4JV5J

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4jv5J00
1XNQJ 1HNZJ 4DV4J 1I94J 1J5EJ 1N34J 4X65J 4JI8J 3J81U 2F4VJ 4DR6J 4DV6J 2MTLA 4JI1J 3JAMU 1IBMJ 4X66J 3T1HJ 1IBLJ 4JI7J 5LMUJ 2VQEJ 4LFCJ 4DV3J 3W1YC 2UUCJ 4LF4J 5AJ3J 4DUYJ 4K0KJ 4JI3J 3T1YJ 1N33J 4DV2J 4JV5J 4GKKJ 4B3TJ 4LF9J 2UU9J 5A2QU 4B3RJ 3R2DJ 2UXDJ 4DR3J 5IWAJ 4HHUA 3D3BJ 4X62J 2UUAJ 4JI5J 4LFBJ 4KHPJ 3D3CJ 3IMQJ 1XMQJ 4YY3J 5LM7E 4LFAJ 4AQYJ 2ZM6J 4RJVA 4DV7J 2MQ8A 4X64J 4DUZJ 3J80U 2UXBJ 4DV5J 2MEWA 4DR5J 3OTOJ 4LF7J 1HNWJ 2KVQE 4LF5J 5BR8J 4DR1J 4KYZA 4OX9J 5FLXU 2UUBJ 2VQFJ 4PWWA 4YHHJ 1XNRJ 5LMNJ 4JI2J 1FJGJ 2HHHJ 1XMOJ 2KL8A 1IBKJ 2E5LJ 4JI6J 5IT9U 4DR4J 4NEYA 4NXNJ 4GKJJ 1HR0J 4LF6J 4DR2J 4DV1J 1HNXJ 4KY3A 4V1Ak 4JI4J 3R2CJ 4DR7J 4NEZA 4DV0J 4B3MJ 3J7AN 4JYAJ 4NXMJ 4LF8J 4B3SJ 1N36J 4JI0J 2UXCJ 1N32J
chains in the Genus database with same CATH superfamily
1T9XA 1T9YA 1JIHA 3MM7A 2FLPA 4HACB 2EVZA 1NEEA 4ECTA 4WZMA 4CH0S 5CYMB 1MMNA 1BE4A 2C22A 1XIQA 5D78A 3CJ8A 3F73A 4K59A 3K8VA 5D77A 3IRWP 3WIUA 4YHHF 5HBMB 4M5NA 3DRSA 3T5HA 3LO3A 4CT8A 2BBEA 1LK5A 2DISA 5ETLA 1RADB 4OMFG 2FVRA 1IKWA 1RAGB 2EC0A 2CPXA 4P7VA 3MAHA 2ZM6J 4HACA 1R6VA 2EKNA 3QAEA 5CYMA 3NRBA 3HZGA 4RWWA 1TK0A 3VVUA 2YNFA 5HBMA 5DRKA 4RZRA 1S97A 2OEMA 2XY7A 1LQ9A 4FVMA 1ZAVA 2YWGA 3K57A 1Q81T 2JSXA 5JVHQ 4Y28C 3V6KA 3V5RA 3O2IA 2D41A 3IFEA 4BHQA 2EI5A 2KB2A 4L74A 1FE4A 2FVPA 2KYXA 2DJWA 2LYVA 4YUDA 3VGTA 2HBRB 4PR6A 3T3FA 4NPOA 4PPDA 3GILA 5FJ4A 2W7OA 3N4WA 5FLXY 1PJ7A 1PILA 1WWHA 3I0SB 2BM1A 4QYZJ 1GX6A 3MR5A 5HQLA 2W9BB 2HHWA 1HBMB 1NJYA 4NRTA 2CNNB 4I7FB 1JXVA 2UUAJ 1FTCA 1XMQJ 2MQPA 2D3ZA 1T9VA 1N5VA 1OSCA 3D6FB 3I5AA 2J0WA 5DLGA 3I0SA 1DZ5A 3UDCA 1SH2A 3FDSA 4AXJA 1RT3A 4TYBA 1YGYA 2OFHX 4OYOA 2RS2A 1ITPA 3TZXA 1HBMA 2XC9A 4CRJA 5CHCB 2QRRA 2RHQB 1XMQF 1T94A 3QNWB 4DR2J 2MKJA 2DR7A 3GONA 3CMES 3OVBA 1YG0A 4J9OA 5HI7A 1QUPA 2ZOMA 3G6YA 1FRXA 2V63A 4AL7A 3G9CA 2Q6CA 3KK1B 4IFVB 2NCKL 2BUNA 2I6WA 1RWPB 3MCSA 1HWLA 3OW2R 2YQ1A 1Q0NA 1FRJA 3ZFVA 1ZM3A 3ZTQA 2N4DA 4WFNQ 3KDOA 1RHJB 4ZVQB 4EZ6A 3IS9A 3OL6A 1U6ZA 4H4MB 1WC3A 4Z2XA 3RB4A 2HURA 4MMOA 2BEFA 4F4XA 3S8SA 2G1DA 4IFVA 3PHTA 3D3CJ 1FE0A 1KWMA 2QC3A 1NHKL 3A3NB 2AT1B 2UVVA 3D6MB 1X4CA 1ZAXA 1VLYA 1SKSA 3RJMB 1RU2A 1Z2ZA 3KMQA 4FDFA 2J0XA 2BE9B 2XMWA 3GPAA 1ZA1B 2BJDA 1FFSB 2GCFA 3SFGA 4H4MA 4P74A 1WTFA 4YR0A 3JYTB 2BM0A 2DO0A 4QOTA 2CG8A 1VQPS 3IR7B 4JI4J 4N5SA 4DZ6A 5KT7A 3AFGA 4XO0A 1FO1A 3CUNA 2FJAB 1YTYA 4FF3A 2B5JB 4JI5F 1R0AB 3TA1A 5HMYA 1BWEA 1NKEA 2A0FB 1Q8IA 3LWLA 1NK4A 3JYTA 3T5LA 1FJEB 2VFSA 4JI4F 3K17A 3TARA 2CPIA 4DCOB 1FX4A 4X4VA 2RHSB 5BR8F 2FVCA 1HQ2A 1GXUA 3LAKA 4H4KC 1IM4A 3CDEA 4IRCA 2B5JA 4LF2A 4QR2A 1R0AA 3GFYA 3N5FA 3ZTOA 4C8KA 4L6V3 3PW7A 3AT1B 3ENAA 4DX6A 4JUZA 4X4RA 1RABB 2XULA 1KOHA 2PI5A 2DPIA 1S6UA 3ZZUA 1TKZB 2HAIA 1CQNA 1PSDA 5KFBA 3OVSA 3AB2B 1YLXA 2VBYA 1H74A 2YNIB 1QUVA 3AOBA 2JOQA 4RW6B 3GFHA 2QJ3A 2JC0A 3KNGA 1ZPVA 2JRSA 1J2VA 1TKZA 3GIKA 2E9TA 3UDVA 1RWWB 1NK6A 4Y2MA 4X4OA 3SSQA 2PEBA 5LT5A 4EEYA 2YNIA 2EFPA 4RW6A 5EGYA 3G8SA 1N4LA 4QIWD 3CCES 4IG0B 5F41A 4CLTA 4USUA 1VFJA 2MHEA 4WFAQ 2ILZA 2KJVA 4ZVEA 1H38A 1S1UB 3GYGA 4O3NA 3EICA 1VQNS 1TKTB 3GZ7A 2JFDA 2D3O1 2J0SD 5C7PA 1RTIA 4LRCA 2QL7B 1K44A 4RUAA 2QA1A 3C6TB 3UVJB 3PKYA 3EGWB 3QT8A 4NYPA 1KN6A 1EKSA 1M5SA 4IG0A 2VONA 1M1HA 3NXZA 4NEZA 4DV0J 1PC4A 2M7SA 1V5VA 3LANA 3ZTPA 1S5ZA 4JI0J 2R8IA 3MAAB 1APSA 3MUTP 3I0RA 1WUUA 3TA2A 4YR3A 2WBRA 4ILMA 3AD8C 1NB2A 3C6TA 3CIMA 3UVJA 1UAWA 1NO8A 1F3VA 4TU9A 3W9JA 5KT2A 2X1GA 2V2KA 4M5JA 1MNEA 4IOAQ 2F65A 4JI0F 1S1XB 5DQHA 2E1RA 3HHEA 2LEPA 3MAAA 4RLEA 1EKRA 1TUWA 4L73A 4NLRA 3MD3A 3MTKA 2PSZA 3D67A 3TUIC 3OFFA 1MN7A 2HVHA 2B56A 2W9AA 1G7CB 3TP2A 3CDWA 1NH7A 2YPYA 3CCJS 5HVFA 3UQSA 5ETOA 1S1XA 3JSBA 1PG5B 3M9OB 3AXMA 3VZHA 1JWWA 1MWYA 3WC2A 2RUSA 3UCUP 2HS3A 2FC8A 6AT1B 1FKPB 3DMJB 2FHJA 3PX6A 2QL5B 1GEHA 1NAQA 4LMZA 4P2MA 4IQMA 1WC0A 3EYZA 3DM2B 2JEJA 2VH7A 4DR6J 2B7BB 1NSAA 3KMSA 2PMWA 4NMXA 2W4CA 2VFVA 3HCXA 1GMUA 3OV7A 2ZNZA 4IDKB 4ZJLA 1HD1A 2LQ5A 4KSEB 1HBUB 2QLBB 3MPDA 3PZPA 4KV8B 2PMHA 1IR0A 4F26A 4KGMA 1T7PA 4QCLA 1FKPA 3DMJA 4CO5A 3D1OA 1V3SA 4YDXA 2KTQA 2VFUA 3DM2A 4DR6F 2HWIA 1M5PC 5ADZA 1KTQA 4ZCIA 5KG7A 3W3SA 1U2FA 4ECWA 2ZUGA 4IDKA 2IVMA 3TVKA 2HVDA 2WB4A 1LW2B 4KV8A 3UCZP 3K0JA 1FA0A 1K9MT 2J7KA 3SCJE 3M30B 1LNQA 4NXNJ 2C3YA 1LV5A 4BWJA 2YQ0A 4I64A 1D09B 2MQNA 2EFOA 2BABA 1VOMA 1NHVA 5DJBA 4FNHA 3DRRB 5HANA 3VGUA 1TAQA 3SSSA 1LW2A 2N7CA 2HVZA 1TK5A 2K8GA 2CNKB 2ZH9A 4Y65A 2VPZB 2FC9A 3M30A 2Z58B 1S59A 2DT9A 3ENVA 3W66A 1S1TB 1IWGA 2HNYA 1EETB 2O01C 3KLGB 3OL8A 3C19A 4HH1A 3DRRA 4ZLPA 4CNYA 3VCDA 2AX1A 2O3DA 4Q44A 2ZHBA 2QTWA 4ZIWA 2Y0BB 3J7YI 1MU2B 4V19X 3QBCA 5KFXA 4BDPA 1YJ9S 1S1TA 4LR7A 5E2QA 1EETA 3MD1A 3KLGA 2DNMA 4J9SA 4NRUA 2J6UA 1Y00A 4PG6A 1HNXJ 3CCZA 1TP7A 4DJBA 1U6FA 1FK9B 1B70B 3U7JA 1MU2A 2E1PA 5ETPA 4UY8T 3Q8UA 3PXGa 3H42A 4EO6A 3US5A 2L9DA 1CS4B 4DSEA 1NSPA 2KG0A 1IBMJ 3DHWC 1U8SA 2OH2A 2DPJA 4UT4A 2PFFB 4Q43A 1HNXF 3C46A 4DR5F 3NMAA 3TRGA 1FK9A 4Q5VA 1S76D 2VBWA 1OPZA 1TQLA 1WACA 2P9GA 2RDJA 3JTPA 5KFEA 3K5PA 5I3UB 2CWXA 1TFWA 3IAS9 4C8NA 1IBMF 1KLMB 2AU0A 4K4UA 2VPYB 2XBPA 2CPZA 3PTWA 4CZCA 4RX6A 4J9RA 1X4AA 2UXBJ 2EBEA 1KHWA 4RNOA 1NKCA 4LQ9A 2XWYA 5F3TA 4ECRA 4NYZA 3M1VB 5I3UA 4CLWA 5HLFA 4QBUA 2GA7A 4ZPTR 4NLSA 3X3UA 1KLMA 2PA8D 2D1CA 1CC7A 1HQUB 2F9JA 1WHWA 2DGUA 1ZM9A 4ED5A 2BACA 1BD6A 2NPIA 2U2FA 1VMBA 3SIPB 5KFTA 2HS0A 1FJ7A 3MZIA 1F2HA 2DGVA 2HHVA 3M1VA 3CCTA 4JI7J 5GMEA 2UUCJ 2RT3A 5HAOA 4DFJA 4C97A 2ZOFA 3FBCA 4J5OA 1FRMA 1HQUA 4CM2A 3CJ0A 1U48A 1RT6A 2JNJA 4O23A 1ZTWA 4N76A 1Y7PA 2NREA 3UD5A 3IC1A 3FBFA 4HT7A 3H8YA 2LFVA 3HHLB 4DFMA 3IGNA 1HNVB 4KH1B 4HDHA 2QMXA 1U2RA 3FVYA 4JI7F 3MCNA 2UUCF 1SC1B 2LLZA 3KYLA 3PY8A 4B3SF 5J2QA 2A10A 2OMLA 2R2SA 3DOLB 2G1HA 4J9UE 3CGIA 5KFHA 2BA9A 3HHLA 3PJ9A 2Y9HA 1HNVA 2DKOB 4FYYB 2HZCA 3Q24A 1VBKA 3BH7B 4CO4A 3IA0A 3KUHA 2QA4S 2QG9B 3R6GB 2E9RX 5CYQB 4ZP8A 1TKXB 3DOLA 1HARA 4OYBA 1SIWB 2OHDA 3SCKE 4CLUA 3C3LA 2NSCA 3CVKA 4EK2A 2YY3A 2DHAA 3G86A 3CPWR 1FVQA 1QTMA 3H90A 3MI7X 3AXKA 1QE1B 2HHQA 3PYGA 3CJRA 4TLRA 3ILIA 3W9HA 4C3MA 1U1RA 5A8RB 4F3OA 5CYQA 2ROEA 3P49B 3KUGA 1TKXA 1RBAA 1BQNB 3C15B 2YWKA 4QR0A 1FRIA 4WYLA 3ZXWA 2MQMA 2MB0B 2GVZB 5CAAA 4WTYA 2AJ1A 4OZ5A 2VASA 1QE1A 1UETA 2J6SA 4YEAA 5A8RA 5L9NA 3FRYA 2CJBA 2UVWA 3PKMA 2B0GA 3BDPA 1KONA 4C48A 4IQXA 4EWTA 1BQNA 1HBOB 2XEXA 2CPHA 4DF8A 3C15A 2DYAA 3V81B 1UWBA 2RQCA 3DOKB 4A48A 2GVZA 4NZ6A 3J81j 2CRLA 3AD7C 4KHRA 2BVZA 2ZH2A 1FDBA 5DM7Q 3RBDA 1FRKA 4EBCA 2YVSA 4YOEA 4NLUA 5EUHA 4GRSA 1QLNA 1XTZA 3V6DA 1VC6A 4FKXA 3RAQA 3HVTB 2LCWA 5GVQA 1GMWA 3HT0A 3EPGA 1HBOA 4QWCA 3NGKA 2HLUA 2Y1LB 3D1QA 4HR2A 1RK8A 1NH8A 2M9KA 4XPCA 3V81A 3O1LA 3DOKA 5IWAJ 2RUGA 2HFZA 3BYPA 3FSYA 5ETQA 1NB7A 2FGOA 3HSGA 3TUZC 3OLBA 2QEXS 3RGIA 3HVTA 2A18A 4XDCA 1O0PA 2HRYA 4W4MA 3V2UC 5IWAF 1GX5A 3M8SA 2KL8A 4KAIA 5B0BA 2QA2A 1FDNA 4G1QB 1FVSA 2DCUB 1X4HA 5F8HA 1I94J 4P71A 5DDOC 2JEGA 4RUCA 2PC6A 3IR6B 4C11B 4RR5A 3I6PA 2WOMA 3E01B 2XMVA 4K4XA 2HGLA 1TTHB 2ILYA 5F9NA 1E6YB 9ATCB 3R97A 4DLEA 1I51B 3GLJA 1S9GA 4G1QA 4UZBA 4KO0B 2I9SA 2YKNA 2HQDA 3MOJB 3RRGA 1I94F 2F40A 1GH8A 5KOWA 3TZYA 1GXTA 5CA5A 1W7WA 3I9ZA 4WIQA 1E6YA 4DUZJ 2I2YA 2JZ5A 2KVQE 4KO0A 4NX9A 5IQ6A 1CJTB 2DGXA 4A8FA 2DNKA 2Z0GA 3BBCA 1F5CA 3KJNB 5C2CA 2F4FA 4I6AA 3ISNC 1PKUA 3R9LA 1FKOB 5B7WA 5IV3A 4DUZF 1LK7A 1IJEB 3JQJA 1N36J 1Q78A 5KAKA 2MHNA 1CJTA 3BSAA 4TU7A 2GNKA 2DH9A 4AXIA 1RKJA 3G2XA 4FYVB 1FRHA 2QE5A 5LXYA 4RNFA 1BWVA 2C2NA 1FKOA 2XTJP 1N36F 3K7RA 1D9FA 1ELOA 1R8BA 4EO8A 3PFEA 3M6XA 1VC5A 2GFFA 5F9LA 2B9WA 1WOSA 4LSZB 3CTRA 3QO9A 4IH5A 1RTDB 5DG8A 3PDNA 3Q2SC 3QWUA 1UVLA 2C2DA 1YDLA 4NE9C 4H4OB 2YWFA 5M2PA 1VRUB 1NDCA 1K1QA 4P73A 1J27A 3OL7A 4PUOB 4ED6A 1T02A 2A3JA 1S79A 4C6AA 5JJBA 1DARA 1SH0A 3MFIA 3KK3B 1YKWA 4WP3A 5E5NA 2HQFA 1JJHA 1RTDA 1RTZA 3KLEB 4QW9A 2QO3A 4FNIA 1KD1T 4H4OA 1VRUA 3R27A 1JLBB 4X65J 4KGKA 2FLLA 1AA1B 4K2XA 3Q83A 4YDDB 2OSQA 3TR5A 2IIHA 4I2QB 2VQEJ 2LXIA 4BS2A 4KC5A 3MM6B 4K0KJ 4GKKJ 2XI2A 1YJ7A 1VS3A 3M8ZA 1SL0A 2Z30B 3KLEA 4HI1A 1DURA 4ZVUB 2FQQB 4FS1A 1X5TA 3CDBA 4PWUA 1JLBA 1NDKA 1PCAA 3DLBA 2VQEF 4RBUA 1CBKA 2R7SA 4B3OB 4K0KF 3MM6A 1RTHB 4NA3A 1TR0A 2BRLA 1KP6A 1BQXA 2XNRA 2C2RA 1HL6A 1LW0B 2RE1A 4I6WA 2VA3A 4QWAA 4FXDA 2DNLA 4KY3A 3TA0A 2ADBA 2FGCA 1FTRA 2B4OA 3S6EA 2DXFA 2WBMA 2NSBA 2O66A 2ZBRA 1LXNA 4B3OA 2IJRA 4FF2A 1RTHA 4Y6IA 4FXWA 1B0PA 3J7A1 4YY3F 5G0RB 1RWNB 4GO5X 1NK5A 2CJAA 4F4ZA 3K59A 1LW0A 4KKOB 1SJFA 2DNNA 4R8UB 4KH0B 4PZVA 1XJWB 3AAWB 3RYLA 4USJC 3R5JB 1WG4A 4F25A 4U7CA 1VK3A 3QFWA 4K8RA 4ZCKA 2GAGC 5F0WA 3TX0A 4USMA 2C2EA 3IMQJ 1GFWB 1IKYB 1FFGB 2KT2A 2XS5A 5G0RA 3TAMB 4U8VA 2H5IB 2FY1A 5HO4A 4A8KA 5LJ3Y 3Q86A 4KKOA 3LPYA 3D68A 1YZ7A 1U6BA 3W8GA 2JLGA 3L4BC 3PRDA 1AT1B 5D0HA 1GAOA 1JB0C 2C3MA 4H4KA 5IOLA 1IKYA 3TWZA 2XYPB 3TAMA 2LA6A 1ZETA 4ES1A 4X4QA 5D8HB 4DN9A 3DU5A 3CCMS 4TNOA 4FKYA 4TQSA 4EU0A 3NGUA 1TUVA 4X62F 4ICLA 5ITHA 1JK9B 4IOBA 3NOCA 2QLJB 2DY1A 4J9VA 3AB4B 3QZ8A 4URQU 4P7TA 2C42A 1L3VA 4K4VA 3MEGB 5EWEA 2YQ3A 3GE9A 4PYDA 1Y5IB 3EZOA 4D3HA 3M8RA 1BGXT 3ZNJ1 4LRAA 2CJKA 3HMJG 4P2FA 1OY9A 1CLFA 1NCLA 3QYYA 4M5KA 4E98A 4FZVA 2R7RA 1RWMB 3MEGA 5DETA 3IBWA 2C28A 4ES2A 3UPFA 2BRKA 4QPTA 5DLFA 2VQFJ 1FNOA 3I32A 1HWJA 2VA2A 4KGZB 1TVRB 1U25A 3ILJA 2HPUA 1FHTA 2AMCB 4KR0B 1FWLA 2VZ9A 1S7IA 1U09A 3LAMA 3A12A 2N3LA 1K0VA 4ZVTB 3PYFA 2VUGA 2IM0A 2GGPB 2VQFF 1N34J 3JB9k 5A8KB 2CPJA 4KFBB 3TZZA 2OD6A 4DQPA 3N9UC 4PG5A 3DOMB 1TVRA 4MKYA 3Q89A 5E3PA 3D2WA 2OELA 1C4AA 2V8HA 4Q45A 3BS9A 4F8RA 4LF9J 3AY0A 4PG8A 1T3NA 1TL3B 1DJ0A 3Q23A 2I38A 1IQTA 2GGPA 1N34F 2MDAA 2ZBPA 2ZJRQ 3QFHA 5A8KA 2JLFA 3W5YA 5K8PA 3MR6A 3D6HB 3DOMA 4KPCA 5FDLB 3CEDA 2NXUA 4LF9F 1RBOB 1M90T 2VIHA 1Q86T 4KIAA 4ZN3A 4Y3CA 1XBWA 2QSWA 3VALA 2CQ0A 1UW9A 1KDNA 2QYCA 4K4ZA 3KG1A 3D1HA 1RTJB 5THWA 1PC5A 4UQTA 3O5TB 1N8RT 4IYQA 4OJ3A 3QT6A 1ROFA 4YP3A 3QMQA 5KT4A 2X1AA 3FMBA 2E7VA 5A6PA 4MH8A 3D66A 3LQVA 3ENWA 1QY7A 1M5KC 1RTJA 2V8DA 1TU0B 4O3PA 4ZVSB 3MXHP 2G2ZA 4ALZA 3PM9A 4ZVRB 1FNMA 2BJ3A 3HVAA 2DNRA 4B9SA 2HFUA 3VAIA 2DR8A 1UZDA 3TNVA 3KDNA 2CADA 1OJ4A 2ZH5A 2YH1A 1Q53A 3WQPA 4NMLA 2CZVC 1PJ5A 1TMMA 2HSEB 4FVCA 4Q8EA 2ZHOA 3D5MA 4YQWA 4NLGA 2F63A 1YRTA 5KG0A 4PWDB 4OLOA 3X1LB 4ZVFA 4C8YA 