4JV5J

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4jv5J00
3OTOJ 3T1YJ 5FLXU 4DR4J 4JV5J 4DV1J 3R2DJ 4GKKJ 2MQ8A 4K0KJ 3JAMU 4JI1J 4YY3J 4B3TJ 2E5LJ 4LF9J 1XMOJ 1N36J 1N32J 4KY3A 4NEZA 2UXCJ 5LMUJ 1IBMJ 4RJVA 2UUBJ 2UU9J 4DV6J 4DR3J 1HNXJ 4X66J 4JI4J 4OX9J 4JYAJ 4LF5J 4LFCJ 4NXMJ 4DR5J 5BR8J 1N34J 2HHHJ 4JI0J 5A2QU 2UXDJ 4JI5J 4DR2J 1XNRJ 2F4VJ 4JI2J 4NXNJ 4DV5J 3D3BJ 4KHPJ 3D3CJ 4DV4J 2VQFJ 4X62J 1I94J 4LFAJ 3J7AN 2ZM6J 4DR1J 2MTLA 4DV3J 4PWWA 4DUYJ 4DR7J 4AQYJ 1IBKJ 5IWAJ 1J5EJ 1XNQJ 4DV0J 2VQEJ 2UUCJ 5LM7E 2UUAJ 3T1HJ 3W1YC 4JI8J 2UXBJ 5AJ3J 4V1Ak 1FJGJ 4LF7J 4LF6J 4B3RJ 4DV7J 4JI7J 3J80U 4HHUA 1HR0J 4JI6J 2KVQE 1IBLJ 1HNWJ 3J81U 4X65J 3R2CJ 1HNZJ 4DV2J 4KYZA 4DUZJ 4JI3J 4LFBJ 5IT9U 4LF8J 4B3SJ 4LF4J 4B3MJ 2MEWA 4X64J 3IMQJ 4NEYA 4YHHJ 1N33J 4GKJJ 4DR6J 5LMNJ 2KL8A 1XMQJ
chains in the Genus database with same CATH superfamily
1N0VC 4KAIA 4C8ZA 1TL5A 3HVTA 3NEKA 2M9KA 3IAM9 3LANA 3Q23A 4ZVQB 4JV5J 5B0CA 4LRFA 3DMJB 3MAAA 4TY8B 1Q7YT 3J7A1 3K5PA 1MNEA 4UY85 2W9CB 1S1WA 3V5RA 3VGTA 4PG8A 4X62F 4WFBQ 2Z56B 2FVCA 2GAGC 3QT5A 4NLUA 4Y2AA 2HS3A 4ZLPA 4ECVA 1YIJS 1WKKA 1DLOB 3N01A 3TA1A 4ZIWA 3PO5A 2Y8WA 2VPYB 4CO0A 3HT3A 1I3OB 3EYZA 5D78A 3JSMA 1LWEB 5IT0A 3M6XA 2VOOA 2W2PP 1VDHA 3ONQA 4DV6J 4DSFA 1HQEA 1LW2A 2HRUA 4CH7A 2ZH4A 4LSNB 5C24A 5HP1A 1VK3A 2DR9A 1XBWA 3S7RA 1VCTA 2KJVA 4DX8H 5GAEU 3C15A 3QATA 1EB0A 2CNNB 2R8HA 4LF5J 4N76A 1VK8A 4ZDNA 4O3SA 4QWCA 3M2VA 1ZZNA 1OYEA 2H1YA 3B8HA 2V4JA 2B5JB 1T3NA 1EX8A 3BH6B 1UTAA 3OFHA 3QZ8A 3R5GA 5AXLA 2XMKA 3DCAA 4ZA1A 3PJXA 4XDDA 4ILLA 4HEA9 2V4JB 3DLHA 5HI7A 4NXNJ 3KNAA 3CSKA 5JVHQ 3IBWA 3KJQB 2Z2MA 3R7NB 5IM0A 1SVDA 3MCOA 2ERRA 1YGYA 4RW8A 3CE8A 5F3TA 2MKKA 3BDPA 1JKHB 2GQ2A 2J6UA 1RAEB 3IM9A 2WBMA 4CO4A 3MR6A 2LXIA 1L5UA 1I94J 3QJLA 3FGVA 2CJXB 2R7OA 3AY0A 4R0EA 4RNFA 1X8DA 3D6HB 4LSLA 1S1VB 2P9CA 3HHLB 1NSQA 2DJWA 5RUBA 4J9NA 1UA0A 1HBUB 2IPOB 2B4VA 1C1BA 2Y1LB 1WG5A 2PA8D 4PWWA 5CYMA 1X4BA 1DLOA 1RAOA 2QYCA 3I96A 1FEEA 3M8ZA 3O3LA 3R5BA 4H4MB 4OI6A 3PEJA 3TP2A 1NKEA 2Y0BB 3AQOA 3Q89A 4LR7A 2UUCJ 5LM7E 3QAEA 1X4CA 4ECYA 4Q8EA 1NLKL 5T7LA 2LU2A 3M9MB 1JX4A 1M1GA 3CT9A 3HSZA 3T1HJ 3LPYA 1SUQB 1GXUA 2CJYB 1SL0A 1IKVA 4RBUA 4LRDA 1NCLA 3T5KA 1FJGJ 1S0NA 1NZ8A 4CLTA 4O44B 4WFXA 1HARA 2ZVIA 4IKAA 1JMTA 4DX7A 4IG3B 3CJ2A 3PW4A 4MH8A 4KKOB 1HBNA 2ADBA 1MWYA 2RU9A 5DQHA 3HZEA 2XULA 1EKSA 2DCLA 1CULA 2OEJA 4USMA 3OVSA 3OR2B 3PKMA 2NYIA 4IR9A 4ED5A 4P2FA 3GTYX 4A8OA 5GADI 1N32F 3ADAC 4IUFA 2ZBIA 3GIKA 3MUMP 1FE0A 3KHRA 1L3TA 4IRDA 2ZC4A 1Y5NB 2YX7A 4I2PA 5AE2A 1WEYA 3EGVA 2PMWA 3W9JA 2HVIA 2KYZA 3VTIA 4DFJA 1Y0HA 2RQCA 1QSSA 3E8OA 5E33A 3DRPA 4E0DA 3PFOA 2DHHA 4DPYA 2CADA 2EFOA 3Q0AA 3BO4A 4GO7X 3TVYA 3D0IE 4ES1A 3I82A 4OZLA 5C5JA 5G0RB 1U1QA 3AFGA 5HO4A 2B51A 4X64J 4AL5A 5DG9A 3PG9A 4WWSA 3HLUA 3NP5A 4GC7A 4OFZA 1ZAXA 1RTJA 2VPXB 3VWSA 2HNDB 4I7FA 5IS2A 3J81Y 4ED0A 1NK4A 1WNEA 4KJIA 1PC4A 2O01C 2OKQA 2GFFA 3MD1A 2IJNA 3M8PA 2ZBQA 1H7WA 2L9DA 3IO1A 2DR5A 4UUXA 3EPGA 4RNHA 4QYRA 1E6VB 2Q6BA 1HBMB 3R8YA 1RTZA 1NDCA 2CVIA 1P9QC 2YH0A 3JSBA 4YDXA 1YBAA 3U7JA 1N52B 2FLPA 3D28A 1NPRA 1Y3KA 4DHVA 1RTHA 1N36J 4I6WA 2JHEA 1JJHA 1UFKA 4MYTA 1G3OA 5BXIA 5E2QA 1VBKA 1X4HA 4Q44A 1URNA 1Q1KA 3M8QB 4ZHRA 3EGZA 3OT9A 5E41A 1NSAA 1S1XB 4DF4A 3MMCB 2HHHF 1VQ6S 2I9SA 2HRTA 3C2PA 1Q82T 4O4GA 1GH8A 4IFYA 1S0MA 5IC6B 4TYAA 1Q4RA 3NAHA 2F4FA 2IC3B 2QE5A 1VQKS 1TKXA 2G2YA 3AOAA 3FCHA 1AA1B 1FESA 4ZJQA 3QYYA 5KG0A 1Q53A 3KHGA 1U45A 1WEXA 3D54A 3PV8A 3B78A 2COLA 5LJ5Y 3EVWA 1CJVA 2JFKA 3I0RB 3CCMS 3UCUP 1Z4UA 2AGOA 4DSJA 2L3MA 2Y1IA 1TK8A 1SJ4P 4AE5A 1DRZA 2EK6A 1RT5B 5KT5A 2HFUA 3MEKA 4IOAQ 3ILLA 1SC1B 1R0CB 2ZDPA 5B09A 1N6QA 3QFWA 4HACB 2BJDA 4X4RA 4KPYA 2MQNA 2J8SA 2HFSA 1VQ7S 5KG7A 3A8KA 1KHVA 1KD1T 2VPWB 2ZH7A 2MZRA 2FHOB 3NGUA 2MZ1A 3D3CJ 5ETOA 1QSYA 2JX2A 4OX6A 3MR7A 2MDAA 3FBEA 1ZM4A 3I4HX 2VFVA 2QL9B 5DDRC 3AD9C 1RU2A 1SQEA 2VF3A 3GLJA 2ZM6J 1IKXA 6FD1A 4C0HA 3MPUB 1OSDA 3EXCX 1DQ8A 2F40A 5HVFA 1FTCA 3MUTP 1X4FA 1W2IA 4FKXA 3ZZTA 3NBPB 4CLZA 2J0WA 5T7LB 4NLVA 3BB5A 4U6PA 5DLFA 1AT1B 1G4CA 4ZP7A 2UU9F 4B3MF 1D9AA 4PUOB 1UVMA 1FJEB 4M5GA 1FFSB 2W9CA 3C46A 2LLZA 2DY9A 4WE1B 3NNCA 3GYNA 3MCNA 1YBUA 5L1JA 4ECWA 3P96A 1AFJA 4RW4B 1OY9A 3DFEA 2HBYB 4O3QA 4ANCA 4RW7B 2ZOMA 7FDRA 4UTGA 4XO0A 2PD1A 2ZD1A 3GIIA 4Y00A 2D9OA 1H38A 3CMAS 1D8YA 1QJHA 4C2MA 2CQ2A 4LIRA 5EDWA 1FXRA 2HURA 3A8IA 3QRRA 4A47A 4CH1A 3H8YA 5IOLA 2XMAA 1T03B 2M4MA 3MGJA 4J91A 4KE5A 2EG1A 1Q79A 3PX0A 2GJFA 2VOPA 3QQCD 2GNKA 4NI2B 2GS8A 4HI1A 1XR5A 4I0WA 4OHXA 1YZ7A 1U8WA 2Y0SD 1U1NA 2HGNA 5B0EA 3D2WA 4NCBA 1X31C 2C3UA 2BXJA 3RAQA 4PQUB 1D0EA 1ZTTA 1GT8A 2Y3YA 2G9OA 3M6VA 4JYAF 4N77A 4DQIA 2IYIA 2VKRA 3GJSB 2KXHA 1WEZA 4KGXB 4M8LA 4PYDA 4BLGA 4NRUA 3VGSA 4TU7A 3GV8B 4EZ9A 4NLGA 3QIPA 4RL1A 5IT9U 2JDJA 4ED7A 3H4BA 3OVBA 3ILJA 4B3OA 2BKPA 4R0JA 1RAAB 2HZVA 3TX0A 3VCDA 4IRKA 4KGKA 4LBPA 1VLOA 4CLLA 3E01A 2DY1A 1CJVB 3LP2B 4Q7AA 1GMVA 2HW3A 3SQOP 1H72C 1X4DA 2SXLA 1IXKA 3GR1A 2X3DA 2IA6A 1TL7A 1HNVA 1U02A 2FJBB 2FHMA 4DU8A 2ZWOA 1Q5YA 1R6YA 2CQIA 4DG1A 1RBOB 3W61A 2NCKL 3RYLA 4WKYA 2N3OA 3M8SA 5D4OA 2ZD1B 3MD3A 1KC8T 1O6XA 4B02A 4CYUA 1M5VC 4JI8F 2E5LJ 2HLTA 4ZVUB 4C7QA 2AV5A 3IP0A 2ATCB 3M2RB 4PG5A 5I3UA 3RB6A 3MMAB 4NLWA 5HQLA 4HHJA 4ZJLA 4QWAA 2L41A 2R2SA 4M5IA 1EARA 1Q8LA 4OYXA 2Q1LA 3LA0A 3PACA 1J5OB 3DLGA 4U96A 5DDOC 5KFBA 3GONA 4BHQA 3VVUA 2ROPA 3NBPA 3N4WA 4JI4J 1T05A 3GR0A 4TQRA 3PYEA 1WDDA 2WHOA 4CI0B 4CT9A 1OPZA 2XNQA 3MPYA 3CC2S 5D4PA 2E1PA 1T0TV 1LK5A 4DX6A 2FZGB 2HS0A 2KT5A 3HULA 5D77A 1Z2ZA 1REVA 2WW4A 3CJ3A 4LVNP 3LH2S 3SSSA 2VBZA 5EUHA 4WCEQ 4DPUA 2DNPA 1QE1B 2UUCF 2CWXA 1T9XA 2V67A 3KDNA 4UQGA 2FDNA 2YNGA 4NPOA 2DR6A 2XS5A 3IGNA 2QA2A 3MM9B 1RP5A 1H7XA 3BO2A 3FJ2A 3BGRA 4WFYA 2F9DA 2JVRA 2NZCA 1WI6A 4QBUA 4ED4A 1PAEX 1S6QA 1SBRA 5KT2A 4R5PA 3GV5B 5HBMB 2GQCA 1NB7A 3VZHA 3V6JA 2HVZA 1NJIT 1JLEB 1MN7A 1RKIA 4X4TA 2VQFJ 3MCSA 3J7AN 1S6PA 2KT2A 5HLFA 1D1UA 4UOCA 2HNZA 5DG7A 1R6VA 1EIYB 2QSFA 2VC1A 4PEOA 4DV3J 1LWXA 4DR7J 5J1PA 2RDIA 1WHYA 1KLMA 5A8RB 3AAWB 3R1HA 2C1EB 2XMUA 1RWWB 2CZVC 2LA6A 3X1LB 5CD4H 2A18A 2XZDB 3TVZA 5KFGA 1TK0A 4OI2A 1VQ4S 1ZOTA 1S5ZA 3DGVA 2BJ8A 3M8WA 1EP4B 1KDNA 1WACA 3VAKA 2HQCA 2ZOFA 2DHAA 2MHEA 5A6PA 2DGOA 4IFVB 1CSJA 3PYFA 4ZMMA 4B9NA 1PILA 2YKAA 2GIQA 3QJJA 1ULRA 2MLYA 3D1QA 4L3KA 4BWJA 2W4PA 2H48B 1AUSL 1APSA 4JI4F 1S9EB 3R3TA 1F2HA 2E5GA 5FDLA 5K14A 2BDPA 2W7AA 3TA2A 3E2EA 2XCAA 3KK1B 2XO7A 5M2UA 3NMAA 3P6YC 4LQ9A 2DNYA 2B6AA 4MIBA 4HH1A 4Z2XA 1N5YA 2J6SA 3BF4A 1S7HA 1N33F 2Z0GA 1MLAA 1YITS 5KT4A 1R0BG 1M1KT 1K0TA 1B0TA 3B4DA 1ZS6A 2KKHA 4F26A 1SJ3P 3HHNB 1HI8A 2GJIA 4F3QA 3MECB 4QYZJ 5IM0B 4NOHA 4B9TA 1G6BA 1P27B 2YX1A 4G65A 3SQGB 3TVKA 4DUZJ 4KHPF 3R5JB 2UXCF 4LFBJ 1GFWB 3HHLC 4I68A 1NHVA 5L38A 1JLGA 1UEUA 1FKPA 4ZCLA 4IG3A 3OHAA 4N7TA 4IRCA 2HQGA 2CRLA 2HAFA 2QA4S 1YJVA 2HPUA 4RW6B 3V81A 1FRHA 1M5PC 3LO3A 3Q8SB 2IY5B 1S72S 1NPPA 2CJQA 4L73A 2JLEA 2PEHA 5C42A 3OSNA 4NLRA 2APOA 2CVEA 1SCJB 2LQ9A 3IS9A 3FSIA 1T03A 1KOHA 1IUJA 2W2OP 3DLGB 2KM8B 5JMNA 3G8SA 4OLOA 3MPWA 2ZH1A 4CCHA 4CH0S 4X65F 4JOUA 3FNNA 5E7OB 1RHJB 5KTQA 3TI0A 2CQ0A 2GCFA 3O44A 2VA3A 4WP3A 1D9DA 1IR0A 1VQ9S 1TL1B 1FJ7A 3DOMA 2CPJA 2RUGA 3DLBA 2HAIA 2HHPA 3DU6A 3PFEA 5EGYA 4QU6A 1IBMJ 1NK5A 2FVPA 2CPYA 1P8GA 4ZOSA 3U1NA 4LR9A 4RUHA 2MJNA 3WHIA 5C42B 2KRBA 4IFVA 4TLQA 4NXMJ 3BO3A 3CCRS 3EZUA 2Q66A 1M0SA 1SH2A 3K7RA 2IM2A 3KJNB 3UW1A 5F8HA 4QJVA 2DNQA 5GMKa 1JLAB 2XS7A 3KLEA 3OPKA 4EBDA 3I32A 2VQEF 4NLYA 2W8KA 4NLXA 4JI2J 2LVWA 2YKMA 3CO0P 4KGVB 5ETVA 5IQ6A 2DO0A 3LP0A 3DOLB 4LVOP 4PPDA 1JXEA 4F4YA 5LMUF 1DARA 1NSPA 1U24A 1B4SA 1T9UA 5D0RA 5DQGA 3RAXA 2DNZA 3RZAA 3MM8A 5J2NB 5HLFB 4PXEA 2RAQA 1UVIA 4NL5A 3VQSA 4YDDB 5DQIA 2UVWA 4K4UA 3C6TB 1SB6A 2HGLA 5H9EJ 1B3TA 2UUWA 1Y00A 5KAKA 5F0WA 4JUZA 4ECXA 3SQGA 4ID5B 2NPIA 4NA1A 2GVZA 1VQSA 2QLXA 3MR2A 2FTRA 2C3YA 3TARA 1PYTA 4IDKB 5J1NA 4J90A 4ATNA 4ZS6A 5IZHA 4RUCA 1PJ6A 3NLCA 3TUZC 3OXGA 4YP3A 2NUHA 1OSCA 2VV5A 3PRVA 1YBTA 1DURA 2CDQA 3W1YC 1XMOF 3JAMU 4DR7F 3O2IA 3B82A 4U7CA 2BQRA 2BQ3A 2QZ8A 1RTIB 1B99A 1RBAA 4DR5F 4PG7A 5CCMA 3N6MA 3WQPA 2XM3A 4Y28C 1S9EA 2VPZB 2RS8A 4MIAA 5E5NA 5HQ8A 3JQMA 4P72A 2RB7A 1T11A 5HJXA 4QWBA 3IS9B 4OI1A 3GU0A 1E6VA 1FDAA 5DDPC 3U27A 4O0IA 3SI8A 1Q95G 4JI7F 1SC4B 4DUYF 4EBCA 4HHUA 1HR0J 2RQ4A 5HMZA 3E51A 1CS4A 4CRJA 4DSEA 4GVBB 2KVQE 3SYZA 2RMLA 2XMWA 3HJVA 2YWGA 3LW5C 5AXMA 5BR8F 3H5UA 3NMRA 2P6SA 3K0JA 3IA0A 3Q8VA 5CQGA 3E3XA 1BXNA 1JLEA 3S8SA 4B9UA 1KVJA 2OEMA 4P7VA 3RAMA 3K2YA 1JWWA 2ZE2B 1Y11A 3ET6B 3NCPA 1RA7A 2VFSA 5J2MB 3PVXA 2OTLS 1FDNA 2BYCA 2KHCA 2KU7A 3OR1B 3UCGA 3FFIB 4I6YA 4ID5A 3UN2A 4Q43A 3TJAA 3EGWB 4B3SJ 4LF4J 1B64A 2AJ0A 1ZM9A 3WDOA 3UN3A 2JOQA 2OFGX 2LP4A 4EFAC 4NYZA 4K2JA 1TKTB 2DH9A 2XLIA 1M5HA 2K3KA 4P2XA 4PAAA 1HD0A 4M5LA 1TELA 3DRRB 4HVZA 4OYAA 2X7IA 3H5SA 3CJ5A 3DNCA 2DRDA 2WW8A 2V94A 3CIMA 3HHDA 3N0VA 5K8MA 2YWKA 3D6TB 4O4GB 5KFZA 4TU8A 3JS9A 1WC6A 2E1AA 4NX9A 4NLTA 4QWEA 1REVB 4PQUA 1VQNS 1TFWA 4ZLNA 4KV8B 3IBCB 3M8QA 2B9EA 2MZQA 4ZHRB 3PIOQ 2ZJPQ 1XMOJ 1FWKA 1KKHA 2A0FB 4A8KA 1EQMA 3AB2B 3IWLA 4LQ3A 5LSOA 2PA3A 2QTWA 3K8WA 1H0HB 5K8NA 2R2RA 4RU9A 2UVRA 1U1KA 4NEZA 4Y2KA 5A0YA 2YTCA 1UW9A 1FDDA 3B54A 4QR1A 1HA1A 3GFZA 1OPIA 3KUEA 5LL6d 1HNXJ 2NQPA 2DCUB 3GP9A 3K89A 3UPFA 1F5BA 2I8EA 1HL6A 2MKSA 2V8DA 5ETSA 3PXGa 3RR8A 1TL7B 4OZ5A 4RW7A 3SSQA 2E1MC 2CNOB 2PMHA 2KJWA 1X5OA 5ETKA 3CPWR 1RZMA 4MT1A 1RUSA 2XCPA 2J76E 3AQPA 4JI0J 3H0PA 4TY9A 1WTBA 5G0RA 4OZ1A 3HF5A 5U47A 2XYPB 1RT4A 2XO6A 4DN0A 4G1IA 3CCLS 4DR2J 4HTJA 3JYTA 3MPDA 1R8HA 2HQFA 2OD4A 2HFVA 1VIXA 2KRRA 2LMIA 1OY8A 2OJ3A 2IVMA 1VQMS 1WKJA 3HVWA 4DBQA 3J7YU 1CQMA 1NJZA 1WOSA 5LOQA 1WF2A 2CG4A 3KWMA 4O0NA 3DHWC 4ZJOA 1Z2LA 3M32B 3MAHA 1R0AA 5HQMA 3CIZA 3TZWA 1Q16B 4K50A 2IIHA 1MMLA 4OJGA 1KWMA 1QY7A 3CDUA 1RT1B 1UJ6A 1VFJA 1YRUA 3M2UB 1S10A 5KFRA 4AQYJ 3A13A 3IR6B 2VDHA 1IBKJ 1V6HA 2ALZA 3V4IA 4OX7A 1FK9B 2FJXA 3W2VA 3MMBA 4ZIVA 3KOAA 3I9ZA 4DV0J 1XJWB 4JI1F 2Z2YB 3UR3C 2C2ZB 2H65B 2ILYA 3CNQP 2VONA 4DV2F 1NDLA 2AEFA 3I0RA 4MKBA 4DR1F 2V6AA 5KFLA 1MROB 2PFFB 1SJQA 1KTQA 3MDFA 2KI2A 3CCZA 3OTEA 1FA0A 2XGPA 3CB4A 4ITSA 3EJMA 4BWMA 2UP1A 3W8PA 2MJUA 1Q8BA 5K5MA 3T9NA 2MXYA 1NDKA 1IM4A 3BS9A 4YQWA 2HHSA 1FJCA 2BM1A 6AT1B 2NLWA 2IHR1 5ETLA 4FVMA 5DETA 1K47A 