1U26 A;  5KFP A;  5LSR A;  2YVS A;  4WXO A;  3LA0 A;  1EET B;  1CJK B;  3F0N A;  2HHW A;  3DLJ A;  1H2T Z;  3I0S A;  1YIJ S;  4NLP A;  2C3Y A;  4P6Q A;  1C4C A;  3Q86 A;  4EU0 A;  2WTF A;  2QSF A;  2XGP A;  4QR2 A;  3T6B A;  3U1N A;  2FLN A;  3TAM A;  3VR1 A;  2J8A A;  3I5B A;  2RF2 B;  1HR0 F;  3CCE S;  2M3D A;  2RQK A;  2VUG A;  1FDN A;  3FFI B;  4OZ2 A;  4USV A;  5J2N A;  2CPJ A;  3SIP B;  3T19 A;  1S1W A;  2XG8 A;  3H8Y A;  3UR3 C;  3W63 A;  1G7C B;  5H9F K;  4J9S A;  2IPO B;  3OVS A;  2QYC A;  2W7P A;  1JIH A;  4DCJ B;  4HL9 A;  1SC6 A;  2R9L A;  5F9L A;  1JX4 A;  4K4S A;  1H2V Z;  1S72 S;  4H4K A;  2MB0 B;  4DFJ A;  5KFL A;  2DR8 A;  4DFK A;  2BA9 A;  2EFV A;  1J5O B;  4FDF A;  5CQG A;  1HBM A;  4LF7 J;  4PG5 A;  3HLU A;  2W2M P;  3D3C J;  2DH8 A;  3G6E S;  1HPZ B;  1TKX A;  1I3O B;  3JSY A;  1JLG A;  2OPR B;  4F4Z A;  3KG0 A;  2D7S A;  2DY9 A;  1D9D A;  1BMQ B;  3KG4 A;  2H3E B;  1RTI B;  2GQQ A;  2F8H A;  3OSP A;  4BLG A;  2E66 A;  3CWJ A;  2CYY A;  4NYO A;  1LFP A;  3HK2 A;  1Q86 T;  4LVO P;  4LRB A;  4C3M A;  4YP3 A;  3LAM A;  2C2K B;  4H4M B;  1RKJ A;  4FYW B;  5CCL A;  4DSK A;  3JYT A;  2Z2L A;  3W66 A;  2KZZ A;  2D69 A;  2IRX A;  1ULR A;  2CQG A;  2YWH A;  1IVZ A;  5KFE A;  3CCS S;  1IN0 A;  1VRU A;  4DUT A;  4OZ5 A;  1JXE A;  1NPK A;  3OTO F;  2DGT A;  2WSE C;  2QL5 B;  2CQC A;  2N4D A;  3VVU A;  2CJQ A;  3DC2 A;  2W9B B;  5D3G A;  2DTJ A;  4I0W A;  4LF9 F;  2OPQ B;  4OYP A;  1N0U A;  4YB7 A;  2OI2 A;  1FXR A;  1F60 B;  2CPY A;  4IUF A;  2RRN A;  2I2Y A;  2IC3 A;  1T3O A;  3SDE A;  1ZAW A;  2NSC A;  3CJT A;  3MR6 A;  3MM9 B;  5ETO A;  2NR0 A;  5K8P A;  4OYA A;  2PO4 A;  2K06 A;  1P8G A;  3PY8 A;  1RT4 A;  3NGK A;  1PJ6 A;  1F2G A;  2Y1L B;  4PCQ A;  1F9F A;  1I94 J;  3C16 B;  3B4D A;  4IFV B;  1U1N A;  3C46 A;  1WF2 A;  3MMB B;  4LRF A;  4LBP A;  3H2U B;  3ZZU A;  4X4U A;  3D1H A;  3EWG A;  4JI1 J;  2FDN A;  3MAQ A;  1AFJ A;  3RZA A;  4QBU A;  4ES1 A;  4MAK A;  1PO6 A;  