3L95X 4K5RA 3B8HA 5KFIA 3CC4S 1QAXA 4MYTA 1VIOA 2AYGA 4DSJA 2OI2A 2V69A 4DX5A 1DHMA 4X66J 5FIIA 2XMTA 4HHJA 3MUMP 2H4YB 4PWDA 1WJ9A 1YJRA 2YNGB 4B08A 3BF4A 1HYSB 2CJXB 2ACYA 3D0GE 5D0RA 4AT1B 1V3ZA 1BUXA 1IXKA 2VOOA 2WAQD 4DPXA 3AOAA 3JSYA 1Y5NB 6FDRA 1U4BA 4X66F 4ENOA 1HD0A 3HD2A 2HYIB 2YNGA 3BQ1A 1FX2A 3F0NA 1HYSA 5HVHA 3BSOA 1D1UA 2V4QA 5A0YB 2QN6B 2KRBA 1DTTA 2UUTA 5LMUF 1MMLA 3UFCX 4JP8A 4X4PA 2BKNA 2YKQA 2D7SA 2XZWA 2XY6A 1WKLA 1NLKL 2LDYA 5IXUA 4ELUA 2YX4A 2K2PA 1YITS 4CO3A 2LKZA 3JAMU 5A0YA 3MFHA 3H5UA 4QIGA 2LVWA 1JLCB 4C3KA 4F50A 4J91A 3MAQA 2V2VA 4JB8B 1S1VB 8AT1B 2LA4A 2QGFB 1U2CA 2FLOA 2OPRB 4J9MA 3FSXA 3G96A 1YRUA 5E0OA 1TL1B 1K0TA 2ZEJA 3CJTA 2UV8G 3OTOJ 1X60A 4DR1J 4KHMA 3A3OB 3C8YA 2J8SA 1YI2S 1L3KA 3QJPA 4X4TA 1DQ8A 3BM7A 2OPRA 5K9FA 1H2TZ 1OS5A 3CJ3A 2QIFA 2NS1B 3DDKA 2E44A 2DY9A 1TL1A 3N6MA 3F44A 4DOZA 1HI8A 2FLNA 3OTOF 3SI8A 2RF2B 3JSRA 4I69A 3RBZA 2VC1A 1IJFB 2JEFA 4OHXA 3E3XA 1XMBA 1VRTB 2IM2A 1C1BB 4GVBB 1KQSR 5J1EB 5KOXA 2NPFA 6FD1A 3RZAA 5D15A 1G3OA 4ELVA 3CC7S 3HSJA 2RF2A 1Q5VA 1Q82T 2E1CA 4ECYA 4M94A 1U47A 5DQIA 2W01A 3HJFA 2XMKA 1SCJB 2AJFE 5HMXA 4ANCA 5BXIA 1WC5A 3U1NA 4DL0C 2MEWA 1C1BA 3LOUA 4GVBA 3H2VE 1KOOA 3A8IA 4KYZA 2A1BA 3N01A 2D3OR 5J1EA 3WZ0A 1B7FA 4ZMMA 3GFXA 3M32B 4JI6J 5CH7B 4U8YA 2LU2A 2FJDB 3ELHA 4DR7J 5I42B 3IAM9 3M05A 1CVJA 3ZZOA 1ZZFA 1H2VZ 1U1MA 1HHTP 2L48A 4E8UA 2N3OA 4Z37A 4GO7X 2GJ2A 1H0HB 4N77A 4JI6F 3M7VA 1NZ8A 2IYIA 1WD6A 1XR6A 3M32A 2X51A 1RT2B 4O0NA 3DRXA 3ISND 2J7WA 3PCOB 5I42A 2M4MA 4N41A 4WWSA 3G8QA 4HEA9 4P2SA 1NKBA 5A2QU 2FDNA 4ER8A 2G2YA 2I5JA 1WNEA 1XMOF 3HSZA 4FPRA 3UCGA 1C0TB 2G4BA 2HAFA 2F9DA 2EC2A 3FQLA 3P8BB 1A7GE 3UR3C 2CDQA 1RT2A 4ZCLA 1HWIA 4UOFA 1RT4B 5DO2A 3B6BA 2MZQA 2ZBCA 2PE8A 3DGPB 1WC4A 1C0TA 5I4MA 1Q7YT 1LWCB 3CDUA 2ZKTA 1JJCB 5HN0A 2CQ2A 4F02A 5J2MB 1RT4A 2COLA 2H5EA 4DF4A 4RNNA 2RU9A 4DL7A 5AXLA 3DGPA 4LJMA 4HT5A 1CULB 2IM1A 3H5SA 1RLDA 1VYAA 1LWCA 2XO7A 4OYZA 4ZKAA 2A2CA 4DQIA 5J2MA 2W4DA 3L09A 1EP4B 2KDOA 2M70A 4WK3A 1LOUA 4I68A 2XO6A 2J7UA 2RRBA 4CLFA 2FJXA 2MPUA 3IWXA 2GW8A 1CULA 1VQSA 3R5BA 1U8WA 3KG0A 5LSOA 2BR0A 2DRDA 4O3QA 3DRPB 1D9AA 1S49A 4G6VB 5L38A 1S7HA 3VVTA 2I0XA 2OO4A 4NI2B 3FEYB 5KFLA 1ZM4A 2R2TA 4RNHA 1TUGB 5L1IA 1EP4A 2V2QA 3EDRB 2B4UA 1RA7A 2IAJB 4WFBQ 2EG1A 2GVDB 2YKPA 1FKAF 1K47A 4LVNP 1X4EA 3DXSX 2RD5C 3PG9A 2AQ4A 2DGQA 2DVIA 5KFFA 2HHXA 3DRPA 2XMJA 3KOAA 1RWXB 4WCEQ 2FZGB 2KJWA 4PEOA 4USTA 1M1KT 4EUVA 3HVWA 3QRQA 3IBFB 3N0VA 2FVSA 4NI2A 5IC6B 3M8WA 3FKBA 3NLCA 3VR1A 4GC7A 2FJWA 3UR0A 4MK9A 1BQMB 2CNOB 2MKSA 2G2OA 3D7SB 4QZVB 1RAHB 3ZTRA 1RAAB 4X4NA 1FFWB 2R7WA 4U67Q 2J6TA 2Q6BA 3CD0A 2LDIA 1Q5YA 4USIA 2W2PP 3JAMY 2P2CB 5G4DA 2DXEA 4X64J 3CF5Q 1SUQB 4BCAA 3QRPA 4OJ1A 2JWNA 4CO1A 2LQ9A 3JS9A 3OHAA 4DX8H 2HIYA 2AIRB 2DHHA 1NPKA 3LALA 2HNDB 2JX2A 1SIZA 3BJYA 1F5BA 4WU3A 4C4WA 1VI7A 4DSFA 3TQ1A 1O5JA 1AZSA 4DEZA 4ITSA 3PO4A 1FDAA 2XS2A 4DV6J 4TLQA 1ZH5A 4GMKA 1Y5LB 3MMAB 4DWIA 2MZSA 1RDRA 4MYUA 4KTQA 3QT7A 3K5MA 2ZJPQ 1C0UB 3W62A 1UW4A 2QFIA 4DV6F 4U7UK 3SXLA 1EIYB 2Z57B 3BN7A 1F9FA 3OJUA 2E5HA 2CQ4A 3MMAA 1T9TA 1N5YB 1S0VA 5K8OA 3NGDA 2AF6A 3OFEA 3AD9C 2KFNA 1C0UA 5AXKA 2CQPA 1QSYA 3J7Z5 4TVAB 2R7XA 4DPUA 3O6QA 3CCWA 5GAEU 4KRWA 4A8MP 2IDLA 1UA0A 2AWZA 5AXNA 2YKOA 3TUPA 2NZCA 3I56S 1NDLA 2VFTA 1WEYA 2H4WB 1NSQA 2GMJA 4OYWA 1N5YA 4ZLJA 3SCLE 4I67A 2B9EA 2ZITA 2YKMB 2K3KA 2JVOA 4WTOB 5KG5A 2XHCA 4PQAA 5HATA 3UI3A 2LMIA 3Q8PB 3OXLA 4OHVA 5HL7Q 3O44A 3G4SS 2DGOA 4FF4A 1U1QA 1SVDA 1KVJA 1FERA 2RRAA 2YKMA 5IT9Y 4ANDA 5LJ5Y 1NPRA 1JLQA 4LF8F 2YH0A 2BJEA 4A8QA 3LGMA 4CP5A 3T6BA 1IKVA 4YHHJ 3J81Y 5A2QY 2MQQA 3ZZ0A 3TVZA 2UV8A 1SJ4P 2KFZA 1CJVB 2V34A 1A0OB 4NXMJ 1RHRB 3QQCD 4UQGA 1HHSA 1EX8A 4Q2LA 3PW0A 3HX9A 3NS5A 4Z7CA 2R8GA 2VDHA 4ECVA 2XYGB 4CCHA 3UN2A 4QWEA 4IOCQ 4F4YA 1N33J 2QX0A 4NXMF 3AQOA 1CJVA 4Y34A 1P6TA 1KVKA 4GC6A 4UUWA 2MKCA 3C6UB 2DRBA 1I6JA 1RI7A 4PXDA 4M95A 1GK8A 2HZVA 3IR5B 5AXMA 3TYTA 3EZ5A 1HNIB 4J9QA 4OZJA 1RWUA 5E41A 3BR8A 1YVFA 1B4SA 1N33F 1HI0P 3PVXA 5IQQA 1VQMS 3MURP 3OPKA 5KG4A 4YMEA 1K73T 4UW2A 5KFJA 1OMSA 4NZ7A 3C6UA 5AT1B 1FESA 4B9MA 3CE8A 3RRKA 5KFPA 4FP9A 1S4EA 3B4MA 1U26A 4OI0A 1U02A 3POTB 2C2KB 2Z2ZA 2ZD1B 3H2UB 4TY9A 1TL4A 3RR7A 1RYSA 5CQGA 2N82B 1HNZJ 4KGVB 3B4DA 3ZZPA 2AD9A 2KHDA 3CJ2A 1OIAA 3CJKB 2KXNB 1LXJA 1QVGR 3HFVA 2XI3A 3HKWA 2JFKA 1X4BA 2D3UA 2DNPA 2DR9A 2J5AA 2OAUA 4ZLLA 3POTA 4ED7A 1RAIB 2UU9J 2ZD1A 1HNZF 1YX2A 1UJ6A 2W9BA 1U1PA 5HQMA 5HMZA 5BYSA 3THPA 2G0JA 4I7FA 2CPFA 3G87A 3GYNA 3CJKA 3LGHA 3SQGB 4LT6A 5KFAA 2MXYA 2GO9A 2KT5A 4ZOSA 5IM0B 2NLWA 3VAFA 1KC8T 1WHYA 3KUEA 1F3FA 2E7WA 1EQ0A 2WVBA 4LF1A 1FD8A 2X7IA 1IR2A 2UU9F 1RT7B 3D54A 3S7RA 5KG3A 4ZPAA 3FCHA 1WI6A 4QWBA 1OYEA 1MW7A 5L8RC 5J1PA 1FT8A 1JLFB 3SQGA 5IFMA 5IM0A 2L9WA 2KRRA 2XY5A 1Y11A 3M6VA 3BQ2A 2RDDA 3KLIB 1S48A 1Y3KA 2KN4A 1RT7A 3VTIA 2OIHA 2CVEA 3KK1A 3QGHA 1KEKA 3BPDA 4IRKA 1MSWD 1JLFA 1FCAA 2V94A 1H7XA 2CAJA 1Z4UA 4UF4A 2IMWP 3KLIA 4JI5J 2VODA 3QATA 2AX0A 4XTTA 4RWXA 1H2UX 4EGLA 3VGSA 2IVYA 3NS6A 2VJVA 2A6MA 1VQ8S 1V9OA 5CABA 2GX8A 5BR8J 8ATCB 3EVOA 5CCLA 2L41A 1R8PA 2Q43A 3HXMA 3UN3A 3C2PA 2B6AB 1H6KX 4W90B 3BKFA 2QFJA 1OSDA 2V6AA 3MWBA 1Q7LB 4KT0C 4A8OA 4U95A 4JV5F 4Z7YA 3HF5A 1UVKA 4UZCA 3CSKA 3M2RB 2CPEA 3DDNA 5KT5A 3R8YA 5KFQA 4QU6A 5CZXA 2LXFA 3GJSB 2W2NP 1SC3B 5C24B 2VC0A 4WK1A 1X9SA 2B6AA 1KSPA 4RPFA 3T1YJ 1ICEB 1RJJA 2AW0A 2W2OP 4RW9B 2GO8A 3ADAC 4HHHA 3MF5A 4CH7A 3M2RA 1AUDA 4HI2A 1J5OB 5B0GA 3DLEB 5C24A 3WX4A 1T05B 1NZAA 2AZ3A 3R7SB 1RT5B 1P9QC 2JJ4D 3D9BA 4P9SA 3T1YF 2BMBA 1X4GA 3GV8B 4RW9A 4ED0A 3CCUS 2B8PA 4NL5A 1NK9A 2YWEA 2VDIA 4M5GA 1SB6A 1J5OA 3DLEA 1BLUA 1JXEA 1WORA 2O67A 2AKWB 1VQ5S 3R7NB 1T05A 1OPIA 1RT5A 4JYAJ 3I82A 2K7KA 1L3UA 4M5HA 1X31C 2OGUA 1KQKA 4NLYA 2YX1A 1VBYA 1U0SA 4NA1A 5D0EA 1P1LA 4PPZA 4PRFA 1NXIA 5KFWA 5KFRA 3SFUA 3MPUB 4NCAA 3LP0B 4K7QA 1K1SA 3OJSA 2M52A 3BZQA 4JYAF 4F4AA 2AP6A 1T03B 4E0DA 5D3GB 3MCMA 4USKA 4ECQA 4DUTA 3OTBA 2M8HA 1SC4B 2ZVSA 3ILLA 3LP0A 4DPTA 4J9NA 4NLOA 3D6TB 2QLFB 2MQ8A 2NXJA 1N32F 3VF0B 2KM8C 2D9PA 1S1UA 1LFWA 4OYPA 5CCMA 1TKTA 2ZH7A 4W92B 2XQCA 2WSCC 3L9ZA 1FDDA 1T03A 3G8TA 2DITA 5D3GA 4CI0B 3BGRB 3KHGA 1HFEL 4RU2A 3NP5A 2PFDA 3GFZA 3CO9A 2PGCA 2ZZMA 3MMJA 1JNRB 3BO2A 1AFJA 5HROB 4DFPA 2IJNA 2MSTA 1VQ9S 3VGVA 4J9KA 4XPEA 1HIYA 5D4PA 1O51A 4ED8A 2HMIB 1VIXA 3OBIA 4LRDA 3GJTB 5J1NA 4I1TA 1X9WA 2R2RA 2EFVA 5HROA 4X84A 4S0MA 3UD4P 1AROP 2L3MA 4PXCA 1X5OA 3MM8B 4C3LA 2B43A 3OTDA 4J37A 3B82A 2HMIA 4OZ3A 4PKDB 1EARA 2K7JA 2H54B 4NLXA 2Y1JA 3VQSA 4DSLA 3ITHB 2HQIA 1DQAA 1W2IA 4RW7B 1WG5A 1P27B 3FUYA 1H7WA 3TAQA 1PGZA 1X7VA 2FUG9 3DXBA 3DFEA 3JTOA 2GQCA 2LEAA 1VQOS 2MYFA 4OYXA 2IRUA 3ZC4A 3NGRA 3ITHA 4RW7A 4IH6A 3FGVA 1VHFA 2JEIA 5L1KA 4P2XA 2DHSA 4UOHA 3CCVS 2NXNA 1X8DA 2BQUA 2Z2MA 1CQMA 4DN0A 1HBUA 2FY8A 1XERA 2CUYA 1PAEX 4MT1A 1UPPA 1WOPA 2FB0A 2AYMA 3NL0A 2VOPA 1S10A 1N0UA 3ZZYA 3EUNA 3WX8A 3K89A 3AOCA 1SQGA 2POKA 2VICA 1P9YA 5LMNJ 3GIJA 1PYTA 3UD3P 1R3NA 4UOGA 4LF4F 3LW5C 1B0VA 4LR8A 4U6PA 1VHIA 4IUFA 2A2DA 1M0SA 3KHRA 3V6JA 1PJ6A 1NMEB 5LMNF 3GR0A 1Q4RA 2DEJA 5M2RA 4ZITA 1VGYA 4C8LA 3IP0A 1PAUB 1A9NB 2XLJA 1VLOA 2KKHA 1HQEB 1X5SA 2Y3YA 5JXSA 2YTCA 2HNZB 1PYOB 4F0KA 2F8EX 1FNXH 3BKTA 5GMDA 4FYDA 3KKFA 4OJGA 1L5UA 3L3CA 3GIMA 2NR0A 1MLAA 5DGBA 4DV5J 2SXLA 4DR5J 1HQEA 2CJQA 3AJ2A 2QSFA 2HNZA 1D3WA 2V5HG 2OTLS 3TI0A 3PX4A 3QJLA 4CLSA 2CYYA 2VFRA 1NNDA 3Q0AA 2U1AA 4DV5F 3I96A 4C7QA 3G82B 4C2MA 2PA3A 4IO9Q 4OX8A 4LIWA 2F8HA 3IBCB 3AA9A 4R25A 2XZDB 1CS4A 2ZBQA 1LWXA 1RISA 4EI2A 1JKHB 3TO8A 1T11A 4MIWA 1UFWA 4ZVOB 1H98A 4AL6A 4H54A 1HW8A 1Y10A 3TVYA 4OL8A 2MLYA 4HHUA 1FI4A 3N5BA 3G82A 3A1YG 1SC6A 3DRYA 2HBQB 1IQZA 1HPZB 2HEKA 4RUHA 2IHR1 1HWUA 1JKHA 2WB1D 3B54A 1U7LA 2CNLB 3G6VA 2HK3A 3M8QB 5HVGA 2H3EB 4OLPA 2KT3A 1SXLA 2W2MP 3R6LB 3LP2B 3W8PA 2D69A 5H9EK 3V4IB 1TK8A 2BW7A 4TY8B 1HPZA 4PAAA 2ZHAA 3FNNA 4B3SJ 1ZPWX 3MM9B 1F6TA 2EWHA 5ETMA 4X4UA 3M8QA 3MOZA 4KE5A 3BR9A 3IWLA 1XC9A 3W5ZA 3OXGA 4YB6A 3KLFB 3DHXA 3LP2A 3M2UB 5A76A 3HM9A 4EBEA 3B78A 2IVFB 2LEBA 3S1TA 1RWVB 5DZ6A 3V4IA 2P6SA 3VWSA 4Y2IA 1RKIA 9RUBA 3U1MA 4TY8A 3RB6A 3MM9A 2FTRA 1L3SA 3HFKA 2MJUA 4WXWA 4USVA 4KBIA 1UVMA 4I4BA 4I0WA 4CLKA 2DH7A 3M2UA 1AFIA 1IVZA 3EE3A 4NA2A 2W4PA 3KXDA 2UVRA 4F7VA 2V68A 1FJCA 1NM2A 5KT6A 1RSCA 3KFWX 1DQ9A 1S6PB 2J76E 3TEHB 4F3MA 3GSIA 4Y2AA 3FRZA 3FJ2A 4Q7AA 5DZ7A 1XK8A 2C3OA 4A4JA 2WK4A 3PJWA 3HDSA 2E5GA 3BEGB 5B0AA 2G0CA 2ROGA 2YX7A 1RQ0A 3ZZTA 4JI8J 3GU0A 1C2PA 1RWKB 2Q3PA 3MEDB 5F8LA 2CG4A 1YJVA 2KO1A 1SKRA 2VF3A 1DTQB 2V8VA 2KYZA 2XS7A 2RIJA 3SV4A 2BE2B 4QQBA 2KI2A 1IKWB 3WC0A 3U27A 4M5LA 2W8LA 4ZPDA 4JI8F 2VKRA 1VDHA 5D4LA 2P9EA 1H73A 2IDEA 4OV6A 4IH7A 1WI8A 3MEDA 2NQPA 4RJVA 2XWXA 2R7QA 1S0NA 4N8OA 3KTQA 2YNFB 2KFYA 2UXCF 1UTAA 1DTQA 3J7ZT 5T7LB 1WHXA 3I4HX 5KFZA 2BOPA 2BE2A 4RBVA 1RE1B 4J90A 1RHUB 3BV8A 3EVMA 1LKZA 2CZ4A 5M2UA 3MUVP 1S72S 4B3MJ 5CYJA 2M88A 3MTJA 3FCVA 5T7LA 4F4WA 1N88A 1RXOB 3OTCA 3NAHA 4J9LA 2ZM6F 1N5QA 2JDJA 1CG2A 2PEHA 3FBEA 1TMJA 3M2VB 2M3DA 1VCTA 4B3MF 1HA1A 3EXYA 1SJ1A 2ZFHA 3BB5A 1S12A 2ZZTA 2OPSB 3PFOA 3A8JA 1WF2A 2BX6A 1RZMA 2WZ1A 1WF1A 1RT3B 1NBEB 4L75A 3J7YU 4ZPCA 2DNOA 2RJZA 3M2VA 2HGNA 5B0CA 2QA4G 5EN1A 1U0HB 3H25A 1RP5A 2OPSA 3GJQB 5DG9A 3THVA 4HKQA 2EPIA 1EHWA 1RBLA 1U1KA 4DR4J 2DHGA 4DSIA 2K06A 3FZBA 3R7BB 3I5BA 1HHQA 2JH3A 2FJBB 1SPBP 1RCOB 1X4DA 1YRXA 4B9VA 3H5XA 4B02A 2UUAF 3AODA 2ZH6A 4E2FB 3RB3A 1U0HA 4HYKA 2WRMA 1WKJA 3I4PA 1P8GA 1LEOA 2ABYA 4ILRA 3MMBB 4DR4F 4MJKA 3MPWA 3IS9B 1KQGB 1VBXA 4C11A 3E01A 2R4FA 4DU7A 1GTHA 4F36A 4HTJA 1K8AT 3QPIA 5L1LA 3AHPA 4DR2F 1I3OB 3D28A 4IRDA 5EX0A 3MMBA 3ULHA 2V50A 2C2MB 4TXSA 4F4KA 4K4WA 4C0OC 1WOOA 2O5DA 1VC0A 1AUSL 2NXEA 3NCRA 4JI2J 4B9NA 4ILLA 1V5IB 1S1WB 2XMAA 4Y00A 1YBAA 4UOCA 1IWAA 1EB0A 1IR1A 4OI1A 4LREA 4FN5A 2HFOA 1FXDA 3PIOQ 5C2GA 2J0QD 1F5AA 3FEXB 5B09A 1V3RA 4AE5A 3THTA 1J5EJ 3BKUA 2NYHA 2FHJD 2XNQA 2AGQA 1FWPA 5KT3A 4V19J 4JI2F 2IBKA 2CQGA 3QRRA 2IA0A 4DCJB 2HG4A 1DBDA 2WVFA 1S1WA 3S01A 4EYIB 4DQQA 3OVAA 2ZH1A 4CM0A 5AJ3J 2Y8WA 3FCWA 2EW9A 2QYGA 3DC2A 1NJIT 2OD4A 2B7CB 2VL1A 5B0DA 5CZVA 1J5EF 1RU1A 3CCQS 4CT9A 4RNMA 4KJIA 3PNIA 3CD7A 1OWXA 1ZM2A 4OYIA 4P10A 4N56A 3ZZZA 4ZVPB 5AJ3F 4EFAC 2H5JB 1HNWJ 3W65A 1VQKS 3K58A 3RTVA 2X1FA 1L3TA 4NLPA 4ZVHA 3CW2C 3T9NA 