2WOMB 4N56A 3MWBA 3BYRA 3DOMB 5CYMB 2R7VA 3HZGA 1F3VA 3P3DA 1S1UB 4OYWA 3TNVA 4BS2A 2M88A 3KJFB 4LF8F 2BW2A 4F4WA 3HI9A 4M5DB 2QX0A 2XY7A 3C14A 1N8RT 1HNWJ 3J7ZT 4RPFA 1RAHB 4XPCA 4ZKAA 4HDHA 5KG4A 5J2NA 4QIGA 2BV3A 3GWCA 4ECUA 1X60A 5GAGI 4LSZB 1ZA1B 4YEAA 4NCAA 1SPBP 1NRKA 2B43A 2EC2A 2OPSA 2RHQB 3BM7A 3DOLA 5E3CA 4ZVHA 3KJVA 4WP8A 3SV3A 5LXYA 1VJWA 5KFTA 2NR0A 1U48A 1FRJA 2NXUA 3J80Y 3NGTA 4ZITA 2C3MA 2DGUA 2GO8A 2DD8S 3RU0A 4USTA 5KFVA 4ECZA 1QLNA 1JLGB 4UOFA 1H2VZ 2XMTA 4OIXA 1PG5B 4OX8A 1U1LA 2KFZA 3G87A 3FMWA 4YB5A 2EG2A 4A8YA 3MEGA 2OPPA 4F04B 1F5AA 3CJQA 2EVZA 2R2TA 4DR4J 3FRZA 2X1BA 3M1VB 2QG9B 4GKKJ 3MEEA 3BGLA 4E98A 4ANDA 2EBEA 2H4YB 2HZCA 1NPKA 3H2LA 4IOBA 4I1TA 4CO5A 1U8SA 3Q86A 1RLCL 1XWLA 3I4PA 4PCQA 4K4XA 4C3LA 2BMBA 3UDVA 4DQSA 5EWFA 1YJ9S 2NXNA 1FKAF 1LW0A 4WF9Q 2DYAA 1RJJA 2YNIA 3G2XA 1PKUA 3KK2B 2YWWA 1TP7A 3KNGA 3MAAB 4TY8A 4UZBA 1XC9A 3ISNC 2NYHA 3ENQA 4P75A 5D4LA 3KK2A 4G1QB 4WFNQ 4M5KA 5AXNA 4MKVA 1P1TA 4CNZA 3QZ7A 1QTMA 4DSLA 2CZ4A 2P6TA 3FEXB 5D4NA 3BDEA 3BJYA 1YJWS 1HI1A 4M5MA 5HANA 4DL5A 3NL0A 2ASJA 3DLEB 1PCAA 2V34A 2JL9A 3ZC4A 1MU2A 2ZZTA 2ALYB 3D0HE 3Q83A 2MKYA 1WWHA 1DTQB 2IAJA 1N4LA 4WK1A 2CPZA 4DV5J 3DRSB 2FJWA 2AF6A 5ETRA 3D3BJ 3CJ0A 4W92B 2XQCA 1T9TA 3ZZRA 4EI2A 1A9NB 1ZPVA 2HSEB 3HHKA 2CPDA 4EUVA 4J37A 4X4PA 1U49A 2XHWA 1S6PB 4KHPJ 4AXIA 1PC5A 1TMJA 2LECA 4U7UK 3PX6A 1DQ9A 1HPZA 1S6UA 1U0SA 2K2PA 2OSQA 3P5BP 4F0MA 4CM2A 2DXEA 3KUGA 3M7VA 5HMYA 2R2UA 4WIIA 2FC8A 2UVUA 1LXJA 4OYPA 4D3GA 5A76A 1RHRB 1NDPA 3Q8YA 2ZH9A 4DUYJ 4PABA 2FZKB 3IBFB 2KZZA 2CQ1A 3MZIA 4ECRA 2OPSB 1TFYA 1QAXA 1V3RA 1WKLA 2H4WB 3TEHB 1JNRB 3D66A 4CP5A 4DUTA 3JTPA 2ASYA 3TZZA 1C1CB 4H4OB 1TTHB 2F65A 2LXFA 1S1XA 4FKYA 4I69A 1NJYA 1X5PA 3NOCA 4M5HA 4CTAB 2UUAJ 2K1RA 4QR0A 3TYTA 3EX7B 3ZTOA 1VRTA 3PTWA 2J9EA 5E3AA 3LF0A 4NZ6A 2VB6A 3ITHB 4F8RA 3Q22A 2ZBRA 3VAMA 3JXOA 2M3DA 3M8YA 1NH8A 1D09B 1J5OA 1XNQF 1Y10A 2IYGA 1OMSA 1Q8KA 4O44A 1YJRA 3GG1A 4ERDA 4WZMA 2R7TA 3JSMB 3DLKA 3T6JA 2OELA 1Q81T 2C2EA 1UWBA 1GMWA 2OMLA 4M5JA 2XTJP 4PYAA 4P73A 1S1VA 4WK3A 4Y34A 3RUBL 3T41A 2V4QA 3W7BA 1EJ7L 2HHXA 4PXBA 2EC0A 4Y2CA 1PO6A 4X4UA 1LW0B 3PRDA 2W7OA 3IG1B 2NXCA 3R2CJ 3NGRA 4C4WA 1T9WA 4PPZA 5CCLA 1RDRA 3KLVA 3V4IB 4KIAA 1CBKA 4CLFA 1EAYC 2YQ1A 4ANEA 3MOJB 4TU9A 1FVSA 2IFXA 1RT1A 1AZSB 1PAUB 2QLWA 5IWAF 2EEYA 1N5VA 2BJ7A 2YPYA 4O4RA 4RW6A 1TKDA 4OL8A 5AXKA 4CIOA 1RCXB 2K7KA 2RT3A 1U26A 2OPPB 5D6GA 1FKPB 2QT7A 3MXHP 1KS2A 3AOBA 4QWDA 2G13A 5KFWA 3IR5B 3KJVB 4ED6A 1WC5A 2HQ3A 2ZBPA 3NGSA 2LEPA 5H9FJ 2AYEA 4U95A 1BQNB 1JLFA 3P5TL 3NNAA 3F56A 3MR5A 2BA9A 1ROFA 2DEIA 4UF4A 1NB2A 2CJAA 4P6QA 3BKUA 2QA4G 4B3TJ 4DR6F 1OYDA 3OQ2A 4M5DA 5KFJA 4LF8J 2B6AB 1NO8A 2EFNA 4PXDA 4WYWA 3CF5Q 1IKVB 3IAS9 1VISA 4E8UA 2CQ4A 4ZVOB 3OXLA 4H54A 1P1LA 3PEHA 5D0EA 3QGPA 1H73A 1ZYQA 1MSWD 1RT7A 2DIUA 1LOUA 9ATCB 2UXCJ 5K8OA 1RACB 1L3SA 3VALA 3PYDA 2E5LF 2QFJA 2ZM6F 2VIHA 1U6FA 3HD1A 1HQUB 1J2VA 1NBEB 2B4PA 3DHXA 3ISZA 3RBZA 1VBXA 3RR7A 3DKDA 4PWDB 3A1YG 1KP6A 3ENVA 1U2RA 5L1KA 1VQ5S 3HK2A 2ACMA 2OEKA 4C11B 2A2CA 1J27A 2FJEB 4P9SA 4DFKA 1K73T 2V2VA 2VG7A 4GVLA 4B9LA 3NAIA 3CD5A 4Y3CA 1WDTA 4KV8A 3GYGA 3MMBB 1LWCA 4HDGA 1HWJA 2AKWB 2MHNA 1IJEB 2XC9A 1BD6A 2L48A 1MN9A 2P2CB 3GFHA 3H2UB 3U02A 5KT3A 4WBFA 3NS6A 1TUGB 3QBCA 4C6AA 3TUIC 4K59A 2D7SA 1NH7A 2JNJA 2G2ZA 2AIRB 2XSFA 3QMQA 5ADZA 1KEKA 1KVKA 3NS5A 2IBOA 2DGVA 1H6KX 1RHUB 5CZVA 2FLOA 3Q8QB 2B7CB 4ETZA 2AYGA 2HWTA 3LWLA 2RHSB 5GADU 3R1LA 3CCWA 4DL7A 1JXVA 1Y9OA 3SV4A 1X7VA 4DSIA 4F2RA 2RQKA 2ZE2A 4FYWB 2VUGA 4IO1A 1RYRA 3DRXA 2AWZA 4OYZA 1XQIA 1QE1A 2A6MA 2OD6A 2ZITA 5CYJA 1HPZB 3LWMA 2NZ4A 4NXNF 2NXEA 4I2PB 4EZ6A 1C2PA 2FGOA 2HYIB 3HPOA 2E9RX 4NXMF 4YS2A 5J2QA 1Y5LB 3L9ZA 2XGQA 1F0XA 5BYQA 1NHUA 4DSKA 2IM0A 3I0SA 5B0FA 4B3RJ 3PCOB 2LQ5A 4USJC 1SJFA 2UUAF 3MM7B 2E44A 1K1SA 2DNKA 2ZH8A 2L9WA 4GVBA 3SBMA 3KHLA 1YJNS 3KFWX 1WD6A 4PKDB 3C6UB 1ZBTA 2B9WA 3AT1B 3B4MA 4OYMA 2GA7A 4MKYA 3BV8A 3QT6A 4A8MP 2DO4A 3TR5A 4LFBF 2AEJA 1RAGB 3BPSP 5BJRA 3H7HB 2FJAB 1GQEA 2QL5B 1RWOB 3IRWP 1HNZF 1RK8A 2RRBA 4PQAA 1M90T 3AJ1A 3AXMA 2PGCA 1K44A 4DF8A 2D41A 4LJMA 5E0OA 4C11A 2J5AA 1MWZA 4OI4A 1ELOA 4QCLA 1RT5A 4EWTA 2BUNA 1RTJB 4PWDA 1FNOA 2DISA 2G0JA 2Z2LA 4NEYA 1MW7A 2G2OA 4Y6IA 3Q8RB 2OUGA 2FUG9 4GKJJ 1KVIA 4U7UD 1X4GA 1YK9A 3EICA 4USIA 1S77D 3HFVA 5H1SV 3QGHA 4NRTA 2IDEA 5J2MA 1ZTWA 4F3OA 2FC9A 3UDLA 3T1YJ 1FWLA 2O1PA 4DZDA 3MFHA 3P45B 4KGMA 2B4UA 4DL6A 1IM6A 3RG6A 1XMBA 5MLCV 4IH7A 3GV7B 2B4OA 2HVHA 4RUBA 1SV5A 2VHGA 1WHVA 4CLPA 5L8RC 2RF2B 3NRBA 1JLFB 2GHVC 1YG0A 3GJTB 5D15A 3CC4S 3THTA 2IVFB 3BQ2A 4NYPA 3TAQA 4K4SA 2AD9A 3DRSA 5AJ3F 1RTHB 1VC0A 1F6TA 1CULB 2ZUGA 4QIWD 1N34F 3Q2SC 1NK8A 1SC6A 2ASLA 2CZ9A 1PBAA 2HS4A 5HP1B 2YKQA 3TW0A 1S1TB 5B0GA 3WX4A 3KG1A 4RJVA 5KG6A 5J2PB 1A0OB 1VBZA 3BYPA 3Q8PB 1JJ4A 4HHHA 3UNGC 1S0VA 3SFUA 4JYAJ 3EVMA 2BRKA 2ZEJA 4ER8A 4G1QA 1C4CA 2EPIA 1DQAA 1FD2A 3N79A 4I2QA 1T02A 3TRGA 2G4BA 5FD1A 2CQCA 2UUTA 5CAAA 2Y9HA 4PUOA 1M1HA 2K3IA 3EZOA 3PM9A 1T94A 1JJCB 2BRLA 2BZ2A 2V2ZA 3D7SB 1LXNA 3SSRA 2MMYA 4ZP8A 1C1BB 3W5XA 1Q7LB 3HP6A 3N5FA 4DV3F 3WBZA 2V9WA 2CYYA 2N82B 2F8HA 4FZVA 2KM8C 1VR6A 4LSLB 4DI6A 3CJRA 3PNIA 1DFDA 1QM9A 4ES2A 2A1BA 3R5CA 1R3NA 5HROB 3W66A 2ZH6A 2OI2A 2HMIA 3MM8B 5JXSA 3T1YF 2M7SA 1RT2A 2RNEA 3KUHA 1H3DA 2AT1B 4HT7A 1UFWA 4ED8A 2MTLA 3DYAB 3WC0A 2VZ9A 2P8IA 4UY8T 4Y0FA 3DOKB 4K5SA 1HHSA 4KQZA 3RW7A 3S6EA 3KK3B 4NLDA 4DFPA 1LFPA 2GW8A 4ECQA 1U09A 2JC1A 2WB1D 2QYGA 1FRIA 2I38A 4LT6A 4DPXA 4JI5F 2ZOGA 4YHHF 2GIRA 1R8AA 3M2VB 5C25B 2ZWPA 3TAMB 5DS7A 2PSZA 5AJ3J 2LEAA 1FFWB 3RRHA 3K58A 4R8UB 1FT8A 4J7CA 4RX6A 4XTTA 3O5TB 3PO4A 2OFHX 3A8EA 5DGBA 1YLXA 1KFDA 3HDSA 2KG1A 1K8AT 3HJFA 1PIEA 2MPUA 2FHJD 4TLRA 4A8WA 3AA8A 3UD5A 2ZBCA 2KYXA 4ZVSB 2MSTA 4A4JA 2F1FA 2R8KA 4K4YA 4ZVPB 5KFQA 1RWMB 3M6WA 3NGDA 3VAFA 1IKWB 2W4DA 3FCWA 1KQKA 4TXSA 4RWWA 3UE2A 1GNKA 4RU2A 4MAKA 2V2KA 4URQU 4U8YA 5KFXA 2CQ3A 3DN9A 3PW5A 1SKWA 4QW9A 3DMJA 2KTQA 5IT9Y 3SXLA 4YN3B 4C0BA 3CGIA 1CJTB 1S4EA 1TK5A 1JLBA 2VL1A 2FLNA 2YNFA 3SEOA 4FBUA 4ZPCA 1CC8A 3HT0A 1HW9A 1NXIA 2Z2ZA 1CQNA 4ES3A 5GMEA 4OV6A 1IKXB 3CXCR 4F50A 2CNLB 5IXUA 2XHCA 4L6V3 3LUYA 2MEWA 1YX2A 2GGPA 5AE1A 3BKTA 2V8VA 5F0UA 4PR6A 6FDRA 4Q5VA 3QT7A 4KH0B 4AXJA 5EWGA 3MOZA 1XNRF 5L9NA 2ZHAA 2BE9B 2W9AA 1EZZB 1OS5A 1H2UX 3CDBA 3N6NA 5LMNJ 3I0SB 3R7BB 4EBEA 2OH2A 1N36F 3OUYA 4EO8A 3MECA 5CZXA 4FF1A 1VIOA 3CUNA 1AFIA 2R4FA 1FXDA 1UPMB 5FLXU 1YKWA 2ZDOA 5LT5A 4C8YA 3GZ7A 4MK7A 3KLGA 2R42A 2AW0A 3LQVA 2ZJRQ 2FZCB 1RYSA 2LFVA 4YFUA 2HFOA 3MM6A 1NJXA 3R2DJ 4S0MA 5KT7A 2FVRA 3AHPA 1D3WA 3C19A 3ISND 4B9SA 1IR2A 3UQSA 1KQSR 2B56A 3ICLA 1SQGA 3NG8A 4RKUC 3BBCA 3ZXWA 3OR1A 3R9LA 2MLXA 1S9GA 5K20B 3CW2C 3LGMA 4Q2MA 5ETTA 3MM9A 4YR2A 1HLWA 2EXUA 1X5SA 1FKOA 3QLHB 2W2QP 2NREA 2ZVSA 1M5KC 4FYVB 2B8PA 1UETA 4L75A 3ZZOA 5LMUJ 2YQ0A 3OTDA 3W60A 2JLGA 2XY6A 3UWTA 2UUBJ 4Q45A 2CG8A 1F9EB 4EYHB 3GB0A 4OYOA 3QIDA 1HFEL 1E6YA 2DTJA 1FX2A 4ZVEA 4A48A 4RNNA 3GIMA 3H42A 2LYVA 4AD6A 4LFCF 1T05B 1SXLA 4A8XA 1DTTB 1RWNB 3CCUS 2RRAA 1MG7A 4RLEA 1R7IA 2DNGA 2G1DA 2XZWA 3ITHA 3VAIA 3RBEA 5FJ4A 1B0PA 4N8NA 2R7WA 1U7LA 3BQ1A 2CWKA 2C2DA 3DLJA 4DUZF 1XEZA 4WXOA 1KRPA 4C9DA 3CVKA 4DPWA 2E29A 2E5IA 3M6UA 3UN5A 1XTZA 1WC1A 4FP9A 3FSXA 4OJ3A 4DV4J 2PC6A 4EU0A 4ZPAA 1RT6B 2BANA 2CXEA 5DRKA 3W64A 4P2MA 4EEYA 5CA5A 5ETNA 2P9EA 5HBMA 4DG1B 2M0GB 3G9CA 1JKHA 2UV8A 4P2SA 3AOCA 4A46A 2EW9A 2RUSA 1LWFA 3D6FB 3C8YA 4UOGA 4LRAA 1X4EA 2GJ2A 5DGAA 3VGUA 1WHXA 2MKIA 3U1MA 2HQDA 1S9FA 2HWHA 2A6OA 1X0FA 1J5EJ 3WIUA 4C3MA 3IFEA 4RR5A 1IBCB 2XI3A 2XNRA 1TQLA 2WVCA 1VQYA 3BEGB 1FTRA 2DK2A 4HR2A 4RBVA 1UVLA 2P5VA 2D1CA 1BQMA 4MIWA 1Z1ZA 3J7Z5 1V3ZA 1HBOA 2HKEA 4QW8A 4JI3F 4F02A 4V19X 3HO1A 1ICEB 2DH8A 1FERA 2Z4PA 4GO5X 3VQTA 2DRAA 2M52A 4KKOA 4OZNA 4K2XA 3RJMB 3BKFA 3FBCA 4J9VA 5B0BA 4X4OA 3G4SS 2ZNZA 2YY3A 3NWRA 1VC6A 4WTOB 1JLAA 2WVBA 1HNIB 3PHEA 3M8RA 1SH3A 2MY8A 3RBXA 3C6UA 3P49B 1C0UB 1ZAVA 2KO1A 3AJ2A 4HKQA 1BHNA 3D6MB 2BACA 2QA1A 4LF2A 4BC7A 2ZUAA 2E7WA 4QPXA 3UCZP 3KYLA 1RT3A 3W5YA 4M94A 2BJEA 4DEZA 2EFGA 3ENAA 1VRQC 2EWHA 4PG4A 4WFZA 4ZCMA 2XZTB 3CJTA 1HHQA 1RT7B 2HNYA 2NUUG 3OD2A 3OFGA 2MQPA 4YY3F 4YB7A 4USVA 1WJ9A 3KLFB 4O3RA 2D69A 3PW0A 3HX9A 4JI3J 3SCIE 1A7GE 1XR6A 4KHMA 3ZO7A 3E01B 1ZETA 2GMLA 4YB6A 4KH1B 1HNIA 2MGZB 3IM8A 5K8PA 1S1TA 3W2VB 2KXFA 3OW2R 4B3OB 2F7VA 3OFFA 4FYYB 1NMEB 2HRYA 2P9GA 1BLUA 2IM1A 2Q43A 2W25A 3M2UA 1QUPA 3F44A 2HG4A 3OXFA 2WSCC 2JVOA 2CQBA 3GJRB 2BW7A 3HMJG 3OTOJ 4K4WA 4AUKA 1T9YA 3JAMY 3B6BA 2KT3A 3T19A 2RF2A 4WYLA 4DV1J 1TUWA 3LALA 3JTNA 2GO9A 3KLIB 4KO0B 4MK8A 2QSWA 2BM0A 3BZQA 2FJDB 1AYEA 5FLXY 3T1HF 1D9FA 4NI2A 1ZAWA 1RU1A 3C15B 2HEKA 4BBYA 3D67A 5IFMA 3DI6B 5GAHU 1DY3A 2WK4A 2WSEC 3G71S 1N6QB 2H54B 2RE1A 3DM2B 4ZCIA 1HR0F 3R6LB 2FQQB 1GXLA 3RRGA 3HHLD 3C14B 5HAOA 3EWGA 4DR3J 1LWEA 3IN5A 1X0PA 3HVRA 3FK4A 1BGXT 2LDIA 1FNXH 2DHGA 2JC0A 2EFPA 1HQUA 1TKXB 5L1LA 5BR8J 3EM1A 4RBTA 1NAQA 2RU3A 2JEIA 2KZMA 1S99A 4M95A 1FVQA 1CJUA 4NCGB 1C4AA 4JI5J 2BOAA 5THWA 1T3OA 2DNMA 4ZN1A 3M4XA 1U1RA 3W5ZA 4GKJF 1AW0A 1U6BA 1TR0A 2V9KA 2W1BA 1UCNA 2RDJA 1S7IA 1F9FA 4JB8B 3NS7B 2CPEA 3U1LA 3VVTA 5AE3A 2W8LA 2VG5B 4M5NA 2DGTA 2ZH3A 1JLCB 4CO3A 1SJRA 1BQNA 2E9TA 3FQLA 3GSIA 4LFAJ 2XSJB 1CPZA 1NM2A 1HBMA 2BX6A 5I42A 1KLMB 1C0TA 2E66A 2RRNA 2XLJA 2VKZG 3FCVA 4FPIA 3CCJS 3V6HA 1OJ4A 4UZCA 2AZ3A 4USWA 1UMJA 2Y1JA 1X4AA 3CJ4A 1S9GB 3IRXA 3JSRA 4FF2A 3V4MA 4FXWA 4FN5A 4OQJA 2RJZA 4FNHA 4LRCA 1UL3A 9RUBA 4NLQA 3IWNC 1OY6A 3G86A 2BJ9A 5ETMA 2VQEJ 3PW7A 5B0DA 3TJ9A 2PN6A 3WC2A 5CHCB 2CA9A 3W2WA 2ZNYA 4I56A 4OYIA 7FD1A 1U4BA 4JI8J 4ZCKA 1DHMA 2PT0A 5DG8A 1JB0C 3FKBA 4Z7YA 1LWFB 2EKNA 1GXTA 2QV6A 5D0HA 4LF7J 3TAPA 1VYAA 1RT4B 1WHWA 4O3PA 2HFNA 3ZZ0A 3CJKA 2W2NP 3C6TA 3N28A 2L9NA 2OPRA 4M1KA 3KKFA 1PYSB 2HK2A 2BJ3A 2J7UA 3O6QA 1UWBB 3AODA 4AFFA 1IBLJ 3QNWB 4LUBA 1B7FA 2LXUA 4CQ1A 4ZPWR 4CLKA 2PDAA 3QT8A 5E3RA 4JI6J 4JV1A 1SKRA 2QRRA 4LMZA 3MTJA 1CJTA 4ZVGA 4N8OA 4IOCQ 3KXDA 1VOMA 2MB0B 2A3JA 3IXQA 5L9XA 1LQ9A 4FS2A 2J6TA 4X2BA 1HQ2A 3K17A 3NNHA 1Y3JA 4EK2A 3TEGA 3TUJC 4YB1P 1AUDA 4OMFG 2CAJA 4ICLA 1SL2A 5KG2A 2XY5A 3MMAA 4LF5F 3LP1A 4X4NA 3W63A 4PZVA 4I7FB 3FZ2A 4WTYA 5T14A 4MFBB 1PGZA 2OAUA 2V8GA 5J1EA 1CJUB 3M05A 4NCGA 2R3VA 1S79A 4ZK7M 2R7QA 2J0SD 1EQ0A 2YVSA 3QLHA 