4JV5K

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4jv5K00
3J7AP 4AQYK 4LF7K 1I94K 4DV3K 5BR8K 1IBKK 4JI2K 1HNZK 1XMQK 4B3SK 4NXMK 1J5EK 4DUYK 2E5LK 5LMNK 4JV5K 2VQFK 2UXCK 5AJ3K 4DR2K 4DR7K 4V19S 4X66K 4JI5K 4JI4K 5FLXO 3OTOK 2UXDK 4DR5K 3J80O 4JI6K 4YY3K 3J7YP 2HHHK 1HNWK 5A2QO 4JYAK 2UUAK 1FJGK 1XMOK 4LF4K 5IT9O 1HR0K 4K0KK 2F4VK 4LF6K 4DR3K 1XNQK 3JAMO 1N36K 4JI0K 1N33K 4GKJK 4OX9K 4DR4K 1IBLK 4CW7B 4DV2K 5IWAK 4LFCK 4KHPK 4YHHK 4X64K 4X62K 4LF8K 4B3RK 4JI8K 4DV4K 5LMUK 2UUBK 4X65K 4DV1K 4GKKK 4LFAK 2VQEK 4LF9K 4LFBK 2UXBK 4DUZK 4DV7K 2UUCK 2UU9K 4JI7K 4JI1K 4B3MK 1HNXK 4DR6K 1N34K 3T1YK 1IBMK 4CVNE 4B3TK 4DV5K 4LF5K 4JI3K 4NXNK 4DV6K 1N32K 3J81O 5LL6Z 4DV0K 4DR1K 3T1HK 2ZM6K 1XNRK
chains in the Genus database with same CATH superfamily
1QVGM 1Z05A 3WNFA 4Z4EA 3LALA 2DPNA 3SPZA 4DHYA 1B92A 1NBWA 1NM1A 1XMQK 4C1NK 1QSSA 4IZ9A 2WC9A 4BRGA 2E5LK 4CBXA 5BRFA 2OPSA 3SV4A 2E6MA 1M1KO 5FLXO 3KLEA 4KHUA 3IDHA 4K8ZA 2YJEA 3OYKA 4AHTA 2BE2A 4YY3K 4B1VA 3AO2A 3E9LA 5CZ1A 5SZTA 3D0PA 4M3ZA 2PZSA 2Q1NA 3G0ZA 5HROA 1NK0A 1LAWA 4DR3K 3QNNA 4O55A 1XNQK 5EU7A 5TKWA 3S41A 1LWCA 4KFBA 4KTWA 2RF2A 1YJWN 2G8VA 2V51B 3GDQA 4DQRA 4DR4K 3SI6A 5EX5A 4FJ5A 4C8KA 3KKSA 3U3GA 2B5JA 3SAHA 1QQNA 4NLCA 3DLRA 4O44A 4LSLA 5J2QA 3JYTA 3ZETA 1ATNA 1SQKA 3OYHA 3WT0A 2A1RA 3THYB 3DI6A 1JCEA 3O6WA 1QE1A 5BPLA 2O8FA 1VSJA 1W9HA 2UUBK 3WNEA 3H1QA 1VQNN 1YVUA 4DUZK 3H08A 4ISGA 2UU9K 4B9SA 1TKDA 1VQLN 3ZSQA 4DR6K 1HPMA 5KRTA 3M5RA 3TAQA 1LWEA 1TUUA 1CZAN 4CJRA 2E4LA 2WOMA 3VQ8A 3T3FA 3NFAA 3SPYA 3V4IA 3VQ5A 4MDAA 4E7LA 3NAEA 5J2MA 3IMXA 4GVMA 4OPKA 3PSIA 3THYA 3TWHA 1YAGA 1QS4A 1I39A 3VGKA 1SS6A 1ATRA 2KLAA 2ZJQL 4KRFA 4IWVA 3R8EA 4GY2B 3NGZA 1TL3A 4DUYK 3EZWA 4C8LA 2J4RA 3A5OC 3F5TA 2P9KA 3BDPA 3VTIA 1JLCA 3KLHA 4V19S 4FJNA 4X66K 3B6OA 1QVFM 5AR0A 1KCFA 3C95A 3LAMA 4DR5K 1S9EA 1W7AA 3NBPA 3WNGA 4AHCA 3KLGA 1BGXT 4BGAA 3VQ4A 2HHHK 4EHTA 3WXMB 3JS6A 4FSVA 1TYQB 4W5TA 4BE2A 3MECA 3QIPA 1NGCA 4RWTA 3O4WA 1HX1A 4FM1A 4OKKA 3QINA 1BU6O 4KHSA 1TAUA 3U9ZA 5FROA 2PYJA 1NNEA 4JRPA 3ZSYA 4F3TA 1V4TA 1EX4A 2DFEA 3OBWA 2ASPA 1SKSA 2HBKA 1BO5O 4ZHRA 