3ET6B 2C3UA 2KH9A 3T19A 1RACB 4WFZA 4LF6J 1SKUB 1NJWA 1VJQA 4C9DA 5H9EJ 4Q0BB 4PUOA 3QSYB 4R0EA 3PJXA 1YBUA 4YFUA 5KG6A 3A13A 3KK3A 3M6UA 1HNWF 3EDQB 1VQLS 3BH6B 3IO1A 2XSJB 3ET6A 5DGAA 3QIPB 1VISA 2IMOA 3JQKA 1VQYA 2E5JA 4LF6F 2GJFA 4Q0BA 1NDPA 2MKHA 4OZLA 4BC9A 4I2QA 1UCNA 3ICLA 1F60B 3OQ2A 2QMUB 5F8MA 2J9DA 5U47A 3DKDA 3D0IE 3CWJA 2FVQA 4DDFA 1O6XA 3CULA 2IPOB 4YY3J 4LFAJ 2XSJA 3QAUA 3QIPA 2MLXA 3DGVA 1S0OA 2WW8A 1RTIB 5E3CA 3VAJA 3A3PB 3NNHA 3P4UB 1U49A 5H1SV 4IR1A 4OZ1A 1GXLA 4ZN1A 1FJGJ 1HI1A 4C98A 2ZZNA 5HJXA 2Q1LA 1IBKJ 1RGVA 4LFAF 1JLGB 3HFZB 4X2BA 4JV2A 3MCOA 1R0BG 1Q95G 3I0RB 3DDIA 2APOA 2MZJA 5JMNA 2FD2A 1AYEA 1KS2A 3HKZD 3KHHA 4LQ3A 1UFLA 1FJGF 1DY3A 3M6WA 2HFNA 1IBKF 3MHYA 4F0HA 4DHVA 1WTBA 1JLGA 3DLLQ 3MR2A 3EGZA 2BOAA 1KFSA 4XIUA 4R8UA 4WFYA 3FFIB 2QV6A 2UXDJ 2XG8A 4X62J 1KNZA 1S99A 1WC6A 1OY6A 4YN3B 1YBTA 5J2PB 2KU7A 2RB7A 2R2UA 1RAOA 2DHXA 4DV0F 3TANA 4I56A 2I8EA 2XM3A 1CJKB 3Q2TC 5I3PA 3FK4A 4OX9J 4J9PA 4WIIA 2ZH4A 2UXDF 3FFIA 4CLZA 4LBIA 2B9YA 3CD5A 3QLHB 3GR1A 4G1IA 2XB2D 2BJ1A 3EVWA 3KJQB 3KK2B 5J2PA 5LOQA 1JJ4A 1WF0A 2ZE2B 1OQ6A 4MKAA 2LXUA 1B64A 2DO4A 2XLIA 4OV1A 5ETVA 1CJKA 4OX9F 3VQTA 2JVRA 2M5YA 1TKDA 4F2SA 2DGWA 4BLGA 1SJ3P 2C2OB 3QLHA 1RHKB 4OZ0A 5L39A 3KK2A 3CCLS 4DMZA 1V6HA 3HJVA 1UWAA 2ZE2A 2OPQB 3I9V9 3BN4A 1FXRA 3ETOA 1HBNB 4ZVGA 2VG6B 2BXJA 1R7IA 4ZJOA 5ETNA 2NUHA 5AE1A 1R43A 1RB0A 1R31A 3SYZA 3IGVA 4DV7J 2DGTA 2G0IA 1HKAA 3M8YA 4LF7J 2OPQA 5H9FK 2ASYA 4A8YA 5EX3A 2KM8B 4PCQA 4LIRA 3K5LA 1HBNA 2PIIA 2VG6A 4U96A 1YK9A 3UE2A 3LWMA 2ZH8A 3N79A 3Q8QB 1ZOTA 3PYDA 4DV7F 3HHLD 3HP6A 4YB7A 4LF7F 1MG7A 2HHTA 2UP1A 3M8PB 3OUYB 2HWHA 1B7YB 4OFZA 2XMMA 2GIFA 3KG4A 2HNYB 2N4CA 1XN9A 4KFBA 3EWGA 2MQLA 2NZ4A 1HLWA 4A8WA 4FYXB 2DB1A 4ED1A 3M8PA 4DI6A 3OUYA 4NXNF 4O3RA 5RUBA 2CQBA 3PW5A 1TL3A 1O8BA 3PHEA 2EK6A 1S4FA 4JOUA 2WHOA 3GG1A 3SSRA 1IN0A 3ZTSA 4X4SA 2HS4A 1Z2LA 2GHVC 5FDLA 3NBPB 2RVJA 3NWRA 1GMVA 3ISZA 2LQBA 4O3SA 3NGSA 2MZTA 2CKWA 4QU7A 2C1EB 4F67A 1Y9OA 4QYRA 2YWHA 2MSSA 2BYCA 3T1AA 1WSRA 2Y8YA 3EGNA 2W25A 2BW2A 3Q8YA 2I1RA 2MTLA 3NBPA 5GAHI 4NLTA 1WDDA 3HHKA 4LBPA 4FBUA 4FF1A 1B99A 4RBTA 4K4TA 2BJ8A 2PD1A 1R8HA 4NLQA 3IM8A 4DCPB 3HSDA 3T6JA 3H59A 3BGOP 4ES3A 2E66A 1VQ4S 2W24A 4DPYA 1GMWD 5FD1A 2B9XA 3MM5B 3QGGA 3CJSA 2AJ4A 3H20A 4PABA 1WSVA 3P96A 4DL6A 3MPYA 4O0IA 2RMLA 3P3DA 2V67A 5HLFB 3HLUA 3TQEA 2O1PA 2BDPA 3SQOP 2ROPA 1IBCB 3LP1B 4ZP7A 2NXCA 5K20B 4MIBA 3MM5A 1RAJA 2ZJQQ 1YJUA 4LR9A 4DS4A 3OSNA 4CLYA 3EZUA 5D4OA 1SQEA 2F4VJ 4L3NA 4ZHRB 1KR4A 3SBMA 3LP1A 3IG1B 5LMUJ 2MGZB 2UXBF 1RT6B 2XZTB 3I31A 5KFGA 4Q8FA 2MKYA 4DL2A 4QR1A 2V9KA 3R5GA 2BKOA 3HD1A 5KFMA 2WSFC 1KHVA 2FHOB 4KHPJ 3A8EA 4P75A 4LVOP 2F4VF 1IM6A 1T0TV 4ZHRA 5J2QB 1AW0A 1ZTTA 2RDIA 1DAXA 2PI4A 1SI9A 3IG1A 2MKKA 5E7OB 5HP1B 3CMQA 2MGZA 4ID8A 1E6VB 2W9CB 1ZBTA 3VAGA 2K1RB 4TKTA 5AE2A 3DLJA 2CIMA 2WVEA 1NSKL 2FZKB 3K5OA 1NPPA 4KHPF 3C14B 1JLEB 2CQHA 2DNYA 1NU4A 3HK2A 1RUSA 5GAGI 2YBVA 3I5CA 4HLBA 4URGA 1WELA 5D0GA 1YQHA 4PG4A 5B08A 5HP1A 2DXDA 4TQRA 1E6VA 2R7UA 4OQJA 2W9CA 2FHMA 2K1RA 3DLKB 3NCQA 3HT3A 1CPZA 5KFYA 2MY7A 3HPOA 4C0HA 2VHGA 3C14A 1JLEA 3P6YC 2RRNA 3M4XA 4A47A 2CA9A 3MGJA 3TAPA 2GQ2A 1RT1B 3W1YC 1NUEA 3GCWP 1REGX 3OFHA 5GMKa 1S9EB 1Q8KA 3GIRA 1JLCA 3RAMA 3RAXA 3EMTA 1WKKA 4QIEA 2J9CA 1S1VA 3DLKA 4PYAA 2LQJA 4FXVA 1JX4A 2GIQA 3H98A 2RAQA 1RT1A 5LL6d 5ETRA 1SJRA 3CC2S 4RO0A 1S9EA 2RILA 4ZCMA 5C5JA 4LSNB 2G13A 3NNAA 1R8CA 2ZC3A 4WPAA 4P52A 5KFOA 1X0PA 2VBXA 3K8WA 2BV3A 2FJVA 2K3IA 1OYDA 4JBCA 1HR0J 3W5XA 1RA6A 1UWBB 2WTFA 3VZIA 3FMWA 3CJQA 3VAKA 4CTAB 2R42A 5KG2A 1QAIA 3FBBA 4ZJQA 4KGXB 3R5DA 4DV4J 4O44B 3V6DB 4LSNA 4ZIVA 2GJIA 1XEZA 1HR0F 4FS2A 1XR5A 1VRTA 4B3TJ 4OHZA 4B9LA 3D0HE 4CTAA 2E5IA 2OKQA 1Y4ZB 4DV4F 3GIIA 1TZ0A 1U1LA 2BANB 4LRBA 4O44A 2H51B 4RL1A 4ATNA 2ALZA 2HK2A 2XLKA 3F41A 3Q8RB 3BQ0A 4OX6A 1GNKA 1JJ2R 3TOQA 3EX7B 1UJ4A 1QAYA 3NY0A 4B3TF 3OL9A 2E9ZA 2KVIA 2RQ4A 2OEKA 5H9FJ 5BYRA 2D9OA 2BKPA 1XMOJ 5IT9U 2EXUA 2BANA 3NGTA 2ASDA 2ZNYA 3BSNA 2BQ3A 5D4NA 3OHBA 1T9UA 3R3TA 2XHWA 2AYBA 2WOMB 3DLGB 3W9IA 1SL2A 3J81U 5K8MA 1SH3A 2ASJA 1JNZB 3V4MA 4O4RA 1S9GB 3PW4A 2GS8A 1SBRA 1WEZA 5J2NB 2YKNB 2C3PA 1QD1A 5DG7A 2WVDA 3A8KA 3HZEA 4DFKA 2HRTA 2AYEA 2NUUG 3HVRA 3SCIE 5EWFA 2CQIA 5GAHU 4DR3J 2BE7D 2ZH3A 3DLGA 2ZKUA 2B8QA 5HK4A 2F8MA 4ZLNA 3GYXB 3BDEA 4PXEA 5J2NA 3CJ5A 2GV1A 2RQKA 3PRBA 2IA6A 2HZAA 4DR3F 1R89A 4GVLA 3M9MB 3PIPQ 2YKAA 1S9FA 3JSMB 5SZTA 4OJHA 1TL7B 3D4JA 3OSPA 1XQIA 3K5NA 4CLLA 4DS5A 4TYAA 4P6QA 2RS8A 3HHDA 2N7YA 2GMLA 5EHHA 2V4RA 3TX8A 3GJRB 3JTNA 4AFFA 3JSMA 2QZ8A 3OD2A 3CCRS 2JC1A 1TL7A 2OUGA 3WDOA 2IRXA 4K4YA 3QO9B 1PYSB 4KB7A 1BY9A 2E7XA 4MFBB 2PO4A 3OFGA 4AQYJ 3NEKA 3MR7A 3NS7B 4ED4A 1N5TA 1M1GA 2F7VA 2W7AA 3Q8SB 3SV3A 3MR3A 1RLCL 1N48A 1VRQC 2ZDPA 5F8IA 4L72B 3RR8A 4U7UD 3GV5B 3CB4A 2X3DA 3UWTA 3QGPA 1IUJA 2LECA 3Q22A 3C66A 4OHYA 5EWGA 2YPZA 2J9DE 4I2PB 4DL3A 1X4FA 2KXHA 4JV0A 4MFBA 3FC9A 2J9EA 2HHSA 4AQYF 4B9UA 3GWCA 3EGVA 3BO3A 2IAJA 4TU8A 1NHUA 2GVDA 4NWBA 1QVFR 2V8GA 4WKYA 2DGSA 1GQEA 5GAGU 1WC1A 3R1HA 3V6HA 4I2PA 4Y0FA 4DV3J 2PT0A 2H48B 4NLWA 2A6OA 1SQFA 3RW6A 2JL9A 3DU6A 3NOGA 1QDUB 3W2VB 2CQDA 4CQ1A 4WJBA 1BQMA 2ATLA 1RCXB 1U45A 1R0CB 1UVIA 3MEEB 4MKBA 1BXNA 3KLHB 2B4VA 3H7HB 1RHQB 4DV3F 4CYUB 1R8AA 1UL3A 1Q16B 3AA8A 3AQPA 3GTYX 4ELTA 4X65F 1VBZA 3W2VA 1SUQA 2EG2A 1CSJA 2R7OA 2IY5B 2DD8S 4JV1A 4I6YA 4DV1J 3MEEA 3KLHA 4ZPBA 2R9LA 4GKKF 4CIOA 4CYUA 2HNDA 4YS2A 3W2WB 1PIEA 4KQZA 5A6WA 1KQFB 1R6YA 3W61A 1W26A 1NK8A 4DU8A 4DV1F 4M5IA 4F0MA 1UA1A 2VPXB 3HI9A 3RG6A 3CMAS 1FRLA 4OZ2A 1URRA 1BC6A 3PYEA 1VQ7S 4LSLB 1URNA 2G9OA 3BYRA 2FIUA 4ZP6A 3UNYA 3DLHA 2VB6A 3W2WA 1KRPA 3LTOA 3GMGA 3TJAA 2HKEA 5F0UA 4M1KA 2EFQA 5CXTA 3UO0A 1TV6B 2MY8A 2OSRA 1RAEB 1UZHA 2GZOA 2HBYB 4LF5J 1EZZB 1TL5A 3UDEA 3ZO7A 5A8WB 4LSLA 3HO1A 4NZ0A 4ECUA 2RNEA 3NG8A 5I3QA 4ICLB 2QL9B 1TV6A 2V0NA 4LF8J 5GADI 4LF5F 1PO6A 3KWMA 2Q79A 3QIDA 4OI2A 3P5BP 2C2ZB 5A8WA 5LXRA 3H5YA 3T9ZA 4MK8A 3CJ4A 3BREA 3I87A 5IT0A 1KTVA 5E3RA 5DM6Q 8RUCA 2FJEB 1U24A 3T5JA 2EK1A 5L1JA 4B3RJ 1KVIA 2LU1A 5DDQC 3SMZA 5IZHA 4K4SA 3CCSS 1GTEA 2AEJA 1FEHA 5K5MA 2WSEC 4Q2MA 2W8KA 2HHPA 2QT7A 4Y2KA 4DZDA 2CXEA 3MMCB 5KFVA 3TJ9A 1N56A 4MAKA 4RUBA 2KHCA 2ZDOA 3FZ2A 4B3RF 3H2LA 3R1LA 1DLOB 2MQOA 2B3TB 1N5SA 3L7OA 1Q8LA 1QAJA 3EXCX 1H3DA 4ZS6A 5AE3A 1UP1A 5JVGQ 3CO0P 3PR5B 2CJYB 3OLAA 1ZA2B 5KFDA 3BPSP 3MMCA 2WW4A 3QWPA 1PBAA 1N0VC 2DNZA 2PN6A 4EMDA 2DR6A 3OXFA 1Q8BA 3HHNB 3C16B 1VJWA 2HWTA 1DLOA 5BJRA 1NJZA 3G71S 1LWEB 1U1OA 4OHWA 2RQMA 2DNHA 4UUXA 1N52B 4M63A 4ERDA 2V8PA 4HL9A 4K5SA 4OYMA 3U1LA 2ZWPA 5ETTA 3TZWA 1WHVA 3ZNUA 1MMDA 4CWBA 3ENQA 3NWGA 3IM9A 2DCLA 1S6OA 2Z4PA 4A8SA 3C16A 4BBYA 5C25B 4M5DB 2BZ2A 4KPYA 2ASLA 1UEKA 1LWEA 1ZYQA 3QZ7A 3PRVA 3J80U 5B0EA 1KKHA 5CD4H 1HNIA 1F0XA 5IV4A 4NOHA 4OIXA 4PWWA 5CD4A 3ETMA 4HDGA 1OQ3A 3H40A 2EFGA 2VKZG 4NEYA 4WP8A 3NMRA 3N6NA 3H0PA 2R3VA 3AJDA 5C25A 3GV7B 4M5DA 2QMWA 4DPWA 3O3LA 2AGOA 1YSJA 2CFXA 4ZPVR 2WVCA 2IM3A 3UN5A 4OI4A 4A46A 2ACMA 1T8EA 3T5KA 2YNHB 3FQKA 1M5HA 4P72A 1U1NA 3ZZRA 1QSLA 4ECSA 2CWKA 4IO1A 3WHIA 1AB8A 4LFCJ 2EKYA 3CD6S 3DNCA 3RU0A 3FSIA 5DDRC 2HQ3A 1UPMB 2OJ3A 3TW0A 5KFKA 1TAUA 2XGQA 4OZNA 1UFKA 3QSIA 3E8OA 5IC4B 1F9HA 2YNHA 5ETSA 2OMOA 5DDPC 1B3TA 4ID5B 3VAMA 1RAFB 2AEMA 1NK7A 4LFCF 2CPYA 2RSQA 4ECZA 1W25A 1VK8A 2EFNA 4XK8C 4ANEA 5T14A 2HFVA 2XCAA 1H72C 3BGLA 1KLNA 3P5TL 1QM9A 4ID5A 3R2CJ 2WONB 5L46A 2JHEA 2ZVIA 5KFSA 1YJNS 2KXFA 1RHMB 3DYAB 1Q79A 2JLEA 1A6LA 2ERRA 4QWDA 5F8JA 4DBQA 4CDIA 2YWWA 4K2JA 2ATCB 1UEUA 4YB5A 2FPHX 2HVEA 2F5GA 2R8HA 4LUBA 2M0GB 5JUMA 4K50A 4C8OA 4JI3J 2WONA 4JV5J 3OT9A 3A4TA 3DCAA 1NJXA 4HTIA 3DYAA 2MZRA 2P8IA 3VV2B 1Z1ZA 1TELA 5LSLA 2DIVA 2ZWOA 4ZPWR 3RBXA 1YHQS 4BWMA 2H65B 4DX7A 4W98A 3GCXP 2AGPA 2V4JB 4JI3F 2MKIA 4CNZA 1DTTB 4WBFA 4D3GA 2X3GA 4L3KA 4QIVA 2H1YA 1Y0HA 4G65A 1NRKA 1M5OC 7FDRA 1LFPA 2R7VA 2R8JA 4O4GB 3P45B 1XWLA 3BBBA 2CZ9A 2IJFA 3ILOA 2V4JA 4WE1B 2R7TA 1UJ5A 3NAIA 1QSSA 3QGIA 4XAKA 5KFUA 2KG1A 1T3OA 3L7PA 3R5AA 4JI1J 3T1HJ 5HQ8A 3IN5A 2NYIA 4J7CA 1S6QB 3CIZA 1ZS6A 1G6BA 1PBUA 3JXOA 2AEFA 2CQ1A 5GADU 4DQSA 1CJUB 4O4GA 2XCPA 1BHNA 4AL5A 3VHQA 1S0MA 3W7BA 4USHA 4WE1A 5K8NA 4C0BA 3GQCA 2GQQA 2RKIB 1T95A 4LFBJ 4JI1F 3T1HF 3QJJA 2IFXA 4DXLA 1CEZA 1S6QA 3T41A 1RWOB 3EPIA 1CJUA 2OPPB 3L7UA 3WBZA 3EM1A 5DS7A 2UUBJ 2P5VA 4ZP9A 4F3QA 4LRFA 4LFBF 2RKIA 5KTQA 3PX0A 1ZAWA 4V1Ak 4IG3B 4A8XA 3W60A 2DEIA 3J7AN 3PACA 2ZOGA 3JQMA 3FEZA 3GB0A 3E51A 4CH1A 1N32J 4CO2A 2OPPA 2UUBF 4OI6A 3PW2A 4N8NA 5C42B 3O8WA 3CT9A 2L9NA 3GSDA 2GAHC 1TFYA 1ZZNA 2M2BA 1I5OB 2EEYA 5E3AA 3CNQP 2B4PA 1VQ6S 4IG3A 3W64A 4RW4B 1UKUA 2ALYB 4OX7A 2HIQA 4DR1F 1X9MA 2FHKA 1D8YA 4AUKA 1AXQA 5EDWA 2Y1IA 5C42A 1YJWS 3IWNC 2ZUAA 4BC7A 4EZ9A 5HMWA 1S57A 1MN9A 4Y2CA 2RU3A 4RW4A 2CQ3A 4EBDA 3BSCA 5HJYA 1YWXA 3BGUA 1MROB 5IS2A 7FD1A 4LBHA 5KFNA 4FPIA 1N54B 4C8MA 2FYXA 4HH0A 5IT4A 2HHUA 5GAEI 3ONQA 3BGRA 2VG5B 5LSRA 1F9EB 1Q1KA 1REVB 2WCXA 2XMUA 4MIAA 3UW1A 4FBTA 4DPOA 3J80Y 3OR1B 3IRXB 2Z2YB 2CJ9A 3LUYA 1F2GA 1MROA 4DL4A 3M9NB 3UDLA 1WG1A 2IBOA 1IBLJ 4MKVA 4UTGA 2Z8QA 3H4BA 4R0JA 1JLAB 1FWKA 2I5JB 1UMJA 1DFDA 3K2YA 1N6QB 2VG5A 1ULRA 1OO0B 1JXLA 1LWFB 2PMZD 4DLGA 1REVA 1VR6A 5B0FA 3OR1A 3HULA 5F8GA 3IRXA 2AZ1A 3CXCR 2GMHA 4IKAA 2DBBA 2VU5A 4DR7F 4WP9A 1IBLF 2R8KA 3RB0A 1D9DA 1FEEA 2DK2A 4AD6A 3MM8A 2HQCA 1JLAA 2AJQA 5KFCA 4WKRA 2Z2LA 2MZ1A 1UVJA 4NCGB 2FZCB 4URSA 1N6QA 1YIJS 1LWFA 4ECXA 1D0EA 1WEXA 1HMVB 4HVZA 3DN9A 3N28A 4ETXA 2D74B 2QLXA 2F1FA 2BQRA 4DG1B 2ZC4A 5F8NA 1G1XA 4NCGA 5HSPA 2DNQA 3LPEA 4ETZA 4UY85 1S77D 4EYHB 3BGFA 2DR5A 1HMVA 1XR7A 2OLWA 4QYZK 1GT8A 3MPVA 3TUJC 2XYHB 4LF4J 2GHWA 2BJ9A 4DV2J 4OYAA 4G3IA 4YR2A 4DG1A 2Q66A 4TN2A 4O3OA 3RW7A 4WF9Q 2AJ0A 1CC8A 5KG1A 2Z56B 3LGNA 4DSKA 3RUBL 3Q8VA 3SEOA 2KZZA 2AV5A 4R5PB 4F04B 1YJTA 2Y0SD 3EJMA 1MWQA 2UUWA 2VBZA 4DV2F 3KHLA 4L76A 4NLVA 5FLXU 2XGPA 3MDFA 2LP4A 1UVNA 2E1MC 1EJ7L 4DQRA 4B9TA 2W2QP 4DL5A 1X5PA 4FYWB 5E3QA 1SKWA 4R5PA 7AT1B 4WFXA 1FD2A 2XSFA 4AYBD 2VG7B 5DQGA 2CDRB 2PDAA 5T41A 5L9XA 3TEGA 1JQGA 2P9CA 3NNCA 4DUYJ 3LF0A 4QW8A 3PO5A 2E29A 1HWKA 2VPWB 1C4CA 5K14B 3HHLC 4M8LA 4B17A 1SJQA 1G4CA 4MK7A 4NLDA 2VG7A 5LM7E 1DRZA 1OY8A 3WIVA 2DNGA 1RYRA 4PXBA 3AJ1A 1FF2A 1ACMB 4PQUB 4NYOA 4DUYF 3RRHA 1D8ZA 1SL1A 2HBZB 3G6XA 1X0FA 4NASA 2P6TA 5K14A 4F2RA 1XNRJ 2ADCA 3KJFB 4IFYB 3LA0A 3KLVA 2Y1RI 2V9WA 1HW9A 1QTNB 4WXOA 4YB1P 2HVIA 2KZMA 1AZSB 3SDEB 1G2EA 1SV5B 4PQUA 1KBRA 2BJ7A 3DI6B 2IRYA 3H4DA 2F3JA 1NK0A 1XNRF 3SZ2A 2ZBIA 2MLZA 3LH2S 2IYGA 4RW8B 2H9ZA 4IFYA 4ZA1A 3W63A 2X1BA 3NCPA 2GIRA 4X64F 1MWZA 5F3ZA 3TJ8A 2IC3B 5E33A 1IKXB 3SDEA 1SV5A 4G1PA 3CDAA 3D3BJ 3DI6A 2HW3A 3VAHA 2YXLA 3MEKA 2CPDA 3PR4A 3AH6A 2HFSA 2LQ8A 4PG7A 4U9RA 4RW8A 3QT5A 2AHOB 2DIUA 3PEHA 3NKYA 5SUHA 3MECB 4MTPA 2IC3A 4M5MA 1IKXA 3G6ES 2GC8A 4QIFA 2DH8A 2HGMA 4N7TA 1C1CB 2HHHJ 2HRUA 3IXQA 4USWA 2UVUA 4ZK7M 2E5LJ 1P1TA 3BO4A 4GKJJ 4CLPA 3GP9A 3BBFA 3KJVB 1W2BR 1WDTA 3OTEA 3UNGC 5ETKA 3R5CA 5BYQA 1XNQJ 3MECA 4IR9A 2EBGA 4XDDA 3PEJA 1BMQB 2OFGX 2VJUA 3N6LA 2HHHF 2MJNA 2E5LF 1C1CA 3E2EA 1I1GA 1QJHA 2L08A 2UZAA 4GKJF 5MLCV 3PV8A 1EQMA 1KFDA 2DRAA 3KJVA 2OTJS 2HLTA 2DTJA 3KLFA 4WU2A 1T9WA 3F56A 4RKUC 2E1AA 4QPXA 4OI3A 3U02A 4WYWA 2RH3A 1M5VC 3R2DJ 1XNQF 3OR2B 2VV5A 2V2ZA 4NCBA 2AJ2A 1JLQB 1EAYC 3I55S 1UEVA 3KNAA 1IKVB 2OP5A 2CVIA 2GHPA 2HQGA 1YZ6A 1R27B 2J8AA 4WZQA 5D6GA 4ED2A 3MM7B 1FXLA 2CQCA 3OR2A 1Y3JA 4C8ZA 4CO0A 4QJVA 3GG0A 1S6PA 2M8DB 4ZDNA 2W7PA 2MMYA 4RU9A 1B0TA 1F1BB 4ED3A 1JMTA 2W1BA 4N47A 2VD3A 2OEJA 3RBEA 3DRSB 2B51A 2UXCJ 5MAOA 2QLWA