3OLAA 4NZ7A 4F4XA 3C16B 1N88A 2JLFA 2CPIA 3DRRA 3JYTB 3PX4A 2EFVA 3LAKA 4U9RA 2GVZB 1HI0P 1QAJA 3Q8UA 1GAOA 1WC4A 3TO8A 1Q5VA 1UEVA 1U25A 3WZ0A 1VHFA 1N5YB 2MQ8A 4DV4F 3UFCX 3NY0A 4PWUA 2QEXS 4C8NA 2IJRA 3KLGB 3FZBA 4MMOA 4YUDA 2PO4A 4L76A 4CWBA 3I55S 8ATCB 4GC6A 2DPIA 3MI7X 5JVGQ 2B0GA 2PFDA 3QIPB 1V5IB 5C2CA 5GAEI 4LF1A 2YXLA 3OR2A 5IV3A 4C8OA 5I42B 3BR9A 3GQCA 5GAHI 2PI4A 4NLSA 1RB0A 2L08A 4I67A 4RUAA 1NK6A 1RAFB 1VQ8S 2QMXA 3AH6A 2R7RA 1M5OC 3P8BB 3FMBA 2DVIA 2MQQA 3FC9A 3W9HA 4DPOA 2HHWA 3D68A 5AT1B 2AEMA 2WONB 1S1UA 1FRXA 2JEFA 1FDBA 2G0IA 1WG4A 2YNFB 1HNWF 1IQZA 3OTCA 1UVJA 3KMQA 3QRPA 4XK8C 2CIMA 1LWCB 4OHZA 3PR4A 3W3SA 4EMDA 5I3QA 1I94F 3HVAA 1P9YA 5HROA 3TQ1A 1FCAA 5LSRA 5A2QU 2Y1RI 2VG7B 4JI2F 2W7PA 3NCRA 4ZPVR 1HWIA 2J9DA 5F9LA 1YRXA 2MSSA 4I2QB 4FS1A 1XNRJ 3OTBA 2IM3A 3D1HA 4RW9A 4ED2A 3V6KA 1UP1A 1YI2S 1VQLS 3R5AA 3BSOA 1SUQA 4A8FA 1KTVA 1EKRA 2R7SA 1TUVA 3UNYA 1U0HA 2ZKTA 3VAJA 4AL7A 3NOGA 2IRYA 1PJ7A 3M1VA 1X9WA 4IG0A 2HQIA 2LU1A 4N41A 2C22A 1MMDA 2J8AA 2V50A 3GFYA 4GRSA 4R8UA 4NLOA 2G1HA 2AJQA 2DGWA 3HHLA 2MKJA 4DWIA 5F41A 3JB9k 1UVNA 1LV5A 1J5EF 2QO3A 5IWAJ 2XB2D 2HHTA 4FBTA 4IQMA 4EYIB 2AYMA 2JEGA 4QYZK 2GQQA 2AX0A 4DL2A 1FK9A 4ETXA 2VG6B 3DRYA 4P71A 1RAIB 3HSGA 2RIJA 3TWZA 2DNLA 2VU5A 2MZSA 3CTRA 4F0KA 1F1BB 1PYOB 4C3KA 4USUA 1FJGF 3CD7A 1K1QA 4LF6J 1RA6A 3L7PA 2HBRB 2LCWA 4KO0A 3OTOF 1R0AB 1B7YB 5D3GB 3JQKA 1UWAA 1JNZB 2IVYA 2YX4A 4K5RA 2MLZA 1OQ6A 3ETMA 4I64A 4N5SA 3GIRA 3TANA 4DV6F 4DV7J 4QQBA 1V5VA 2AJFE 2C2KB 3KTQA 4L72B 4C48A 1R8CA 3I31A 2DHSA 4FXVA 5KFFA 4FF3A 5HMWA 2ZKUA 2VICA 3SFGA 3V2UC 1EHWA 3D4JA 1V3SA 1UW4A 2CPFA 2VFUA 2VH7A 3FSYA 3IG1A 4OJ1A 2IC3A 3D5MA 3ZNUA 3KLHB 2RS2A 3QGIA 1RWKB 3EXYA 5KG1A 4DV1F 4WP9A 4P7TA 4QIEA 5ETQA 4OI3A 4KB7A 2LA4A 2VDIA 4F67A 2WB4A 1MROA 3G6VA 5DJBA 1QAYA 3G82B 4JI6F 3DLKB 2GIFA 1RQ0A 2ZH2A 2E1CA 2UVVA 4G3IA 2OTJS 2KB2A 4OZ0A 2VC0A 4WE1A 2Z8QA 4LBHA 1RSCA 3IMQJ 3CCVS 3OJSA 2ZHBA 3FEYB 5G4DA 2VD3A 4DV5F 5C7PA 2RQMA 4Y2MA 2QN6B 2DEJA 3C3LA 1BQXA 3HKZD 1Y4ZB 2QLBB 1LNQA 1O51A 3QPIA 4HH0A 2C28A 1IKYA 2H51B 1UZDA 1VRUB 1ZPWX 2OPQA 2D9PA 1TKTA 4P74A 2YBVA 3M32A 3BSCA 5I3UB 2RD5C 4B9MA 2V69A 2XWXA 1NK0A 1F9HA 3CJKB 4YY3J 1R8BA 3ULHA 4Z7CA 4QOTA 3MEEB 3LGNA 4J9UE 5HSPA 2B3TB 4ZPBA 4IDKA 2DBBA 1S49A 3O8WA 4KR0B 4CO1A 2CJ9A 4IYQA 4K4VA 3IR7B 5IC4B 3T9ZA 3US5A 3FBBA 5DO2A 4KSEB 1N48A 2D3ZA 3QGGA 4BDPA 1IQTA 2V0NA 4WXWA 1XERA 2ROEA 3MM6B 2XMMA 3MTKA 3OL6A 3V6DB 4R25A 3IWXA 4CLWA 1U47A 4X66J 2AGQA 4KHRA 3FFIA 3TUPA 1F3FA 2W4CA 3KK1A 2HBZB 1IKYB 1VRUA 4W90B 4DU7A 2CPHA 3ET6A 3GCXP 1TL3A 3CD6S 5ITHA 1PSDA 2IMOA 4DQPA 4LF7F 1XN9A 3CWJA 1RT6A 2BANB 2D3UA 3A3PB 3DXSX 4DJBA 3CJSA 2OMOA 2RH3A 4B08A 3EPIA 3GYXB 1DTTA 4F4AA 1UKUA 1R89A 2JJ4D 3MM5A 2O67A 2AJ2A 2M8HA 3LPEA 2C2NA 3LGHA 4CT8A 2GHWA 5HATA 4L3NA 5M2PA 1ZZFA 3AXKA 2YNHA 1WI8A 4X62J 2HBQB 3PZPA 5F8MA 1HMVB 1KONA 3KLHA 1U0HB 2N7CA 3PJWA 2FPHX 1RKJA 3H5XA 3L4BC 1N5SA 1RWVB 2AMCB 3M8PB 3NXZA 3POTB 2CQHA 3QRQA 4ZN3A 1B0VA 5GVQA 4B9VA 2RSQA 3IGVA 1KN6A 3FUYA 2OIHA 1UZHA 4ILMA 2NXJA 1YSJA 1FO1A 2A10A 4LRBA 2F8MA 3VV2B 5KFPA 1NKCA 1KQFB 4V1Ak 3J81j 1GMUA 3W2WB 4ZVRB 2HHVA 1X9SA 2WONA 4KC5A 2FHKA 1RE1B 2WVFA 1JIHA 1H98A 1RISA 2CPXA 3HHEA 1BMQB 4OJHA 3V81B 2CQPA 1K0VA 1G2EA 1FX4A 3FRYA 1N5TA 4ID8A 5GMDA 5KFIA 1CEZA 2GGPB 1WTFA 2GVDB 4WZQA 1UVKA 2RDDA 4ZP9A 3TZXA 4DR3F 1Q78A 2IBKA 2Q3PA 3LOUA 3TA0A 5BYRA 2MQLA 3N5BA 3GMGA 2F3JA 1BC6A 4NWBA 1S6OA 1NZAA 2ZHOA 2YH1A 1QAIA 2OP5A 3NCQA 4OLPA 4DQQA 4DL3A 1HQEB 1LW2B 3OBIA 4DCPB 1O5JA 3C66A 4USKA 1SIZA 5SZTA 4IH6A 4F3MA 5I4MA 4ECTA 1AZSA 1YWXA 1YZ6A 3AJDA 2FY1A 4ZPDA 1RWUA 2B7BB 2OHDA 1RI7A 4Q0BB 1LKZA 1JLBB 2KVIA 4U8VA 5KFNA 4ZPTR 3POTA 2DGQA 3K59A 2XWYA 1S57A 3VR1A 3CCQS 2NSBA 2XMVA 3C16A 4I4BA 4DDFA 3PIPQ 4KGZB 3CD0A 4TN2A 4AL6A 5J1EB 2QFIA 1TAUA 4OHWA 4UQTA 3HVTB 1S4FA 2R8JA 1TL1A 1GEHA 3A12A 2H3EB 2DITA 2RKIB 2V2QA 3GFXA 3OFEA 1YTYA 5A8WA 2BQUA 1UEKA 1VBYA 5H9FK 4DX5A 4CLYA 2N3LA 4NASA 3G6YA 2D3O1 4WU3A 2GV1A 2HWIA 1RWXB 5CH7B 1N0UA 4JI1J 2MZTA 2F5GA 3BH7B 2ZZMA 3LAMA 1U2CA 5H9EK 3UDCA 5A8RA 4CZCA 3G6XA 1VMBA 2ILZA 1TL3B 2W01A 4MYUA 1N32J 4QU7A 3L95X 3I6PA 2UZAA 3SIPB 5DLGA 1NJWA 2MQMA 2DNOA 4KY3A 4KT0C 2AGPA 3OJUA 2AHOB 4AYBD 4QPTA 2R8IA 3G8QA 4DLGA 1HD1A 2UU9J 4URSA 3HXMA 3WX8A 2DH7A 1SI9A 2RKIA 5E3PA 2QMWA 5LXRA 4TQSA 2FVQA 4CLSA 2R8GA 2XLKA 1VC5A 2Y8YA 1TU0B 1U1MA 4PRFA 2LQ8A 2QMUB 2DT9A 2C42A 2VBYA 2DNNA 3WIVA 3OL9A 1HKAA 5KFSA 1O8BA 4IFYB 2UXDJ 2JEJA 4OHVA 5KFCA 3D0GE 4KPCA 3GCWP 7AT1B 2GMJA 5B7WA 3FEZA 2F8EX 4DV7F 1Q86T 1CS4B 4FDFA 5T41A 3DGPB 5KG5A 2VASA 1NHKL 2BJ1A 2WAQD 4YOEA 4AT1B 1NSKL 4C0OC 1NU4A 1D8ZA 3A3NB 1MU2B 2WTFA 2DXFA 4K4ZA 4OHYA 3DLLQ 2N7YA 3BBBA 2FVSA 3VGVA 4O3NA 2W9BA 1KHWA 1H74A 1VS3A 2YNIB 3EGNA 3VAGA 3OLBA 1C0UA 4ELVA 2E9ZA 1TKZB 1KR4A 1NNDA 1SKUB 2C3PA 3BSAA 3UI3A 5L1IA 5J2PA 3AD7C 2UV8G 3KDOA 1OWXA 2HNDA 3ENWA 3MEDA 4HTIA 4C8MA 1RADB 3HCXA 2XMJA 5A6WA 1S0OA 4IR1A 2YKOA 4F4KA 3ILIA 1PJ5A 4KBIA 3H4DA 1WUUA 3TQEA 5DZ7A 1HNVB 3ILOA 2VODA 3W8GA 3BBFA 2EI5A 4NE9C 1LEOA 1SV5B 1RBLA 4BC9A 2DNHA 4J9RA 1U6ZA 1TVRA 3ZTPA 4ED3A 3T5HA 2AYBA 2E5JA 3W9IA 1HNXF 2DR8A 4UUWA 2F9JA 5D3GA 2EBGA 1TAQA 5HN0A 3TZYA 1U1OA 5CXTA 4RNMA 1ACMB 3OL8A 2OLWA 4JI7J 1KLNA 3JSYA 2VBWA 3R97A 3NWGA 4FPRA 3W62A 2YWFA 4Y2IA 2HHUA 3MMJA 5KFYA 4ELUA 2X1FA 3DC2A 3IC1A 2E5HA 1YDLA 2V8PA 2M2BA 2VG6A 3CDEA 3GJQB 4DS5A 5EX3A 3I87A 4JBCA 3CCSS 3KLEB 4ENOA 3LP1B 4QR2A 3IRXB 1HNZJ 4RNOA 2NSCA 1I5OB 3GSDA 3VAHA 2A2DA 2QJ3A 4WIQA 3MM5B 4X4SA 3EZ5A 5A8WB 5F8IA 2CJBA 4Z37A 3CULA 1RHKB 1X5TA 3I5CA 4DZ6A 3BGFA 2CJKA 4B3MJ 3AB4B 4HI2A 4J9MA 3OV7A 2XI2A 5EWEA 2IMWP 1GX5A 4J9OA 4IG0B 4NZ0A 4DS4A 2F4VF 3MURP 2I5JA 3HD2A 1FRLA 1N5QA 4B3TF 2KDOA 1AB8A 4C98A 4DR6J 2FB0A 2JSXA 3OSPA 1JLQA 2BR0A 4AQYF 1OO0B 2K8GA 3BGUA 4I6AA 2BOPA 3K57A 1QVFR 4Q0BA 1H2TZ 1GTEA 4RW4A 2E7XA 3L7OA 4OZJA 2CFXA 4CYUB 4ALZA 4LF6F 2V5HG 4H4KA 3PW2A 4X66F 1NK9A 1DZ5A 3CDWA 4K7QA 1N56A 4K8RA 3Q24A 4RW8B 1TV6A 4MTPA 2U1AA 2I2YA 2LKZA 4DCJB 4ZVTB 4W98A 2QIFA 1F2GA 1WSVA 5I3PA 2IDLA 2MZJA 1FFGB 3R7SB 1KFSA 2FYXA 5KFEA 3KG0A 1TL4A 2ZJQQ 2WRMA 2ATLA 2KG0A 1LK7A 1HIYA 2J7WA 5C2GA 1U1PA 5LSLA 4JP8A 3NKYA 4C97A 5F3ZA 3M9OB 1KNZA 1YQHA 3ELHA 3BGOP 3RTVA 1UJ4A 2YWEA 3PRBA 4NA2A 4NYOA 1JJ2R 2HFZA 4H4KC 3R6GB 2ZC3A 4OX9J 2MKHA 3EUNA 4MKAA 1HWLA 4IH5A 3ZZZA 2FJVA 4DR5J 5KFUA 3MPVA 4LSNA 3ZFVA 5ETPA 5C24B 4L74A 5IV4A 4C8KA 3BR8A 1X9MA 2Q6CA 3KLIA 5SUHA 2O5DA 1SL1A 1N34J 2V4RA 2V8HA 4N47A 5EN1A 4QIFA 2ZZNA 4TNOA 1WC0A 3PHTA 2PI5A 2UXDF 1NEEA 1XIQA 1G1XA 2X3GA 3G82A 4TKTA 5HK4A 1WELA 2J7KA 2NS1B 4HT5A 2XBPA 4J5OA 3TOQA 1FF2A 3UD4P 1YHQS 2WOMA 4HL9A 1R8PA 3SMZA 3DU5A 4FYXB 3HFKA 4U67Q 1HMVA 4XPEA 5CD4A 4J9PA 3UVJA 2ROGA 3EE3A 3L3CA 5D0GA 3THVA 2CQGA 2HVDA 3A8JA 2YNHB 1RT3B 2H9ZA 4QZVB 4ZLLA 1I6JA 2HIQA 4BCAA 4TYBA 2H5JB 2HIYA 3K8VA 4OX9F 2DIVA 1JXLA 4NA3A 2J0QD 3BREA 2HNYB 2C2OB 2RILA 4JV0A 1IWGA 2BVZA 1RABB 3DM2A 5A0YB 2AX1A 1S76D 3CDAA 3OHBA 3CJ8A 4FNIA 1IWAA 1SQFA 4ED1A 2CQDA 5K9FA 2R9LA 3QSYB 3BSNA 5C25A 1E6YB 1VRTB 1BQMB 2ZH5A 4DL4A 2GVDA 2X1AA 2KFNA 2FLLA 2B5JA 2O3DA 3A3OB 2VQFF 2GAHC 3L09A 1CVJA 2VBXA 1R27B 2ACYA 5CABA 2IJFA 3HSJA 3THPA 4DCOB 4R5PB 2GX8A 2DXDA 2GMHA 3D1OA 2IRUA 1HBOB 2J0XA 2WSFC 2Z58B 1HHTP 3MUVP 1IBKF 1F5CA 2BKOA 2WZ1A 1TV6B 1S48A 8RUCA 3RBDA 4HLBA 1NKBA 2DGXA 1L3VA 3RB3A 1SKSA 1DJ0A 3QWUA 1OIAA 5F8NA 3HSDA 4JV2A 3UO0A 4K0KF 3MMCA 4P10A 3MF5A 2GC8A 5HJYA 4KYZA 2XS2A 2E1RA 4RW9B 1CJKA 1QTNB 4TVAB 5E3QA 2VA2A 1S97A 1CLFA 1XMQF 1WOPA 1QVGR 1FI4A 4WJBA 2Z57B 2MYFA 1EETB 2V68A 2XYHB 1WF0A 3FQKA 1A6LA 3FVYA 3BN7A 4LREA 4XAKA 2J9CA 4YHHJ 2EKYA 1N33J 2EK1A 2XSJA 4NMXA 2H5EA 3T1AA 5KG3A 4MFBA 3UDEA 5IT4A 4F25A 2DB1A 2F63A 1WSRA 1ZA2B 2K7JA 2PEBA 2GHPA 4J9QA 2PIIA 3SCLE 3R5DA 5L46A 1HYSB 1AROP 1EP4A 2I5JB 1FXLA 1VHIA 2PMZD 4GMKA 3DXBA 3SDEB 3W65A 5KFMA 4F2SA 1GMWD 1C1CA 4H4OA 4IO9Q 3ZZUA 5JJBA 5JUMA 2O66A 3F73A 3LTOA 2R7XA 3PYGA 2IA0A 4P52A 1YJ7A 3UD3P 1RHMB 3I5AA 5F8JA 4RZRA 2WVDA 1RTIA 4DOZA 2N4DA 1Q0NA 4DXLA 2HHQA 1ITPA 1NK7A 4O23A 4OZ2A 5KFKA 3FDSA 2BE7D 3DDKA 1S59A 3EMTA 1FRMA 4Q2LA 3S1TA 5MAOA 4OI0A 4USHA 4FVCA 2PE8A 1UJ5A 3X3UA 2CDRB 4A8QA 5EX0A 4A8SA 2D74B 3T3FA 1VI7A 5DM7Q 1Q8IA 4DLEA 1ZM3A 2KN4A 1F60B 3MCMA 3KG4A 3MHYA 4J9SA 1T95A 4UT4A 1DAXA 1DTQA 1W7WA 2IAJB 3QO9A 3TAMA 2YKMB 1HBNB 3H59A 2CNKB 1FEHA 3MEDB 4CDIA 2POKA 3DLEA 5LMNF 2OPQB 5HVHA 3CO9A 3G96A 3H2VE 5F9NA 4DQRA 3H5YA 1XR7A 4Y65A 4XIUA 3DOKA 2NPFA 4C8LA 4ZP6A 5KOXA 1TMMA 1IVZA 4D3HA 4B3RF 2B9YA 1RCOB 4DPTA 2JH3A 3HM9A 2H5IB 3CCES 3D9BA 1RWPB 4ILRA 2I6WA 4B17A 4E2FB 3H40A 2X1GA 2KH9A 2UUBF 3RGIA 3SDEA 2MGZA 3SCJE 2QC3A 3NGKA 8AT1B 1TKZA 4DR1J 4H4MA 2JWNA 1VQOS 1R31A 2DKOB 2OO4A 1DBDA 2QL7B 4LBIA 4J9LA 1KSPA 3M2RA 1N54B 1HBUA 1SC3B 3QFHA 5DDQC 3TX8A 1T9VA 1TZ0A 1W26A 5D8HB 1FNMA 4CO2A 3ZZYA 2KHDA 3JTOA 4WFAQ 4MK9A 2BABA 3K5OA 3UVJB 3JQJA 2AZ1A 5B0AA 3H98A 5M2RA 3SCKE 1BWVA 3MEGB 3DGPA 3P4UB 2UXBJ 3DDIA 3KMSA 1IKWA 5KFAA 3AD8C 2X51A 1IR1A 1IJFB 1VLYA 3LP2A 2B8QA 2GZOA 2QGFB 3N6LA 1RXOB 1AXQA 5KT6A 1KQGB 3MR3A 4UOHA 1CC7A 2QLJB 5GAGU 2KXNB 3DI6A 3S01A 3QSIA 4DN9A 4DR2F 3RB4A 1P6TA 3ZNJ1 4EO6A 3J80U 2OGUA 4Q8FA 3LP0B 1Y7PA 4WKRA 2DHXA 4HACA 3GE9A 3ZTQA 1QDUB 5A2QY 1RT2B 5KFHA 4WPAA 4ELTA 3AA9A 1HWKA 3CEDA 1YRTA 2VG5A 3HKWA 3QWPA 4DL0C 2VJVA 1ZH5A 4GKKF 2LQBA 1RLDA 3T6BA 1G7CB 2HK3A 3KK3A 3T5LA 4LFAF 1BUXA 4OV1A 1BWEA 2M70A 1QD1A 2Z30B 3N9UC 4CLUA 4FF4A 1T7PA 3PR5B 5CYQB 3DYAA 4K4TA 1W2BR 2G0CA 1IBLF 2B9XA 2N4CA 3RRKA 3Q2TC 1MMNA 3J7YI 3CMES 2JZ5A 1M5SA 2E7VA 4URGA 3M9NB 1S1WB 4YR3A 4ZLJA 5HL7Q 3KHHA 2KFYA 3BPDA 2AU0A 2C2MB 4FYDA 3RB0A 3SZ2A 1FHTA 2KL8A 3ZTRA 3PJ9A 1XMQJ 2C3OA 2FHJA 2I1RA 1LFWA 1YVFA 4ICLB 4WU2A 4ECSA 4JV5F 4V19J 4FXDA 2YKPA 1IN0A 1GX6A 4MJKA 2C2RA 2JFDA 2Q79A 4K0KJ 3L7UA 3CMQA 5KFDA 3HFZB 3K5MA 1BY9A 2HZAA 1IBMF 4LF9J 2UXBF 3RW6A 3H25A 2YQ3A 5CYQA 5FIIA 3ZZPA 1QSLA 1JQGA 1WOOA 4X84A 2ZFHA 4X4VA 3I9V9 4J9KA 1NUEA 3QJPA 1WORA 5HMXA 3I56S 3TJ8A 2HNZB 1B70B 2BEFA 4DFMA 4CTAA 4M63A 4RWXA 3CCTA 4PG6A 4B3SF 4LF4F 1RHQB 2XYGB 1YJTA 3MM7A 4F7VA 2OPRB 1RTDB 3A4TA 2YKNA 1JK9B 1T8EA 2R7UA 1FKOB 2DGSA 2W24A 3QO9B 1EETA 2RVJA 3PKYA 1FRKA 1WG1A 2D3OR 4ZVFA 3BGRB 1CG2A 2BE2B 5F8GA 4LFCJ 5DZ6A 1UFLA 5KFOA 1CJKB 1W25A 4DMZA 4YR0A 1VQPS 2AQ4A 3G8TA 2HHHJ 1PBUA 3M30B 4QIVA 2HVEA 4YMEA 1S12A 1KBRA 5BYSA 3EDQB 1ZM2A 1U2FA 2I0XA 2F4VJ 3M30A 1S6QB 4LF9F 4W4MA 1WC3A 2DNRA 5KOWA 3KLFA 2ASDA 3MAQA 1QUVA 2MKCA 1UAWA 2BKNA 1O0PA 1HW8A 3BN4A 3GG0A 3H20A 3GILA 3K5NA 3OUYB 4CNYA 5FDLB 5K14B 2YNGB 3ZTSA 2XG8A 2XEXA 4DR4F 2YKNB 3QAUA 1KOOA 4CM0A 3OVAA 2OSRA 4NLPA 2WCXA 1FWPA 1SJ1A 3ETOA 1JLCA 3I5BA 4F36A 2YPZA 4KFBA 1JLQB 1I1GA 1WF1A 3H90A 2HLUA 1HYSA 1RAJA 1YJUA 3F41A 3CC7S 4KFBB 2W9BB 1HWUA 1OQ3A 4KRWA 1K9MT 2MY7A 3VHQA 4F4ZA 1XNQJ 5DM6Q 1GTHA 4JI0F 2FD2A 3PDNA 4UW2A 1V9OA 1MWQA 1L3KA 4PXCA 2ADCA 5F8LA 1FE4A 5L39A 2DRBA 2VFRA 2K1RB 4HYKA 2IRXA 4LIWA 4XDCA 2FGCA 2FY8A 2DR7A 1GK8A 2AJ1A 1VGYA 3MFIA 2VJUA 3GIJA 3V6DA 3VF0B 2J9DE 1VJQA 1URRA 1R43A 5LJ3Y 3BQ0A 2LQJA 2M5YA 5A8KB 2FIUA 4KTQA 4G1PA 3UR0A 2ABYA 5B08A 3DDNA 2WBRA 4G6VB 3GPAA 3DRPB 3K5LA 2LEBA 1RGVA 2BE2A 4OYBA 5J2QB 2YWHA 3EDRB 5A8KA 1REGX 2U2FA 2AP6A 4RO0A 1UA1A 2V63A 5HVGA 4OZ3A 1RTDA 1TVRB 3EVOA 3J81U 4IQXA 4X64F 4X65J 2JRSA 1XK8A 2QLFB 4F0HA 4X4QA 4DV2J 1I51B 2HGMA 2CKWA 2BBEA 3T5JA 2LDYA 3OL7A 4O3OA 1UPPA 3R27A 1C0TB 3FBFA 1BE4A 2AJ4A 1L3UA 5IQQA 3PY8A 3O1LA 4DV0F 4NMLA 2DPJA 2W2MP 5EHHA 3G6ES 3F0NA 1FD8A 2HMIB 2M8DB 4LR8A 1Y5IB 1SIWB 1SH0A 2CUYA 3VZIA 2MQOA 2WVEA 2K06A 2VFTA 2EFQA 4EGLA