3Q7CA 4H5TA 4LFCK 1VRTA 2RHKA 4J2BA 1JJ2M 5AQRA 1IKVA 3LAKA 3HP9A 5BN8A 4DF4A 3L3UA 3RMAA 5KI6A 1HKGA 4BR9A 3HPGA 4FWOA 3HL8A 2VWBA 3HRGA 4OJRA 1S3XA 3MWPA 4FLVA 2O8DB 1EWRA 4KHQA 3K9JA 2Q3SA 4JI3K 3CERA 3VF4A 2A6AA 4O4GA 2GUIA 5LL6Z 4AM6A 3BZCA 3L2UA 3SK3A 5AQOA 3H3NO 3T1HK 2F96A 4CEZA 3I56N 1RTDA 1T03A 2A40A 1C1AA 3SQ2A 1J9AA 1TV6A 1KXPA 1W0HA 3HYFA 3MXIA 5F0XA 2I7NA 1Q82O 1YJNN 2G8WA 2VG5A 4M3YA 4CZJA 4JS5A 2IVPA 3L2VA 5HP1A 1BUPA 4CZKA 4XIUA 4N47A 3LM9A 2Y1JA 3I33A 4CK2A 5GINA 2Z1GA 4DQQA 3SUNA 1UAXA 4DQPA 4E7IA 4A57A 4JYAK 3UKRB 1W97L 5C2FA 3I0RA 3RMCA 4LF4K 3OYMA 1HPZA 4M3UA 4OO1J 1NGEA 3BZKA 1NMNA 4JKDA 3O9TA 3HPOA 1VHXA 2JGUA 3SUPA 3CCVN 2LSNA 4BG8A 1T3VA 3C0BA 4DSIA 2Z1HA 1ASUA 4OLBA 4MFBA 3IAYA 1QZ6A 3NF9A 4CHNA 2P5GA 2BANA 1RT6A 4DTRA 4ZTJA 4B9NA 4B9VA 1LOTB 3VN5A 3QEWA 2ZF5O 5AZJB 4DU3A 3MCPA 2JWKA 5EOYA 4MLHA 1KLNA 3M8PA 3UKRA 1GLLO 3P31A 1BHLA 3CPEA 3TSPA 4IOCL 2QXLA 1C0GA 2NRTA 3R9PA 2P1JA 1CLQA 3CC2N 2NRZA 4IBNA 3LDPA 1NJWA 3V1OA 1Z25A 3SUQA 4FL9A 5KGWA 1VQMN 3ZLJA 1KRPA 4Q5VA 1VQON 1N34K 2OCEA 3RMBA 3ATVA 3FLCO 4FO0A 4FLYA 1L3UA 1GOAA 4E89A 1ZBSA 1KVAA 1MDUB 2P51A 1X9SA 1OH6A 2QTDA 3SV3A 3CCUN 2F9TA 4DS4A 1BA0A 3DWLA 5AQUA 3OS0A 4FM2A 3MCAB 1BL3A 4EZ6A 1NK7A 1R59O 3LWLA 4IO8A 3TSQA 4AQYK 3QNOA 4FJXA 4FLZA 5C0YA 4HHTA 1B9DA 4JKBA 4QS7A 4DV3K 4I6MB 1OVYA 4KH6A 3CQ8A 3LP1A 2P9LB 1LW0A 3T7ZA 4YOVA 4B3SK 4DSEA 1TKZA 4RG8A 1CXUA 2FBTA 4CGFA 4B9QA 1TL1A 3LL3A 4ICLA 3AO4A 1BQMA 4JLHA 4BRNA 3OTOK 2WTUA 4KTZA 5HL7L 2ASMA 4NO7A 4W5QA 3J80O 2VG6A 3DM2A 4JRQA 4FK4A 1BOTO 2FBYA 2KZMA 2YHYA 3I55N 3MX5A 1C0FA 3U4LA 1HMVA 4WYBA 4B9TA 5M1OA 1WUAA 1SL2A 2CGJA 1NK5A 1NLVA 1CXQA 1MA9B 2QWPA 1KTQA 1TUYA 2OA8A 3VETA 1VSLA 2YNGA 2A1SA 3V9WA 1SL1A 1VQKN 1C0UA 4FJ8A 3U9DA 3LDLA 3D6RA 2QWLA 4WE1A 3DYAA 3PO4A 1K8KB 2A5XA 2EX3A 4KPYA 1VQ4N 4QAGA 3O4QA 4PL7A 3VEVA 2XHBA 4CZHA 1S6QA 2A3ZA 4UQGA 5LMUK 4BR7A 1B9FA 5JMVA 3F2KA 2IGIA 4IJNA 2OTLN 4CZFA 5HRPA 3KZBA 3NF6A 1Q86O 1K9MO 2W40A 3CCJN 2OYQA 3WQTA 3B6PA 4CZGA 1HKBA 2CGLA 1HRHA 4BG9A 2X6NA 2ZWHA 3MK6A 4DV5K 1KAZA 1NKEA 1BI4B 4E7HA 1U45A 4JHDB 1C1CA 5E26A 1JXBA 2PYLA 3VF2A 3HSTB 5J2PA 4FOEA 3QERA 4H5RA 4AF1A 1XC3A 3PX6A 1YITN 4BREA 3RR7A 4OGEA 5AQGA 5JLHA 4FW2A 3SJJA 4JI2K 1SKWA 2HOEA 3KKRA 1Q9XA 5JS2A 4FM0A 2VQFK 1WLJA 2AJQA 1WSJA 2O8CB 1KQSM 2I7PA 5AFUA 3AGRA 2O8FB 3MEGA 1TVRA 3V6DA 3ZSXA 3RSEA 4DQ8A 3HZ6A 4BR0A 1YHQN 2IDOA 3TAFA 4CD3A 3O4NA 1RT5A 5AQJA 4M42A 3IUCA 4BDZA 2E2QA 3O3FA 4CEDA 2PBDA 3FGUA 1RDUA 1JLEA 3CJ1A 2OPQA 2A41A 3VENA 4B1XB 1N36K 4RW7A 2O8EB 4CJEA 4FJGA 3VQAA 4KBOA 3THWA 2RKIA 1R0AA 2HMPA 4E0DA 3L6QA 5ELZA 5HRNA 2QK9A 3E66A 5AZIA 2D0CA 2KHOA 3BGRA 1S22A 3O1BA 4RW9A 3EEQA 3O9SA 2ETJA 3VTHA 4OKJA 4F8RA 2BDPA 2GV9A 4JI8K 4DTSA 2D4WA 3L0QA 3P1GA 2ZGZA 1NG9A 2FLOA 4LC9B 3N4PA 3VEOA 2P9SB 5AQXA 1ZBLA 4CERA 1YTAA 4BRPA 1CZBA 2NZTA 4UY8O 4E19A 1M90O 1A5WA 3D2EB 4CVNE 3ZYYX 1ZBHA 4CF8A 5BRDA 4HVJA 3VGLA 3VPZA 4DV0K 2QXFA 3T69A 1RBRA 4DTXA 4FWKA 1IKYA 3LP3A 4M3RA 4DLGA 2YJFA 3L4IA 3KK3A 4B9UA 4M3TA 3AY9A 4JKGB 3PIPL 1SV5A 4HWIA 3M8RA 3BEXA 3G10A 4JV5K 1RT1A 5HRRA 4BVPA 4KI4A 3VA0A 4N56A 5FPMA 1VSDA 2FBXA 2IS3A 2UXDK 3ENBA 3ZX0A 4XH4A 3O5BA 3K2PA 3DOLA 1KAYA 1IJJA 4FXDA 2KKZA 5FPDA 4MLEA 3RR8A 1X9MA 1BISA 3HOSA 3W3DA 1NK6A 3KHYA 4K0KK 1VQPN 3V1RA 2F8SA 1J54A 4JK7A 4JD2B 1YI2N 1RTHA 4E7KA 2OPPA 5EXWA 4CEFA 1BQNA 4WCEL 4AHVA 4JEPA 3V9XA 1XHZA 2YHWA 1XC9A 4FWLA 4WQ5C 2IVNA 4PA1A 4H5WA 4BWMA 3OJSA 2GEMA 3CFPA 3V1QA 2HNDA 3C6HA 4LF8K 1RGIA 3MMVA 1RBTA 1DEJA 4FZZA 4BROA 1K73O 4LF9K 4PKGA 4KKOA 3OHRA 2YV0X 3MN6A 4LD0A 3NVMA 3F9MA 2E2NA 3A0IX 1KC8O 2W6LA 3ID8A 3WNHA 5AQIA 1UA1A 1WOQA 3WXIA 2HHWA 1JCFA 4I6MA 3RVCA 5AQWA 1EP4A 4ID1A 4FWMA 4JK8A 2HMIA 1X3NA 2RPIA 2VCPA 5C15A 1OH8A 4EAHD 2ZM6K 3CI5A 4DG1A 2P9NA 4FLXA 2IVOA 2Y1IA 3IFRA 5BPNA 1BA1A 2YX6A 2QA4N 1KSPA 3O8MA 4CEBA 3TABA 3LZIA 1HNVA 2AP1A 1S1VA 1S1UA 3ITHA 4ELUA 1GLCG 4ID5A 1J6ZA 4NCGA 3AVIA 3R6MA 3O9QA 3HPHA 4JI6K 1U2VB 3QB0A 2KFZA 1VSEA 4RW6A 1C0TA 5F2RA 1ILYA 1NJZA 3AA4A 3K58A 3EY1A 3VESA 2P5OA 2QM1A 3QEPA 5KRSA 3WXJA 3IRXA 2UYTA 1HQUA 5M1QA 3KVGA 3ZCMA 4BC3A 4E3SA 4CFDA 3JAMO 3V9ZA 1VSFA 3I8BA 1RFQA 1QTMA 4H0PA 4FJHA 3CCMN 4WF9L 1BI4A 1O13A 2EHGA 3CJCA 1NGFA 1TKTA 3H6EA 4C8MA 4YOUA 3FZKA 4H0TB 4PWDA 2FSKA 4ILJA 5KQDA 