chains in the Genus database with same CATH topology
1XNQJ 1HNZJ 4DV4J 1I94J 1J5EJ 1N34J 4X65J 4JI8J 3J81U 2F4VJ 4DR6J 4DV6J 2MTLA 4JI1J 3JAMU 1IBMJ 4X66J 3T1HJ 1IBLJ 4JI7J 5LMUJ 2VQEJ 4LFCJ 4DV3J 3W1YC 2UUCJ 4LF4J 5AJ3J 4DUYJ 4K0KJ 4JI3J 3T1YJ 1N33J 4DV2J 4JV5J 4GKKJ 4B3TJ 4LF9J 2UU9J 5A2QU 4B3RJ 3R2DJ 2UXDJ 4DR3J 5IWAJ 4HHUA 3D3BJ 4X62J 2UUAJ 4JI5J 4LFBJ 4KHPJ 3D3CJ 3IMQJ 1XMQJ 4YY3J 5LM7E 4LFAJ 4AQYJ 2ZM6J 4RJVA 4DV7J 2MQ8A 4X64J 4DUZJ 3J80U 2UXBJ 4DV5J 2MEWA 4DR5J 3OTOJ 4LF7J 1HNWJ 2KVQE 4LF5J 5BR8J 4DR1J 4KYZA 4OX9J 5FLXU 2UUBJ 2VQFJ 4PWWA 4YHHJ 1XNRJ 5LMNJ 4JI2J 1FJGJ 2HHHJ 1XMOJ 2KL8A 1IBKJ 2E5LJ 4JI6J 5IT9U 4DR4J 4NEYA 4NXNJ 4GKJJ 1HR0J 4LF6J 4DR2J 4DV1J 1HNXJ 4KY3A 4V1Ak 4JI4J 3R2CJ 4DR7J 4NEZA 4DV0J 4B3MJ 3J7AN 4JYAJ 4NXMJ 4LF8J 4B3SJ 1N36J 4JI0J 2UXCJ 1N32J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ J;  1HNZ J;  4DV4 J;  1I94 J;  1J5E J;  1N34 J;  4X65 J;  4JI8 J;  3J81 U;  2F4V J;  4DR6 J;  4DV6 J;  2MTL A;  4JI1 J;  3JAM U;  1IBM J;  4X66 J;  3T1H J;  1IBL J;  4JI7 J;  5LMU J;  2VQE J;  4LFC J;  4DV3 J;  3W1Y C;  2UUC J;  4LF4 J;  5AJ3 J;  4DUY J;  4K0K J;  4JI3 J;  3T1Y J;  1N33 J;  4DV2 J;  4JV5 J;  4GKK J;  4B3T J;  4LF9 J;  2UU9 J;  5A2Q U;  4B3R J;  3R2D J;  2UXD J;  4DR3 J;  5IWA J;  4HHU A;  3D3B J;  4X62 J;  2UUA J;  4JI5 J;  4LFB J;  4KHP J;  3D3C J;  3IMQ J;  1XMQ J;  4YY3 J;  5LM7 E;  4LFA J;  4AQY J;  2ZM6 J;  4RJV A;  4DV7 J;  2MQ8 A;  4X64 J;  4DUZ J;  3J80 U;  2UXB J;  4DV5 J;  2MEW A;  4DR5 J;  3OTO J;  4LF7 J;  1HNW J;  2KVQ E;  4LF5 J;  5BR8 J;  4DR1 J;  4KYZ A;  4OX9 J;  5FLX U;  2UUB J;  2VQF J;  4PWW A;  4YHH J;  1XNR J;  5LMN J;  4JI2 J;  1FJG J;  2HHH J;  1XMO J;  2KL8 A;  1IBK J;  2E5L J;  4JI6 J;  5IT9 U;  4DR4 J;  4NEY A;  4NXN J;  4GKJ J;  1HR0 J;  4LF6 J;  4DR2 J;  4DV1 J;  1HNX J;  4KY3 A;  4V1A k;  4JI4 J;  3R2C J;  4DR7 J;  4NEZ A;  4DV0 J;  4B3M J;  3J7A N;  4JYA J;  4NXM J;  4LF8 J;  4B3S J;  1N36 J;  4JI0 J;  2UXC J;  1N32 J; 
#chains in the Genus database with same CATH topology
 1T9X A;  1T9Y A;  1JIH A;  3MM7 A;  2FLP A;  4HAC B;  2EVZ A;  1NEE A;  4ECT A;  4WZM A;  4CH0 S;  5CYM B;  1MMN A;  1BE4 A;  2C22 A;  1XIQ A;  5D78 A;  3CJ8 A;  3F73 A;  4K59 A;  3K8V A;  5D77 A;  3IRW P;  3WIU A;  4YHH F;  5HBM B;  4M5N A;  3DRS A;  3T5H A;  3LO3 A;  4CT8 A;  2BBE A;  1LK5 A;  2DIS A;  5ETL A;  1RAD B;  4OMF G;  2FVR A;  1IKW A;  1RAG B;  2EC0 A;  2CPX A;  4P7V A;  3MAH A;  2ZM6 J;  4HAC A;  1R6V A;  2EKN A;  3QAE A;  5CYM A;  3NRB A;  3HZG A;  4RWW A;  1TK0 A;  3VVU A;  2YNF A;  5HBM A;  5DRK A;  4RZR A;  1S97 A;  2OEM A;  2XY7 A;  1LQ9 A;  4FVM A;  1ZAV A;  2YWG A;  3K57 A;  1Q81 T;  2JSX A;  5JVH Q;  4Y28 C;  3V6K A;  3V5R A;  3O2I A;  2D41 A;  3IFE A;  4BHQ A;  2EI5 A;  2KB2 A;  4L74 A;  1FE4 A;  2FVP A;  2KYX A;  2DJW A;  2LYV A;  4YUD A;  3VGT A;  2HBR B;  4PR6 A;  3T3F A;  4NPO A;  4PPD A;  3GIL A;  5FJ4 A;  2W7O A;  3N4W A;  5FLX Y;  1PJ7 A;  1PIL A;  1WWH A;  3I0S B;  2BM1 A;  4QYZ J;  1GX6 A;  3MR5 A;  5HQL A;  2W9B B;  2HHW A;  1HBM B;  1NJY A;  4NRT A;  2CNN B;  4I7F B;  1JXV A;  2UUA J;  1FTC A;  1XMQ J;  2MQP A;  2D3Z A;  1T9V A;  1N5V A;  1OSC A;  3D6F B;  3I5A A;  2J0W A;  5DLG A;  3I0S A;  1DZ5 A;  3UDC A;  1SH2 A;  3FDS A;  4AXJ A;  1RT3 A;  4TYB A;  1YGY A;  2OFH X;  4OYO A;  2RS2 A;  1ITP A;  3TZX A;  1HBM A;  2XC9 A;  4CRJ A;  5CHC B;  2QRR A;  2RHQ B;  1XMQ F;  1T94 A;  3QNW B;  4DR2 J;  2MKJ A;  2DR7 A;  3GON A;  3CME S;  3OVB A;  1YG0 A;  4J9O A;  5HI7 A;  1QUP A;  2ZOM A;  3G6Y A;  1FRX A;  2V63 A;  4AL7 A;  3G9C A;  2Q6C A;  3KK1 B;  4IFV B;  2NCK L;  2BUN A;  2I6W A;  1RWP B;  3MCS A;  1HWL A;  3OW2 R;  2YQ1 A;  1Q0N A;  1FRJ A;  3ZFV A;  1ZM3 A;  3ZTQ A;  2N4D A;  4WFN Q;  3KDO A;  1RHJ B;  4ZVQ B;  4EZ6 A;  3IS9 A;  3OL6 A;  1U6Z A;  4H4M B;  1WC3 A;  4Z2X A;  3RB4 A;  2HUR A;  4MMO A;  2BEF A;  4F4X A;  3S8S A;  2G1D A;  4IFV A;  3PHT A;  3D3C J;  1FE0 A;  1KWM A;  2QC3 A;  1NHK L;  3A3N B;  2AT1 B;  2UVV A;  3D6M B;  1X4C A;  1ZAX A;  1VLY A;  1SKS A;  3RJM B;  1RU2 A;  1Z2Z A;  3KMQ A;  4FDF A;  2J0X A;  2BE9 B;  2XMW A;  3GPA A;  1ZA1 B;  2BJD A;  1FFS B;  2GCF A;  3SFG A;  4H4M A;  4P74 A;  1WTF A;  4YR0 A;  3JYT B;  2BM0 A;  2DO0 A;  4QOT A;  2CG8 A;  1VQP S;  3IR7 B;  4JI4 J;  4N5S A;  4DZ6 A;  5KT7 A;  3AFG A;  4XO0 A;  1FO1 A;  3CUN A;  2FJA B;  1YTY A;  4FF3 A;  2B5J B;  4JI5 F;  1R0A B;  3TA1 A;  5HMY A;  1BWE A;  1NKE A;  2A0F B;  1Q8I A;  3LWL A;  1NK4 A;  3JYT A;  3T5L A;  1FJE B;  2VFS A;  4JI4 F;  3K17 A;  3TAR A;  2CPI A;  4DCO B;  1FX4 A;  4X4V A;  2RHS B;  5BR8 F;  2FVC A;  1HQ2 A;  1GXU A;  3LAK A;  4H4K C;  1IM4 A;  3CDE A;  4IRC A;  2B5J A;  4LF2 A;  4QR2 A;  1R0A A;  3GFY A;  3N5F A;  3ZTO A;  4C8K A;  4L6V 3;  3PW7 A;  3AT1 B;  3ENA A;  4DX6 A;  4JUZ A;  4X4R A;  1RAB B;  2XUL A;  1KOH A;  2PI5 A;  2DPI A;  1S6U A;  3ZZU A;  1TKZ B;  2HAI A;  1CQN A;  1PSD A;  5KFB A;  3OVS A;  3AB2 B;  1YLX A;  2VBY A;  1H74 A;  2YNI B;  1QUV A;  3AOB A;  2JOQ A;  4RW6 B;  3GFH A;  2QJ3 A;  2JC0 A;  3KNG A;  1ZPV A;  2JRS A;  1J2V A;  1TKZ A;  3GIK A;  2E9T A;  3UDV A;  1RWW B;  1NK6 A;  4Y2M A;  4X4O A;  3SSQ A;  2PEB A;  5LT5 A;  4EEY A;  2YNI A;  2EFP A;  4RW6 A;  5EGY A;  3G8S A;  1N4L A;  4QIW D;  3CCE S;  4IG0 B;  5F41 A;  4CLT A;  4USU A;  1VFJ A;  2MHE A;  4WFA Q;  2ILZ A;  2KJV A;  4ZVE A;  1H38 A;  1S1U B;  3GYG A;  4O3N A;  3EIC A;  1VQN S;  1TKT B;  3GZ7 A;  2JFD A;  2D3O 1;  2J0S D;  5C7P A;  1RTI A;  4LRC A;  2QL7 B;  1K44 A;  4RUA A;  2QA1 A;  3C6T B;  3UVJ B;  3PKY A;  3EGW B;  3QT8 A;  4NYP A;  1KN6 A;  1EKS A;  1M5S A;  4IG0 A;  2VON A;  1M1H A;  3NXZ A;  4NEZ A;  4DV0 J;  1PC4 A;  2M7S A;  1V5V A;  3LAN A;  3ZTP A;  1S5Z A;  4JI0 J;  2R8I A;  3MAA B;  1APS A;  3MUT P;  3I0R A;  1WUU A;  3TA2 A;  4YR3 A;  2WBR A;  4ILM A;  3AD8 C;  1NB2 A;  3C6T A;  3CIM A;  3UVJ A;  1UAW A;  1NO8 A;  1F3V A;  4TU9 A;  3W9J A;  5KT2 A;  2X1G A;  2V2K A;  4M5J A;  1MNE A;  4IOA Q;  2F65 A;  4JI0 F;  1S1X B;  5DQH A;  2E1R A;  3HHE A;  2LEP A;  3MAA A;  4RLE A;  1EKR A;  1TUW A;  4L73 A;  4NLR A;  3MD3 A;  3MTK A;  2PSZ A;  3D67 A;  3TUI C;  3OFF A;  1MN7 A;  2HVH A;  2B56 A;  2W9A A;  1G7C B;  3TP2 A;  3CDW A;  1NH7 A;  2YPY A;  3CCJ S;  5HVF A;  3UQS A;  5ETO A;  1S1X A;  3JSB A;  1PG5 B;  3M9O B;  3AXM A;  3VZH A;  1JWW A;  1MWY A;  3WC2 A;  2RUS A;  3UCU P;  2HS3 A;  2FC8 A;  6AT1 B;  1FKP B;  3DMJ B;  2FHJ A;  3PX6 A;  2QL5 B;  1GEH A;  1NAQ A;  4LMZ A;  4P2M A;  4IQM A;  1WC0 A;  3EYZ A;  3DM2 B;  2JEJ A;  2VH7 A;  4DR6 J;  2B7B B;  1NSA A;  3KMS A;  2PMW A;  4NMX A;  2W4C A;  2VFV A;  3HCX A;  1GMU A;  3OV7 A;  2ZNZ A;  4IDK B;  4ZJL A;  1HD1 A;  2LQ5 A;  4KSE B;  1HBU B;  2QLB B;  3MPD A;  3PZP A;  4KV8 B;  2PMH A;  1IR0 A;  4F26 A;  4KGM A;  1T7P A;  4QCL A;  1FKP A;  3DMJ A;  4CO5 A;  3D1O A;  1V3S A;  4YDX A;  2KTQ A;  2VFU A;  3DM2 A;  4DR6 F;  2HWI A;  1M5P C;  5ADZ A;  1KTQ A;  4ZCI A;  5KG7 A;  3W3S A;  1U2F A;  4ECW A;  2ZUG A;  4IDK A;  2IVM A;  3TVK A;  2HVD A;  2WB4 A;  1LW2 B;  4KV8 A;  3UCZ P;  3K0J A;  1FA0 A;  1K9M T;  2J7K A;  3SCJ E;  3M30 B;  1LNQ A;  4NXN J;  2C3Y A;  1LV5 A;  4BWJ A;  2YQ0 A;  4I64 A;  1D09 B;  2MQN A;  2EFO A;  2BAB A;  1VOM A;  1NHV A;  5DJB A;  4FNH A;  3DRR B;  5HAN A;  3VGU A;  1TAQ A;  3SSS A;  1LW2 A;  2N7C A;  2HVZ A;  1TK5 A;  2K8G A;  2CNK B;  2ZH9 A;  4Y65 A;  2VPZ B;  2FC9 A;  3M30 A;  2Z58 B;  1S59 A;  2DT9 A;  3ENV A;  3W66 A;  1S1T B;  1IWG A;  2HNY A;  1EET B;  2O01 C;  3KLG B;  3OL8 A;  3C19 A;  4HH1 A;  3DRR A;  4ZLP A;  4CNY A;  3VCD A;  2AX1 A;  2O3D A;  4Q44 A;  2ZHB A;  2QTW A;  4ZIW A;  2Y0B B;  3J7Y I;  1MU2 B;  4V19 X;  3QBC A;  5KFX A;  4BDP A;  1YJ9 S;  1S1T A;  4LR7 A;  5E2Q A;  1EET A;  3MD1 A;  3KLG A;  2DNM A;  4J9S A;  4NRU A;  2J6U A;  1Y00 A;  4PG6 A;  1HNX J;  3CCZ A;  1TP7 A;  4DJB A;  1U6F A;  1FK9 B;  1B70 B;  3U7J A;  1MU2 A;  2E1P A;  5ETP A;  4UY8 T;  3Q8U A;  3PXG a;  3H42 A;  4EO6 A;  3US5 A;  2L9D A;  1CS4 B;  4DSE A;  1NSP A;  2KG0 A;  1IBM J;  3DHW C;  1U8S A;  2OH2 A;  2DPJ A;  4UT4 A;  2PFF B;  4Q43 A;  1HNX F;  3C46 A;  4DR5 F;  3NMA A;  3TRG A;  1FK9 A;  4Q5V A;  1S76 D;  2VBW A;  1OPZ A;  1TQL A;  1WAC A;  2P9G A;  2RDJ A;  3JTP A;  5KFE A;  3K5P A;  5I3U B;  2CWX A;  1TFW A;  3IAS 9;  4C8N A;  1IBM F;  1KLM B;  2AU0 A;  4K4U A;  2VPY B;  2XBP A;  2CPZ A;  3PTW A;  4CZC A;  4RX6 A;  4J9R A;  1X4A A;  2UXB J;  2EBE A;  1KHW A;  4RNO A;  1NKC A;  4LQ9 A;  2XWY A;  5F3T A;  4ECR A;  4NYZ A;  3M1V B;  5I3U A;  4CLW A;  5HLF A;  4QBU A;  2GA7 A;  4ZPT R;  4NLS A;  3X3U A;  1KLM A;  2PA8 D;  2D1C A;  1CC7 A;  1HQU B;  2F9J A;  1WHW A;  2DGU A;  1ZM9 A;  4ED5 A;  2BAC A;  1BD6 A;  2NPI A;  2U2F A;  1VMB A;  3SIP B;  5KFT A;  2HS0 A;  1FJ7 A;  3MZI A;  1F2H A;  2DGV A;  2HHV A;  3M1V A;  3CCT A;  4JI7 J;  5GME A;  2UUC J;  2RT3 A;  5HAO A;  4DFJ A;  4C97 A;  2ZOF A;  3FBC A;  4J5O A;  1FRM A;  1HQU A;  4CM2 A;  3CJ0 A;  1U48 A;  1RT6 A;  2JNJ A;  4O23 A;  1ZTW A;  4N76 A;  1Y7P A;  2NRE A;  3UD5 A;  3IC1 A;  3FBF A;  4HT7 A;  3H8Y A;  2LFV A;  3HHL B;  4DFM A;  3IGN A;  1HNV B;  4KH1 B;  4HDH A;  2QMX A;  1U2R A;  3FVY A;  4JI7 F;  3MCN A;  2UUC F;  1SC1 B;  2LLZ A;  3KYL A;  3PY8 A;  4B3S F;  5J2Q A;  2A10 A;  2OML A;  2R2S A;  3DOL B;  2G1H A;  4J9U E;  3CGI A;  5KFH A;  2BA9 A;  3HHL A;  3PJ9 A;  2Y9H A;  1HNV A;  2DKO B;  4FYY B;  2HZC A;  3Q24 A;  1VBK A;  3BH7 B;  4CO4 A;  3IA0 A;  3KUH A;  2QA4 S;  2QG9 B;  3R6G B;  2E9R X;  5CYQ B;  4ZP8 A;  1TKX B;  3DOL A;  1HAR A;  4OYB A;  1SIW B;  2OHD A;  3SCK E;  4CLU A;  3C3L A;  2NSC A;  3CVK A;  4EK2 A;  2YY3 A;  2DHA A;  3G86 A;  3CPW R;  1FVQ A;  1QTM A;  3H90 A;  3MI7 X;  3AXK A;  1QE1 B;  2HHQ A;  3PYG A;  3CJR A;  4TLR A;  3ILI A;  3W9H A;  4C3M A;  1U1R A;  5A8R B;  4F3O A;  5CYQ A;  2ROE A;  3P49 B;  3KUG A;  1TKX A;  1RBA A;  1BQN B;  3C15 B;  2YWK A;  4QR0 A;  1FRI A;  4WYL A;  3ZXW A;  2MQM A;  2MB0 B;  2GVZ B;  5CAA A;  4WTY A;  2AJ1 A;  4OZ5 A;  2VAS A;  1QE1 A;  1UET A;  2J6S A;  4YEA A;  5A8R A;  5L9N A;  3FRY A;  2CJB A;  2UVW A;  3PKM A;  2B0G A;  3BDP A;  1KON A;  4C48 A;  4IQX A;  4EWT A;  1BQN A;  1HBO B;  2XEX A;  2CPH A;  4DF8 A;  3C15 A;  2DYA A;  3V81 B;  1UWB A;  2RQC A;  3DOK B;  4A48 A;  2GVZ A;  4NZ6 A;  3J81 j;  2CRL A;  3AD7 C;  4KHR A;  2BVZ A;  2ZH2 A;  1FDB A;  5DM7 Q;  3RBD A;  1FRK A;  4EBC A;  2YVS A;  4YOE A;  4NLU A;  5EUH A;  4GRS A;  1QLN A;  1XTZ A;  3V6D A;  1VC6 A;  4FKX A;  3RAQ A;  3HVT B;  2LCW A;  5GVQ A;  1GMW A;  3HT0 A;  3EPG A;  1HBO A;  4QWC A;  3NGK A;  2HLU A;  2Y1L B;  3D1Q A;  4HR2 A;  1RK8 A;  1NH8 A;  2M9K A;  4XPC A;  3V81 A;  3O1L A;  3DOK A;  5IWA J;  2RUG A;  2HFZ A;  3BYP A;  3FSY A;  5ETQ A;  1NB7 A;  2FGO A;  3HSG A;  3TUZ C;  3OLB A;  2QEX S;  3RGI A;  3HVT A;  2A18 A;  4XDC A;  1O0P A;  2HRY A;  4W4M A;  3V2U C;  5IWA F;  1GX5 A;  3M8S A;  2KL8 A;  4KAI A;  5B0B A;  2QA2 A;  1FDN A;  4G1Q B;  1FVS A;  2DCU B;  1X4H A;  5F8H A;  1I94 J;  4P71 A;  5DDO C;  2JEG A;  4RUC A;  2PC6 A;  3IR6 B;  4C11 B;  4RR5 A;  3I6P A;  2WOM A;  3E01 B;  2XMV A;  4K4X A;  2HGL A;  1TTH B;  2ILY A;  5F9N A;  1E6Y B;  9ATC B;  3R97 A;  4DLE A;  1I51 B;  3GLJ A;  1S9G A;  4G1Q A;  4UZB A;  4KO0 B;  2I9S A;  2YKN A;  2HQD A;  3MOJ B;  3RRG A;  1I94 F;  2F40 A;  1GH8 A;  5KOW A;  3TZY A;  1GXT A;  5CA5 A;  1W7W A;  3I9Z A;  4WIQ A;  1E6Y A;  4DUZ J;  2I2Y A;  2JZ5 A;  2KVQ E;  4KO0 A;  4NX9 A;  5IQ6 A;  1CJT B;  2DGX A;  4A8F A;  2DNK A;  2Z0G A;  3BBC A;  1F5C A;  3KJN B;  5C2C A;  2F4F A;  4I6A A;  3ISN C;  1PKU A;  3R9L A;  1FKO B;  5B7W A;  5IV3 A;  4DUZ F;  1LK7 A;  1IJE B;  3JQJ A;  1N36 J;  1Q78 A;  5KAK A;  2MHN A;  1CJT A;  3BSA A;  4TU7 A;  2GNK A;  2DH9 A;  4AXI A;  1RKJ A;  3G2X A;  4FYV B;  1FRH A;  2QE5 A;  5LXY A;  4RNF A;  1BWV A;  2C2N A;  1FKO A;  2XTJ P;  1N36 F;  3K7R A;  1D9F A;  1ELO A;  1R8B A;  4EO8 A;  3PFE A;  3M6X A;  1VC5 A;  2GFF A;  5F9L A;  2B9W A;  1WOS A;  4LSZ B;  3CTR A;  3QO9 A;  4IH5 A;  1RTD B;  5DG8 A;  3PDN A;  3Q2S C;  3QWU A;  1UVL A;  2C2D A;  1YDL A;  4NE9 C;  4H4O B;  2YWF A;  5M2P A;  1VRU B;  1NDC A;  1K1Q A;  4P73 A;  1J27 A;  3OL7 A;  4PUO B;  4ED6 A;  1T02 A;  2A3J A;  1S79 A;  4C6A A;  5JJB A;  1DAR A;  1SH0 A;  3MFI A;  3KK3 B;  1YKW A;  4WP3 A;  5E5N A;  2HQF A;  1JJH A;  1RTD A;  1RTZ A;  3KLE B;  4QW9 A;  2QO3 A;  4FNI A;  1KD1 T;  4H4O A;  1VRU A;  3R27 A;  1JLB B;  4X65 J;  4KGK A;  2FLL A;  1AA1 B;  4K2X A;  3Q83 A;  4YDD B;  2OSQ A;  3TR5 A;  2IIH A;  4I2Q B;  2VQE J;  2LXI A;  4BS2 A;  4KC5 A;  3MM6 B;  4K0K J;  4GKK J;  2XI2 A;  1YJ7 A;  1VS3 A;  3M8Z A;  1SL0 A;  2Z30 B;  3KLE A;  4HI1 A;  1DUR A;  4ZVU B;  2FQQ B;  4FS1 A;  1X5T A;  3CDB A;  4PWU A;  1JLB A;  1NDK A;  1PCA A;  3DLB A;  2VQE F;  4RBU A;  1CBK A;  2R7S A;  4B3O B;  4K0K F;  3MM6 A;  1RTH B;  4NA3 A;  1TR0 A;  2BRL A;  1KP6 A;  1BQX A;  2XNR A;  2C2R A;  1HL6 A;  1LW0 B;  2RE1 A;  4I6W A;  2VA3 A;  4QWA A;  4FXD A;  2DNL A;  4KY3 A;  3TA0 A;  2ADB A;  2FGC A;  1FTR A;  2B4O A;  3S6E A;  2DXF A;  2WBM A;  2NSB A;  2O66 A;  2ZBR A;  1LXN A;  4B3O A;  2IJR A;  4FF2 A;  1RTH A;  4Y6I A;  4FXW A;  1B0P A;  3J7A 1;  4YY3 F;  5G0R B;  1RWN B;  4GO5 X;  1NK5 A;  2CJA A;  4F4Z A;  3K59 A;  1LW0 A;  4KKO B;  1SJF A;  2DNN A;  4R8U B;  4KH0 B;  4PZV A;  1XJW B;  3AAW B;  3RYL A;  4USJ C;  3R5J B;  1WG4 A;  4F25 A;  4U7C A;  1VK3 A;  3QFW A;  4K8R A;  4ZCK A;  2GAG C;  5F0W A;  3TX0 A;  4USM A;  2C2E A;  3IMQ J;  1GFW B;  1IKY B;  1FFG B;  2KT2 A;  2XS5 A;  5G0R A;  3TAM B;  4U8V A;  2H5I B;  2FY1 A;  5HO4 A;  4A8K A;  5LJ3 Y;  3Q86 A;  4KKO A;  3LPY A;  3D68 A;  1YZ7 A;  1U6B A;  3W8G A;  2JLG A;  3L4B C;  3PRD A;  1AT1 B;  5D0H A;  1GAO A;  1JB0 C;  2C3M A;  4H4K A;  5IOL A;  1IKY A;  3TWZ A;  2XYP B;  3TAM A;  2LA6 A;  1ZET A;  4ES1 A;  4X4Q A;  5D8H B;  4DN9 A;  3DU5 A;  3CCM S;  4TNO A;  4FKY A;  4TQS A;  4EU0 A;  3NGU A;  1TUV A;  4X62 F;  4ICL A;  5ITH A;  1JK9 B;  4IOB A;  3NOC A;  2QLJ B;  2DY1 A;  4J9V A;  3AB4 B;  3QZ8 A;  4URQ U;  4P7T A;  2C42 A;  1L3V A;  4K4V A;  3MEG B;  5EWE A;  2YQ3 A;  3GE9 A;  4PYD A;  1Y5I B;  3EZO A;  4D3H A;  3M8R A;  1BGX T;  3ZNJ 1;  4LRA A;  2CJK A;  3HMJ G;  4P2F A;  1OY9 A;  1CLF A;  1NCL A;  3QYY A;  4M5K A;  4E98 A;  4FZV A;  2R7R A;  1RWM B;  3MEG A;  5DET A;  3IBW A;  2C28 A;  4ES2 A;  3UPF A;  2BRK A;  4QPT A;  5DLF A;  2VQF J;  1FNO A;  3I32 A;  1HWJ A;  2VA2 A;  4KGZ B;  1TVR B;  1U25 A;  3ILJ A;  2HPU A;  1FHT A;  2AMC B;  4KR0 B;  1FWL A;  2VZ9 A;  1S7I A;  1U09 A;  3LAM A;  3A12 A;  2N3L A;  1K0V A;  4ZVT B;  3PYF A;  2VUG A;  2IM0 A;  2GGP B;  2VQF F;  1N34 J;  3JB9 k;  5A8K B;  2CPJ A;  4KFB B;  3TZZ A;  2OD6 A;  4DQP A;  3N9U C;  4PG5 A;  3DOM B;  1TVR A;  4MKY A;  3Q89 A;  5E3P A;  3D2W A;  2OEL A;  1C4A A;  2V8H A;  4Q45 A;  3BS9 A;  4F8R A;  4LF9 J;  3AY0 A;  4PG8 A;  1T3N A;  1TL3 B;  1DJ0 A;  3Q23 A;  2I38 A;  1IQT A;  2GGP A;  1N34 F;  2MDA A;  2ZBP A;  2ZJR Q;  3QFH A;  5A8K A;  2JLF A;  3W5Y A;  5K8P A;  3MR6 A;  3D6H B;  3DOM A;  4KPC A;  5FDL B;  3CED A;  2NXU A;  4LF9 F;  1RBO B;  1M90 T;  2VIH A;  1Q86 T;  4KIA A;  4ZN3 A;  4Y3C A;  1XBW A;  2QSW A;  3VAL A;  2CQ0 A;  1UW9 A;  1KDN A;  2QYC A;  4K4Z A;  3KG1 A;  3D1H A;  1RTJ B;  5THW A;  1PC5 A;  4UQT A;  3O5T B;  1N8R T;  4IYQ A;  4OJ3 A;  3QT6 A;  1ROF A;  4YP3 A;  3QMQ A;  5KT4 A;  2X1A A;  3FMB A;  2E7V A;  5A6P A;  4MH8 A;  3D66 A;  3LQV A;  3ENW A;  1QY7 A;  1M5K C;  1RTJ A;  2V8D A;  1TU0 B;  4O3P A;  4ZVS B;  3MXH P;  2G2Z A;  4ALZ A;  3PM9 A;  4ZVR B;  1FNM A;  2BJ3 A;  3HVA A;  2DNR A;  4B9S A;  2HFU A;  3VAI A;  2DR8 A;  1UZD A;  3TNV A;  3KDN A;  2CAD A;  1OJ4 A;  2ZH5 A;  2YH1 A;  1Q53 A;  3WQP A;  4NML A;  2CZV C;  1PJ5 A;  1TMM A;  2HSE B;  4FVC A;  4Q8E A;  2ZHO A;  3D5M A;  4YQW A;  4NLG A;  2F63 A;  1YRT A;  5KG0 A;  4PWD B;  4OLO A;  3X1L B;  4ZVF A;  4C8Y A;  3L95 X;  4K5R A;  3B8H A;  5KFI A;  3CC4 S;  1QAX A;  4MYT A;  1VIO A;  2AYG A;  4DSJ A;  2OI2 A;  2V69 A;  4DX5 A;  1DHM A;  4X66 J;  5FII A;  2XMT A;  4HHJ A;  3MUM P;  2H4Y B;  4PWD A;  1WJ9 A;  1YJR A;  2YNG B;  4B08 A;  3BF4 A;  1HYS B;  2CJX B;  2ACY A;  3D0G E;  5D0R A;  4AT1 B;  1V3Z A;  1BUX A;  1IXK A;  2VOO A;  2WAQ D;  4DPX A;  3AOA A;  3JSY A;  1Y5N B;  6FDR A;  1U4B A;  4X66 F;  4ENO A;  1HD0 A;  3HD2 A;  2HYI B;  2YNG A;  3BQ1 A;  1FX2 A;  3F0N A;  1HYS A;  5HVH A;  3BSO A;  1D1U A;  2V4Q A;  5A0Y B;  2QN6 B;  2KRB A;  1DTT A;  2UUT A;  5LMU F;  1MML A;  3UFC X;  4JP8 A;  4X4P A;  2BKN A;  2YKQ A;  2D7S A;  2XZW A;  2XY6 A;  1WKL A;  1NLK L;  2LDY A;  5IXU A;  4ELU A;  2YX4 A;  2K2P A;  1YIT S;  4CO3 A;  2LKZ A;  3JAM U;  5A0Y A;  3MFH A;  3H5U A;  4QIG A;  2LVW A;  1JLC B;  4C3K A;  4F50 A;  4J91 A;  3MAQ A;  2V2V A;  4JB8 B;  1S1V B;  8AT1 B;  2LA4 A;  2QGF B;  1U2C A;  2FLO A;  2OPR B;  4J9M A;  3FSX A;  3G96 A;  1YRU A;  5E0O A;  1TL1 B;  1K0T A;  2ZEJ A;  3CJT A;  2UV8 G;  3OTO J;  1X60 A;  4DR1 J;  4KHM A;  3A3O B;  3C8Y A;  2J8S A;  1YI2 S;  1L3K A;  3QJP A;  4X4T A;  1DQ8 A;  3BM7 A;  2OPR A;  5K9F A;  1H2T Z;  1OS5 A;  3CJ3 A;  2QIF A;  2NS1 B;  3DDK A;  2E44 A;  2DY9 A;  1TL1 A;  3N6M A;  3F44 A;  4DOZ A;  1HI8 A;  2FLN A;  3OTO F;  3SI8 A;  2RF2 B;  3JSR A;  4I69 A;  3RBZ A;  2VC1 A;  1IJF B;  2JEF A;  4OHX A;  3E3X A;  1XMB A;  1VRT B;  2IM2 A;  1C1B B;  4GVB B;  1KQS R;  5J1E B;  5KOX A;  2NPF A;  6FD1 A;  3RZA A;  5D15 A;  1G3O A;  4ELV A;  3CC7 S;  3HSJ A;  2RF2 A;  1Q5V A;  1Q82 T;  2E1C A;  4ECY A;  4M94 A;  1U47 A;  5DQI A;  2W01 A;  3HJF A;  2XMK A;  1SCJ B;  2AJF E;  5HMX A;  4ANC A;  5BXI A;  1WC5 A;  3U1N A;  4DL0 C;  2MEW A;  1C1B A;  3LOU A;  4GVB A;  3H2V E;  1KOO A;  3A8I A;  4KYZ A;  2A1B A;  3N01 A;  2D3O R;  5J1E A;  3WZ0 A;  1B7F A;  4ZMM A;  3GFX A;  3M32 B;  4JI6 J;  5CH7 B;  4U8Y A;  2LU2 A;  2FJD B;  3ELH A;  4DR7 J;  5I42 B;  3IAM 9;  3M05 A;  1CVJ A;  3ZZO A;  1ZZF A;  1H2V Z;  1U1M A;  1HHT P;  2L48 A;  4E8U A;  2N3O A;  4Z37 A;  4GO7 X;  2GJ2 A;  1H0H B;  4N77 A;  4JI6 F;  3M7V A;  1NZ8 A;  2IYI A;  1WD6 A;  1XR6 A;  3M32 A;  2X51 A;  1RT2 B;  4O0N A;  3DRX A;  3ISN D;  2J7W A;  3PCO B;  5I42 A;  2M4M A;  4N41 A;  4WWS A;  3G8Q A;  4HEA 9;  4P2S A;  1NKB A;  5A2Q U;  2FDN A;  4ER8 A;  2G2Y A;  2I5J A;  1WNE A;  1XMO F;  3HSZ A;  4FPR A;  3UCG A;  1C0T B;  2G4B A;  2HAF A;  2F9D A;  2EC2 A;  3FQL A;  3P8B B;  1A7G E;  3UR3 C;  2CDQ A;  1RT2 A;  4ZCL A;  1HWI A;  4UOF A;  1RT4 B;  5DO2 A;  3B6B A;  2MZQ A;  2ZBC A;  2PE8 A;  3DGP B;  1WC4 A;  1C0T A;  5I4M A;  1Q7Y T;  1LWC B;  3CDU A;  2ZKT A;  1JJC B;  5HN0 A;  2CQ2 A;  4F02 A;  5J2M B;  1RT4 A;  2COL A;  2H5E A;  4DF4 A;  4RNN A;  2RU9 A;  4DL7 A;  5AXL A;  3DGP A;  4LJM A;  4HT5 A;  1CUL B;  2IM1 A;  3H5S A;  1RLD A;  1VYA A;  1LWC A;  2XO7 A;  4OYZ A;  4ZKA A;  2A2C A;  4DQI A;  5J2M A;  2W4D A;  3L09 A;  1EP4 B;  2KDO A;  2M70 A;  4WK3 A;  1LOU A;  4I68 A;  2XO6 A;  2J7U A;  2RRB A;  4CLF A;  2FJX A;  2MPU A;  3IWX A;  2GW8 A;  1CUL