2V8P A;  5RUB A;  3P3D A;  3T1H J;  3H5S A;  1WG1 A;  1VMB A;  1UP1 A;  2RQM A;  3AJ1 A;  1JQG A;  2CDR B;  3TA2 A;  3RUB L;  1RAD B;  4KYZ A;  3M7V A;  1G1X A;  1KQG B;  5GAD I;  5L46 A;  2VZ9 A;  5L38 A;  3OTC A;  4IR9 A;  1VOM A;  3KMQ A;  2BR0 A;  1CJT B;  5F3Z A;  4EMD A;  1FNX H;  2B8P A;  2DR6 A;  1BQM A;  3J81 U;  4CLT A;  1T11 A;  4YB6 A;  2G1D A;  5SUH A;  2EK1 A;  2IFX A;  2O01 C;  1URN A;  1X8D A;  1SUQ A;  3CDW A;  4A8Q A;  1C1B A;  3MM5 B;  1WEX A;  2L08 A;  2VOD A;  5DDR C;  1ZAV A;  3N6L A;  1XNQ J;  4G1Q A;  1FVS A;  3FRZ A;  1RWX B;  2WB4 A;  4IH6 A;  5B0F A;  1HQ2 A;  3WBZ A;  1HNX F;  1BGX T;  1R6Y A;  2BM1 A;  2RHQ B;  3C15 A;  2PI5 A;  2M88 A;  3T3F A;  2VPZ B;  2Y1R I;  1TMJ A;  2PI4 A;  4QZV B;  4C97 A;  1TUG B;  2UVV A;  1IKV B;  2BVZ A;  3MZI A;  5KFK A;  1V3S A;  4WK1 A;  3VGU A;  4DG1 B;  2R8G A;  4NLO A;  2QL9 B;  2GMJ A;  3AOD A;  3VQT A;  3QGH A;  3OSN A;  2DNK A;  2CUY A;  1WAC A;  1CLF A;  1Y10 A;  3HFV A;  3QO9 B;  3QQC D;  4HDH A;  2I1R A;  2IM2 A;  1RAF B;  2I0X A;  3QAT A;  1ZPW X;  3I55 S;  4DR6 J;  2LXF A;  3KXD A;  1DLO A;  4JI7 J;  2CJK A;  1NK9 A;  4G1P A;  2POK A;  4GMK A;  5HMY A;  3GSI A;  4DV5 J;  2W01 A;  4JI6 F;  3UN2 A;  1FTC A;  1VRT B;  3KG1 A;  4GO7 X;  1HNI A;  2P6S A;  2ALY B;  3LAK A;  2GQ2 A;  2W1B A;  3LP2 A;  3ZZP A;  3R3T A;  4B3T J;  4NCG B;  3RU0 A;  4B9T A;  3CJQ A;  2I38 A;  2MKI A;  1NPP A;  4ELU A;  1FEE A;  3C6U B;  3IWN C;  3H7H B;  3FC9 A;  3W9H A;  3RBZ A;  4ZVH A;  4DV6 J;  2BV3 A;  4FKX A;  4DS5 A;  1AW0 A;  2GNK A;  4K8R A;  1ZM9 A;  4AXI A;  1TR0 A;  1B7Y B;  2CG8 A;  1TL4 A;  3R5G A;  4IOB A;  4ANC A;  3SCK E;  2KYZ A;  3M1V A;  3TJ8 A;  2Q43 A;  4YN3 B;  4A8Y A;  5DQH A;  4AND A;  4JBC A;  7FD1 A;  4Q0B A;  1UFW A;  1S6Q B;  4OX7 A;  4DQQ A;  2WSF C;  4TY9 A;  4JI3 F;  4O0I A;  1FDD A;  3W5Z A;  2HRY A;  5T7L A;  2DGV A;  3CDU A;  3VAI A;  1VCT A;  9ATC B;  4TY8 A;  3NBP B;  2HZV A;  1WHW A;  1VC0 A;  3EM1 A;  