4JS4A 2NRVA 3MN9A 1GLJO 3OS2A 4FK0A 3DRPA 2DFFA 5M1FA 4DFMA 2FF3B 3TANA 2W41A 3KLIA 4XEIA 3CJAA 4IEEA 3CC4N 2YNIA 1SUQA 3IG1A 2UUCK 4B08A 5C10A 3L4QA 1XHXA 3CJ9A 2YI1A 3AO3A 3ATUA 1LCUA 1MWMA 4DS5A 5M1KA 1UWBA 5M1PA 1K8AO 3CXCM 4ISFA 3A5LC 4IOXA 1W2BM 2XRIA 3GBTA 3DLEA 4A62A 3AVLA 4FWNA 2WFBA 4CJWA 3J81O 2P9IA 2X74A 4Y1CA 3SJHA 1JLBA 1K8KA 2YNFA 4GVEA 2VGNA 3DRSA 3KJVA 3ID6A 4C1NI 3CCRN 4NLBA 2OTJN 3ZETB 1EXQA 3VQQA 1X3MA 4K25A 3VQDA 1S1WA 3T19A 3LZJA 4NXMK 4AH9A 3NH1A 4WQ5A 4M45A 3SQ1A 1VSHA 1WNSA 4O8KA 1ESVA 4Z94A 5KTQA 4FVUA 3LPUA 3TAPA 2XO7A 1WBBA 4FJ9A 3S3OA 5D3GA 1KLMA 2NLXA 2FSNA 3A8YA 4TSXA 2YKNA 3GL1A 4YOWA 2UUAK 3U3YA 4BQLA 3OS1A 1YJ9N 2P9SA 1HYVA 3SUOA 3LANA 3OW2M 3QETA 5F1XA 4PL8A 2GWJA 1E4FT 1ZC6A 2NRRA 4IFVA 2HHUA 2F9WA 4CCHA 4H5NA 2CH6A 2H3GX 3SMSA 4IFEA 5BR9A 3CQYA 3OJUA 2B4JA 3QEIA 3VGMA 2E8AA 4HUEA 4EFHA 1V4SA 3DMJA 4JN4A 2F8TA 2HHVA 3MEDA 5BREA 3DLGA 1U47A 1T6DA 2WUSA 3SLCA 4HUFA 3O08A 4DTMA 5FPNA 5C25A 2O8BA 4BE0A 3TR8A 2QWNA 5CYQA 4A5BA 3QO9A 3PO5A 1GOCA 1VQ9N 4PY5A 1RBVA 3JSMA 3AA5X 3HM8A 4YDUC 3QEXA 5CZ2A 1HJOA 3VQCA 2D0PA 3TTFA 4I2PA 4U7BA 2FBVA 4BC2A 2QWOA 1WSIA 1QQCA 4KB0A 4OPJA 3ZX2A 3A5NC 3DXMA 4ELTA 4PKHA 3UKUB 3HJFA 5JLFA 3PUFA 3DLBA 3OYEA 4OKEA 3E1YA 4FZXC 2D0BA 3AVMA 3DXKB 2B6AA 2YCHA 1Q18A 5AQFA 4DSLA 3LDNA 4FVMA 3DXMB 2EWSA 1BIUA 2ITMA 5C42A 5E41A 4BWJA 1NOZA 3OYBA 1XI1A 3AAPA 3THWB 3AO1A 2WBNA 5J1EA 2PAVA 3T1AA 1U04A 3DOKA 4G1QA 3C94A 4J2EA 3TAEA 1FW6A 3MXMA 4YDUA 1ASVA 4B8CA 3E01A 3M1FA 3CFOA 1S9GA 1ZBUA 3EO3A 1ZXOA 3MDQA 4J8FA 4DSKA 3D2FB 1WB9A 1HNWK 5A2QO 4Z4HA 4BGBA 3F73A 4O5BA 3OYCA 3CCLN 4C8OA 4KHWA 5H1SQ 4F4KA 3K5NA 4RCHA 4CJPA 4BDYA 1JKHA 4A2AA 4CHOA 2GBZA 2Q0UA 5GAGP 4BRAA 5AZJA 3ZEUB 2DY4A 1NJYA 3LPTA 5DK5A 4CECA 3NVKA 3OVNA 1L5UA 4CGIA 3DLHA 1WSFA 3SNNA 4DFPA 3LM2A 2FSJA 3HSCA 1IBLK 2CGKA 4IKFA 2NUBA 3OYFA 2RN2A 4DKWA 4H0YB 3D45A 4DB3A 3I0SA 2Z1JA 3WQUA 3PX0A 4H4MA 3CG7A 1G99A 5BRHA 3L2QA 3C7NA 3MN5A 3CM5A 2HVHA 3EKSA 4DTOA 1ZBFA 1KFDA 3P83D 4K8XA 3HBTA 4X65K 1D4XA 1HKCA 1QHTA 3O9UA 3OYLA 2OPRA 4K42A 3NH0A 4AHUA 3BF1A 4JI1K 1RDDA 3ALYA 3D7EO 1FKPA 1HYSA 2OANA 