A;  1VQS A;  3R5B A;  1U8W A;  3KG0 A;  5LSO A;  2BR0 A;  2DRD A;  4O3Q A;  3DRP B;  1D9A A;  1S49 A;  4G6V B;  5L38 A;  1S7H A;  3VVT A;  2I0X A;  2OO4 A;  4NI2 B;  3FEY B;  5KFL A;  1ZM4 A;  2R2T A;  4RNH A;  1TUG B;  5L1I A;  1EP4 A;  2V2Q A;  3EDR B;  2B4U A;  1RA7 A;  2IAJ B;  4WFB Q;  2EG1 A;  2GVD B;  2YKP A;  1FKA F;  1K47 A;  4LVN P;  1X4E A;  3DXS X;  2RD5 C;  3PG9 A;  2AQ4 A;  2DGQ A;  2DVI A;  5KFF A;  2HHX A;  3DRP A;  2XMJ A;  3KOA A;  1RWX B;  4WCE Q;  2FZG B;  2KJW A;  4PEO A;  4UST A;  1M1K T;  4EUV A;  3HVW A;  3QRQ A;  3IBF B;  3N0V A;  2FVS A;  4NI2 A;  5IC6 B;  3M8W A;  3FKB A;  3NLC A;  3VR1 A;  4GC7 A;  2FJW A;  3UR0 A;  4MK9 A;  1BQM B;  2CNO B;  2MKS A;  2G2O A;  3D7S B;  4QZV B;  1RAH B;  3ZTR A;  1RAA B;  4X4N A;  1FFW B;  2R7W A;  4U67 Q;  2J6T A;  2Q6B A;  3CD0 A;  2LDI A;  1Q5Y A;  4USI A;  2W2P P;  3JAM Y;  2P2C B;  5G4D A;  2DXE A;  4X64 J;  3CF5 Q;  1SUQ B;  4BCA A;  3QRP A;  4OJ1 A;  2JWN A;  4CO1 A;  2LQ9 A;  3JS9 A;  3OHA A;  4DX8 H;  2HIY A;  2AIR B;  2DHH A;  1NPK A;  3LAL A;  2HND B;  2JX2 A;  1SIZ A;  3BJY A;  1F5B A;  4WU3 A;  4C4W A;  1VI7 A;  4DSF A;  3TQ1 A;  1O5J A;  1AZS A;  4DEZ A;  4ITS A;  3PO4 A;  1FDA A;  2XS2 A;  4DV6 J;  4TLQ A;  1ZH5 A;  4GMK A;  1Y5L B;  3MMA B;  4DWI A;  2MZS A;  1RDR A;  4MYU A;  4KTQ A;  3QT7 A;  3K5M A;  2ZJP Q;  1C0U B;  3W62 A;  1UW4 A;  2QFI A;  4DV6 F;  4U7U K;  3SXL A;  1EIY B;  2Z57 B;  3BN7 A;  1F9F A;  3OJU A;  2E5H A;  2CQ4 A;  3MMA A;  1T9T A;  1N5Y B;  1S0V A;  5K8O A;  3NGD A;  2AF6 A;  3OFE A;  3AD9 C;  2KFN A;  1C0U A;  5AXK A;  2CQP A;  1QSY A;  3J7Z 5;  4TVA B;  2R7X A;  4DPU A;  3O6Q A;  3CCW A;  5GAE U;  4KRW A;  4A8M P;  2IDL A;  1UA0 A;  2AWZ A;  5AXN A;  2YKO A;  3TUP A;  2NZC A;  3I56 S;  1NDL A;  2VFT A;  1WEY A;  2H4W B;  1NSQ A;  2GMJ A;  4OYW A;  1N5Y A;  4ZLJ A;  3SCL E;  4I67 A;  2B9E A;  2ZIT A;  2YKM B;  2K3K A;  2JVO A;  4WTO B;  5KG5 A;  2XHC A;  4PQA A;  5HAT A;  3UI3 A;  2LMI A;  3Q8P B;  3OXL A;  4OHV A;  5HL7 Q;  3O44 A;  3G4S S;  2DGO A;  4FF4 A;  1U1Q A;  1SVD A;  1KVJ A;  1FER A;  2RRA A;  2YKM A;  5IT9 Y;  4AND A;  5LJ5 Y;  1NPR A;  1JLQ A;  4LF8 F;  2YH0 A;  2BJE A;  4A8Q A;  3LGM A;  4CP5 A;  3T6B A;  1IKV A;  4YHH J;  3J81 Y;  5A2Q Y;  2MQQ A;  3ZZ0 A;  3TVZ A;  2UV8 A;  1SJ4 P;  2KFZ A;  1CJV B;  2V34 A;  1A0O B;  4NXM J;  1RHR B;  3QQC D;  4UQG A;  1HHS A;  1EX8 A;  4Q2L A;  3PW0 A;  3HX9 A;  3NS5 A;  4Z7C A;  2R8G A;  2VDH A;  4ECV A;  2XYG B;  4CCH A;  3UN2 A;  4QWE A;  4IOC Q;  4F4Y A;  1N33 J;  2QX0 A;  4NXM F;  3AQO A;  1CJV A;  4Y34 A;  1P6T A;  1KVK A;  4GC6 A;  4UUW A;  2MKC A;  3C6U B;  2DRB A;  1I6J A;  1RI7 A;  4PXD A;  4M95 A;  1GK8 A;  2HZV A;  3IR5 B;  5AXM A;  3TYT A;  3EZ5 A;  1HNI B;  4J9Q A;  4OZJ A;  1RWU A;  5E41 A;  3BR8 A;  1YVF A;  1B4S A;  1N33 F;  1HI0 P;  3PVX A;  5IQQ A;  1VQM S;  3MUR P;  3OPK A;  5KG4 A;  4YME A;  1K73 T;  4UW2 A;  5KFJ A;  1OMS A;  4NZ7 A;  3C6U A;  5AT1 B;  1FES A;  4B9M A;  3CE8 A;  3RRK A;  5KFP A;  4FP9 A;  1S4E A;  3B4M A;  1U26 A;  4OI0 A;  1U02 A;  3POT B;  2C2K B;  2Z2Z A;  2ZD1 B;  3H2U B;  4TY9 A;  1TL4 A;  3RR7 A;  1RYS A;  5CQG A;  2N82 B;  1HNZ J;  4KGV B;  3B4D A;  3ZZP A;  2AD9 A;  2KHD A;  3CJ2 A;  1OIA A;  3CJK B;  2KXN B;  1LXJ A;  1QVG R;  3HFV A;  2XI3 A;  3HKW A;  2JFK A;  1X4B A;  2D3U A;  2DNP A;  2DR9 A;  2J5A A;  2OAU A;  4ZLL A;  3POT A;  4ED7 A;  1RAI B;  2UU9 J;  2ZD1 A;  1HNZ F;  1YX2 A;  1UJ6 A;  2W9B A;  1U1P A;  5HQM A;  5HMZ A;  5BYS A;  3THP A;  2G0J A;  4I7F A;  2CPF A;  3G87 A;  3GYN A;  3CJK A;  3LGH A;  3SQG B;  4LT6 A;  5KFA A;  2MXY A;  2GO9 A;  2KT5 A;  4ZOS A;  5IM0 B;  2NLW A;  3VAF A;  1KC8 T;  1WHY A;  3KUE A;  1F3F A;  2E7W A;  1EQ0 A;  2WVB A;  4LF1 A;  1FD8 A;  2X7I A;  1IR2 A;  2UU9 F;  1RT7 B;  3D54 A;  3S7R A;  5KG3 A;  4ZPA A;  3FCH A;  1WI6 A;  4QWB A;  1OYE A;  1MW7 A;  5L8R C;  5J1P A;  1FT8 A;  1JLF B;  3SQG A;  5IFM A;  5IM0 A;  2L9W A;  2KRR A;  2XY5 A;  1Y11 A;  3M6V A;  3BQ2 A;  2RDD A;  3KLI B;  1S48 A;  1Y3K A;  2KN4 A;  1RT7 A;  3VTI A;  2OIH A;  2CVE A;  3KK1 A;  3QGH A;  1KEK A;  3BPD A;  4IRK A;  1MSW D;  1JLF A;  1FCA A;  2V94 A;  1H7X A;  2CAJ A;  1Z4U A;  4UF4 A;  2IMW P;  3KLI A;  4JI5 J;  2VOD A;  3QAT A;  2AX0 A;  4XTT A;  4RWX A;  1H2U X;  4EGL A;  3VGS A;  2IVY A;  3NS6 A;  2VJV A;  2A6M A;  1VQ8 S;  1V9O A;  5CAB A;  2GX8 A;  5BR8 J;  8ATC B;  3EVO A;  5CCL A;  2L41 A;  1R8P A;  2Q43 A;  3HXM A;  3UN3 A;  3C2P A;  2B6A B;  1H6K X;  4W90 B;  3BKF A;  2QFJ A;  1OSD A;  2V6A A;  3MWB A;  1Q7L B;  4KT0 C;  4A8O A;  4U95 A;  4JV5 F;  4Z7Y A;  3HF5 A;  1UVK A;  4UZC A;  3CSK A;  3M2R B;  2CPE A;  3DDN A;  5KT5 A;  3R8Y A;  5KFQ A;  4QU6 A;  5CZX A;  2LXF A;  3GJS B;  2W2N P;  1SC3 B;  5C24 B;  2VC0 A;  4WK1 A;  1X9S A;  2B6A A;  1KSP A;  4RPF A;  3T1Y J;  1ICE B;  1RJJ A;  2AW0 A;  2W2O P;  4RW9 B;  2GO8 A;  3ADA C;  4HHH A;  3MF5 A;  4CH7 A;  3M2R A;  1AUD A;  4HI2 A;  1J5O B;  5B0G A;  3DLE B;  5C24 A;  3WX4 A;  1T05 B;  1NZA A;  2AZ3 A;  3R7S B;  1RT5 B;  1P9Q C;  2JJ4 D;  3D9B A;  4P9S A;  3T1Y F;  2BMB A;  1X4G A;  3GV8 B;  4RW9 A;  4ED0 A;  3CCU S;  2B8P A;  4NL5 A;  1NK9 A;  2YWE A;  2VDI A;  4M5G A;  1SB6 A;  1J5O A;  3DLE A;  1BLU A;  1JXE A;  1WOR A;  2O67 A;  2AKW B;  1VQ5 S;  3R7N B;  1T05 A;  1OPI A;  1RT5 A;  4JYA J;  3I82 A;  2K7K A;  1L3U A;  4M5H A;  1X31 C;  2OGU A;  1KQK A;  4NLY A;  2YX1 A;  1VBY A;  1U0S A;  4NA1 A;  5D0E A;  1P1L A;  4PPZ A;  4PRF A;  1NXI A;  5KFW A;  5KFR A;  3SFU A;  3MPU B;  4NCA A;  3LP0 B;  4K7Q A;  1K1S A;  3OJS A;  2M52 A;  3BZQ A;  4JYA F;  4F4A A;  2AP6 A;  1T03 B;  4E0D A;  5D3G B;  3MCM A;  4USK A;  4ECQ A;  4DUT A;  3OTB A;  2M8H A;  1SC4 B;  2ZVS A;  3ILL A;  3LP0 A;  4DPT A;  4J9N A;  4NLO A;  3D6T B;  2QLF B;  2MQ8 A;  2NXJ A;  1N32 F;  3VF0 B;  2KM8 C;  2D9P A;  1S1U A;  1LFW A;  4OYP A;  5CCM A;  1TKT A;  2ZH7 A;  4W92 B;  2XQC A;  2WSC C;  3L9Z A;  1FDD A;  1T03 A;  3G8T A;  2DIT A;  5D3G A;  4CI0 B;  3BGR B;  3KHG A;  1HFE L;  4RU2 A;  3NP5 A;  2PFD A;  3GFZ A;  3CO9 A;  2PGC A;  2ZZM A;  3MMJ A;  1JNR B;  3BO2 A;  1AFJ A;  5HRO B;  4DFP A;  2IJN A;  2MST A;  1VQ9 S;  3VGV A;  4J9K A;  4XPE A;  1HIY A;  5D4P A;  1O51 A;  4ED8 A;  2HMI B;  1VIX A;  3OBI A;  4LRD A;  3GJT B;  5J1N A;  4I1T A;  1X9W A;  2R2R A;  2EFV A;  5HRO A;  4X84 A;  4S0M A;  3UD4 P;  1ARO P;  2L3M A;  4PXC A;  1X5O A;  3MM8 B;  4C3L A;  2B43 A;  3OTD A;  4J37 A;  3B82 A;  2HMI A;  4OZ3 A;  4PKD B;  1EAR A;  2K7J A;  2H54 B;  4NLX A;  2Y1J A;  3VQS A;  4DSL A;  3ITH B;  2HQI A;  1DQA A;  1W2I A;  4RW7 B;  1WG5 A;  1P27 B;  3FUY A;  1H7W A;  3TAQ A;  1PGZ A;  1X7V A;  2FUG 9;  3DXB A;  3DFE A;  3JTO A;  2GQC A;  2LEA A;  1VQO S;  2MYF A;  4OYX A;  2IRU A;  3ZC4 A;  3NGR A;  3ITH A;  4RW7 A;  4IH6 A;  3FGV A;  1VHF A;  2JEI A;  5L1K A;  4P2X A;  2DHS A;  4UOH A;  3CCV S;  2NXN A;  1X8D A;  2BQU A;  2Z2M A;  1CQM A;  4DN0 A;  1HBU A;  2FY8 A;  1XER A;  2CUY A;  1PAE X;  4MT1 A;  1UPP A;  1WOP A;  2FB0 A;  2AYM A;  3NL0 A;  2VOP A;  1S10 A;  1N0U A;  3ZZY A;  3EUN A;  3WX8 A;  3K89 A;  3AOC A;  1SQG A;  2POK A;  2VIC A;  1P9Y A;  5LMN J;  3GIJ A;  1PYT A;  3UD3 P;  1R3N A;  4UOG A;  4LF4 F;  3LW5 C;  1B0V A;  4LR8 A;  4U6P A;  1VHI A;  4IUF A;  2A2D A;  1M0S A;  3KHR A;  3V6J A;  1PJ6 A;  1NME B;  5LMN F;  3GR0 A;  1Q4R A;  2DEJ A;  5M2R A;  4ZIT A;  1VGY A;  4C8L A;  3IP0 A;  1PAU B;  1A9N B;  2XLJ A;  1VLO A;  2KKH A;  1HQE B;  1X5S A;  2Y3Y A;  5JXS A;  2YTC A;  2HNZ B;  1PYO B;  4F0K A;  2F8E X;  1FNX H;  3BKT A;  5GMD A;  4FYD A;  3KKF A;  4OJG A;  1L5U A;  3L3C A;  3GIM A;  2NR0 A;  1MLA A;  5DGB A;  4DV5 J;  2SXL A;  4DR5 J;  1HQE A;  2CJQ A;  3AJ2 A;  2QSF A;  2HNZ A;  1D3W A;  2V5H G;  2OTL S;  3TI0 A;  3PX4 A;  3QJL A;  4CLS A;  2CYY A;  2VFR A;  1NND A;  3Q0A A;  2U1A A;  4DV5 F;  3I96 A;  4C7Q A;  3G82 B;  4C2M A;  2PA3 A;  4IO9 Q;  4OX8 A;  4LIW A;  2F8H A;  3IBC B;  3AA9 A;  4R25 A;  2XZD B;  1CS4 A;  2ZBQ A;  1LWX A;  1RIS A;  4EI2 A;  1JKH B;  3TO8 A;  1T11 A;  4MIW A;  1UFW A;  4ZVO B;  1H98 A;  4AL6 A;  4H54 A;  1HW8 A;  1Y10 A;  3TVY A;  4OL8 A;  2MLY A;  4HHU A;  1FI4 A;  3N5B A;  3G82 A;  3A1Y G;  1SC6 A;  3DRY A;  2HBQ B;  1IQZ A;  1HPZ B;  2HEK A;  4RUH A;  2IHR 1;  1HWU A;  1JKH A;  2WB1 D;  3B54 A;  1U7L A;  2CNL B;  3G6V A;  2HK3 A;  3M8Q B;  5HVG A;  2H3E B;  4OLP A;  2KT3 A;  1SXL A;  2W2M P;  3R6L B;  3LP2 B;  3W8P A;  2D69 A;  5H9E K;  3V4I B;  1TK8 A;  2BW7 A;  4TY8 B;  1HPZ A;  4PAA A;  2ZHA A;  3FNN A;  4B3S J;  1ZPW X;  3MM9 B;  1F6T A;  2EWH A;  5ETM A;  4X4U A;  3M8Q A;  3MOZ A;  4KE5 A;  3BR9 A;  3IWL A;  1XC9 A;  3W5Z A;  3OXG A;  4YB6 A;  3KLF B;  3DHX A;  3LP2 A;  3M2U B;  5A76 A;  3HM9 A;  4EBE A;  3B78 A;  2IVF B;  2LEB A;  3S1T A;  1RWV B;  5DZ6 A;  3V4I A;  2P6S A;  3VWS A;  4Y2I A;  1RKI A;  9RUB A;  3U1M A;  4TY8 A;  3RB6 A;  3MM9 A;  2FTR A;  1L3S A;  3HFK A;  2MJU A;  4WXW A;  4USV A;  4KBI A;  1UVM A;  4I4B A;  4I0W A;  4CLK A;  2DH7 A;  3M2U A;  1AFI A;  1IVZ A;  3EE3 A;  4NA2 A;  2W4P A;  3KXD A;  2UVR A;  4F7V A;  2V68 A;  1FJC A;  1NM2 A;  5KT6 A;  1RSC A;  3KFW X;  1DQ9 A;  1S6P B;  2J76 E;  3TEH B;  4F3M A;  3GSI A;  4Y2A A;  3FRZ A;  3FJ2 A;  4Q7A A;  5DZ7 A;  1XK8 A;  2C3O A;  4A4J A;  2WK4 A;  3PJW A;  3HDS A;  2E5G A;  3BEG B;  5B0A A;  2G0C A;  2ROG A;  2YX7 A;  1RQ0 A;  3ZZT A;  4JI8 J;  3GU0 A;  1C2P A;  1RWK B;  2Q3P A;  3MED B;  5F8L A;  2CG4 A;  1YJV A;  2KO1 A;  1SKR A;  2VF3 A;  1DTQ B;  2V8V A;  2KYZ A;  2XS7 A;  2RIJ A;  3SV4 A;  2BE2 B;  4QQB A;  2KI2 A;  1IKW B;  3WC0 A;  3U27 A;  4M5L A;  2W8L A;  4ZPD A;  4JI8 F;  2VKR A;  1VDH A;  5D4L A;  2P9E A;  1H73 A;  2IDE A;  4OV6 A;  4IH7 A;  1WI8 A;  3MED A;  2NQP A;  4RJV A;  2XWX A;  2R7Q A;  1S0N A;  4N8O A;  3KTQ A;  2YNF B;  2KFY A;  2UXC F;  1UTA A;  1DTQ A;  3J7Z T;  5T7L B;  1WHX A;  3I4H X;  5KFZ A;  2BOP A;  2BE2 A;  4RBV A;  1RE1 B;  4J90 A;  1RHU B;  3BV8 A;  3EVM A;  1LKZ A;  2CZ4 A;  5M2U A;  3MUV P;  1S72 S;  4B3M J;  5CYJ A;  2M88 A;  3MTJ A;  3FCV A;  5T7L A;  4F4W A;  1N88 A;  1RXO B;  3OTC A;  3NAH A;  4J9L A;  2ZM6 F;  1N5Q A;  2JDJ A;  1CG2 A;  2PEH A;  3FBE A;  1TMJ A;  3M2V B;  2M3D A;  1VCT A;  4B3M F;  1HA1 A;  3EXY A;  1SJ1 A;  2ZFH A;  3BB5 A;  1S12 A;  2ZZT A;  2OPS B;  3PFO A;  3A8J A;  1WF2 A;  2BX6 A;  1RZM A;  2WZ1 A;  1WF1 A;  1RT3 B;  1NBE B;  4L75 A;  3J7Y U;  4ZPC A;  2DNO A;  2RJZ A;  3M2V A;  2HGN A;  5B0C A;  2QA4 G;  5EN1 A;  1U0H B;  3H25 A;  1RP5 A;  2OPS A;  3GJQ B;  5DG9 A;  3THV A;  4HKQ A;  2EPI A;  1EHW A;  1RBL A;  1U1K A;  4DR4 J;  2DHG A;  4DSI A;  2K06 A;  3FZB A;  3R7B B;  3I5B A;  1HHQ A;  2JH3 A;  2FJB B;  1SPB P;  1RCO B;  1X4D A;  1YRX A;  4B9V A;  3H5X A;  4B02 A;  2UUA F;  3AOD A;  2ZH6 A;  4E2F B;  3RB3 A;  1U0H A;  4HYK A;  2WRM A;  1WKJ A;  3I4P A;  1P8G A;  1LEO A;  2ABY A;  4ILR A;  3MMB B;  4DR4 F;  4MJK A;  3MPW A;  3IS9 B;  1KQG B;  1VBX A;  4C11 A;  3E01 A;  2R4F A;  4DU7 A;  1GTH A;  4F36 A;  4HTJ A;  1K8A T;  3QPI A;  5L1L A;  3AHP A;  4DR2 F;  1I3O B;  3D28 A;  4IRD A;  5EX0 A;  3MMB A;  3ULH A;  2V50 A;  2C2M B;  4TXS A;  4F4K A;  4K4W A;  4C0O C;  1WOO A;  2O5D A;  1VC0 A;  1AUS L;  2NXE A;  3NCR A;  4JI2 J;  4B9N A;  4ILL A;  1V5I B;  1S1W B;  2XMA A;  4Y00 A;  1YBA A;  4UOC A;  1IWA A;  1EB0 A;  1IR1 A;  4OI1 A;  4LRE A;  4FN5 A;  2HFO A;  1FXD A;  3PIO Q;  5C2G A;  2J0Q D;  1F5A A;  3FEX B;  5B09 A;  1V3R A;  4AE5 A;  3THT A;  1J5E J;  3BKU A;  2NYH A;  2FHJ D;  2XNQ A;  2AGQ A;  1FWP A;  5KT3 A;  4V19 J;  4JI2 F;  2IBK A;  2CQG A;  3QRR A;  2IA0 A;  4DCJ B;  2HG4 A;  1DBD A;  2WVF A;  1S1W A;  3S01 A;  4EYI B;  4DQQ A;  3OVA A;  2ZH1 A;  4CM0 A;  5AJ3 J;  2Y8W A;  3FCW A;  2EW9 A;  2QYG A;  3DC2 A;  1NJI T;  2OD4 A;  2B7C B;  2VL1 A;  5B0D A;  5CZV A;  1J5E F;  1RU1 A;  3CCQ S;  4CT9 A;  4RNM A;  4KJI A;  3PNI A;  3CD7 A;  1OWX A;  1ZM2 A;  4OYI A;  4P10 A;  4N56 A;  3ZZZ A;  4ZVP B;  5AJ3 F;  4EFA C;  2H5J B;  1HNW J;  3W65 A;  1VQK S;  3K58 A;  3RTV A;  2X1F A;  1L3T A;  4NLP A;  4ZVH A;  3CW2 C;  3T9N A;  3ET6 B;  2C3U A;  2KH9 A;  3T19 A;  1RAC B;  4WFZ A;  4LF6 J;  1SKU B;  1NJW A;  1VJQ A;  4C9D A;  5H9E J;  4Q0B B;  4PUO A;  3QSY B;  4R0E A;  3PJX A;  1YBU A;  4YFU A;  5KG6 A;  3A13 A;  3KK3 A;  3M6U A;  1HNW F;  3EDQ B;  1VQL S;  3BH6 B;  3IO1 A;  2XSJ B;  3ET6 A;  5DGA A;  3QIP B;  1VIS A;  2IMO A;  3JQK A;  1VQY A;  2E5J A;  4LF6 F;  2GJF A;  4Q0B A;  1NDP A;  2MKH A;  4OZL A;  4BC9 A;  4I2Q A;  1UCN A;  3ICL A;  1F60 B;  3OQ2 A;  2QMU B;  5F8M A;  2J9D A;  5U47 A;  3DKD A;  3D0I E;  3CWJ A;  2FVQ A;  4DDF A;  1O6X A;  3CUL A;  2IPO B;  4YY3 J;  4LFA J;  2XSJ A;  3QAU A;  3QIP A;  2MLX A;  3DGV A;  1S0O A;  2WW8 A;  1RTI B;  5E3C A;  3VAJ A;  3A3P B;  3NNH A;  3P4U B;  1U49 A;  5H1S V;  4IR1 A;  4OZ1 A;  1GXL A;  4ZN1 A;  1FJG J;  1HI1 A;  4C98 A;  2ZZN A;  5HJX A;  2Q1L A;  1IBK J;  1RGV A;  4LFA F;  1JLG B;  3HFZ B;  4X2B A;  4JV2 A;  3MCO A;  1R0B G;  1Q95 G;  3I0R B;  3DDI A;  2APO A;  2MZJ A;  5JMN A;  2FD2 A;  1AYE A;  1KS2 A;  3HKZ D;  3KHH A;  4LQ3 A;  1UFL A;  1FJG F;  1DY3 A;  3M6W A;  2HFN A;  1IBK F;  3MHY A;  4F0H A;  4DHV A;  1WTB A;  1JLG A;  3DLL Q;  3MR2 A;  3EGZ A;  2BOA A;  1KFS A;  4XIU A;  4R8U A;  4WFY A;  3FFI B;  2QV6 A;  2UXD J;  2XG8 A;  4X62 J;  1KNZ A;  1S99 A;  1WC6 A;  1OY6 A;  4YN3 B;  1YBT A;  5J2P B;  2KU7 A;  2RB7 A;  2R2U A;  1RAO A;  2DHX A;  4DV0 F;  3TAN A;  4I56 A;  2I8E A;  2XM3 A;  1CJK B;  3Q2T C;  5I3P A;  3FK4 A;  4OX9 J;  4J9P A;  4WII A;  2ZH4 A;  2UXD F;  3FFI A;  4CLZ A;  4LBI A;  2B9Y A;  3CD5 A;  3QLH B;  3GR1 A;  4G1I A;  2XB2 D;  2BJ1 A;  3EVW A;  3KJQ B;  3KK2 B;  5J2P A;  5LOQ A;  1JJ4 A;  1WF0 A;  2ZE2 B;  1OQ6 A;  4MKA A;  2LXU A;  1B64 A;  2DO4 A;  2XLI A;  4OV1 A;  5ETV A;  1CJK A;  4OX9 F;  3VQT A;  2JVR A;  2M5Y A;  1TKD A;  4F2S A;  2DGW A;  4BLG A;  1SJ3 P;  2C2O B;  3QLH A;  1RHK B;  4OZ0 A;  5L39 A;  3KK2 A;  3CCL S;  4DMZ A;  1V6H A;  3HJV A;  1UWA A;  2ZE2 A;  2OPQ B;  3I9V 9;  3BN4 A;  1FXR A;  3ETO A;  1HBN B;  4ZVG A;  2VG6 B;  2BXJ A;  1R7I A;  4ZJO A;  5ETN A;  2NUH A;  5AE1 A;  1R43 A;  1RB0 A;  1R31 A;  3SYZ A;  3IGV A;  4DV7 J;  2DGT A;  2G0I A;  1HKA A;  3M8Y A;  4LF7 J;  2OPQ A;  5H9F K;  2ASY A;  4A8Y A;  5EX3 A;  2KM8 B;  4PCQ A;  4LIR A;  3K5L A;  1HBN A;  2PII A;  2VG6 A;  4U96 A;  1YK9 A;  3UE2 A;  3LWM A;  2ZH8 A;  3N79 A;  3Q8Q B;  1ZOT A;  3PYD A;  4DV7 F;  3HHL D;  3HP6 A;  4YB7 A;  4LF7 F;  1MG7 A;  2HHT A;  2UP1 A;  3M8P B;  3OUY B;  2HWH A;  1B7Y B;  4OFZ A;  2XMM A;  2GIF A;  3KG4 A;  2HNY B;  2N4C A;  1XN9 A;  4KFB A;  3EWG A;  2MQL A;  2NZ4 A;  1HLW A;  4A8W A;  4FYX B;  2DB1 A;  4ED1 A;  3M8P A;  4DI6 A;  3OUY A;  4NXN F;  4O3R A;  5RUB A;  2CQB A;  3PW5 A;  1TL3 A;  1O8B A;  3PHE A;  2EK6 A;  1S4F A;  4JOU A;  2WHO A;  3GG1 A;  3SSR A;  1IN0 A;  3ZTS A;  4X4S A;  2HS4 A;  1Z2L A;  2GHV C;  5FDL A;  3NBP B;  2RVJ A;  3NWR A;  1GMV A;  3ISZ A;  2LQB A;  4O3S A;  3NGS A;  2MZT A;  2CKW A;  4QU7 A;  2C1E B;  4F67 A;  1Y9O A;  4QYR A;  2YWH A;  2MSS A;  2BYC A;  3T1A A;  1WSR A;  2Y8Y A;  3EGN A;  2W25 A;  2BW2 A;  3Q8Y A;  2I1R A;  2MTL A;  3NBP A;  5GAH I;  4NLT A;  1WDD A;  3HHK A;  4LBP A;  4FBU A;  4FF1 A;  1B99 A;  4RBT A;  4K4T A;  2BJ8 A;  2PD1 A;  1R8H A;  4NLQ A;  3IM8 A;  4DCP B;  3HSD A;  3T6J A;  3H59 A;  3BGO P;  4ES3 A;  2E66 A;  1VQ4 S;  2W24 A;  4DPY A;  1GMW D;  5FD1 A;  2B9X A;  3MM5 B;  3QGG A;  3CJS A;  2AJ4 A;  3H20 A;  4PAB A;  1WSV A;  3P96 A;  4DL6 A;  3MPY A;  4O0I A;  2RML A;  3P3D A;  2V67 A;  5HLF B;  3HLU A;  3TQE A;  2O1P A;  2BDP A;  3SQO P;  2ROP A;  1IBC B;  3LP1 B;  4ZP7 A;  2NXC A;  5K20 B;  4MIB A;  3MM5 A;  1RAJ A;  2ZJQ Q;  1YJU A;  4LR9 A;  4DS4 A;  3OSN A;  4CLY A;  3EZU A;  5D4O A;  1SQE A;  2F4V J;  4L3N A;  4ZHR B;  1KR4 A;  3SBM A;  3LP1 A;  3IG1 B;  5LMU J;  2MGZ B;  2UXB F;  1RT6 B;  2XZT B;  3I31 A;  5KFG A;  4Q8F A;  2MKY A;  4DL2 A;  4QR1 A;  2V9K A;  3R5G A;  2BKO A;  3HD1 A;  5KFM A;  2WSF C;  1KHV A;  2FHO B;  4KHP J;  3A8E A;  4P75 A;  4LVO P;  2F4V F;  1IM6 A;  1T0T V;  4ZHR A;  5J2Q B;  1AW0 A;  1ZTT A;  2RDI A;  1DAX A;  2PI4 A;  1SI9 A;  3IG1 A;  2MKK A;  5E7O B;  5HP1 B;  3CMQ A;  2MGZ A;  4ID8 A;  1E6V B;  2W9C B;  1ZBT A;  3VAG A;  2K1R B;  4TKT A;  5AE2 A;  3DLJ A;  2CIM A;  2WVE A;  1NSK L;  2FZK B;  3K5O A;  1NPP A;  4KHP F;  3C14 B;  1JLE B;  2CQH A;  2DNY A;  1NU4 A;  3HK2 A;  1RUS A;  5GAG I;  2YBV A;  3I5C A;  4HLB A;  4URG A;  1WEL A;  5D0G A;  1YQH A;  4PG4 A;  5B08 A;  5HP1 A;  2DXD A;  4TQR A;  1E6V A;  2R7U A;  4OQJ A;  2W9C A;  2FHM A;  2K1R A;  3DLK B;  3NCQ A;  3HT3 A;  1CPZ A;  5KFY A;  2MY7 A;  3HPO A;  4C0H A;  2VHG A;  3C14 A;  1JLE A;  3P6Y C;  2RRN A;  3M4X A;  4A47 A;  2CA9 A;  3MGJ A;  3TAP A;  2GQ2 A;  1RT1 B;  3W1Y C;  1NUE A;  3GCW P;  1REG X;  3OFH A;  5GMK a;  1S9E B;  1Q8K A;  3GIR A;  1JLC A;  3RAM A;  3RAX A;  3EMT A;  1WKK A;  4QIE A;  2J9C A;  1S1V A;  3DLK A;  4PYA A;  2LQJ A;  4FXV A;  1JX4 A;  2GIQ A;  3H98 A;  2RAQ A;  1RT1 A;  5LL6 d;  5ETR A;  1SJR A;  3CC2 S;  4RO0 A;  1S9E A;  2RIL A;  4ZCM A;  5C5J A;  4LSN B;  2G13 A;  3NNA A;  1R8C A;  2ZC3 A;  4WPA A;  4P52 A;  5KFO A;  1X0P A;  2VBX A;  3K8W A;  2BV3 A;  2FJV A;  2K3I A;  1OYD A;  4JBC A;  1HR0 J;  3W5X A;  1RA6 A;  1UWB B;  2WTF A;  3VZI A;  3FMW A;  3CJQ A;  3VAK A;  4CTA B;  2R42 A;  5KG2 A;  1QAI A;  3FBB A;  4ZJQ A;  4KGX B;  3R5D A;  4DV4 J;  4O44 B;  3V6D B;  4LSN A;  4ZIV A;  2GJI A;  1XEZ A;  1HR0 F;  4FS2 A;  1XR5 A;  1VRT A;  4B3T J;  4OHZ A;  4B9L A;  3D0H E;  4CTA A;  2E5I A;  2OKQ A;  1Y4Z B;  4DV4 F;  3GII A;  1TZ0 A;  1U1L A;  2BAN B;  4LRB A;  4O44 A;  2H51 B;  4RL1 A;  4ATN A;  2ALZ A;  2HK2 A;  2XLK A;  3F41 A;  3Q8R B;  3BQ0 A;  4OX6 A;  1GNK A;  1JJ2 R;  3TOQ A;  3EX7 B;  1UJ4 A;  1QAY A;  3NY0 A;  4B3T F;  3OL9 A;  2E9Z A;  2KVI A;  2RQ4 A;  2OEK A;  5H9F J;  5BYR A;  2D9O A;  2BKP A;  1XMO J;  5IT9 U;  2EXU A;  2BAN A;  3NGT A;  2ASD A;  2ZNY A;  3BSN A;  2BQ3 A;  5D4N A;  3OHB A;  1T9U A;  3R3T A;  2XHW A;  2AYB A;  2WOM B;  3DLG B;  3W9I A;  1SL2 A;  3J81 U;  5K8M A;  1SH3 A;  2ASJ A;  1JNZ B;  3V4M A;  4O4R A;  1S9G B;  3PW4 A;  2GS8 A;  1SBR A;  1WEZ A;  5J2N B;  2YKN B;  2C3P A;  1QD1 A;  5DG7 A;  2WVD A;  3A8K A;  3HZE A;  4DFK A;  2HRT A;  2AYE A;  2NUU G;  3HVR A;  3SCI E;  5EWF A;  2CQI A;  5GAH U;  4DR3 J;  2BE7 D;  2ZH3 A;  3DLG A;  2ZKU A;  2B8Q A;  5HK4 A;  2F8M A;  4ZLN A;  3GYX B;  3BDE A;  4PXE A;  5J2N A;  3CJ5 A;  2GV1 A;  2RQK A;  3PRB A;  2IA6 A;  2HZA A;  4DR3 F;  1R89 A;  4GVL A;  3M9M B;  3PIP Q;  2YKA A;  1S9F A;  3JSM B;  5SZT A;  4OJH A;  1TL7 B;  3D4J A;  3OSP A;  1XQI A;  3K5N A;  4CLL A;  4DS5 A;  4TYA A;  4P6Q A;  2RS8 A;  3HHD A;  2N7Y A;  2GML A;  5EHH A;  2V4R A;  3TX8 A;  3GJR B;  3JTN A;  4AFF A;  3JSM A;  2QZ8 A;  3OD2 A;  3CCR S;  2JC1 A;  1TL7 A;  2OUG A;  3WDO A;  2IRX A;  4K4Y A;  3QO9 B;  1PYS B;  4KB7 A;  1BY9 A;  2E7X A;  4MFB B;  2PO4 A;  3OFG A;  4AQY J;  3NEK A;  3MR7 A;  3NS7 B;  4ED4 A;  1N5T A;  1M1G A;  2F7V A;  2W7A A;  3Q8S B;  3SV3 A;  3MR3 A;  1RLC L;  1N48 A;  1VRQ C;  2ZDP A;  5F8I A;  4L72 B;  3RR8 A;  4U7U D;  3GV5 B;  3CB4 A;  2X3D A;  3UWT A;  3QGP A;  1IUJ A;  2LEC A;  3Q22 A;  3C66 A;  4OHY A;  5EWG A;  2YPZ A;  2J9D E;  4I2P B;  4DL3 A;  1X4F A;  2KXH A;  4JV0 A;  4MFB A;  3FC9 A;  2J9E A;  2HHS A;  4AQY F;  4B9U A;  3GWC A;  3EGV A;  3BO3 A;  2IAJ A;  4TU8 A;  1NHU A;  2GVD A;  4NWB A;  1QVF R;  2V8G A;  4WKY A;  2DGS A;  1GQE A;  5GAG U;  1WC1 A;  3R1H A;  3V6H A;  4I2P A;  4Y0F A;  4DV3 J;  2PT0 A;  2H48 B;  4NLW A;  2A6O A;  1SQF A;  3RW6 A;  2JL9 A;  3DU6 A;  3NOG A;  1QDU B;  3W2V B;  2CQD A;  4CQ1 A;  4WJB A;  1BQM A;  2ATL A;  1RCX B;  1U45 A;  1R0C B;  1UVI A;  3MEE B;  4MKB A;  1BXN A;  3KLH B;  2B4V A;  3H7H B;  1RHQ B;  4DV3 F;  4CYU B;  1R8A A;  1UL3 A;  1Q16 B;  3AA8 A;  3AQP A;  3GTY X;  4ELT A;  4X65 F;  1VBZ A;  3W2V A;  1SUQ A;  2EG2 A;  1CSJ A;  2R7O A;  2IY5 B;  2DD8 S;  4JV1 A;  4I6Y A;  4DV1 J;  3MEE A;  3KLH A;  4ZPB A;  2R9L A;  4GKK F;  4CIO A;  4CYU A;  2HND A;  4YS2 A;  3W2W B;  1PIE A;  4KQZ A;  5A6W A;  1KQF B;  1R6Y A;  3W61 A;  1W26 A;  1NK8 A;  4DU8 A;  4DV1 F;  4M5I A;  4F0M A;  