3R7S B;  1DTT A;  2CPI A;  2MQ8 A;  3QBC A;  2CAJ A;  3MR2 A;  2F1F A;  1EZZ B;  5ETQ A;  1WG4 A;  4CLF A;  4L72 B;  2X1A A;  2FJV A;  1N34 J;  1KR4 A;  2DK2 A;  5ETV A;  4JI0 J;  2QFJ A;  3MM7 B;  4LSN B;  4CLL A;  2DNG A;  4WJB A;  2KXF A;  2WW4 A;  4DPW A;  1SPB P;  4NXN F;  2HK2 A;  3MOZ A;  3KK3 A;  5E3R A;  2GS8 A;  4L76 A;  2D9P A;  1D9F A;  1FD2 A;  4DU7 A;  4ZJO A;  3BBC A;  2HWH A;  4KPC A;  1NUE A;  4LFB F;  3VAM A;  3UD4 P;  2ZH1 A;  1XR6 A;  1FO1 A;  3OL6 A;  2VV5 A;  4PG6 A;  1NHK L;  1NJY A;  1NXI A;  5GAH U;  2R7R A;  1XMO F;  2GGP A;  2OTJ S;  4LF8 J;  3B4M A;  4W92 B;  2A2C A;  1JLA B;  2DT9 A;  3V6D B;  3KTQ A;  4K5S A;  1IBK F;  2HSE B;  3ZTP A;  1R0B G;  3L95 X;  2XZW A;  2DNH A;  4B3O A;  4DPX A;  2QN6 B;  6AT1 B;  3AJD A;  4EEY A;  4NLD A;  4NLX A;  2DEI A;  4OHV A;  4ETZ A;  4I7F B;  2DNN A;  2P9E A;  2WON B;  4DPY A;  2FQQ B;  4RX6 A;  2XMM A;  3TAQ A;  1MU2 B;  3QGI A;  1IKY A;  1N88 A;  4ZLN A;  3UDC A;  1X4E A;  4DV1 F;  1WOO A;  2Y8Y A;  2HQ3 A;  3G8T A;  1KDN A;  1JK9 B;  1NDK A;  1WF1 A;  3A1Y G;  3GPA A;  4LFC J;  2QA4 G;  3HVT B;  2Y0S D;  1GH8 A;  4J9L A;  1RT6 B;  2IVM A;  4MFB B;  5HLF B;  3ITH A;  3DYA B;  2Y9H A;  1YIT S;  3AT1 B;  5L9N A;  4DR7 F;  3G9C A;  1X0F A;  4Q44 A;  1SKW A;  4BHQ A;  5KT7 A;  2U1A A;  1S6P A;  4P2X A;  3QNW B;  4DQS A;  1U1O A;  1N36 F;  2DKO B;  3SSS A;  2A1B A;  3MFI A;  5DDO C;  1LWX A;  4DLG A;  3AD8 C;  4CT9 A;  2WOM B;  2DRB A;  3CMA S;  1N52 B;  4O4G A;  2YNI A;  1UCN A;  4MK7 A;  2PC6 A;  1YG0 A;  2L9N A;  4DR4 J;  2RQC A;  5IV3 A;  3KLF A;  3S01 A;  3PCO B;  1IBC B;  1YLX A;  4CLU A;  3OR2 B;  4C2M A;  2HEK A;  3M32 A;  2B9Y A;  1CJU A;  4KT0 C;  1MMD A;  1U1L A;  3IP0 A;  3JSR A;  2GIR A;  2YKN A;  3ONQ A;  4LSL B;  4NEZ A;  2RUS A;  2UXD J;  3JQJ A;  1F2H A;  4QYZ K;  3EZ5 A;  2YKM B;  2J6T A;  1L3K A;  1U1K A;  2NQP A;  2XMA A;  4ZLL A;  3GLJ A;  2HQI A;  2C3O A;  4I6Y A;  2F8E X;  3M8P B;  1CEZ A;  2HQG A;  3T1Y