3VA3A 4B3TK 1JL1A 4CIFA 2V7ZA 4AILC 5AQHA 1IG9A 4DV6K 1D8YA 3KK7A 4FWSA 3VQ7A 1YT3A 3L8BA 1HQEA 2CH5A 3O80A 4FLTA 3KLFA 4CGDA 4DLEA 5J2NA 3ZX3A 3JXUA 4BC4A 2OZSA 2PFUA 1IH7A 5FRNA 1BDGA 3A2FA 1EKEA 3O3HA 4C8NA 1UA0A 5LMNK 2X78A 3VOVA 2P9PA 3L3VA 4CK3A 3P38A 4J2DA 5AJ3K 3SQ4A 3C6TA 2ITGA 4B3OA 1L3TA 3THXB 4CGJA 3EYZA 3KD1E 4FOIA 1BWFO 3P5JA 1NGBA 1QHAA 3OYNA 3DLLL 4CZLA 2QKKA 3C65A 4DCHA 4E1MA 3FE1A 2FC0A 1S1XA 4IG3A 3MWTA 3TTDA 4BRIA 3RWUA 2HF4A 2QKBA 3TU5A 2QW9A 4A2BA 4JI0K 1A5XA 3WEEB 1N33K 1OKJA 5SWMA 3K5LA 3HTVA 1GOBA 4FK2A 3EZ5A 2YKMA 4DV2K 3S3MA 3EN9A 3FZFA 3NGIA 1NJXA 1REVA 3FR0A 3C7NB 4BRCA 3V81A 2YHBA 4OLAA 4KO0A 4YHHK 2KFNA 1KFSA 1IKXA 3ZSOA 3WEEA 1QQOA 4DFJA 4K43A 4BQZA 4DTNA 2VYPA 1S72N 4JHDA 4CJFA 4H8KA 4KV8A 4Z4GA 4Z4CA 1Z26A 2WONA 3G6EN 4CJ4A 3VERA 3KD5E 1RT2A 5AQPA 5DM6L 2Q0RA 3VQBA 3CQXA 4NCAA 1IBMK 4CEQA 3SAFA 3OYIA 4LF5K 3AA2A 4PQUA 1I3AA 2GX9A 3CYMA 1GLEG 4O5FA 5MLCQ 3QESA 3WXKA 3CMEN 2A42A 4AHSA 3OYGA 1C1BA 4RW8A 2RE2A 4CE9A 5E84A 4CJKA 2HNYA 1N5YA 4DFKA 4B1ZA 5BR8K 3CPWM 3TAGA 2G8HA 4Z4IA 3HI0A 1NGGA 4BR2A 3U6FA 4G9ZA 3ZSZA 4ZTFA 1EETA 1IV0A 3OBYA 3ULEA 2KTQA 3EE8A 3WXLA 3AA3A 5LJVA 2YNHA 2UXCK 2BUPA 4KTQA 4BRHA 1YVNA 4JI5K 1YXQA 3AO5A 1X9WA 2BTFA 3K9KA 1D9DA 3HM9A 2GUPA 4IJAA 4BRKA 4CF0A 3HXMA 3PV8A 1JL2A 2O8BB 1OVQA 3ULEB 5AQKA 1T7PA 3NF8A 4CIGA 1NKBA 4CHQA 3L2WA 4LSNA 3B8AX 2XY5A 4FPAA 3MAQA 2P9IB 3ZSVA 4BY9C 1TGOA 1IG8A 2KQ2A 4M7YA 3K57A 2HSTA 4QOZB 2O4IA 3MX2A 2GTDA 3ULDA 3ISNC 2Q36A 4FWQA 3NCIA 2HB5A 3NH2A 3CJ7A 4O0JA 5GAEP 4FLUA 1JLAA 4F2RA 5AZIB 4EZ9A 4MDBA 2Z1IA 1RBUA 1VQ7N 5CHIA 5JVHL 2DFHA 2OZMA 3CC7N 1NJIO 1RT4A 4CJ7A 3J7ZO 4DV1K 4LFAK 2BGGA 1J53A 3ZT3A 2UXBK 4DV7K 3V9SA 3ZT0A 3BY5A 4JI7K 4KH5A 4M41A 1TYQA 4B3MK 2ZJRL 2HHTA 4A61A 4IDKA 4JKEA 4EP4A 4B1YB 1TK0A 1EQYA 1RBSA 3L2RA 4ISEA 1WBDA 2QI2A 3CCEN 3ENHA 1LV5A 2E88A 4H0VB 1BG3A 2HBMA 4BVOA 1I94K 1NOYA 4U67L 1S6PA 2O8EA 3TARA 1IBKK 1HNZK 1YF5L 4JKGA 3ZEUA 1FKOA 1OH7A 5DMRA 2HNZA 3K0SA 1ATSA 5C12A 2NRWA 3VEYA 5I3UA 1C0MA 4B1WB 4DR2K 4DR7K 3OYDA 2D0AA 3CFRA 1F21A 1JXEA 3AARA 3DRRA 1VQ8N 1JLFA 2E20A 3QFPA 4CZMA 5CYMA 3SYZA 3QFUA 