chains in the Genus database with same CATH topology
3OTOJ 3T1YJ 5FLXU 4DR4J 4JV5J 4DV1J 3R2DJ 4GKKJ 2MQ8A 4K0KJ 3JAMU 4JI1J 4YY3J 4B3TJ 2E5LJ 4LF9J 1XMOJ 1N36J 1N32J 4KY3A 4NEZA 2UXCJ 5LMUJ 1IBMJ 4RJVA 2UUBJ 2UU9J 4DV6J 4DR3J 1HNXJ 4X66J 4JI4J 4OX9J 4JYAJ 4LF5J 4LFCJ 4NXMJ 4DR5J 5BR8J 1N34J 2HHHJ 4JI0J 5A2QU 2UXDJ 4JI5J 4DR2J 1XNRJ 2F4VJ 4JI2J 4NXNJ 4DV5J 3D3BJ 4KHPJ 3D3CJ 4DV4J 2VQFJ 4X62J 1I94J 4LFAJ 3J7AN 2ZM6J 4DR1J 2MTLA 4DV3J 4PWWA 4DUYJ 4DR7J 4AQYJ 1IBKJ 5IWAJ 1J5EJ 1XNQJ 4DV0J 2VQEJ 2UUCJ 5LM7E 2UUAJ 3T1HJ 3W1YC 4JI8J 2UXBJ 5AJ3J 4V1Ak 1FJGJ 4LF7J 4LF6J 4B3RJ 4DV7J 4JI7J 3J80U 4HHUA 1HR0J 4JI6J 2KVQE 1IBLJ 1HNWJ 3J81U 4X65J 3R2CJ 1HNZJ 4DV2J 4KYZA 4DUZJ 4JI3J 4LFBJ 5IT9U 4LF8J 4B3SJ 4LF4J 4B3MJ 2MEWA 4X64J 3IMQJ 4NEYA 4YHHJ 1N33J 4GKJJ 4DR6J 5LMNJ 2KL8A 1XMQJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO J;  3T1Y J;  5FLX U;  4DR4 J;  4JV5 J;  4DV1 J;  3R2D J;  4GKK J;  2MQ8 A;  4K0K J;  3JAM U;  4JI1 J;  4YY3 J;  4B3T J;  2E5L J;  4LF9 J;  1XMO J;  1N36 J;  1N32 J;  4KY3 A;  4NEZ A;  2UXC J;  5LMU J;  1IBM J;  4RJV A;  2UUB J;  2UU9 J;  4DV6 J;  4DR3 J;  1HNX J;  4X66 J;  4JI4 J;  4OX9 J;  4JYA J;  4LF5 J;  4LFC J;  4NXM J;  4DR5 J;  5BR8 J;  1N34 J;  2HHH J;  4JI0 J;  5A2Q U;  2UXD J;  4JI5 J;  4DR2 J;  1XNR J;  2F4V J;  4JI2 J;  4NXN J;  4DV5 J;  3D3B J;  4KHP J;  3D3C J;  4DV4 J;  2VQF J;  4X62 J;  1I94 J;  4LFA J;  3J7A N;  2ZM6 J;  4DR1 J;  2MTL A;  4DV3 J;  4PWW A;  4DUY J;  4DR7 J;  4AQY J;  1IBK J;  5IWA J;  1J5E J;  1XNQ J;  4DV0 J;  2VQE J;  2UUC J;  5LM7 E;  2UUA J;  3T1H J;  3W1Y C;  4JI8 J;  2UXB J;  5AJ3 J;  4V1A k;  1FJG J;  4LF7 J;  4LF6 J;  4B3R J;  4DV7 J;  4JI7 J;  3J80 U;  4HHU A;  1HR0 J;  4JI6 J;  2KVQ E;  1IBL J;  1HNW J;  3J81 U;  4X65 J;  3R2C J;  1HNZ J;  4DV2 J;  4KYZ A;  4DUZ J;  4JI3 J;  4LFB J;  5IT9 U;  4LF8 J;  4B3S J;  4LF4 J;  4B3M J;  2MEW A;  4X64 J;  3IMQ J;  4NEY A;  4YHH J;  1N33 J;  4GKJ J;  4DR6 J;  5LMN J;  2KL8 A;  1XMQ J; 
#chains in the Genus database with same CATH topology
 1N0V C;  4KAI A;  4C8Z A;  1TL5 A;  3HVT A;  3NEK A;  2M9K A;  3IAM 9;  3LAN A;  3Q23 A;  4ZVQ B;  4JV5 J;  5B0C A;  4LRF A;  3DMJ B;  3MAA A;  4TY8 B;  1Q7Y T;  3J7A 1;  3K5P A;  1MNE A;  4UY8 5;  2W9C B;  1S1W A;  3V5R A;  3VGT A;  4PG8 A;  4X62 F;  4WFB Q;  2Z56 B;  2FVC A;  2GAG C;  3QT5 A;  4NLU A;  4Y2A A;  2HS3 A;  4ZLP A;  4ECV A;  1YIJ S;  1WKK A;  1DLO B;  3N01 A;  3TA1 A;  4ZIW A;  3PO5 A;  2Y8W A;  2VPY B;  4CO0 A;  3HT3 A;  1I3O B;  3EYZ A;  5D78 A;  3JSM A;  1LWE B;  5IT0 A;  3M6X A;  2VOO A;  2W2P P;  1VDH A;  3ONQ A;  4DV6 J;  4DSF A;  1HQE A;  1LW2 A;  2HRU A;  4CH7 A;  2ZH4 A;  4LSN B;  5C24 A;  5HP1 A;  1VK3 A;  2DR9 A;  1XBW A;  3S7R A;  1VCT A;  2KJV A;  4DX8 H;  5GAE U;  3C15 A;  3QAT A;  1EB0 A;  2CNN B;  2R8H A;  4LF5 J;  4N76 A;  1VK8 A;  4ZDN A;  4O3S A;  4QWC A;  3M2V A;  1ZZN A;  1OYE A;  2H1Y A;  3B8H A;  2V4J A;  2B5J B;  1T3N A;  1EX8 A;  3BH6 B;  1UTA A;  3OFH A;  3QZ8 A;  3R5G A;  5AXL A;  2XMK A;  3DCA A;  4ZA1 A;  3PJX A;  4XDD A;  4ILL A;  4HEA 9;  2V4J B;  3DLH A;  5HI7 A;  4NXN J;  3KNA A;  3CSK A;  5JVH Q;  3IBW A;  3KJQ B;  2Z2M A;  3R7N B;  5IM0 A;  1SVD A;  3MCO A;  2ERR A;  1YGY A;  4RW8 A;  3CE8 A;  5F3T A;  2MKK A;  3BDP A;  1JKH B;  2GQ2 A;  2J6U A;  1RAE B;  3IM9 A;  2WBM A;  4CO4 A;  3MR6 A;  2LXI A;  1L5U A;  1I94 J;  3QJL A;  3FGV A;  2CJX B;  2R7O A;  3AY0 A;  4R0E A;  4RNF A;  1X8D A;  3D6H B;  4LSL A;  1S1V B;  2P9C A;  3HHL B;  1NSQ A;  2DJW A;  5RUB A;  4J9N A;  1UA0 A;  1HBU B;  2IPO B;  2B4V A;  1C1B A;  2Y1L B;  1WG5 A;  2PA8 D;  4PWW A;  5CYM A;  1X4B A;  1DLO A;  1RAO A;  2QYC A;  3I96 A;  1FEE A;  3M8Z A;  3O3L A;  3R5B A;  4H4M B;  4OI6 A;  3PEJ A;  3TP2 A;  1NKE A;  2Y0B B;  3AQO A;  3Q89 A;  4LR7 A;  2UUC J;  5LM7 E;  3QAE A;  1X4C A;  4ECY A;  4Q8E A;  1NLK L;  5T7L A;  2LU2 A;  3M9M B;  1JX4 A;  1M1G A;  3CT9 A;  3HSZ A;  3T1H J;  3LPY A;  1SUQ B;  1GXU A;  2CJY B;  1SL0 A;  1IKV A;  4RBU A;  4LRD A;  1NCL A;  3T5K A;  1FJG J;  1S0N A;  1NZ8 A;  4CLT A;  4O44 B;  4WFX A;  1HAR A;  2ZVI A;  4IKA A;  1JMT A;  4DX7 A;  4IG3 B;  3CJ2 A;  3PW4 A;  4MH8 A;  4KKO B;  1HBN A;  2ADB A;  1MWY A;  2RU9 A;  5DQH A;  3HZE A;  2XUL A;  1EKS A;  2DCL A;  1CUL A;  2OEJ A;  4USM A;  3OVS A;  3OR2 B;  3PKM A;  2NYI A;  4IR9 A;  4ED5 A;  4P2F A;  3GTY X;  4A8O A;  5GAD I;  1N32 F;  3ADA C;  4IUF A;  2ZBI A;  3GIK A;  3MUM P;  1FE0 A;  3KHR A;  1L3T A;  4IRD A;  2ZC4 A;  1Y5N B;  2YX7 A;  4I2P A;  5AE2 A;  1WEY A;  3EGV A;  2PMW A;  3W9J A;  2HVI A;  2KYZ A;  3VTI A;  4DFJ A;  1Y0H A;  2RQC A;  1QSS A;  3E8O A;  5E33 A;  3DRP A;  4E0D A;  3PFO A;  2DHH A;  4DPY A;  2CAD A;  2EFO A;  3Q0A A;  3BO4 A;  4GO7 X;  3TVY A;  3D0I E;  4ES1 A;  3I82 A;  4OZL A;  5C5J A;  5G0R B;  1U1Q A;  3AFG A;  5HO4 A;  2B51 A;  4X64 J;  4AL5 A;  5DG9 A;  3PG9 A;  4WWS A;  3HLU A;  3NP5 A;  4GC7 A;  4OFZ A;  1ZAX A;  1RTJ A;  2VPX B;  3VWS A;  2HND B;  4I7F A;  5IS2 A;  3J81 Y;  4ED0 A;  1NK4 A;  1WNE A;  4KJI A;  1PC4 A;  2O01 C;  2OKQ A;  2GFF A;  3MD1 A;  2IJN A;  3M8P A;  2ZBQ A;  1H7W A;  2L9D A;  3IO1 A;  2DR5 A;  4UUX A;  3EPG A;  4RNH A;  4QYR A;  1E6V B;  2Q6B A;  1HBM B;  3R8Y A;  1RTZ A;  1NDC A;  2CVI A;  1P9Q C;  2YH0 A;  3JSB A;  4YDX A;  1YBA A;  3U7J A;  1N52 B;  2FLP A;  3D28 A;  1NPR A;  1Y3K A;  4DHV A;  1RTH A;  1N36 J;  4I6W A;  2JHE A;  1JJH A;  1UFK A;  4MYT A;  1G3O A;  5BXI A;  5E2Q A;  1VBK A;  1X4H A;  4Q44 A;  1URN A;  1Q1K A;  3M8Q B;  4ZHR A;  3EGZ A;  3OT9 A;  5E41 A;  1NSA A;  1S1X B;  4DF4 A;  3MMC B;  2HHH F;  1VQ6 S;  2I9S A;  2HRT A;  3C2P A;  1Q82 T;  4O4G A;  1GH8 A;  4IFY A;  1S0M A;  5IC6 B;  4TYA A;  1Q4R A;  3NAH A;  2F4F A;  2IC3 B;  2QE5 A;  1VQK S;  1TKX A;  2G2Y A;  3AOA A;  3FCH A;  1AA1 B;  1FES A;  4ZJQ A;  3QYY A;  5KG0 A;  1Q53 A;  3KHG A;  1U45 A;  1WEX A;  3D54 A;  3PV8 A;  3B78 A;  2COL A;  5LJ5 Y;  3EVW A;  1CJV A;  2JFK A;  3I0R B;  3CCM S;  3UCU P;  1Z4U A;  2AGO A;  4DSJ A;  2L3M A;  2Y1I A;  1TK8 A;  1SJ4 P;  4AE5 A;  1DRZ A;  2EK6 A;  1RT5 B;  5KT5 A;  2HFU A;  3MEK A;  4IOA Q;  3ILL A;  1SC1 B;  1R0C B;  2ZDP A;  5B09 A;  1N6Q A;  3QFW A;  4HAC B;  2BJD A;  4X4R A;  4KPY A;  2MQN A;  2J8S A;  2HFS A;  1VQ7 S;  5KG7 A;  3A8K A;  1KHV A;  1KD1 T;  2VPW B;  2ZH7 A;  2MZR A;  2FHO B;  3NGU A;  2MZ1 A;  3D3C J;  5ETO A;  1QSY A;  2JX2 A;  4OX6 A;  3MR7 A;  2MDA A;  3FBE A;  1ZM4 A;  3I4H X;  2VFV A;  2QL9 B;  5DDR C;  3AD9 C;  1RU2 A;  1SQE A;  2VF3 A;  3GLJ A;  2ZM6 J;  1IKX A;  6FD1 A;  4C0H A;  3MPU B;  1OSD A;  3EXC X;  1DQ8 A;  2F40 A;  5HVF A;  1FTC A;  3MUT P;  1X4F A;  1W2I A;  4FKX A;  3ZZT A;  3NBP B;  4CLZ A;  2J0W A;  5T7L B;  4NLV A;  3BB5 A;  4U6P A;  5DLF A;  1AT1 B;  1G4C A;  4ZP7 A;  2UU9 F;  4B3M F;  1D9A A;  4PUO B;  1UVM A;  1FJE B;  4M5G A;  1FFS B;  2W9C A;  3C46 A;  2LLZ A;  2DY9 A;  4WE1 B;  3NNC A;  3GYN A;  3MCN A;  1YBU A;  5L1J A;  4ECW A;  3P96 A;  1AFJ A;  4RW4 B;  1OY9 A;  3DFE A;  2HBY B;  4O3Q A;  4ANC A;  4RW7 B;  2ZOM A;  7FDR A;  4UTG A;  4XO0 A;  2PD1 A;  2ZD1 A;  3GII A;  4Y00 A;  2D9O A;  1H38 A;  3CMA S;  1D8Y A;  1QJH A;  4C2M A;  2CQ2 A;  4LIR A;  5EDW A;  1FXR A;  2HUR A;  3A8I A;  3QRR A;  4A47 A;  4CH1 A;  3H8Y A;  5IOL A;  2XMA A;  1T03 B;  2M4M A;  3MGJ A;  4J91 A;  4KE5 A;  2EG1 A;  1Q79 A;  3PX0 A;  2GJF A;  2VOP A;  3QQC D;  2GNK A;  4NI2 B;  2GS8 A;  4HI1 A;  1XR5 A;  4I0W A;  4OHX A;  1YZ7 A;  1U8W A;  2Y0S D;  1U1N A;  2HGN A;  5B0E A;  3D2W A;  4NCB A;  1X31 C;  2C3U A;  2BXJ A;  3RAQ A;  4PQU B;  1D0E A;  1ZTT A;  1GT8 A;  2Y3Y A;  2G9O A;  3M6V A;  4JYA F;  4N77 A;  4DQI A;  2IYI A;  2VKR A;  3GJS B;  2KXH A;  1WEZ A;  4KGX B;  4M8L A;  4PYD A;  4BLG A;  4NRU A;  3VGS A;  4TU7 A;  3GV8 B;  4EZ9 A;  4NLG A;  3QIP A;  4RL1 A;  5IT9 U;  2JDJ A;  4ED7 A;  3H4B A;  3OVB A;  3ILJ A;  4B3O A;  2BKP A;  4R0J A;  1RAA B;  2HZV A;  3TX0 A;  3VCD A;  4IRK A;  4KGK A;  4LBP A;  1VLO A;  4CLL A;  3E01 A;  2DY1 A;  1CJV B;  3LP2 B;  4Q7A A;  1GMV A;  2HW3 A;  3SQO P;  1H72 C;  1X4D A;  2SXL A;  1IXK A;  3GR1 A;  2X3D A;  2IA6 A;  1TL7 A;  1HNV A;  1U02 A;  2FJB B;  2FHM A;  4DU8 A;  2ZWO A;  1Q5Y A;  1R6Y A;  2CQI A;  4DG1 A;  1RBO B;  3W61 A;  2NCK L;  3RYL A;  4WKY A;  2N3O A;  3M8S A;  5D4O A;  2ZD1 B;  3MD3 A;  1KC8 T;  1O6X A;  4B02 A;  4CYU A;  1M5V C;  4JI8 F;  2E5L J;  2HLT A;  4ZVU B;  4C7Q A;  2AV5 A;  3IP0 A;  2ATC B;  3M2R B;  4PG5 A;  5I3U A;  3RB6 A;  3MMA B;  4NLW A;  5HQL A;  4HHJ A;  4ZJL A;  4QWA A;  2L41 A;  2R2S A;  4M5I A;  1EAR A;  1Q8L A;  4OYX A;  2Q1L A;  3LA0 A;  3PAC A;  1J5O B;  3DLG A;  4U96 A;  5DDO C;  5KFB A;  3GON A;  4BHQ A;  3VVU A;  2ROP A;  3NBP A;  3N4W A;  4JI4 J;  1T05 A;  3GR0 A;  4TQR A;  3PYE A;  1WDD A;  2WHO A;  4CI0 B;  4CT9 A;  1OPZ A;  2XNQ A;  3MPY A;  3CC2 S;  5D4P A;  2E1P A;  1T0T V;  1LK5 A;  4DX6 A;  2FZG B;  2HS0 