F;  2DJW A;  5KG0 A;  1FER A;  3HSD A;  5KG4 A;  2MLZ A;  3OR1 A;  3MPY A;  2NUH A;  1Q0N A;  3KK2 B;  3W5Y A;  3BGO P;  2AYB A;  3OTB A;  2VQF F;  3GJT B;  1RGV A;  2NPF A;  1S6U A;  5CYM A;  1B64 A;  5E3Q A;  5CAA A;  2OSR A;  4C8N A;  1O51 A;  1BQN B;  1IKW A;  2JZ5 A;  4XPC A;  1K73 T;  2BUN A;  1FKO A;  3U1M A;  2BX6 A;  2FJA B;  2G0C A;  2AJ1 A;  1VYA A;  1FX2 A;  2VPX B;  3I6P A;  4ZVP B;  1TV6 A;  2ZD1 B;  4DPO A;  1ZTW A;  2EXU A;  3HX9 A;  5KT5 A;  4R25 A;  1DAR A;  2BM0 A;  1CBK A;  2CZ4 A;  3ZTO A;  4HYK A;  1QM9 A;  4OX9 F;  4I2Q B;  1ZM3 A;  3F44 A;  3QWP A;  1GX6 A;  4QW9 A;  4TVA B;  2XZT B;  2JX2 A;  3L7P A;  3D28 A;  4NRU A;  2ASL A;  3B54 A;  4WZM A;  4QWC A;  1HNW F;  4DV4 F;  4O3R A;  3V81 A;  4DUY F;  2H5I B;  3BEG B;  4YEA A;  2XNQ A;  2ZOM A;  2VFT A;  2XYH B;  2OPS A;  1HBU B;  2F63 A;  2BW2 A;  5AXN A;  4R5P A;  3SXL A;  1YDL A;  3CO9 A;  1JLE A;  1S12 A;  2XQC A;  2EG2 A;  2V9K A;  4IOA Q;  4RBU A;  1PC4 A;  4EBE A;  1VK8 A;  1FT8 A;  3UN3 A;  3OLB A;  3K2Y A;  5CYJ A;  4ZS6 A;  5DQG A;  4ID5 A;  3CIZ A;  2QX0 A;  4LFA F;  1AZS A;  3GQC A;  3BDE A;  3OTO J;  1M1G A;  3F73 A;  3FEZ A;  5L9X A;  3U1L A;  1HMV A;  2FYX A;  1RAG B;  4LF9 J;  2UUC F;  3MPW A;  1UPP A;  5C24 B;  4YFU A;  3MUR P;  2K2P A;  2XLJ A;  4HT7 A;  4I1T A;  1NZ8 A;  4ZPC A;  2RKI B;  2H4Y B;  4EYH B;  2CJ9 A;  3PYF A;  3W2W B;  2KXH A;  2XMU A;  2CQD A;  1VI7 A;  2AYM A;  5ETP A;  5DG9 A;  2YNF B;  5B0A A;  5A6P A;  1Z2L A;  2NXJ A;  1TVR A;  1TP7 A;  2UP1 A;  1K8A T;  1OY8 A;  3K0J A;  2WW8 A;  1JXV A;  1I1G A;  3R5J B;  2XHC A;  1YJR A;  2XC9 A;  4RU2 A;  2QMU B;  3AXK A;  1XMQ F;  1MN9 A;  2BJ7 A;  2AX1 A;  5G0R A;  5HMW A;  2J6U A;  4U7C A;  3ZTQ A;  4A8M P;  4RJV A;  1UVN A;  4UY8 T;  3ENA A;  4Q43 A;  4A8K A;  2DH7 A;  2MZT A;  4I64 A;  3CJ0 A;  2J9C A;  5GMD A;  3U02 A;  2FJW A;  3T9N A;  4LF5 F;  3PTW A;  3N4W A;  3MTK A;  1UMJ A;  5A8R A;  1NSQ A;  4ELV A;  3IRX B;  1VQ8 S;  1VBZ A;  2N3O A;  3TOQ A;  4AT1 B;  1F3F A;  1UKU A;  2OFH X;  4E98 A;  5J1P A;  2OPR A;  4NOH A;  2UZA A;  4O4R A;  2IA0 A;  1R8B A;  3DOK A;  2B9E A;  1MN7 A;  1CC8 A;  2OH2 A;  3Q22 A;  1DHM A;  4LQ9 A;  3HJV A;  4Z7C A;  2J0W A;  2XYG B;  4MKY A;  4ZPA A;  2VFU A;  1MRO B;  4FXD A;  3POT B;  4ZDN A;  4ZCM A;  4U67 Q;  1YRX A;  1SBR A;  3DM2 B;  4WFA Q;  3MGJ A;  4QIE A;  4IRK A;  3EGV A;  4DJB A;  1YRT A;  2LA6 A;  2AJ2 A;  2ZUG A;  3D54 A;  3IM8 A;  1JKH A;  1S1X A;  1GXT A;  2XB2 D;  3ULH A;  1C1C A;  1C2P A;  7FDR A;  5DO2 A;  1FE4 A;  3GYN A;  2LMI A;  1A7G E;  1S1T A;  2MJN A;  2AYG A;  3ZZZ A;  4FS2 A;  3IG1 A;  5KG5 A;  2RDJ A;  3I0R B;  4OX6 A;  1EAY C;  3R2C J;  2AHO B;  2K1R A;  3NWR A;  2D3O R;  3MMC B;  1Y5N B;  4DBQ A;  1J5E F;  1WHY A;  3QLH A;  1HNX J;  3DRS A;  3DXS X;  5B7W A;  1X7V A;  3CCV S;  1OQ6 A;  2V0N A;  5IQ6 A;  1R8P A;  4C7Q A;  3MM9 A;  2BMB A;  4ZMM A;  4QJV A;  1RTJ B;  3BF4 A;  4FVC A;  2XMT A;  4F4A A;  3UQS A;  5HN0 A;  4ZLP A;  4DV3 F;  3TP2 A;  1WKJ A;  4F3M A;  2FC8 A;  2A3J A;  3PR5 B;  5D4O A;  4CT8 A;  4CDI A;  4I67 A;  3BSO A;  1X9S A;  3PFO A;  4OV1 A;  1KKH A;  3MMB A;  4F0M A;  5D0H A;  1H0H B;  1X5P A;  2AJQ A;  1RHQ B;  1UZD A;  1S4F A;  5KFH A;  3GIL A;  5U47 A;  3PYE A;  2JNJ A;  2LDY A;  2R7T A;  4J7C A;  3ET6 A;  4HHU A;  2HHT A;  1KQK A;  2ZNZ A;  3H5Y A;  1IUJ A;  2HZC A;  5A8W A;  2OLW A;  4JI6 J;  5HRO A;  2R2S A;  5GVQ A;  2VDI A;  4CO0 A;  2MJU A;  4CI0 B;  3GJQ B;  2W25 A;  4I4B A;  2W9C A;  3P45 B;  2IJF A;  1YX2 A;  3GP9 A;  1S9E A;  4TQS A;  4ZHR B;  1HYS B;  4FN5 A;  1NH8 A;  4O3S A;  2CJA A;  3AY0 A;  1HD0 A;  1MW7 A;  4AE5 A;  5F9N A;  1IM6 A;  3ZZY A;  4DQI A;  3FBB A;  2VG7 B;  1HKA A;  3Q8S B;  4JYA F;  4Z2X A;  2GJF A;  4DSE A;  2AV5 A;  2F9D A;  1HL6 A;  1RZM A;  3PM9 A;  4GVB A;  1S1U B;  2GZO A;  2FHK A;  2CVI A;  4KB7 A;  3UCG A;  1MML A;  2P2C B;  4DR5 J;  2B8Q A;  1UVM A;  2D3O 1;  5LM7 E;  4X4R A;  2HLT A;  4DFP