1T44A 4HTUA 3FZHA 2HW3A 4W5RA 1NU0A 3UKUA 4I9QA 4Z0UA 1QSYA 1U49A 4OPHA 3SQ0A 2KZZA 4DMNA 3ZSWA 2HF3A 1RTIA 4JKCA 3RRHA 1RDBA 4AHRA 1P90A 1RNHA 3QBXA 3PSFA 4Z4FA 1GLBG 3H3OB 3DXKA 3AAQA 1HUXA 2G8IA 1NGJA 4OX9K 1TKXA 3BUZB 3CHWA 1X1PA 5AFUH 2Q2RA 3E9PA 1P8ZA 4WQ4C 4GMJB 5GAHP 4CFAA 3AVGA 3RRGA 3PIOL 4KB1A 1IKWA 4IXCA 3TSUA 4CHPA 2X6SA 4N76A 2E1ZA 3CJBA 4JK9A 4PHTX 4AM7A 3KTQA 3NE6A 1OH5A 5FPEA 4E7JA 2XY8A 3P4IA 4M63C 4CJ3A 4DSFA 5AQSA 4H0XB 3QIOA 3VQ6A 4E1JA 1XUPO 1HNXK 4QS8A 3LDOA 4LH4A 3K59A 4FWPA 4PUOA 4FJJA 2HBLA 3UE5A 2QWRA 5I42A 4CBWA 1VQ6N 3NMUA 3E9OA 1NWKA 4GW6A 5FRMA 5CY4A 4JNEA 4CJSA 4KHNA 1UOCA 4CJLA 3H45C 2O4GA 5FDLA 4R79A 4IG0A 1QSLA 2PY5A 1DT9A 3M8QA 4JAXA 4GV6A 3R1XA 5EY4A 2ZE2A 4K41A 5JVGL 3J7AP 2HVIA 4CK1A 3KK2A 4FJLA 2HHXA 4QS9A 4C23A 4FJMA 4KREA 2Q97A 4HCCA 2D1KA 4FJIA 1XWLA 1TAQA 2ASOA 3EL2A 4CD1A 4CHZA 4CHYA 3RMDA 3OY9A 3UIQA 5EVZA 4CEEA 3G71N 5CR4A 4OPAA 1WAFA 3TI0A 4MQ3A 2YHXA 1JCGA 1D5AA 4H03B 4CJVA 5B8HA 4N5SA 3SMPA 4GNIA 1K6YA 3AVKA 4ILHA 5IT9O 1SKRA 1VSIA 5BN9A 4DSJA 3LDSA 3A5MC 1YTUA 1T6CA 1G15A 2JWLA 3O1WA 4M3WA 3NGYA 4HTLA 1RDAA 4GKJK 4BRFA 2D0OA 1WSEA 1Y64A 3MXJA 2FXUA 4CJQA 3SBGA 2IIRA 1JLGA 4W5NA 2KW4A 5IWAK 1VSMA 4NYFA 4KHPK 2BH1A 2G8UA 1DTQA 4I9LA 1LW2A 4X62K 3SBTA 4F2SA 4B3RK 4DV4K 1EWQA 3FFIA 4GKKK 4LY7A 4RW4A 1GLDG 3HVRA 3FZMA 2IOCA 4LH5A 5HOOA 1O1WA 1Q7YO 1CZ9A 3KWGA 3J8AA 3ZT2A 4CGGA 1X9JA 3DJCA 2HHSA 4MO4A 5M1NA 4NXNK 2G8KA 4WFNL 1N32K 3H46O 1VRUA 4B9LA 5ADXH 2W6KA 1NGHA 3O9RA 1U6ZA 4NB4A 2G8FA 3AVBA 1Q81O 3ASMA 3QLHA 4DQIA 2O8CA 5TKYA 4BRMA 4EIAA 4WQ4A 1KVCA 4YOXA 3LWMA 4PKIA 3QBWA 4RTFD 4JKAA 1J5EK 3LP0A 4IDHA 3KK1A 2XY6A 4OGCA 3TAMA 4IO9L 1LAVA 3VQEA 4R5PA 2P9NB 5GIPA 1L3VA 3CD6N 3N4QA 3VQPA 1T8EA 4FYDA 3GOIA 5GIOA 5CE3A 3LP2A 4Y1DA 1KVBA 1MU2A 2V52B 3UB5A 4EHUA 3BP8A 4CF9A 3J7YP 3VEWA 1S5JA 1U4BA 1HYZA 3CMAN 3EE9A 4H0OA 2W42A 2F7TA 4DU1A 3P39A 1HR0K 2QWQA 4CF1A 3GE1A 1H1VA 4I7FA 4CI6A 2F4VK 3AVHA 4LF6K 3AV9A 5HLFA 1U2VA 1BIZA 4B8AB 1DLOA 1T05A 4QCLA 1MWKA 4DTUA 3K5OA 3CM6A 1YIJN 2V7YA 1GLAG 1WAJA 5I9EB 4YOYA 1RT7A 5KPTA 4CW7B 1ZBIA 3HO1A 1ASWA 1JLQA 2P9KB 4BC5A 5AQTA 