A;  2KT5 A;  3HUL A;  5D77 A;  1Z2Z A;  1REV A;  2WW4 A;  3CJ3 A;  4LVN P;  3LH2 S;  3SSS A;  2VBZ A;  5EUH A;  4WCE Q;  4DPU A;  2DNP A;  1QE1 B;  2UUC F;  2CWX A;  1T9X A;  2V67 A;  3KDN A;  4UQG A;  2FDN A;  2YNG A;  4NPO A;  2DR6 A;  2XS5 A;  3IGN A;  2QA2 A;  3MM9 B;  1RP5 A;  1H7X A;  3BO2 A;  3FJ2 A;  3BGR A;  4WFY A;  2F9D A;  2JVR A;  2NZC A;  1WI6 A;  4QBU A;  4ED4 A;  1PAE X;  1S6Q A;  1SBR A;  5KT2 A;  4R5P A;  3GV5 B;  5HBM B;  2GQC A;  1NB7 A;  3VZH A;  3V6J A;  2HVZ A;  1NJI T;  1JLE B;  1MN7 A;  1RKI A;  4X4T A;  2VQF J;  3MCS A;  3J7A N;  1S6P A;  2KT2 A;  5HLF A;  1D1U A;  4UOC A;  2HNZ A;  5DG7 A;  1R6V A;  1EIY B;  2QSF A;  2VC1 A;  4PEO A;  4DV3 J;  1LWX A;  4DR7 J;  5J1P A;  2RDI A;  1WHY A;  1KLM A;  5A8R B;  3AAW B;  3R1H A;  2C1E B;  2XMU A;  1RWW B;  2CZV C;  2LA6 A;  3X1L B;  5CD4 H;  2A18 A;  2XZD B;  3TVZ A;  5KFG A;  1TK0 A;  4OI2 A;  1VQ4 S;  1ZOT A;  1S5Z A;  3DGV A;  2BJ8 A;  3M8W A;  1EP4 B;  1KDN A;  1WAC A;  3VAK A;  2HQC A;  2ZOF A;  2DHA A;  2MHE A;  5A6P A;  2DGO A;  4IFV B;  1CSJ A;  3PYF A;  4ZMM A;  4B9N A;  1PIL A;  2YKA A;  2GIQ A;  3QJJ A;  1ULR A;  2MLY A;  3D1Q A;  4L3K A;  4BWJ A;  2W4P A;  2H48 B;  1AUS L;  1APS A;  4JI4 F;  1S9E B;  3R3T A;  1F2H A;  2E5G A;  5FDL A;  5K14 A;  2BDP A;  2W7A A;  3TA2 A;  3E2E A;  2XCA A;  3KK1 B;  2XO7 A;  5M2U A;  3NMA A;  3P6Y C;  4LQ9 A;  2DNY A;  2B6A A;  4MIB A;  4HH1 A;  4Z2X A;  1N5Y A;  2J6S A;  3BF4 A;  1S7H A;  1N33 F;  2Z0G A;  1MLA A;  1YIT S;  5KT4 A;  1R0B G;  1M1K T;  1K0T A;  1B0T A;  3B4D A;  1ZS6 A;  2KKH A;  4F26 A;  1SJ3 P;  3HHN B;  1HI8 A;  2GJI A;  4F3Q A;  3MEC B;  4QYZ J;  5IM0 B;  4NOH A;  4B9T A;  1G6B A;  1P27 B;  2YX1 A;  4G65 A;  3SQG B;  3TVK A;  4DUZ J;  4KHP F;  3R5J B;  2UXC F;  4LFB J;  1GFW B;  3HHL C;  4I68 A;  1NHV A;  5L38 A;  1JLG A;  1UEU A;  1FKP A;  4ZCL A;  4IG3 A;  3OHA A;  4N7T A;  4IRC A;  2HQG A;  2CRL A;  2HAF A;  2QA4 S;  1YJV A;  2HPU A;  4RW6 B;  3V81 A;  1FRH A;  1M5P C;  3LO3 A;  3Q8S B;  2IY5 B;  1S72 S;  1NPP A;  2CJQ A;  4L73 A;  2JLE A;  2PEH A;  5C42 A;  3OSN A;  4NLR A;  2APO A;  2CVE A;  1SCJ B;  2LQ9 A;  3IS9 A;  3FSI A;  1T03 A;  1KOH A;  1IUJ A;  2W2O P;  3DLG B;  2KM8 B;  5JMN A;  3G8S A;  4OLO A;  3MPW A;  2ZH1 A;  4CCH A;  4CH0 S;  4X65 F;  4JOU A;  3FNN A;  5E7O B;  1RHJ B;  5KTQ A;  3TI0 A;  2CQ0 A;  2GCF A;  3O44 A;  2VA3 A;  4WP3 A;  1D9D A;  1IR0 A;  1VQ9 S;  1TL1 B;  1FJ7 A;  3DOM A;  2CPJ A;  2RUG A;  3DLB A;  2HAI A;  2HHP A;  3DU6 A;  3PFE A;  5EGY A;  4QU6 A;  1IBM J;  1NK5 A;  2FVP A;  2CPY A;  1P8G A;  4ZOS A;  3U1N A;  4LR9 A;  4RUH A;  2MJN A;  3WHI A;  5C42 B;  2KRB A;  4IFV A;  4TLQ A;  4NXM J;  3BO3 A;  3CCR S;  3EZU A;  2Q66 A;  1M0S A;  1SH2 A;  3K7R A;  2IM2 A;  3KJN B;  3UW1 A;  5F8H A;  4QJV A;  2DNQ A;  5GMK a;  1JLA B;  2XS7 A;  3KLE A;  3OPK A;  4EBD A;  3I32 A;  2VQE F;  4NLY A;  2W8K A;  4NLX A;  4JI2 J;  2LVW A;  2YKM A;  3CO0 P;  4KGV B;  5ETV A;  5IQ6 A;  2DO0 A;  3LP0 A;  3DOL B;  4LVO P;  4PPD A;  1JXE A;  4F4Y A;  5LMU F;  1DAR A;  1NSP A;  1U24 A;  1B4S A;  1T9U A;  5D0R A;  5DQG A;  3RAX A;  2DNZ A;  3RZA A;  3MM8 A;  5J2N B;  5HLF B;  4PXE A;  2RAQ A;  1UVI A;  4NL5 A;  3VQS A;  4YDD B;  5DQI A;  2UVW A;  4K4U A;  3C6T B;  1SB6 A;  2HGL A;  5H9E J;  1B3T A;  2UUW A;  1Y00 A;  5KAK A;  5F0W A;  4JUZ A;  4ECX A;  3SQG A;  4ID5 B;  2NPI A;  4NA1 A;  2GVZ A;  1VQS A;  2QLX A;  3MR2 A;  2FTR A;  2C3Y A;  3TAR A;  1PYT A;  4IDK B;  5J1N A;  4J90 A;  4ATN A;  4ZS6 A;  5IZH A;  4RUC A;  1PJ6 A;  3NLC A;  3TUZ C;  3OXG A;  4YP3 A;  2NUH A;  1OSC A;  2VV5 A;  3PRV A;  1YBT A;  1DUR A;  2CDQ A;  3W1Y C;  1XMO F;  3JAM U;  4DR7 F;  3O2I A;  3B82 A;  4U7C A;  2BQR A;  2BQ3 A;  2QZ8 A;  1RTI B;  1B99 A;  1RBA A;  4DR5 F;  4PG7 A;  5CCM A;  3N6M A;  3WQP A;  2XM3 A;  4Y28 C;  1S9E A;  2VPZ B;  2RS8 A;  4MIA A;  5E5N A;  5HQ8 A;  3JQM A;  4P72 A;  2RB7 A;  1T11 A;  5HJX A;  4QWB A;  3IS9 B;  4OI1 A;  3GU0 A;  1E6V A;  1FDA A;  5DDP C;  3U27 A;  4O0I A;  3SI8 A;  1Q95 G;  4JI7 F;  1SC4 B;  4DUY F;  4EBC A;  4HHU A;  1HR0 J;  2RQ4 A;  5HMZ A;  3E51 A;  1CS4 A;  4CRJ A;  4DSE A;  4GVB B;  2KVQ E;  3SYZ A;  2RML A;  2XMW A;  3HJV A;  2YWG A;  3LW5 C;  5AXM A;  5BR8 F;  3H5U A;  3NMR A;  2P6S A;  3K0J A;  3IA0 A;  3Q8V A;  5CQG A;  3E3X A;  1BXN A;  1JLE A;  3S8S A;  4B9U A;  1KVJ A;  2OEM A;  4P7V A;  3RAM A;  3K2Y A;  1JWW A;  2ZE2 B;  1Y11 A;  3ET6 B;  3NCP A;  1RA7 A;  2VFS A;  5J2M B;  3PVX A;  2OTL S;  1FDN A;  2BYC A;  2KHC A;  2KU7 A;  3OR1 B;  3UCG A;  3FFI B;  4I6Y A;  4ID5 A;  3UN2 A;  4Q43 A;  3TJA A;  3EGW B;  4B3S J;  4LF4 J;  1B64 A;  2AJ0 A;  1ZM9 A;  3WDO A;  3UN3 A;  2JOQ A;  2OFG X;  2LP4 A;  4EFA C;  4NYZ A;  4K2J A;  1TKT B;  2DH9 A;  2XLI A;  1M5H A;  2K3K A;  4P2X A;  4PAA A;  1HD0 A;  4M5L A;  1TEL A;  3DRR B;  4HVZ A;  4OYA A;  2X7I A;  3H5S A;  3CJ5 A;  3DNC A;  2DRD A;  2WW8 A;  2V94 A;  3CIM A;  3HHD A;  3N0V A;  5K8M A;  2YWK A;  3D6T B;  4O4G B;  5KFZ A;  4TU8 A;  3JS9 A;  1WC6 A;  2E1A A;  4NX9 A;  4NLT A;  4QWE A;  1REV B;  4PQU A;  1VQN S;  1TFW A;  4ZLN A;  4KV8 B;  3IBC B;  3M8Q A;  2B9E A;  2MZQ A;  4ZHR B;  3PIO Q;  2ZJP Q;  1XMO J;  1FWK A;  1KKH A;  2A0F B;  4A8K A;  1EQM A;  3AB2 B;  3IWL A;  4LQ3 A;  5LSO A;  2PA3 A;  2QTW A;  3K8W A;  1H0H B;  5K8N A;  2R2R A;  4RU9 A;  2UVR A;  1U1K A;  4NEZ A;  4Y2K A;  5A0Y A;  2YTC A;  1UW9 A;  1FDD A;  3B54 A;  4QR1 A;  1HA1 A;  3GFZ A;  1OPI A;  3KUE A;  5LL6 d;  1HNX J;  2NQP A;  2DCU B;  3GP9 A;  3K89 A;  3UPF A;  1F5B A;  2I8E A;  1HL6 A;  2MKS A;  2V8D A;  5ETS A;  3PXG a;  3RR8 A;  1TL7 B;  4OZ5 A;  4RW7 A;  3SSQ A;  2E1M C;  2CNO B;  2PMH A;  2KJW A;  1X5O A;  5ETK A;  3CPW R;  1RZM A;  4MT1 A;  1RUS A;  2XCP A;  2J76 E;  3AQP A;  4JI0 J;  3H0P A;  4TY9 A;  1WTB A;  5G0R A;  4OZ1 A;  3HF5 A;  5U47 A;  2XYP B;  1RT4 A;  2XO6 A;  4DN0 A;  4G1I A;  3CCL S;  4DR2 J;  4HTJ A;  3JYT A;  3MPD A;  1R8H A;  2HQF A;  2OD4 A;  2HFV A;  1VIX A;  2KRR A;  2LMI A;  1OY8 A;  2OJ3 A;  2IVM A;  1VQM S;  1WKJ A;  3HVW A;  4DBQ A;  3J7Y U;  1CQM A;  1NJZ A;  1WOS A;  5LOQ A;  1WF2 A;  2CG4 A;  3KWM A;  4O0N A;  3DHW C;  4ZJO A;  1Z2L A;  3M32 B;  3MAH A;  1R0A A;  5HQM A;  3CIZ A;  3TZW A;  1Q16 B;  4K50 A;  2IIH A;  1MML A;  4OJG A;  1KWM A;  1QY7 A;  3CDU A;  1RT1 B;  1UJ6 A;  1VFJ A;  1YRU A;  3M2U B;  1S10 A;  5KFR A;  4AQY J;  3A13 A;  3IR6 B;  2VDH A;  1IBK J;  1V6H A;  2ALZ A;  3V4I A;  4OX7 A;  1FK9 B;  2FJX A;  3W2V A;  3MMB A;  4ZIV A;  3KOA A;  3I9Z A;  4DV0 J;  1XJW B;  4JI1 F;  2Z2Y B;  3UR3 C;  2C2Z B;  2H65 B;  2ILY A;  3CNQ P;  2VON A;  4DV2 F;  1NDL A;  2AEF A;  3I0R A;  4MKB A;  4DR1 F;  2V6A A;  5KFL A;  1MRO B;  2PFF B;  1SJQ A;  1KTQ A;  3MDF A;  2KI2 A;  3CCZ A;  3OTE A;  1FA0 A;  2XGP A;  3CB4 A;  4ITS A;  3EJM A;  4BWM A;  2UP1 A;  3W8P A;  2MJU A;  1Q8B A;  5K5M A;  3T9N A;  2MXY A;  1NDK A;  1IM4 A;  3BS9 A;  4YQW A;  2HHS A;  1FJC A;  2BM1 A;  6AT1 B;  2NLW A;  2IHR 1;  5ETL A;  4FVM A;  5DET A;  1K47 A;  2WOM B;  4N56 A;  3MWB A;  3BYR A;  3DOM B;  5CYM B;  2R7V A;  3HZG A;  1F3V A;  3P3D A;  1S1U B;  4OYW A;  3TNV A;  4BS2 A;  2M88 A;  3KJF B;  4LF8 F;  2BW2 A;  4F4W A;  3HI9 A;  4M5D B;  2QX0 A;  2XY7 A;  3C14 A;  1N8R T;  1HNW J;  3J7Z T;  4RPF A;  1RAH B;  4XPC A;  4ZKA A;  4HDH A;  5KG4 A;  5J2N A;  4QIG A;  2BV3 A;  3GWC A;  4ECU A;  1X60 A;  5GAG I;  4LSZ B;  1ZA1 B;  4YEA A;  4NCA A;  1SPB P;  1NRK A;  2B43 A;  2EC2 A;  2OPS A;  2RHQ B;  3BM7 A;  3DOL A;  5E3C A;  4ZVH A;  3KJV A;  4WP8 A;  3SV3 A;  5LXY A;  1VJW A;  5KFT A;  2NR0 A;  1U48 A;  1FRJ A;  2NXU A;  3J80 Y;  3NGT A;  4ZIT A;  2C3M A;  2DGU A;  2GO8 A;  2DD8 S;  3RU0 A;  4UST A;  5KFV A;  4ECZ A;  1QLN A;  1JLG B;  4UOF A;  1H2V Z;  2XMT A;  4OIX A;  1PG5 B;  4OX8 A;  1U1L A;  2KFZ A;  3G87 A;  3FMW A;  4YB5 A;  2EG2 A;  4A8Y A;  3MEG A;  2OPP A;  4F04 B;  1F5A A;  3CJQ A;  2EVZ A;  2R2T A;  4DR4 J;  3FRZ A;  2X1B A;  3M1V B;  2QG9 B;  4GKK J;  3MEE A;  3BGL A;  4E98 A;  4AND A;  2EBE A;  2H4Y B;  2HZC A;  1NPK A;  3H2L A;  4IOB A;  4I1T A;  4CO5 A;  1U8S A;  3Q86 A;  1RLC L;  1XWL A;  3I4P A;  4PCQ A;  4K4X A;  4C3L A;  2BMB A;  3UDV A;  4DQS A;  5EWF A;  1YJ9 S;  2NXN A;  1FKA F;  1LW0 A;  4WF9 Q;  2DYA A;  1RJJ A;  2YNI A;  3G2X A;  1PKU A;  3KK2 B;  2YWW A;  1TP7 A;  3KNG A;  3MAA B;  4TY8 A;  4UZB A;  1XC9 A;  3ISN C;  2NYH A;  3ENQ A;  4P75 A;  5D4L A;  3KK2 A;  4G1Q B;  4WFN Q;  4M5K A;  5AXN A;  4MKV A;  1P1T A;  4CNZ A;  3QZ7 A;  1QTM A;  4DSL A;  2CZ4 A;  2P6T A;  3FEX B;  5D4N A;  3BDE A;  3BJY A;  1YJW S;  1HI1 A;  4M5M A;  5HAN A;  4DL5 A;  3NL0 A;  2ASJ A;  3DLE B;  1PCA A;  2V34 A;  2JL9 A;  3ZC4 A;  1MU2 A;  2ZZT A;  2ALY B;  3D0H E;  3Q83 A;  2MKY A;  1WWH A;  1DTQ B;  2IAJ A;  1N4L A;  4WK1 A;  2CPZ A;  4DV5 J;  3DRS B;  2FJW A;  2AF6 A;  5ETR A;  3D3B J;  3CJ0 A;  4W92 B;  2XQC A;  1T9T A;  3ZZR A;  4EI2 A;  1A9N B;  1ZPV A;  2HSE B;  3HHK A;  2CPD A;  4EUV A;  4J37 A;  4X4P A;  1U49 A;  2XHW A;  1S6P B;  4KHP J;  4AXI A;  1PC5 A;  1TMJ A;  2LEC A;  4U7U K;  3PX6 A;  1DQ9 A;  1HPZ A;  1S6U A;  1U0S A;  2K2P A;  2OSQ A;  3P5B P;  4F0M A;  4CM2 A;  2DXE A;  3KUG A;  3M7V A;  5HMY A;  2R2U A;  4WII A;  2FC8 A;  2UVU A;  1LXJ A;  4OYP A;  4D3G A;  5A76 A;  1RHR B;  1NDP A;  3Q8Y A;  2ZH9 A;  4DUY J;  4PAB A;  2FZK B;  3IBF B;  2KZZ A;  2CQ1 A;  3MZI A;  4ECR A;  2OPS B;  1TFY A;  1QAX A;  1V3R A;  1WKL A;  2H4W B;  3TEH B;  1JNR B;  3D66 A;  4CP5 A;  4DUT A;  3JTP A;  2ASY A;  3TZZ A;  1C1C B;  4H4O B;  1TTH B;  2F65 A;  2LXF A;  1S1X A;  4FKY A;  4I69 A;  1NJY A;  1X5P A;  3NOC A;  4M5H A;  4CTA B;  2UUA J;  2K1R A;  4QR0 A;  3TYT A;  3EX7 B;  3ZTO A;  1VRT A;  3PTW A;  2J9E A;  5E3A A;  3LF0 A;  4NZ6 A;  2VB6 A;  3ITH B;  4F8R A;  3Q22 A;  2ZBR A;  3VAM A;  3JXO A;  2M3D A;  3M8Y A;  1NH8 A;  1D09 B;  1J5O A;  1XNQ F;  1Y10 A;  2IYG A;  1OMS A;  1Q8K A;  4O44 A;  1YJR A;  3GG1 A;  4ERD A;  4WZM A;  2R7T A;  3JSM B;  3DLK A;  3T6J A;  2OEL A;  1Q81 T;  2C2E A;  1UWB A;  1GMW A;  2OML A;  4M5J A;  2XTJ P;  4PYA A;  4P73 A;  1S1V A;  4WK3 A;  4Y34 A;  3RUB