A;  3AD9 C;  5AXK A;  5D0G A;  1RAB B;  2HYI B;  3UWT A;  4I6A A;  1U2C A;  2BKN A;  2V34 A;  3DLG A;  1NHV A;  5F8H A;  2GHP A;  4UY8 5;  4TXS A;  1HBN B;  3BGR B;  5KFG A;  3BKT A;  1AUD A;  1E6V A;  1S77 D;  2MZJ A;  4PG8 A;  3I31 A;  2HVD A;  4WFX A;  2ZH6 A;  2UXC F;  1M5H A;  1VC6 A;  4RO0 A;  4N41 A;  4W4M A;  3NKY A;  3BSN A;  5B0D A;  4ALZ A;  1TTH B;  1HA1 A;  2VPW B;  3DRR A;  1R89 A;  4IO1 A;  3GON A;  3A13 A;  3WDO A;  4ELT A;  2CWK A;  2EK6 A;  1YQH A;  1U25 A;  4M5H A;  4IH5 A;  2C2N A;  3MMJ A;  1BWE A;  2LFV A;  3BN4 A;  5AJ3 F;  4ZVS B;  4ZVQ B;  1QE1 A;  4JI8 J;  2MKS A;  2ZE2 A;  4K2X A;  4ES3 A;  1EB0 A;  1REG X;  2DNY A;  2GV1 A;  2XMK A;  1F6T A;  1KFD A;  3CCZ A;  2KZM A;  2MZR A;  3SI8 A;  4UZC A;  2EKY A;  1KQS R;  1LWE A;  2CPZ A;  2GVD A;  2BZ2 A;  3DI6 B;  4CYU B;  2GW8 A;  2JVR A;  1FRL A;  4H4O B;  3RBD A;  4R0E A;  1HNZ F;  5J2Q B;  2K3K A;  1Z4U A;  1IWA A;  3QID A;  1HNV B;  4XK8 C;  4QWA A;  2V94 A;  4X4T A;  1QSS A;  4NA3 A;  2PMH A;  2ZWO A;  3MMA A;  4UOH A;  4IR1 A;  1PC5 A;  2ERR A;  5KG2 A;  3JTN A;  3IRW P;  3RGI A;  4Z37 A;  3IS9 A;  4C48 A;  2ZHB A;  1XMO J;  4RW9 B;  2FVP A;  3O44 A;  1WDT A;  5KG3 A;  2ALZ A;  2XCA A;  1IBK J;  2PT0 A;  3H4D A;  1WC0 A;  4CO5 A;  5HMX A;  3BGU A;  1R0C B;  1WC4 A;  3CPW R;  1GMW D;  2IHR 1;  2RS8 A;  4C98 A;  3W8G A;  2DD8 S;  1FTR A;  1PJ5 A;  5A0Y B;  1YKW A;  4DV1 J;  5D4P A;  3CCT A;  3CB4 A;  1UA1 A;  4H4K C;  3M2V B;  2OSQ A;  1GMV A;  3VZI A;  3CMQ A;  2W2Q P;  4RWW A;  4KV8 A;  2HZA A;  4X64 F;  4FXW A;  3GSD A;  1NJI T;  4DWI A;  2KTQ A;  2UVW A;  2ROP A;  2HWI A;  1HQU B;  3PW7 A;  3CW2 C;  1R8A A;  2WVC A;  1FNM A;  2MY7 A;  1KP6 A;  4OYI A;  2ZWP A;  4LF6 F;  4LR8 A;  5DM6 Q;  1SJR A;  4F2R A;  4RL1 A;  3FQL A;  3D6F B;  4KE5 A;  5FLX U;  3DKD A;  4J9R A;  2UUB J;  1NHU A;  1LOU A;  1YZ7 A;  4A8S A;  1U4B A;  2Y8W A;  3EVW A;  2DVI A;  1QSL A;  4DQR A;  3M8Z A;  2GVZ A;  3PX0 A;  1WEY A;  4RR5 