4IOAL 4WFBL 2QEXN 2R7YA 4X64K 1KD1O 1D9FA 3OA9A 1EO1A 3F9KA 4Y0WA 2GELA 3RSEB 4KH4A 1HJRA 3SCXA 2VQEK 4DTPA 4LFBK 5JICA 4BE1A 2FF6A 4N41A 3PLAA 2YHAA 2IC3A 1Q9YA 1RDCA 1KAXA 2Q31A 3SAGA 4BR4A 3QICA 4NYNA 3T1YK 1ITGA 1Q8IA 3HP6A 4CZIA 1DGKN 4BR5A 4JKHA 1HNIA 1DKGD 4CZEA 1FXXA 3G25A 3AGKA 4CEAA 5AQZA 3PX4A 4CIEA 3NHGA 3VEXA 4E1NA 1QZ5A 4IEIA 4DR1K 3M8SA 3ZSRA 2P9UA 4CFCA 1VQ5N 3U8XA 1TK5A 4YOTA 4FWRA 3THVA 1U48A 4CF2A 3FZLA 2JLEA 5K14A 1NK4A 5LJWA 2VWJA 4A59A 5GADP 4ELVA 3BF3A 3LDQA 1FK9A 3HOTA 4L3QA 3I8DA 4FJKA 3QEVA 5KGXA 3D2EA 1NGDA 3S9HA 4I2QA 1XMOK 4HCBA 4DQSA 4O8UA 4O0IA 1Z6RA 3O3GA 4DF8A 2E6LA 2O8DA 2HHQA 3VF6A 1NGAA 2HBJA 1NMDA 1SL0A 4BDPA 1YUWA 5ADXA 2E1YA 2VG7A 3ZT4A 4CFBA 4DTJA 4B9MA 1SZ2A 2I5JA 3H1VX 3VMFB 3CCQN 5HBMA 2NNWA 2ZJPL 3QDKA 2D5RA 1NK8A 3OYJA 4KAZA 3D2FA 1NKCA 4ILGB 1DTTA 1RILA 1E3MA 3HK2A 1XQSC 4EP5A 2QWMA 4XH5A 4WFAL 3MN7A 5T7BA 1HLUA 4GV9A 5AQQA 3AVCA 1SAZA 1WSHA 4YORA 4FW1A 1VSKA 3RTVA 5AQYA 4MO5A 1N6QA 4CEOA 4M7XA 4DWIA 3CCSN 1TK8A 1RTJA 3W0LA 2NRHA 3NF7A 4W5OA 3ENOA 4CGHA 3HT3A 3Q7BA 3G4SN 3AVFA 4YNQA 4F3OA 4M3XA 1Y97A 4FLWA 1GLFO 4A5AA 3S3NA 5JS1A 1C6VA 3CF5L 4JKFA 3M6GA 4LF7K 2P9UB 3GG4A 4CJ5A 3PY8A 3R3LA 1RDWX 1VAZA 2ATQA 4KHYA 4CJTA 3FFKB 2P9LA 4J2AA 4FZYA 1NK9A 3ZT1A 4YFUA 3HVTA 3WUHA 4OVLA 3VEZA 4DU4A 3CETA 2DTUA 2GWKA 4JI4K 4BACA 4Q0BA 2IAJA 2ZD1A 3OYAA 3TPQA 5AQVA 1BCOA 2VWKA 2VGMA 3DAWA 1ZYQA 2AA4A 5BPMA 3IKMA 1WSGA 4L8RB 1L3SA 1FJGK 2ZGYA 4FCYA 1VK0A 4GV3A 3QMLA 3M3ZA 3NDKA 5AQLA 4IFYA 5AQNA 1RT3A 3MEEA 1E4GT 4CBUA 3SZ2A 4KI6A 5KPRA 4FPBA 1QQMA 1S1TA 3VQ9A 2XY7A 5AQMA 5KPZA 2P9PB 1WN7A 4JD2A 4HUGA 3C6UA 1N8RO 2NRXA 1A5VA 3AVJA 3V9UA 3CIPA 3THXA 2E2PA 4FJ7A 1RCHA 5C24A 1LWFA 4CESA 4H5VA 3IS9A 5DM7L 2E2OA 3AVAA 1NGIA 3K5MA 5LY3A 5KQ8A 3KIOA 5HRSA 3DLKA 1IO2A 4XH1A 3EKUA 4CJUA 4H4OA 3KWIA 5C2DA 1BCMA 3C6AA 4BRDA 1J5OA 4BRQA 3AVNA 3TTCA 4BRLA 4F9OA 4NCBA 1XNRK 2ZQBA 4B1UB
chains in the Genus database with same CATH topology