L;  3T41 A;  2V4Q A;  3W7B A;  1EJ7 L;  2HHX A;  4PXB A;  2EC0 A;  4Y2C A;  1PO6 A;  4X4U A;  1LW0 B;  3PRD A;  2W7O A;  3IG1 B;  2NXC A;  3R2C J;  3NGR A;  4C4W A;  1T9W A;  4PPZ A;  5CCL A;  1RDR A;  3KLV A;  3V4I B;  4KIA A;  1CBK A;  4CLF A;  1EAY C;  2YQ1 A;  4ANE A;  3MOJ B;  4TU9 A;  1FVS A;  2IFX A;  1RT1 A;  1AZS B;  1PAU B;  2QLW A;  5IWA F;  2EEY A;  1N5V A;  2BJ7 A;  2YPY A;  4O4R A;  4RW6 A;  1TKD A;  4OL8 A;  5AXK A;  4CIO A;  1RCX B;  2K7K A;  2RT3 A;  1U26 A;  2OPP B;  5D6G A;  1FKP B;  2QT7 A;  3MXH P;  1KS2 A;  3AOB A;  4QWD A;  2G13 A;  5KFW A;  3IR5 B;  3KJV B;  4ED6 A;  1WC5 A;  2HQ3 A;  2ZBP A;  3NGS A;  2LEP A;  5H9F J;  2AYE A;  4U95 A;  1BQN B;  1JLF A;  3P5T L;  3NNA A;  3F56 A;  3MR5 A;  2BA9 A;  1ROF A;  2DEI A;  4UF4 A;  1NB2 A;  2CJA A;  4P6Q A;  3BKU A;  2QA4 G;  4B3T J;  4DR6 F;  1OYD A;  3OQ2 A;  4M5D A;  5KFJ A;  4LF8 J;  2B6A B;  1NO8 A;  2EFN A;  4PXD A;  4WYW A;  3CF5 Q;  1IKV B;  3IAS 9;  1VIS A;  4E8U A;  2CQ4 A;  4ZVO B;  3OXL A;  4H54 A;  1P1L A;  3PEH A;  5D0E A;  3QGP A;  1H73 A;  1ZYQ A;  1MSW D;  1RT7 A;  2DIU A;  1LOU A;  9ATC B;  2UXC J;  5K8O A;  1RAC B;  1L3S A;  3VAL A;  3PYD A;  2E5L F;  2QFJ A;  2ZM6 F;  2VIH A;  1U6F A;  3HD1 A;  1HQU B;  1J2V A;  1NBE B;  2B4P A;  3DHX A;  3ISZ A;  3RBZ A;  1VBX A;  3RR7 A;  3DKD A;  4PWD B;  3A1Y G;  1KP6 A;  3ENV A;  1U2R A;  5L1K A;  1VQ5 S;  3HK2 A;  2ACM A;  2OEK A;  4C11 B;  2A2C A;  1J27 A;  2FJE B;  4P9S A;  4DFK A;  1K73 T;  2V2V A;  2VG7 A;  4GVL A;  4B9L A;  3NAI A;  3CD5 A;  4Y3C A;  1WDT A;  4KV8 A;  3GYG A;  3MMB B;  1LWC A;  4HDG A;  1HWJ A;  2AKW B;  2MHN A;  1IJE B;  2XC9 A;  1BD6 A;  2L48 A;  1MN9 A;  2P2C B;  3GFH A;  3H2U B;  3U02 A;  5KT3 A;  4WBF A;  3NS6 A;  1TUG B;  3QBC A;  4C6A A;  3TUI C;  4K59 A;  2D7S A;  1NH7 A;  2JNJ A;  2G2Z A;  2AIR B;  2XSF A;  3QMQ A;  5ADZ A;  1KEK A;  1KVK A;  3NS5 A;  2IBO A;  2DGV A;  1H6K X;  1RHU B;  5CZV A;  2FLO A;  3Q8Q B;  2B7C B;  4ETZ A;  2AYG A;  2HWT A;  3LWL A;  2RHS B;  5GAD U;  3R1L A;  3CCW A;  4DL7 A;  1JXV A;  1Y9O A;  3SV4 A;  1X7V A;  4DSI A;  4F2R A;  2RQK A;  2ZE2 A;  4FYW B;  2VUG A;  4IO1 A;  1RYR A;  3DRX A;  2AWZ A;  4OYZ A;  1XQI A;  1QE1 A;  2A6M A;  2OD6 A;  2ZIT A;  5CYJ A;  1HPZ B;  3LWM A;  2NZ4 A;  4NXN F;  2NXE A;  4I2P B;  4EZ6 A;  1C2P A;  2FGO A;  2HYI B;  3HPO A;  2E9R X;  4NXM F;  4YS2 A;  5J2Q A;  1Y5L B;  3L9Z A;  2XGQ A;  1F0X A;  5BYQ A;  1NHU A;  4DSK A;  2IM0 A;  3I0S A;  5B0F A;  4B3R J;  3PCO B;  2LQ5 A;  4USJ C;  1SJF A;  2UUA F;  3MM7 B;  2E44 A;  1K1S A;  2DNK A;  2ZH8 A;  2L9W A;  4GVB A;  3SBM A;  3KHL A;  1YJN S;  3KFW X;  1WD6 A;  4PKD B;  3C6U B;  1ZBT A;  2B9W A;  3AT1 B;  3B4M A;  4OYM A;  2GA7 A;  4MKY A;  3BV8 A;  3QT6 A;  4A8M P;  2DO4 A;  3TR5 A;  4LFB F;  2AEJ A;  1RAG B;  3BPS P;  5BJR A;  3H7H B;  2FJA B;  1GQE A;  2QL5 B;  1RWO B;  3IRW P;  1HNZ F;  1RK8 A;  2RRB A;  4PQA A;  1M90 T;  3AJ1 A;  3AXM A;  2PGC A;  1K44 A;  4DF8 A;  2D41 A;  4LJM A;  5E0O A;  4C11 A;  2J5A A;  1MWZ A;  4OI4 A;  1ELO A;  4QCL A;  1RT5 A;  4EWT A;  2BUN A;  1RTJ B;  4PWD A;  1FNO A;  2DIS A;  2G0J A;  2Z2L A;  4NEY A;  1MW7 A;  2G2O A;  4Y6I A;  3Q8R B;  2OUG A;  2FUG 9;  4GKJ J;  1KVI A;  4U7U D;  1X4G A;  1YK9 A;  3EIC A;  4USI A;  1S77 D;  3HFV A;  5H1S V;  3QGH A;  4NRT A;  2IDE A;  5J2M A;  1ZTW A;  4F3O A;  2FC9 A;  3UDL A;  3T1Y J;  1FWL A;  2O1P A;  4DZD A;  3MFH A;  3P45 B;  4KGM A;  2B4U A;  4DL6 A;  1IM6 A;  3RG6 A;  1XMB A;  5MLC V;  4IH7 A;  3GV7 B;  2B4O A;  2HVH A;  4RUB A;  1SV5 A;  2VHG A;  1WHV A;  4CLP A;  5L8R C;  2RF2 B;  3NRB A;  1JLF B;  2GHV C;  1YG0 A;  3GJT B;  5D15 A;  3CC4 S;  3THT A;  2IVF B;  3BQ2 A;  4NYP A;  3TAQ A;  4K4S A;  2AD9 A;  3DRS A;  5AJ3 F;  1RTH B;  1VC0 A;  1F6T A;  1CUL B;  2ZUG A;  4QIW D;  1N34 F;  3Q2S C;  1NK8 A;  1SC6 A;  2ASL A;  2CZ9 A;  1PBA A;  2HS4 A;  5HP1 B;  2YKQ A;  3TW0 A;  1S1T B;  5B0G A;  3WX4 A;  3KG1 A;  4RJV A;  5KG6 A;  5J2P B;  1A0O B;  1VBZ A;  3BYP A;  3Q8P B;  1JJ4 A;  4HHH A;  3UNG C;  1S0V A;  3SFU A;  4JYA J;  3EVM A;  2BRK A;  2ZEJ A;  4ER8 A;  4G1Q A;  1C4C A;  2EPI A;  1DQA A;  1FD2 A;  3N79 A;  4I2Q A;  1T02 A;  3TRG A;  2G4B A;  5FD1 A;  2CQC A;  2UUT A;  5CAA A;  2Y9H A;  4PUO A;  1M1H A;  2K3I A;  3EZO A;  3PM9 A;  1T94 A;  1JJC B;  2BRL A;  2BZ2 A;  2V2Z A;  3D7S B;  1LXN A;  3SSR A;  2MMY A;  4ZP8 A;  1C1B B;  3W5X A;  1Q7L B;  3HP6 A;  3N5F A;  4DV3 F;  3WBZ A;  2V9W A;  2CYY A;  2N82 B;  2F8H A;  4FZV A;  2KM8 C;  1VR6 A;  4LSL B;  4DI6 A;  3CJR A;  3PNI A;  1DFD A;  1QM9 A;  4ES2 A;  2A1B A;  3R5C A;  1R3N A;  5HRO B;  3W66 A;  2ZH6 A;  2OI2 A;  2HMI A;  3MM8 B;  5JXS A;  3T1Y F;  2M7S A;  1RT2 A;  2RNE A;  3KUH A;  1H3D A;  2AT1 B;  4HT7 A;  1UFW A;  4ED8 A;  2MTL A;  3DYA B;  3WC0 A;  2VZ9 A;  2P8I A;  4UY8 T;  4Y0F A;  3DOK B;  4K5S A;  1HHS A;  4KQZ A;  3RW7 A;  3S6E A;  3KK3 B;  4NLD A;  4DFP A;  1LFP A;  2GW8 A;  4ECQ A;  1U09 A;  2JC1 A;  2WB1 D;  2QYG A;  1FRI A;  2I38 A;  4LT6 A;  4DPX A;  4JI5 F;  2ZOG A;  4YHH F;  2GIR A;  1R8A A;  3M2V B;  5C25 B;  2ZWP A;  3TAM B;  5DS7 A;  2PSZ A;  5AJ3 J;  2LEA A;  1FFW B;  3RRH A;  3K58 A;  4R8U B;  1FT8 A;  4J7C A;  4RX6 A;  4XTT A;  3O5T B;  3PO4 A;  2OFH X;  3A8E A;  5DGB A;  1YLX A;  1KFD A;  3HDS A;  2KG1 A;  1K8A T;  3HJF A;  1PIE A;  2MPU A;  2FHJ D;  4TLR A;  4A8W A;  3AA8 A;  3UD5 A;  2ZBC A;  2KYX A;  4ZVS B;  2MST A;  4A4J A;  2F1F A;  2R8K A;  4K4Y A;  4ZVP B;  5KFQ A;  1RWM B;  3M6W A;  3NGD A;  3VAF A;  1IKW B;  2W4D A;  3FCW A;  1KQK A;  4TXS A;  4RWW A;  3UE2 A;  1GNK A;  4RU2 A;  4MAK A;  2V2K A;  4URQ U;  4U8Y A;  5KFX A;  2CQ3 A;  3DN9 A;  3PW5 A;  1SKW A;  4QW9 A;  3DMJ A;  2KTQ A;  5IT9 Y;  3SXL A;  4YN3 B;  4C0B A;  3CGI A;  1CJT B;  1S4E A;  1TK5 A;  1JLB A;  2VL1 A;  2FLN A;  2YNF A;  3SEO A;  4FBU A;  4ZPC A;  1CC8 A;  3HT0 A;  1HW9 A;  1NXI A;  2Z2Z A;  1CQN A;  4ES3 A;  5GME A;  4OV6 A;  1IKX B;  3CXC R;  4F50 A;  2CNL B;  5IXU A;  2XHC A;  4L6V 3;  3LUY A;  2MEW A;  1YX2 A;  2GGP A;  5AE1 A;  3BKT A;  2V8V A;  5F0U A;  4PR6 A;  6FDR A;  4Q5V A;  3QT7 A;  4KH0 B;  4AXJ A;  5EWG A;  3MOZ A;  1XNR F;  5L9N A;  2ZHA A;  2BE9 B;  2W9A A;  1EZZ B;  1OS5 A;  1H2U X;  3CDB A;  3N6N A;  5LMN J;  3I0S B;  3R7B B;  4EBE A;  2OH2 A;  1N36 F;  3OUY A;  4EO8 A;  3MEC A;  5CZX A;  4FF1 A;  1VIO A;  3CUN A;  1AFI A;  2R4F A;  1FXD A;  1UPM B;  5FLX U;  1YKW A;  2ZDO A;  5LT5 A;  4C8Y A;  3GZ7 A;  4MK7 A;  3KLG A;  2R42 A;  2AW0 A;  3LQV A;  2ZJR Q;  2FZC B;  1RYS A;  2LFV A;  4YFU A;  2HFO A;  3MM6 A;  1NJX A;  3R2D J;  4S0M A;  5KT7 A;  2FVR A;  3AHP A;  1D3W A;  3C19 A;  3ISN D;  4B9S A;  1IR2 A;  3UQS A;  1KQS R;  2B56 A;  3ICL A;  1SQG A;  3NG8 A;  4RKU C;  3BBC A;  3ZXW A;  3OR1 A;  3R9L A;  2MLX A;  1S9G A;  5K20 B;  3CW2 C;  3LGM A;  4Q2M A;  5ETT A;  3MM9 A;  4YR2 A;  1HLW A;  2EXU A;  1X5S A;  1FKO A;  3QLH B;  2W2Q P;  2NRE A;  2ZVS A;  1M5K C;  4FYV B;  2B8P A;  1UET A;  4L75 A;  3ZZO A;  5LMU J;  2YQ0 A;  3OTD A;  3W60 A;  2JLG A;  2XY6 A;  3UWT A;  2UUB J;  4Q45 A;  2CG8 A;  1F9E B;  4EYH B;  3GB0 A;  4OYO A;  3QID A;  1HFE L;  1E6Y A;  2DTJ A;  1FX2 A;  4ZVE A;  4A48 A;  4RNN A;  3GIM A;  3H42 A;  2LYV A;  4AD6 A;  4LFC F;  1T05 B;  1SXL A;  4A8X A;  1DTT B;  1RWN B;  3CCU S;  2RRA A;  1MG7 A;  4RLE A;  1R7I A;  2DNG A;  2G1D A;  2XZW A;  3ITH A;  3VAI A;  3RBE A;  5FJ4 A;  1B0P A;  4N8N A;  2R7W A;  1U7L A;  3BQ1 A;  2CWK A;  2C2D A;  3DLJ A;  4DUZ F;  1XEZ A;  4WXO A;  1KRP A;  4C9D A;  3CVK A;  4DPW A;  2E29 A;  2E5I A;  3M6U A;  3UN5 A;  1XTZ A;  1WC1 A;  4FP9 A;  3FSX A;  4OJ3 A;  4DV4 J;  2PC6 A;  4EU0 A;  4ZPA A;  1RT6 B;  2BAN A;  2CXE A;  5DRK A;  3W64 A;  4P2M A;  4EEY A;  5CA5 A;  5ETN A;  2P9E A;  5HBM A;  4DG1 B;  2M0G B;  3G9C A;  1JKH A;  2UV8 A;  4P2S A;  3AOC A;  4A46 A;  2EW9 A;  2RUS A;  1LWF A;  3D6F B;  3C8Y A;  4UOG A;  4LRA A;  1X4E A;  2GJ2 A;  5DGA A;  3VGU A;  1WHX A;  2MKI A;  3U1M A;  2HQD A;  1S9F A;  2HWH A;  2A6O A;  1X0F A;  1J5E J;  3WIU A;  4C3M A;  3IFE A;  4RR5 A;  1IBC B;  2XI3 A;  2XNR A;  1TQL A;  2WVC A;  1VQY A;  3BEG B;  1FTR A;  2DK2 A;  4HR2 A;  4RBV A;  1UVL A;  2P5V A;  2D1C A;  1BQM A;  4MIW A;  1Z1Z A;  3J7Z 5;  1V3Z A;  1HBO A;  2HKE A;  4QW8 A;  4JI3 F;  4F02 A;  4V19 X;  3HO1 A;  1ICE B;  2DH8 A;  1FER A;  2Z4P A;  4GO5 X;  3VQT A;  2DRA A;  2M52 A;  4KKO A;  4OZN A;  4K2X A;  3RJM B;  3BKF A;  3FBC A;  4J9V A;  5B0B A;  4X4O A;  3G4S S;  2ZNZ A;  2YY3 A;  3NWR A;  1VC6 A;  4WTO B;  1JLA A;  2WVB A;  1HNI B;  3PHE A;  3M8R A;  1SH3 A;  2MY8 A;  3RBX A;  3C6U A;  3P49 B;  1C0U B;  1ZAV A;  2KO1 A;  3AJ2 A;  4HKQ A;  1BHN A;  3D6M B;  2BAC A;  2QA1 A;  4LF2 A;  4BC7 A;  2ZUA A;  2E7W A;  4QPX A;  3UCZ P;  3KYL A;  1RT3 A;  3W5Y A;  4M94 A;  2BJE A;  4DEZ A;  2EFG A;  3ENA A;  1VRQ C;  2EWH A;  4PG4 A;  4WFZ A;  4ZCM A;  2XZT B;  3CJT A;  1HHQ A;  1RT7 B;  2HNY A;  2NUU G;  3OD2 A;  3OFG A;  2MQP A;  4YY3 F;  4YB7 A;  4USV A;  1WJ9 A;  3KLF B;  4O3R A;  2D69 A;  3PW0 A;  3HX9 A;  4JI3 J;  3SCI E;  1A7G E;  1XR6 A;  4KHM A;  3ZO7 A;  3E01 B;  1ZET A;  2GML A;  4YB6 A;  4KH1 B;  1HNI A;  2MGZ B;  3IM8 A;  5K8P A;  1S1T A;  3W2V B;  2KXF A;  3OW2 R;  4B3O B;  2F7V A;  3OFF A;  4FYY B;  1NME B;  2HRY A;  2P9G A;  1BLU A;  2IM1 A;  2Q43 A;  2W25 A;  3M2U A;  1QUP A;  3F44 A;  2HG4 A;  3OXF A;  2WSC C;  2JVO A;  2CQB A;  3GJR B;  2BW7 A;  3HMJ G;  3OTO J;  4K4W A;  4AUK A;  1T9Y A;  3JAM Y;  3B6B A;  2KT3 A;  3T19 A;  2RF2 A;  4WYL A;  4DV1 J;  1TUW A;  3LAL A;  3JTN A;  2GO9 A;  3KLI B;  4KO0 B;  4MK8 A;  2QSW A;  2BM0 A;  3BZQ A;  2FJD B;  1AYE A;  5FLX Y;  3T1H F;  1D9F A;  4NI2 A;  1ZAW A;  1RU1 A;  3C15 B;  2HEK A;  4BBY A;  3D67 A;  5IFM A;  3DI6 B;  5GAH U;  1DY3 A;  2WK4 A;  2WSE C;  3G71 S;  1N6Q B;  2H54 B;  2RE1 A;  3DM2 B;  4ZCI A;  1HR0 F;  3R6L B;  2FQQ B;  1GXL A;  3RRG A;  3HHL D;  3C14 B;  5HAO A;  3EWG A;  4DR3 J;  1LWE A;  3IN5 A;  1X0P A;  3HVR A;  3FK4 A;  1BGX T;  2LDI A;  1FNX H;  2DHG A;  2JC0 A;  2EFP A;  1HQU A;  1TKX B;  5L1L A;  5BR8 J;  3EM1 A;  4RBT A;  1NAQ A;  2RU3 A;  2JEI A;  2KZM