1UA1 A;  2VPX B;  3HI9 A;  3RG6 A;  3CMA S;  1FRL A;  4OZ2 A;  1URR A;  1BC6 A;  3PYE A;  1VQ7 S;  4LSL B;  1URN A;  2G9O A;  3BYR A;  2FIU A;  4ZP6 A;  3UNY A;  3DLH A;  2VB6 A;  3W2W A;  1KRP A;  3LTO A;  3GMG A;  3TJA A;  2HKE A;  5F0U A;  4M1K A;  2EFQ A;  5CXT A;  3UO0 A;  1TV6 B;  2MY8 A;  2OSR A;  1RAE B;  1UZH A;  2GZO A;  2HBY B;  4LF5 J;  1EZZ B;  1TL5 A;  3UDE A;  3ZO7 A;  5A8W B;  4LSL A;  3HO1 A;  4NZ0 A;  4ECU A;  2RNE A;  3NG8 A;  5I3Q A;  4ICL B;  2QL9 B;  1TV6 A;  2V0N A;  4LF8 J;  5GAD I;  4LF5 F;  1PO6 A;  3KWM A;  2Q79 A;  3QID A;  4OI2 A;  3P5B P;  2C2Z B;  5A8W A;  5LXR A;  3H5Y A;  3T9Z A;  4MK8 A;  3CJ4 A;  3BRE A;  3I87 A;  5IT0 A;  1KTV A;  5E3R A;  5DM6 Q;  8RUC A;  2FJE B;  1U24 A;  3T5J A;  2EK1 A;  5L1J A;  4B3R J;  1KVI A;  2LU1 A;  5DDQ C;  3SMZ A;  5IZH A;  4K4S A;  3CCS S;  1GTE A;  2AEJ A;  1FEH A;  5K5M A;  2WSE C;  4Q2M A;  2W8K A;  2HHP A;  2QT7 A;  4Y2K A;  4DZD A;  2CXE A;  3MMC B;  5KFV A;  3TJ9 A;  1N56 A;  4MAK A;  4RUB A;  2KHC A;  2ZDO A;  3FZ2 A;  4B3R F;  3H2L A;  3R1L A;  1DLO B;  2MQO A;  2B3T B;  1N5S A;  3L7O A;  1Q8L A;  1QAJ A;  3EXC X;  1H3D A;  4ZS6 A;  5AE3 A;  1UP1 A;  5JVG Q;  3CO0 P;  3PR5 B;  2CJY B;  3OLA A;  1ZA2 B;  5KFD A;  3BPS P;  3MMC A;  2WW4 A;  3QWP A;  1PBA A;  1N0V C;  2DNZ A;  2PN6 A;  4EMD A;  2DR6 A;  3OXF A;  1Q8B A;  3HHN B;  3C16 B;  1VJW A;  2HWT A;  1DLO A;  5BJR A;  1NJZ A;  3G71 S;  1LWE B;  1U1O A;  4OHW A;  2RQM A;  2DNH A;  4UUX A;  1N52 B;  4M63 A;  4ERD A;  2V8P A;  4HL9 A;  4K5S A;  4OYM A;  3U1L A;  2ZWP A;  5ETT A;  3TZW A;  1WHV A;  3ZNU A;  1MMD A;  4CWB A;  3ENQ A;  3NWG A;  3IM9 A;  2DCL A;  1S6O A;  2Z4P A;  4A8S A;  3C16 A;  4BBY A;  5C25 B;  4M5D B;  2BZ2 A;  4KPY A;  2ASL A;  1UEK A;  1LWE A;  1ZYQ A;  3QZ7 A;  3PRV A;  3J80 U;  5B0E A;  1KKH A;  5CD4 H;  1HNI A;  1F0X A;  5IV4 A;  4NOH A;  4OIX A;  4PWW A;  5CD4 A;  3ETM A;  4HDG A;  1OQ3 A;  3H40 A;  2EFG A;  2VKZ G;  4NEY A;  4WP8 A;  3NMR A;  3N6N A;  3H0P A;  2R3V A;  3AJD A;  5C25 A;  3GV7 B;  4M5D A;  2QMW A;  4DPW A;  3O3L A;  2AGO A;  1YSJ A;  2CFX A;  4ZPV R;  2WVC A;  2IM3 A;  3UN5 A;  4OI4 A;  4A46 A;  2ACM A;  1T8E A;  3T5K A;  2YNH B;  3FQK A;  1M5H A;  4P72 A;  1U1N A;  3ZZR A;  1QSL A;  4ECS A;  2CWK A;  4IO1 A;  3WHI A;  1AB8 A;  4LFC J;  2EKY A;  3CD6 S;  3DNC A;  3RU0 A;  3FSI A;  5DDR C;  2HQ3 A;  1UPM B;  2OJ3 A;  3TW0 A;  5KFK A;  1TAU A;  2XGQ A;  4OZN A;  1UFK A;  3QSI A;  3E8O A;  5IC4 B;  1F9H A;  2YNH A;  5ETS A;  2OMO A;  5DDP C;  1B3T A;  4ID5 B;  3VAM A;  1RAF B;  2AEM A;  1NK7 A;  4LFC F;  2CPY A;  2RSQ A;  4ECZ A;  1W25 A;  1VK8 A;  2EFN A;  4XK8 C;  4ANE A;  5T14 A;  2HFV A;  2XCA A;  1H72 C;  3BGL A;  1KLN A;  3P5T L;  1QM9 A;  4ID5 A;  3R2C J;  2WON B;  5L46 A;  2JHE A;  2ZVI A;  5KFS A;  1YJN S;  2KXF A;  1RHM B;  3DYA B;  1Q79 A;  2JLE A;  1A6L A;  2ERR A;  4QWD A;  5F8J A;  4DBQ A;  4CDI A;  2YWW A;  4K2J A;  2ATC B;  1UEU A;  4YB5 A;  2FPH X;  2HVE A;  2F5G A;  2R8H A;  4LUB A;  2M0G B;  5JUM A;  4K50 A;  4C8O A;  4JI3 J;  2WON A;  4JV5 J;  3OT9 A;  3A4T A;  3DCA A;  1NJX A;  4HTI A;  3DYA A;  2MZR A;  2P8I A;  3VV2 B;  1Z1Z A;  1TEL A;  5LSL A;  2DIV A;  2ZWO A;  4ZPW R;  3RBX A;  1YHQ S;  4BWM A;  2H65 B;  4DX7 A;  4W98 A;  3GCX P;  2AGP A;  2V4J B;  4JI3 F;  2MKI A;  4CNZ A;  1DTT B;  4WBF A;  4D3G A;  2X3G A;  4L3K A;  4QIV A;  2H1Y A;  1Y0H A;  4G65 A;  1NRK A;  1M5O C;  7FDR A;  1LFP A;  2R7V A;  2R8J A;  4O4G B;  3P45 B;  1XWL A;  3BBB A;  2CZ9 A;  2IJF A;  3ILO A;  2V4J A;  4WE1 B;  2R7T A;  1UJ5 A;  3NAI A;  1QSS A;  3QGI A;  4XAK A;  5KFU A;  2KG1 A;  1T3O A;  3L7P A;  3R5A A;  4JI1 J;  3T1H J;  5HQ8 A;  3IN5 A;  2NYI A;  4J7C A;  1S6Q B;  3CIZ A;  1ZS6 A;  1G6B A;  1PBU A;  3JXO A;  2AEF A;  2CQ1 A;  5GAD U;  4DQS A;  1CJU B;  4O4G A;  2XCP A;  1BHN A;  4AL5 A;  3VHQ A;  1S0M A;  3W7B A;  4USH A;  4WE1 A;  5K8N A;  4C0B A;  3GQC A;  2GQQ A;  2RKI B;  1T95 A;  4LFB J;  4JI1 F;  3T1H F;  3QJJ A;  2IFX A;  4DXL A;  1CEZ A;  1S6Q A;  3T41 A;  1RWO B;  3EPI A;  1CJU A;  2OPP B;  3L7U A;  3WBZ A;  3EM1 A;  5DS7 A;  2UUB J;  2P5V A;  4ZP9 A;  4F3Q A;  4LRF A;  4LFB F;  2RKI A;  5KTQ A;  3PX0 A;  1ZAW A;  4V1A k;  4IG3 B;  4A8X A;  3W60 A;  2DEI A;  3J7A N;  3PAC A;  2ZOG A;  3JQM A;  3FEZ A;  3GB0 A;  3E51 A;  4CH1 A;  1N32 J;  4CO2 A;  2OPP A;  2UUB F;  4OI6 A;  3PW2 A;  4N8N A;  5C42 B;  3O8W A;  3CT9 A;  2L9N A;  3GSD A;  2GAH C;  1TFY A;  1ZZN A;  2M2B A;  1I5O B;  2EEY A;  5E3A A;  3CNQ P;  2B4P A;  1VQ6 S;  4IG3 A;  3W64 A;  4RW4 B;  1UKU A;  2ALY B;  4OX7 A;  2HIQ A;  4DR1 F;  1X9M A;  2FHK A;  1D8Y A;  4AUK A;  1AXQ A;  5EDW A;  2Y1I A;  5C42 A;  1YJW S;  3IWN C;  2ZUA A;  4BC7 A;  4EZ9 A;  5HMW A;  1S57 A;  1MN9 A;  4Y2C A;  2RU3 A;  4RW4 A;  2CQ3 A;  4EBD A;  3BSC A;  5HJY A;  1YWX A;  3BGU A;  1MRO B;  5IS2 A;  7FD1 A;  4LBH A;  5KFN A;  4FPI A;  1N54 B;  4C8M A;  2FYX A;  4HH0 A;  5IT4 A;  2HHU A;  5GAE I;  3ONQ A;  3BGR A;  2VG5 B;  5LSR A;  1F9E B;  1Q1K A;  1REV B;  2WCX A;  2XMU A;  4MIA A;  3UW1 A;  4FBT A;  4DPO A;  3J80 Y;  3OR1 B;  3IRX B;  2Z2Y B;  2CJ9 A;  3LUY A;  1F2G A;  1MRO A;  4DL4 A;  3M9N B;  3UDL A;  1WG1 A;  2IBO A;  1IBL J;  4MKV A;  4UTG A;  2Z8Q A;  3H4B A;  4R0J A;  1JLA B;  1FWK A;  2I5J B;  1UMJ A;  1DFD A;  3K2Y A;  1N6Q B;  2VG5 A;  1ULR A;  1OO0 B;  1JXL A;  1LWF B;  2PMZ D;  4DLG A;  1REV A;  1VR6 A;  5B0F A;  3OR1 A;  3HUL A;  5F8G A;  3IRX A;  2AZ1 A;  3CXC R;  2GMH A;  4IKA A;  2DBB A;  2VU5 A;  4DR7 F;  4WP9 A;  1IBL F;  2R8K A;  3RB0 A;  1D9D A;  1FEE A;  2DK2 A;  4AD6 A;  3MM8 A;  2HQC A;  1JLA A;  2AJQ A;  5KFC A;  4WKR A;  2Z2L A;  2MZ1 A;  1UVJ A;  4NCG B;  2FZC B;  4URS A;  1N6Q A;  1YIJ S;  1LWF A;  4ECX A;  1D0E A;  1WEX A;  1HMV B;  4HVZ A;  3DN9 A;  3N28 A;  4ETX A;  2D74 B;  2QLX A;  2F1F A;  2BQR A;  4DG1 B;  2ZC4 A;  5F8N A;  1G1X A;  4NCG A;  5HSP A;  2DNQ A;  3LPE A;  4ETZ A;  4UY8 5;  1S77 D;  4EYH B;  3BGF A;  2DR5 A;  1HMV A;  1XR7 A;  2OLW A;  4QYZ K;  1GT8 A;  3MPV A;  3TUJ C;  2XYH B;  4LF4 J;  2GHW A;  2BJ9 A;  4DV2 J;  4OYA A;  4G3I A;  4YR2 A;  4DG1 A;  2Q66 A;  4TN2 A;  4O3O A;  3RW7 A;  4WF9 Q;  2AJ0 A;  1CC8 A;  5KG1 A;  2Z56 B;  3LGN A;  4DSK A;  3RUB L;  3Q8V A;  3SEO A;  2KZZ A;  2AV5 A;  4R5P B;  4F04 B;  1YJT A;  2Y0S D;  3EJM A;  1MWQ A;  2UUW A;  2VBZ A;  4DV2 F;  3KHL A;  4L76 A;  4NLV A;  5FLX U;  2XGP A;  3MDF A;  2LP4 A;  1UVN A;  2E1M C;  1EJ7 L;  4DQR A;  4B9T A;  2W2Q P;  4DL5 A;  1X5P A;  4FYW B;  5E3Q A;  1SKW A;  4R5P A;  7AT1 B;  4WFX A;  1FD2 A;  2XSF A;  4AYB D;  2VG7 B;  5DQG A;  2CDR B;  2PDA A;  5T41 A;  5L9X A;  3TEG A;  1JQG A;  2P9C A;  3NNC A;  4DUY J;  3LF0 A;  4QW8 A;  3PO5 A;  2E29 A;  1HWK A;  2VPW B;  1C4C A;  5K14 B;  3HHL C;  4M8L A;  4B17 A;  1SJQ A;  1G4C A;  4MK7 A;  4NLD A;  2VG7 A;  5LM7 E;  1DRZ A;  1OY8 A;  3WIV A;  2DNG A;  1RYR A;  4PXB A;  3AJ1 A;  1FF2 A;  1ACM B;  4PQU B;  4NYO A;  4DUY F;  3RRH A;  1D8Z A;  1SL1 A;  2HBZ B;  3G6X A;  1X0F A;  4NAS A;  2P6T A;  5K14 A;  4F2R A;  1XNR J;  2ADC A;  3KJF B;  4IFY B;  3LA0 A;  3KLV A;  2Y1R I;  2V9W A;  1HW9 A;  1QTN B;  4WXO A;  4YB1 P;  2HVI A;  2KZM A;  1AZS B;  3SDE B;  1G2E A;  1SV5 B;  4PQU A;  1KBR A;  2BJ7 A;  3DI6 B;  2IRY A;  3H4D A;  2F3J A;  1NK0 A;  1XNR F;  3SZ2 A;  2ZBI A;  2MLZ A;  3LH2 S;  2IYG A;  4RW8 B;  2H9Z A;  4IFY A;  4ZA1 A;  3W63 A;  2X1B A;  3NCP A;  2GIR A;  4X64 F;  1MWZ A;  5F3Z A;  3TJ8 A;  2IC3 B;  5E33 A;  1IKX B;  3SDE A;  1SV5 A;  4G1P A;  3CDA A;  3D3B J;  3DI6 A;  2HW3 A;  3VAH A;  2YXL A;  3MEK A;  2CPD A;  3PR4 A;  3AH6 A;  2HFS A;  2LQ8 A;  4PG7 A;  4U9R A;  4RW8 A;  3QT5 A;  2AHO B;  2DIU A;  3PEH A;  3NKY A;  5SUH A;  3MEC B;  4MTP A;  2IC3 A;  4M5M A;  1IKX A;  3G6E S;  2GC8 A;  4QIF A;  2DH8 A;  2HGM A;  4N7T A;  1C1C B;  2HHH J;  2HRU A;  3IXQ A;  4USW A;  2UVU A;  4ZK7 M;  2E5L J;  1P1T A;  3BO4 A;  4GKJ J;  4CLP A;  3GP9 A;  3BBF A;  3KJV B;  1W2B R;  1WDT A;  3OTE A;  3UNG C;  5ETK A;  3R5C A;  5BYQ A;  1XNQ J;  3MEC A;  4IR9 A;  2EBG A;  4XDD A;  3PEJ A;  1BMQ B;  2OFG X;  2VJU A;  3N6L A;  2HHH F;  2MJN A;  2E5L F;  1C1C A;  3E2E A;  1I1G A;  1QJH A;  2L08 A;  2UZA A;  4GKJ F;  5MLC V;  3PV8 A;  1EQM A;  1KFD A;  2DRA A;  3KJV A;  2OTJ S;  2HLT A;  2DTJ A;  3KLF A;  4WU2 A;  1T9W A;  3F56 A;  4RKU C;  2E1A A;  4QPX A;  4OI3 A;  3U02 A;  4WYW A;  2RH3 A;  1M5V C;  3R2D J;  1XNQ F;  3OR2 B;  2VV5 A;  2V2Z A;  4NCB A;  2AJ2 A;  1JLQ B;  1EAY C;  3I55 S;  1UEV A;  3KNA A;  1IKV B;  2OP5 A;  2CVI A;  2GHP A;  2HQG A;  1YZ6 A;  1R27 B;  2J8A A;  4WZQ A;  5D6G A;  4ED2 A;  3MM7 B;  1FXL A;  2CQC A;  3OR2 A;  1Y3J A;  4C8Z A;  4CO0 A;  4QJV A;  3GG0 A;  1S6P A;  2M8D B;  4ZDN A;  2W7P A;  2MMY A;  4RU9 A;  1B0T A;  1F1B B;  4ED3 A;  1JMT A;  2W1B A;  4N47 A;  2VD3 A;  2OEJ A;  3RBE A;  3DRS B;  2B51 A;  2UXC J;  5MAO A;  2QLW A; 
#chains in the Genus database with same CATH homology
 1XNQ J;  1HNZ J;  4DV4 J;  1I94 J;  1J5E J;  1N34 J;  4X65 J;  4JI8 J;  3J81 U;  2F4V J;  4DR6 J;  4DV6 J;  2MTL A;  4JI1 J;  3JAM U;  1IBM J;  4X66 J;  3T1H J;  1IBL J;  4JI7 J;  5LMU J;  2VQE J;  4LFC J;  4DV3 J;  3W1Y C;  2UUC J;  4LF4 J;  5AJ3 J;  4DUY J;  4K0K J;  4JI3 J;  3T1Y J;  1N33 J;  4DV2 J;  4JV5 J;  4GKK J;  4B3T J;  4LF9 J;  2UU9 J;  5A2Q U;  4B3R J;  3R2D J;  2UXD J;  4DR3 J;  5IWA J;  4HHU A;  3D3B J;  4X62 J;  2UUA J;  4JI5 J;  4LFB J;  4KHP J;  3D3C J;  3IMQ J;  1XMQ J;  4YY3 J;  5LM7 E;  4LFA J;  4AQY J;  2ZM6 J;  4RJV A;  4DV7 J;  2MQ8 A;  4X64 J;  4DUZ J;  3J80 U;  2UXB J;  4DV5 J;  2MEW A;  4DR5 J;  3OTO J;  4LF7 J;  1HNW J;  2KVQ E;  4LF5 J;  5BR8 J;  4DR1 J;  4KYZ A;  4OX9 J;  5FLX U;  2UUB J;  2VQF J;  4PWW A;  4YHH J;  1XNR J;  5LMN J;  4JI2 J;  1FJG J;  2HHH J;  1XMO J;  2KL8 A;  1IBK J;  2E5L J;  4JI6 J;  5IT9 U;  4DR4 J;  4NEY A;  4NXN J;  4GKJ J;  1HR0 J;  4LF6 J;  4DR2 J;  4DV1 J;  1HNX J;  4KY3 A;  4V1A k;  4JI4 J;  3R2C J;  4DR7 J;  4NEZ A;  4DV0 J;  4B3M J;  3J7A N;  4JYA J;  4NXM J;  4LF8 J;  4B3S J;  1N36 J;  4JI0 J;  2UXC J;  1N32 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...