A;  4F50 A;  1S0V A;  2OEK A;  2ZKT A;  3DOL A;  4ZN3 A;  2CRL A;  4P2M A;  2WK4 A;  1F9H A;  2KM8 C;  1D3W A;  3QAE A;  1B70 B;  1JB0 C;  2RH3 A;  5IT4 A;  2HMI A;  1X5O A;  1TKT A;  1MLA A;  1U2R A;  5KFN A;  5DRK A;  2WBR A;  3FNN A;  4ZVU B;  3R6L B;  1T9Y A;  3HZE A;  3OJS A;  3TW0 A;  3T1Y J;  3I0S B;  4HLB A;  2FZK B;  1S79 A;  5D4L A;  4N8O A;  3RR8 A;  4Y2A A;  4WKR A;  2WVE A;  1JLA A;  1KN6 A;  1K47 A;  3NWG A;  2CQP A;  3TAM B;  3PG9 A;  2H1Y A;  3UFC X;  4Y28 C;  1OYD A;  3BR9 A;  1N32 F;  1VR6 A;  5KFW A;  1BXN A;  1DY3 A;  2ZZT A;  4KBI A;  2CWX A;  4I7F A;  4K4X A;  1N5Q A;  1RU2 A;  3H42 A;  1NDL A;  5J2N B;  5JMN A;  1MU2 A;  1A0O B;  4F4Y A;  2BKO A;  4A8W A;  1NK0 A;  4AQY J;  3CUL A;  3C14 A;  1FWL A;  1O5J A;  3PW2 A;  1WC5 A;  2AGQ A;  3DLB A;  3FGV A;  3TEH B;  1SVD A;  1VFJ A;  4FYV B;  1JMT A;  2N82 B;  4DL7 A;  4OX9 J;  2IY5 B;  4OZL A;  3TZY A;  3RB0 A;  2XZD B;  4MFB A;  1WHX A;  3BQ1 A;  3HVA A;  4LSZ B;  2C42 A;  3PEH A;  1HBM B;  1Q5V A;  2HFN A;  1R8C A;  2WVF A;  1TKX B;  4DUY J;  4OHY A;  1JLG B;  5DGA A;  2HRU A;  5L1K A;  5DDP C;  1XIQ A;  3GJS B;  1VIO A;  4OZJ A;  3G6Y A;  3TZW A;  5LXY A;  2DCU B;  4IOC Q;  4FYY B;  1VQK S;  1TFY A;  3QIP A;  2YQ1 A;  1KLM A;  3FUY A;  1URR A;  4X62 F;  5IS2 A;  3PKM A;  5KFB A;  3HXM A;  3JYT B;  1GNK A;  1EP4 A;  5KFC A;  2NCK L;  1XTZ A;  3QPI A;  4OZ1 A;  1VRU B;  3P49 B;  1XWL A;  4D3G A;  4OFZ A;  1VLO A;  1RIS A;  2XBP A;  2ATC B;  2GMH A;  4XDC A;  3N9U C;  3DLH A;  4LF2 A;  4R8U A;  4DX6 A;  3PKY A;  3CNQ P;  1RHU B;  3CC7 S;  3LGM A;  3ZC4 A;  1T9V A;  3MEK A;  2QLF B;  1FCA A;  4ZP6 A;  2DRD A;  1RT1 B;  4LQ3 A;  2AMC B;  4J9O A;  1S9F A;  3RRK A;  2PD1 A;  3N6M A;  2NUU G;  3CCQ S;  1U1P A;  3LOU A;  1KRP A;  2BYC A;  2BE9 B;  4ZPV R;  3R97 A;  4QYR A;  2IC3 B;  2Z57 B;  1Q4R A;  3TEG A;  3SDE B;  1WTF A;  4CLY A;  1BUX A;  3FCV A;  1RT4 B;  4QIV A;  4RU9 A;  4YHH J;  2MTL A;  4YY3 J;  3D4J A;  1T0T