A;  1S99 A;  4M95 A;  1FVQ A;  1CJU A;  4NCG B;  1C4A A;  4JI5 J;  2BOA A;  5THW A;  1T3O A;  2DNM A;  4ZN1 A;  3M4X A;  1U1R A;  3W5Z A;  4GKJ F;  1AW0 A;  1U6B A;  1TR0 A;  2V9K A;  2W1B A;  1UCN A;  2RDJ A;  1S7I A;  1F9F A;  4JB8 B;  3NS7 B;  2CPE A;  3U1L A;  3VVT A;  5AE3 A;  2W8L A;  2VG5 B;  4M5N A;  2DGT A;  2ZH3 A;  1JLC B;  4CO3 A;  1SJR A;  1BQN A;  2E9T A;  3FQL A;  3GSI A;  4LFA J;  2XSJ B;  1CPZ A;  1NM2 A;  1HBM A;  2BX6 A;  5I42 A;  1KLM B;  1C0T A;  2E66 A;  2RRN A;  2XLJ A;  2VKZ G;  3FCV A;  4FPI A;  3CCJ S;  3V6H A;  1OJ4 A;  4UZC A;  2AZ3 A;  4USW A;  1UMJ A;  2Y1J A;  1X4A A;  3CJ4 A;  1S9G B;  3IRX A;  3JSR A;  4FF2 A;  3V4M A;  4FXW A;  4FN5 A;  4OQJ A;  2RJZ A;  4FNH A;  4LRC A;  1UL3 A;  9RUB A;  4NLQ A;  3IWN C;  1OY6 A;  3G86 A;  2BJ9 A;  5ETM A;  2VQE J;  3PW7 A;  5B0D A;  3TJ9 A;  2PN6 A;  3WC2 A;  5CHC B;  2CA9 A;  3W2W A;  2ZNY A;  4I56 A;  4OYI A;  7FD1 A;  1U4B A;  4JI8 J;  4ZCK A;  1DHM A;  2PT0 A;  5DG8 A;  1JB0 C;  3FKB A;  4Z7Y A;  1LWF B;  2EKN A;  1GXT A;  2QV6 A;  5D0H A;  4LF7 J;  3TAP A;  1VYA A;  1RT4 B;  1WHW A;  4O3P A;  2HFN A;  3ZZ0 A;  3CJK A;  2W2N P;  3C6T A;  3N28 A;  2L9N A;  2OPR A;  4M1K A;  3KKF A;  1PYS B;  2HK2 A;  2BJ3 A;  2J7U A;  3O6Q A;  1UWB B;  3AOD A;  4AFF A;  1IBL J;  3QNW B;  4LUB A;  1B7F A;  2LXU A;  4CQ1 A;  4ZPW R;  4CLK A;  2PDA A;  3QT8 A;  5E3R A;  4JI6 J;  4JV1 A;  1SKR A;  2QRR A;  4LMZ A;  3MTJ A;  1CJT A;  4ZVG A;  4N8O A;  4IOC Q;  3KXD A;  1VOM A;  2MB0 B;  2A3J A;  3IXQ A;  5L9X A;  1LQ9 A;  4FS2 A;  2J6T A;  4X2B A;  1HQ2 A;  3K17 A;  3NNH A;  1Y3J A;  4EK2 A;  3TEG A;  3TUJ C;  4YB1 P;  1AUD A;  4OMF G;  2CAJ A;  4ICL A;  1SL2 A;  5KG2 A;  2XY5 A;  3MMA A;  4LF5 F;  3LP1 A;  4X4N A;  3W63 A;  4PZV A;  4I7F B;  3FZ2 A;  4WTY A;  5T14 A;  4MFB B;  1PGZ A;  2OAU A;  2V8G A;  5J1E A;  1CJU B;  3M05 A;  4NCG A;  2R3V A;  1S79 A;  4ZK7 M;  2R7Q A;  2J0S D;  1EQ0 A;  2YVS A;  3QLH A;  3OLA A;  4NZ7 A;  4F4X A;  3C16 B;  1N88 A;  2JLF A;  2CPI A;  3DRR A;  3JYT B;  3PX4 A;  2EFV A;  3LAK A;  4U9R A;  2GVZ B;  1HI0 P;  1QAJ A;  3Q8U A;  1GAO A;  1WC4 A;  3TO8 A;  1Q5V A;  1UEV A;  1U25 A;  3WZ0 A;  1VHF A;  1N5Y B;  2MQ8 A;  4DV4 F;  3UFC X;  3NY0 A;  4PWU A;  2QEX S;  4C8N A;  2IJR A;  3KLG B;  3FZB A;  4MMO A;  4YUD A;  2PO4 A;  4L76 A;  4CWB A;  3I55 S;  8ATC B;  4GC6 A;  2DPI A;  3MI7 X;  5JVG Q;  2B0G A;  2PFD A;  3QIP B;  1V5I B;  5C2C A;  5GAE I;  4LF1 A;  2YXL A;  3OR2 A;  5IV3 A;  4C8O A;  5I42 B;  3BR9 A;  3GQC A;  5GAH I;  2PI4 A;  4NLS A;  1RB0 A;  2L08 A;  4I67 A;  4RUA A;  1NK6 A;  1RAF B;  1VQ8 S;  2QMX A;  3AH6 A;  2R7R A;  1M5O C;  3P8B B;  3FMB A;  2DVI A;  2MQQ A;  3FC9 A;  3W9H A;  4DPO A;  2HHW A;  3D68 A;  5AT1 B;  2AEM A;  2WON B;  1S1U A;  1FRX A;  2JEF A;  1FDB A;  2G0I A;  1WG4 A;  2YNF B;  1HNW F;  1IQZ A;  3OTC A;  1UVJ A;  3KMQ A;  3QRP A;  4XK8 C;  2CIM A;  1LWC B;  4OHZ A;  3PR4 A;  3W3S A;  4EMD A;  5I3Q A;  1I94 F;  3HVA A;  1P9Y A;  5HRO A;  3TQ1 A;  1FCA A;  5LSR A;  5A2Q U;  2Y1R I;  2VG7 B;  4JI2 F;  2W7P A;  3NCR A;  4ZPV R;  1HWI A;  2J9D A;  5F9L A;  1YRX A;  2MSS A;  4I2Q B;  4FS1 A;  1XNR J;  3OTB A;  2IM3 A;  3D1H A;  4RW9 A;  4ED2 A;  3V6K A;  1UP1 A;  1YI2 S;  1VQL S;  3R5A A;  3BSO A;  1SUQ A;  4A8F A;  1KTV A;  1EKR A;  2R7S A;  1TUV A;  3UNY A;  1U0H A;  2ZKT A;  3VAJ A;  4AL7 A;  3NOG A;  2IRY A;  1PJ7 A;  3M1V A;  1X9W A;  4IG0 A;  2HQI A;  2LU1 A;  4N41 A;  2C22 A;  1MMD A;  2J8A A;  2V50 A;  3GFY A;  4GRS A;  4R8U A;  4NLO A;  2G1H A;  2AJQ A;  2DGW A;  3HHL A;  2MKJ A;  4DWI A;  5F41 A;  3JB9 k;  1UVN A;  1LV5 A;  1J5E F;  2QO3 A;  5IWA J;  2XB2 D;  2HHT A;  4FBT A;  4IQM A;  4EYI B;  2AYM A;  2JEG A;  4QYZ K;  2GQQ A;  2AX0 A;  4DL2 A;  1FK9 A;  4ETX A;  2VG6 B;  3DRY A;  4P71 A;  1RAI B;  3HSG A;  2RIJ A;  3TWZ A;  2DNL A;  2VU5 A;  2MZS A;  3CTR A;  4F0K A;  1F1B B;  1PYO B;  4C3K A;  4USU A;  1FJG F;  3CD7 A;  1K1Q A;  4LF6 J;  1RA6 A;  3L7P A;  2HBR B;  2LCW A;  4KO0 A;  3OTO F;  1R0A B;  1B7Y B;  5D3G B;  3JQK A;  1UWA A;  1JNZ B;  2IVY A;  2YX4 A;  4K5R A;  2MLZ A;  1OQ6 A;  3ETM A;  4I64 A;  4N5S A;  3GIR A;  3TAN A;  4DV6 F;  4DV7 J;  4QQB A;  1V5V A;  2AJF E;  2C2K B;  3KTQ A;  4L72 B;  4C48 A;  1R8C A;  3I31 A;  2DHS A;  4FXV A;  5KFF A;  4FF3 A;  5HMW A;  2ZKU A;  2VIC A;  3SFG A;  3V2U C;  1EHW A;  3D4J A;  1V3S A;  1UW4 A;  2CPF A;  2VFU A;  2VH7 A;  3FSY A;  3IG1 A;  4OJ1 A;  2IC3 A;  3D5M A;  3ZNU A;  3KLH B;  2RS2 A;  3QGI A;  1RWK B;  3EXY A;  5KG1 A;  4DV1 F;  4WP9 A;  4P7T A;  4QIE A;  5ETQ A;  4OI3 A;  4KB7 A;  2LA4 A;  2VDI A;  4F67 A;  2WB4 A;  1MRO A;  3G6V A;  5DJB A;  1QAY A;  3G82 B;  4JI6 F;  3DLK B;  2GIF A;  1RQ0 A;  2ZH2 A;  2E1C A;  2UVV A;  4G3I A;  2OTJ S;  2KB2 A;  4OZ0 A;  2VC0 A;  4WE1 A;  2Z8Q A;  4LBH A;  1RSC A;  3IMQ J;  3CCV S;  3OJS A;  2ZHB A;  3FEY B;  5G4D A;  2VD3 A;  4DV5 F;  5C7P A;  2RQM A;  4Y2M A;  2QN6 B;  2DEJ A;  3C3L A;  1BQX A;  3HKZ D;  1Y4Z B;  2QLB B;  1LNQ A;  1O51 A;  3QPI A;  4HH0 A;  2C28 A;  1IKY A;  2H51 B;  1UZD A;  1VRU B;  1ZPW X;  2OPQ A;  2D9P A;  1TKT A;  4P74 A;  2YBV A;  3M32 A;  3BSC A;  5I3U B;  2RD5 C;  4B9M A;  2V69 A;  2XWX A;  1NK0 A;  1F9H A;  3CJK B;  4YY3 J;  1R8B A;  3ULH A;  4Z7C A;  4QOT A;  3MEE B;  3LGN A;  4J9U E;  5HSP A;  2B3T B;  4ZPB A;  4IDK A;  2DBB A;  1S49 A;  3O8W A;  4KR0 B;  4CO1 A;  2CJ9 A;  4IYQ A;  4K4V A;  3IR7 B;  5IC4 B;  3T9Z A;  3US5 A;  3FBB A;  5DO2 A;  4KSE B;  1N48 A;  2D3Z A;  3QGG A;  4BDP A;  1IQT A;  2V0N A;  4WXW A;  1XER A;  2ROE A;  3MM6 B;  2XMM A;  3MTK A;  3OL6 A;  3V6D B;  4R25 A;  3IWX A;  4CLW A;  1U47 A;  4X66 J;  2AGQ A;  4KHR A;  3FFI A;  3TUP A;  1F3F A;  2W4C A;  3KK1 A;  2HBZ B;  1IKY B;  1VRU A;  4W90 B;  4DU7 A;  2CPH A;  3ET6 A;  3GCX P;  1TL3 A;  3CD6 S;  5ITH A;  1PSD A;  2IMO A;  4DQP A;  4LF7 F;  1XN9 A;  3CWJ A;  1RT6 A;  2BAN B;  2D3U A;  3A3P B;  3DXS X;  4DJB A;  3CJS A;  2OMO A;  2RH3 A;  4B08 A;  3EPI A;  3GYX B;  1DTT A;  4F4A A;  1UKU A;  1R89 A;  2JJ4 D;  3MM5 A;  2O67 A;  2AJ2 A;  2M8H A;  3LPE A;  2C2N A;  3LGH A;  4CT8 A;  2GHW A;  5HAT A;  4L3N A;  5M2P A;  1ZZF A;  3AXK A;  2YNH A;  1WI8 A;  4X62 J;  2HBQ B;  3PZP A;  5F8M A;  1HMV B;  1KON A;  3KLH A;  1U0H B;  2N7C A;  3PJW A;  2FPH X;  1RKJ A;  3H5X A;  3L4B C;  1N5S A;  1RWV B;  2AMC B;  3M8P B;  3NXZ A;  3POT B;  2CQH A;  3QRQ A;  4ZN3 A;  1B0V A;  5GVQ A;  4B9V A;  2RSQ A;  3IGV A;  1KN6 A;  3FUY A;  2OIH A;  1UZH A;  4ILM A;  2NXJ A;  1YSJ A;  1FO1 A;  2A10 A;  4LRB A;  2F8M A;  3VV2 B;  5KFP A;  1NKC A;  1KQF B;  4V1A k;  3J81 j;  1GMU A;  3W2W B;  4ZVR B;  2HHV A;  1X9S A;  2WON A;  4KC5 A;  2FHK A;  1RE1 B;  2WVF A;  1JIH A;  1H98 A;  1RIS A;  2CPX A;  3HHE A;  1BMQ B;  4OJH A;  3V81 B;  2CQP A;  1K0V A;  1G2E A;  1FX4 A;  3FRY A;  1N5T A;  4ID8 A;  5GMD A;  5KFI A;  1CEZ A;  2GGP B;  1WTF A;  2GVD B;  4WZQ A;  1UVK A;  2RDD A;  4ZP9 A;  3TZX A;  4DR3 F;  1Q78 A;  2IBK A;  2Q3P A;  3LOU A;  3TA0 A;  5BYR A;  2MQL A;  3N5B A;  3GMG A;  2F3J A;  1BC6 A;  4NWB A;  1S6O A;  1NZA A;  2ZHO A;  2YH1 A;  1QAI A;  2OP5 A;  3NCQ A;  4OLP A;  4DQQ A;  4DL3 A;  1HQE B;  1LW2 B;  3OBI A;  4DCP B;  1O5J A;  3C66 A;  4USK A;  1SIZ A;  5SZT A;  4IH6 A;  4F3M A;  5I4M A;  4ECT A;  1AZS A;  1YWX A;  1YZ6 A;  3AJD A;  2FY1 A;  4ZPD A;  1RWU A;  2B7B B;  2OHD A;  1RI7 A;  4Q0B B;  1LKZ A;  1JLB B;  2KVI A;  4U8V A;  5KFN A;  4ZPT R;  3POT A;  2DGQ A;  3K59 A;  2XWY A;  1S57 A;  3VR1 A;  3CCQ S;  2NSB A;  2XMV A;  3C16 A;  4I4B A;  4DDF A;  3PIP Q;  4KGZ B;  3CD0 A;  4TN2 A;  4AL6 A;  5J1E B;  2QFI A;  1TAU A;  4OHW A;  4UQT A;  3HVT B;  1S4F A;  2R8J A;  1TL1 A;  1GEH A;  3A12 A;  2H3E B;  2DIT A;  2RKI B;  2V2Q A;  3GFX A;  3OFE A;  1YTY A;  5A8W A;  2BQU A;  1UEK A;  1VBY A;  5H9F K;  4DX5 A;  4CLY A;  2N3L A;  4NAS A;  3G6Y A;  2D3O 1;  4WU3 A;  2GV1 A;  2HWI A;  1RWX B;  5CH7 B;  1N0U A;  4JI1 J;  2MZT A;  2F5G A;  3BH7 B;  2ZZM A;  3LAM A;  1U2C A;  5H9E K;  3UDC A;  5A8R A;  4CZC A;  3G6X A;  1VMB A;  2ILZ A;  1TL3 B;  2W01 A;  4MYU A;  1N32 J;  4QU7 A;  3L95 X;  3I6P A;  2UZA A;  3SIP B;  5DLG A;  1NJW A;  2MQM A;  2DNO A;  4KY3 A;  4KT0 C;  2AGP A;  3OJU A;  2AHO B;  4AYB D;  4QPT A;  2R8I A;  3G8Q A;  4DLG A;  1HD1 A;  2UU9 J;  4URS A;  3HXM A;  3WX8 A;  2DH7 A;  1SI9 A;  2RKI A;  5E3P A;  2QMW A;  5LXR A;  4TQS A;  2FVQ A;  4CLS A;  2R8G A;  2XLK A;  1VC5 A;  2Y8Y A;  1TU0 B;  1U1M A;  4PRF A;  2LQ8 A;  2QMU B;  2DT9 A;  2C42 A;  2VBY A;  2DNN A;  3WIV A;  3OL9 A;  1HKA A;  5KFS A;  1O8B A;  4IFY B;  2UXD J;  2JEJ A;  4OHV A;  5KFC A;  3D0G E;  4KPC A;  3GCW P;  7AT1 B;  2GMJ A;  5B7W A;  3FEZ A;  2F8E X;  4DV7 F;  1Q86 T;  1CS4 B;  4FDF A;  5T41 A;  3DGP B;  5KG5 A;  2VAS A;  1NHK L;  2BJ1 A;  2WAQ D;  4YOE A;  4AT1 B;  1NSK L;  4C0O C;  1NU4 A;  1D8Z A;  3A3N B;  1MU2 B;  2WTF A;  2DXF A;  4K4Z A;  4OHY A;  3DLL Q;  2N7Y A;  3BBB A;  2FVS A;  3VGV A;  4O3N A;  2W9B A;  1KHW A;  1H74 A;  1VS3 A;  2YNI B;  3EGN A;  3VAG A;  3OLB A;  1C0U A;  4ELV A;  2E9Z A;  1TKZ B;  1KR4 A;  1NND A;  1SKU B;  2C3P A;  3BSA A;  3UI3 A;  5L1I A;  5J2P A;  3AD7 C;  2UV8 G;  3KDO A;  1OWX A;  2HND A;  3ENW A;  3MED A;  4HTI A;  4C8M A;  1RAD B;  3HCX A;  2XMJ A;  5A6W A;  1S0O A;  4IR1 A;  2YKO A;  4F4K A;  3ILI A;  1PJ5 A;  4KBI A;  3H4D A;  1WUU A;  3TQE A;  5DZ7 A;  1HNV B;  3ILO A;  2VOD A;  3W8G A;  3BBF A;  2EI5 A;  4NE9 C;  1LEO A;  1SV5 B;  1RBL A;  4BC9 A;  2DNH A;  4J9R A;  1U6Z A;  1TVR A;  3ZTP A;  4ED3 A;  3T5H A;  2AYB A;  2E5J A;  3W9I A;  1HNX F;  2DR8 A;  4UUW A;  2F9J A;  5D3G A;  2EBG A;  1TAQ A;  5HN0 A;  3TZY A;  1U1O A;  5CXT A;  4RNM A;  1ACM B;  3OL8 A;  2OLW A;  4JI7 J;  1KLN A;  3JSY A;  2VBW A;  3R97 A;  3NWG A;  4FPR A;  3W62 A;  2YWF A;  4Y2I A;  2HHU A;  3MMJ A;  5KFY A;  4ELU A;  2X1F A;  3DC2 A;  3IC1 A;  2E5H A;  1YDL A;  2V8P A;  2M2B A;  2VG6 A;  3CDE A;  3GJQ B;  4DS5 A;  5EX3 A;  3I87 A;  4JBC A;  3CCS S;  3KLE B;  4ENO A;  3LP1 B;  4QR2 A;  3IRX B;  1HNZ J;  4RNO A;  2NSC A;  1I5O B;  3GSD A;  3VAH A;  2A2D A;  2QJ3 A;  4WIQ A;  3MM5 B;  4X4S A;  3EZ5 A;  5A8W B;  5F8I A;  2CJB A;  4Z37 A;  3CUL A;  1RHK B;  1X5T A;  3I5C A;  4DZ6 A;  3BGF A;  2CJK A;  4B3M J;  3AB4 B;  4HI2 A;  4J9M A;  3OV7 A;  2XI2 A;  5EWE A;  2IMW P;  1GX5 A;  4J9O A;  4IG0 B;  4NZ0 A;  4DS4 A;  2F4V F;  3MUR P;  2I5J A;  3HD2 A;  1FRL A;  1N5Q A;  4B3T F;  2KDO A;  1AB8 A;  4C98 A;  4DR6 J;  2FB0 A;  2JSX A;  3OSP A;  1JLQ A;  2BR0 A;  4AQY F;  1OO0 B;  2K8G A;  3BGU A;  4I6A A;  2BOP A;  3K57 A;  1QVF R;  4Q0B A;  1H2T Z;  1GTE A;  4RW4 A;  2E7X A;  3L7O A;  4OZJ A;  2CFX A;  4CYU B;  4ALZ A;  4LF6 F;  2V5H G;  4H4K A;  3PW2 A;  4X66 F;  1NK9 A;  1DZ5 A;  3CDW A;  4K7Q A;  1N56 A;  4K8R A;  3Q24 A;  4RW8 B;  1TV6 A;  4MTP A;  2U1A A;  2I2Y A;  2LKZ A;  4DCJ B;  4ZVT B;  4W98 A;  2QIF A;  1F2G A;  1WSV A;  5I3P A;  2IDL A;  2MZJ A;  1FFG B;  3R7S B;  1KFS A;  2FYX A;  5KFE A;  3KG0 A;  1TL4 A;  2ZJQ Q;  2WRM A;  2ATL A;  2KG0 A;  1LK7 A;  1HIY A;  2J7W A;  5C2G A;  1U1P A;  5LSL A;  4JP8 A;  3NKY A;  4C97 A;  5F3Z A;  3M9O B;  1KNZ A;  1YQH A;  3ELH A;  3BGO P;  3RTV A;  1UJ4 A;  2YWE A;  3PRB A;  4NA2 A;  4NYO A;  1JJ2 R;  2HFZ A;  4H4K C;  3R6G B;  2ZC3 A;  4OX9 J;  2MKH A;  3EUN A;  4MKA A;  1HWL A;  4IH5 A;  3ZZZ A;  2FJV A;  4DR5 J;  5KFU A;  3MPV A;  4LSN A;  3ZFV A;  5ETP A;  5C24 B;  4L74 A;  5IV4 A;  4C8K A;  3BR8 A;  1X9M A;  2Q6C A;  3KLI A;  5SUH A;  2O5D A;  1SL1 A;  1N34 J;  2V4R A;  2V8H A;  4N47 A;  5EN1 A;  4QIF A;  2ZZN A;  4TNO A;  1WC0 A;  3PHT A;  2PI5 A;  2UXD F;  1NEE A;  1XIQ A;  1G1X A;  2X3G A;  3G82 A;  4TKT A;  5HK4 A;  1WEL A;  2J7K A;  2NS1 B;  4HT5 A;  2XBP A;  4J5O A;  3TOQ A;  1FF2 A;  3UD4 P;  1YHQ S;  2WOM A;  4HL9 A;  1R8P A;  3SMZ A;  3DU5 A;  4FYX B;  3HFK A;  4U67 Q;  1HMV A;  4XPE A;  5CD4 A;  4J9P A;  3UVJ A;  2ROG A;  3EE3 A;  3L3C A;  5D0G A;  3THV A;  2CQG A;  2HVD A;  3A8J A;  2YNH B;  1RT3 B;  2H9Z A;  4QZV B;  4ZLL A;  1I6J A;  2HIQ A;  4BCA A;  4TYB A;  2H5J B;  2HIY A;  3K8V A;  4OX9 F;  2DIV A;  1JXL A;  4NA3 A;  2J0Q D;  3BRE A;  2HNY B;  2C2O B;  2RIL A;  4JV0 A;  1IWG A;  2BVZ A;  1RAB B;  3DM2 A;  5A0Y B;  2AX1 A;  1S76 D;  3CDA A;  3OHB A;  3CJ8 A;  4FNI A;  1IWA A;  1SQF A;  4ED1 A;  2CQD A;  5K9F A;  2R9L A;  3QSY B;  3BSN A;  5C25 A;  1E6Y B;  1VRT B;  1BQM B;  2ZH5 A;  4DL4 A;  2GVD A;  2X1A A;  2KFN A;  2FLL A;  2B5J A;  2O3D A;  3A3O B;  2VQF F;  2GAH C;  3L09 A;  1CVJ A;  2VBX A;  1R27 B;  2ACY A;  5CAB A;  2IJF A;  3HSJ A;  3THP A;  4DCO B;  4R5P B;  2GX8 A;  2DXD A;  2GMH A;  3D1O A;  2IRU A;  1HBO B;  2J0X A;  2WSF C;  2Z58 B;  1HHT P;  3MUV P;  1IBK F;  1F5C A;  2BKO A;  2WZ1 A;  1TV6 B;  1S48 A;  8RUC A;  3RBD A;  4HLB A;  1NKB A;  2DGX A;  1L3V A;  3RB3 A;  1SKS A;  1DJ0 A;  3QWU A;  1OIA A;  5F8N A;  3HSD A;  4JV2 A;  3UO0 A;  4K0K F;  3MMC A;  4P10 A;  3MF5 A;  2GC8 A;  5HJY A;  4KYZ A;  2XS2 A;  2E1R A;  4RW9 B;  1CJK A;  1QTN B;  4TVA B;  5E3Q A;  2VA2 A;  1S97 A;  1CLF A;  1XMQ F;  1WOP A;  1QVG R;  1FI4 A;  4WJB A;  2Z57 B;  2MYF A;  1EET B;  2V68 A;  2XYH B;  1WF0 A;  3FQK A;  1A6L A;  3FVY A;  3BN7 A;  4LRE A;  4XAK A;  2J9C A;  4YHH J;  2EKY A;  1N33 J;  2EK1 A;  2XSJ A;  4NMX A;  2H5E A;  3T1A A;  5KG3 A;  4MFB A;  3UDE A;  5IT4 A;  4F25 A;  2DB1 A;  2F63 A;  1WSR A;  1ZA2 B;  2K7J A;  2PEB A;  2GHP A;  4J9Q A;  2PII A;  3SCL E;  3R5D A;  5L46 A;  1HYS B;  1ARO P;  1EP4 A;  2I5J B;  1FXL A;  1VHI A;  2PMZ D;  4GMK A;  3DXB A;  3SDE B;  3W65 A;  5KFM A;  4F2S A;  1GMW D;  1C1C A;  4H4O A;  4IO9 Q;  3ZZU A;  5JJB A;  5JUM A;  2O66 A;  3F73 A;  3LTO A;  2R7X A;  3PYG A;  2IA0 A;  4P52 A;  1YJ7 A;  3UD3 P;  1RHM B;  3I5A A;  5F8J A;  4RZR A;  2WVD A;  1RTI A;  4DOZ A;  2N4D A;  1Q0N A;  4DXL A;  2HHQ A;  1ITP A;  1NK7 A;  4O23 A;  4OZ2 A;  5KFK A;  3FDS A;  2BE7 D;  3DDK A;  1S59 A;  3EMT A;  1FRM A;  4Q2L A;  3S1T A;  5MAO A;  4OI0 A;  4USH A;  4FVC A;  2PE8 A;  1UJ5 A;  3X3U A;  2CDR B;  4A8Q A;  5EX0 A;  4A8S A;  2D74 B;  3T3F A;  1VI7 A;  5DM7 Q;  1Q8I A;  4DLE A;  1ZM3 A;  2KN4 A;  1F60 B;  3MCM A;  3KG4 A;  3MHY A;  4J9S A;  1T95 A;  4UT4 A;  1DAX A;  1DTQ A;  1W7W A;  2IAJ B;  3QO9 A;  3TAM A;  2YKM B;  1HBN B;  3H59 A;  2CNK B;  1FEH A;  3MED B;  4CDI A;  2POK A;  3DLE A;  5LMN F;  2OPQ B;  5HVH A;  3CO9 A;  3G96 A;  3H2V E;  5F9N A;  4DQR A;  3H5Y A;  1XR7 A;  4Y65 A;  4XIU A;  3DOK A;  2NPF A;  4C8L A;  4ZP6 A;  5KOX A;  1TMM A;  1IVZ A;  4D3H A;  4B3R F;  2B9Y A;  1RCO B;  4DPT A;  2JH3 A;  3HM9 A;  2H5I B;  3CCE S;  3D9B A;  1RWP B;  4ILR A;  2I6W A;  4B17 A;  4E2F B;  3H40 A;  2X1G A;  2KH9 A;  2UUB F;  3RGI A;  3SDE A;  2MGZ A;  3SCJ E;  2QC3 A;  3NGK A;  8AT1 B;  1TKZ A;  4DR1 J;  4H4M A;  2JWN A;  1VQO S;  1R31 A;  2DKO B;  2OO4 A;  1DBD A;  2QL7 B;  4LBI A;  4J9L A;  1KSP A;  3M2R A;  1N54 B;  1HBU A;  1SC3 B;  3QFH A;  5DDQ C;  3TX8 A;  1T9V A;  1TZ0 A;  1W26 A;  5D8H B;  1FNM A;  4CO2 A;  3ZZY A;  2KHD A;  3JTO A;  4WFA Q;  4MK9 A;  2BAB A;  3K5O A;  3UVJ B;  3JQJ A;  2AZ1 A;  5B0A A;  3H98 A;  5M2R A;  3SCK E;  1BWV A;  3MEG B;  3DGP A;  3P4U B;  2UXB J;  3DDI A;  3KMS A;  1IKW A;  5KFA A;  3AD8 C;  2X51 A;  1IR1 A;  1IJF B;  1VLY A;  3LP2 A;  2B8Q A;  2GZO A;  2QGF B;  3N6L A;  1RXO B;  1AXQ A;  5KT6 A;  1KQG B;  3MR3 A;  4UOH A;  1CC7 A;  2QLJ B;  5GAG U;  2KXN B;  3DI6 A;  3S01 A;  3QSI A;  4DN9 A;  4DR2 F;  3RB4 A;  1P6T A;  3ZNJ 1;  4EO6 A;  3J80 U;  2OGU A;  4Q8F A;  3LP0 B;  1Y7P A;  4WKR A;  2DHX A;  4HAC A;  3GE9 A;  3ZTQ A;  1QDU B;  5A2Q Y;  1RT2 B;  5KFH A;  4WPA A;  4ELT A;  3AA9 A;  1HWK A;  3CED A;  1YRT A;  2VG5 A;  3HKW A;  3QWP A;  4DL0 C;  2VJV A;  1ZH5 A;  4GKK F;  2LQB A;  1RLD A;  3T6B A;  1G7C B;  2HK3 A;  3KK3 A;  3T5L A;  4LFA F;  1BUX A;  4OV1 A;  1BWE A;  2M70 A;  1QD1 A;  2Z30 B;  3N9U C;  4CLU A;  4FF4 A;  1T7P A;  3PR5 B;  5CYQ B;  3DYA A;  4K4T A;  1W2B R;  2G0C A;  1IBL F;  2B9X A;  2N4C A;  3RRK A;  3Q2T C;  1MMN A;  3J7Y I;  3CME S;  2JZ5 A;  1M5S A;  2E7V A;  4URG A;  3M9N B;  1S1W B;  4YR3 A;  4ZLJ A;  5HL7 Q;  3KHH A;  2KFY A;  3BPD A;  2AU0 A;  2C2M B;  4FYD A;  3RB0 A;  3SZ2 A;  1FHT A;  2KL8 A;  3ZTR A;  3PJ9 A;  1XMQ J;  2C3O A;  2FHJ A;  2I1R A;  1LFW A;  1YVF A;  4ICL B;  4WU2 A;  4ECS A;  4JV5 F;  4V19 J;  4FXD A;  2YKP A;  1IN0 A;  1GX6 A;  4MJK A;  2C2R A;  2JFD A;  2Q79 A;  4K0K J;  3L7U A;  3CMQ A;  5KFD A;  3HFZ B;  3K5M A;  1BY9 A;  2HZA A;  1IBM F;  4LF9 J;  2UXB F;  3RW6 A;  3H25 A;  2YQ3 A;  5CYQ A;  5FII A;  3ZZP A;  1QSL A;  1JQG A;  1WOO A;  4X84 A;  2ZFH A;  4X4V A;  3I9V 9;  4J9K A;  1NUE A;  3QJP A;  1WOR A;  5HMX A;  3I56 S;  3TJ8 A;  2HNZ B;  1B70 B;  2BEF A;  4DFM A;  4CTA A;  4M63 A;  4RWX A;  3CCT A;  4PG6 A;  4B3S F;  4LF4 F;  1RHQ B;  2XYG B;  1YJT A;  3MM7 A;  4F7V A;  2OPR B;  1RTD B;  3A4T A;  2YKN A;  1JK9 B;  1T8E A;  2R7U A;  1FKO B;  2DGS A;  2W24 A;  3QO9 B;  1EET A;  2RVJ A;  3PKY A;  1FRK A;  1WG1 A;  2D3O R;  4ZVF A;  3BGR B;  1CG2 A;  2BE2 B;  5F8G A;  4LFC J;  5DZ6 A;  1UFL A;  5KFO A;  1CJK B;  1W25 A;  4DMZ A;  4YR0 A;  1VQP S;  2AQ4 A;  3G8T A;  2HHH J;  1PBU A;  3M30 B;  4QIV A;  2HVE A;  4YME A;  1S12 A;  1KBR A;  5BYS A;  3EDQ B;  1ZM2 A;  1U2F A;  2I0X A;  2F4V J;  3M30 A;  1S6Q B;  4LF9 F;  4W4M A;  1WC3 A;  2DNR A;  5KOW A;  3KLF A;  2ASD A;  3MAQ A;  1QUV A;  2MKC A;  1UAW A;  2BKN A;  1O0P A;  1HW8 A;  3BN4 A;  3GG0 A;  3H20 A;  3GIL A;  3K5N A;  3OUY B;  4CNY A;  5FDL B;  5K14 B;  2YNG B;  3ZTS A;  2XG8 A;  2XEX A;  4DR4 F;  2YKN B;  3QAU A;  1KOO A;  4CM0 A;  3OVA A;  2OSR A;  4NLP A;  2WCX A;  1FWP A;  1SJ1 A;  3ETO A;  1JLC A;  3I5B A;  4F36 A;  2YPZ A;  4KFB A;  1JLQ B;  1I1G A;  1WF1 A;  3H90 A;  2HLU A;  1HYS A;  1RAJ A;  1YJU A;  3F41 A;  3CC7 S;  4KFB B;  2W9B B;  1HWU A;  1OQ3 A;  4KRW A;  1K9M T;  2MY7 A;  3VHQ A;  4F4Z A;  1XNQ J;  5DM6 Q;  1GTH A;  4JI0 F;  2FD2 A;  3PDN A;  4UW2 A;  1V9O A;  1MWQ A;  1L3K A;  4PXC A;  2ADC A;  5F8L A;  1FE4 A;  5L39 A;  2DRB A;  2VFR A;  2K1R B;  4HYK A;  2IRX A;  4LIW A;  4XDC A;  2FGC A;  2FY8 A;  2DR7 A;  1GK8 A;  2AJ1 A;  1VGY A;  3MFI A;  2VJU A;  3GIJ A;  3V6D A;  3VF0 B;  2J9D E;  1VJQ A;  1URR A;  1R43 A;  5LJ3 Y;  3BQ0 A;  2LQJ A;  2M5Y A;  5A8K B;  2FIU A;  4KTQ A;  4G1P A;  3UR0 A;  2ABY A;  5B08 A;  3DDN A;  2WBR A;  4G6V B;  3GPA A;  3DRP B;  3K5L A;  2LEB A;  1RGV A;  2BE2 A;  4OYB A;  5J2Q B;  2YWH A;  3EDR B;  5A8K A;  1REG X;  2U2F A;  2AP6 A;  4RO0 A;  1UA1 A;  2V63 A;  5HVG A;  4OZ3 A;  1RTD A;  1TVR B;  3EVO A;  3J81 U;  4IQX A;  4X64 F;  4X65 J;  2JRS A;  1XK8 A;  2QLF B;  4F0H A;  4X4Q A;  4DV2 J;  1I51 B;  2HGM A;  2CKW A;  2BBE A;  3T5J A;  2LDY A;  3OL7 A;  4O3O A;  1UPP A;  3R27 A;  1C0T B;  3FBF A;  1BE4 A;  2AJ4 A;  1L3U A;  5IQQ A;  3PY8 A;  3O1L A;  4DV0 F;  4NML A;  2DPJ A;  2W2M P;  5EHH A;  3G6E S;  3F0N A;  1FD8 A;  2HMI B;  2M8D B;  4LR8 A;  1Y5I B;  1SIW B;  1SH0 A;  2CUY A;  3VZI A;  2MQO A;  2WVE A;  2K06 A;  2VFT A;  2EFQ A;  4EGL A; 
#chains in the Genus database with same CATH homology
 3OTO J;  3T1Y J;  5FLX U;  4DR4 J;  4JV5 J;  4DV1 J;  3R2D J;  4GKK J;  2MQ8 A;  4K0K J;  3JAM U;  4JI1 J;  4YY3 J;  4B3T J;  2E5L J;  4LF9 J;  1XMO J;  1N36 J;  1N32 J;  4KY3 A;  4NEZ A;  2UXC J;  5LMU J;  1IBM J;  4RJV A;  2UUB J;  2UU9 J;  4DV6 J;  4DR3 J;  1HNX J;  4X66 J;  4JI4 J;  4OX9 J;  4JYA J;  4LF5 J;  4LFC J;  4NXM J;  4DR5 J;  5BR8 J;  1N34 J;  2HHH J;  4JI0 J;  5A2Q U;  2UXD J;  4JI5 J;  4DR2 J;  1XNR J;  2F4V J;  4JI2 J;  4NXN J;  4DV5 J;  3D3B J;  4KHP J;  3D3C J;  4DV4 J;  2VQF J;  4X62 J;  1I94 J;  4LFA J;  3J7A N;  2ZM6 J;  4DR1 J;  2MTL A;  4DV3 J;  4PWW A;  4DUY J;  4DR7 J;  4AQY J;  1IBK J;  5IWA J;  1J5E J;  1XNQ J;  4DV0 J;  2VQE J;  2UUC J;  5LM7 E;  2UUA J;  3T1H J;  3W1Y C;  4JI8 J;  2UXB J;  5AJ3 J;  4V1A k;  1FJG J;  4LF7 J;  4LF6 J;  4B3R J;  4DV7 J;  4JI7 J;  3J80 U;  4HHU A;  1HR0 J;  4JI6 J;  2KVQ E;  1IBL J;  1HNW J;  3J81 U;  4X65 J;  3R2C J;  1HNZ J;  4DV2 J;  4KYZ A;  4DUZ J;  4JI3 J;  4LFB J;  5IT9 U;  4LF8 J;  4B3S J;  4LF4 J;  4B3M J;  2MEW A;  4X64 J;  3IMQ J;  4NEY A;  4YHH J;  1N33 J;  4GKJ J;  4DR6 J;  5LMN J;  2KL8 A;  1XMQ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...