V;  4OMF G;  5CCM A;  4EZ9 A;  1XMQ J;  3TUI C;  1PAE X;  4PXC A;  1UL3 A;  3K89 A;  3QFW A;  1F5A A;  4CLK A;  2V67 A;  2Q1L A;  2R7U A;  3AQP A;  4X66 F;  1Q8K A;  4M63 A;  3F56 A;  2VG6 A;  2J6S A;  1DTQ A;  2B5J A;  5HJX A;  1JJ4 A;  3W3S A;  4G65 A;  3ISZ A;  3HDS A;  3CC4 S;  2ROE A;  2F5G A;  1QDU B;  2IM1 A;  2ROG A;  3SV4 A;  2B3T B;  3C3L A;  3BQ0 A;  1FJE B;  1T03 A;  4PXD A;  5LXR A;  3CDB A;  2LXU A;  4NEY A;  3KDO A;  2XSF A;  3ENW A;  1SQG A;  4M5G A;  5KFX A;  4OYB A;  2OP5 A;  4A46 A;  4B3R J;  1WSV A;  1Q7Y T;  3HHL A;  1FJG F;  2X1B A;  4RW4 A;  2ASD A;  4ZJQ A;  1XC9 A;  1RTH A;  2CG4 A;  5LSO A;  3FDS A;  5T14 A;  4AFF A;  2VIH A;  1BQM B;  2NYI A;  4K4U A;  2ACM A;  3MM6 A;  3DLE A;  3PHT A; 
#chains in the Genus database with same CATH homology
 4LF5 J;  4JI0 J;  3JAM U;  4DV6 J;  4LF6 J;  5A2Q U;  4DV7 J;  1HNX J;  4KY3 A;  4NEZ A;  4JI5 J;  4X66 J;  4AQY J;  2UU9 J;  2UXD J;  4LF9 J;  4DR3 J;  4K0K J;  2KL8 A;  2UUC J;  4PWW A;  4NXM J;  4LFC J;  4JI8 J;  5AJ3 J;  4X62 J;  4NXN J;  3J81 U;  3R2D J;  2F4V J;  4DR6 J;  4X65 J;  4JI7 J;  1I94 J;  1XNR J;  4DR5 J;  4OX9 J;  4DV0 J;  1HR0 J;  2ZM6 J;  5LM7 E;  4DV1 J;  1J5E J;  1HNW J;  4DV4 J;  4JYA J;  2UXB J;  3D3B J;  4DR7 J;  5BR8 J;  4LF4 J;  2HHH J;  4NEY A;  1N33 J;  4LFB J;  4DV5 J;  3J80 U;  2VQE J;  1IBM J;  2E5L J;  2VQF J;  4B3M J;  4GKJ J;  2MEW A;  4B3S J;  5IT9 U;  4KHP J;  4JV5 J;  1HNZ J;  1N36 J;  1IBL J;  4LF8 J;  3T1Y J;  4JI3 J;  4B3R J;  4JI1 J;  5LMN J;  4DUY J;  4JI4 J;  4JI2 J;  1XNQ J;  3IMQ J;  4GKK J;  4HHU A;  1FJG J;  4DV3 J;  4DR1 J;  2UXC J;  4B3T J;  3T1H J;  4DUZ J;  4DR2 J;  4JI6 J;  4RJV A;  4DV2 J;  4DR4 J;  4X64 J;  2KVQ E;  1XMO J;  4YHH J;  2MTL A;  5IWA J;  4YY3 J;  2MQ8 A;  2UUA J;  4KYZ A;  4V1A k;  5FLX U;  4LFA J;  5LMU J;  4LF7 J;  3OTO J;  1XMQ J;  3J7A N;  3D3C J;  1N32 J;  2UUB J;  1IBK J;  3R2C J;  3W1Y C;  1N34 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...