3J7AP 4AQYK 4LF7K 1I94K 4DV3K 5BR8K 1IBKK 4JI2K 1HNZK 1XMQK 4B3SK 4NXMK 1J5EK 4DUYK 2E5LK 5LMNK 4JV5K 2VQFK 2UXCK 5AJ3K 4DR2K 4DR7K 4V19S 4X66K 4JI5K 4JI4K 5FLXO 3OTOK 2UXDK 4DR5K 3J80O 4JI6K 4YY3K 3J7YP 2HHHK 1HNWK 5A2QO 4JYAK 2UUAK 1FJGK 1XMOK 4LF4K 5IT9O 1HR0K 4K0KK 2F4VK 4LF6K 4DR3K 1XNQK 3JAMO 1N36K 4JI0K 1N33K 4GKJK 4OX9K 4DR4K 1IBLK 4CW7B 4DV2K 5IWAK 4LFCK 4KHPK 4YHHK 4X64K 4X62K 4LF8K 4B3RK 4JI8K 4DV4K 5LMUK 2UUBK 4X65K 4DV1K 4GKKK 4LFAK 2VQEK 4LF9K 4LFBK 2UXBK 4DUZK 4DV7K 2UUCK 2UU9K 4JI7K 4JI1K 4B3MK 1HNXK 4DR6K 1N34K 3T1YK 1IBMK 4CVNE 4B3TK 4DV5K 4LF5K 4JI3K 4NXNK 4DV6K 1N32K 3J81O 5LL6Z 4DV0K 4DR1K 3T1HK 2ZM6K 1XNRK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A P;  4AQY K;  4LF7 K;  1I94 K;  4DV3 K;  5BR8 K;  1IBK K;  4JI2 K;  1HNZ K;  1XMQ K;  4B3S K;  4NXM K;  1J5E K;  4DUY K;  2E5L K;  5LMN K;  4JV5 K;  2VQF K;  2UXC K;  5AJ3 K;  4DR2 K;  4DR7 K;  4V19 S;  4X66 K;  4JI5 K;  4JI4 K;  5FLX O;  3OTO K;  2UXD K;  4DR5 K;  3J80 O;  4JI6 K;  4YY3 K;  3J7Y P;  2HHH K;  1HNW K;  5A2Q O;  4JYA K;  2UUA K;  1FJG K;  1XMO K;  4LF4 K;  5IT9 O;  1HR0 K;  4K0K K;  2F4V K;  4LF6 K;  4DR3 K;  1XNQ K;  3JAM O;  1N36 K;  4JI0 K;  1N33 K;  4GKJ K;  4OX9 K;  4DR4 K;  1IBL K;  4CW7 B;  4DV2 K;  5IWA K;  4LFC K;  4KHP K;  4YHH K;  4X64 K;  4X62 K;  4LF8 K;  4B3R K;  4JI8 K;  4DV4 K;  5LMU K;  2UUB K;  4X65 K;  4DV1 K;  4GKK K;  4LFA K;  2VQE K;  4LF9 K;  4LFB K;  2UXB K;  4DUZ K;  4DV7 K;  2UUC K;  2UU9 K;  4JI7 K;  4JI1 K;  4B3M K;  1HNX K;  4DR6 K;  1N34 K;  3T1Y K;  1IBM K;  4CVN E;  4B3T K;  4DV5 K;  4LF5 K;  4JI3 K;  4NXN K;  4DV6 K;  1N32 K;  3J81 O;  5LL6 Z;  4DV0 K;  4DR1 K;  3T1H K;  2ZM6 K;  1XNR K; 
#chains in the Genus database with same CATH topology
 1QVG M;  1Z05 A;  3WNF A;  4Z4E A;  3LAL A;  2DPN A;  3SPZ A;  4DHY A;  1B92 A;  1NBW A;  1NM1 A;  1XMQ K;  4C1N K;  1QSS A;  4IZ9 A;  2WC9 A;  4BRG A;  2E5L K;  4CBX A;  5BRF A;  2OPS A;  3SV4 A;  2E6M A;  1M1K O;  5FLX O;  3KLE A;  4KHU A;  3IDH A;  4K8Z A;  2YJE A;  3OYK A;  4AHT A;  2BE2 A;  4YY3 K;  4B1V A;  3AO2 A;  3E9L A;  5CZ1 A;  5SZT A;  3D0P A;  4M3Z A;  2PZS A;  2Q1N A;  3G0Z A;  5HRO A;  1NK0 A;  1LAW A;  4DR3 K;  3QNN A;  4O55 A;  1XNQ K;  5EU7 A;  5TKW A;  3S41 A;  1LWC A;  4KFB A;  4KTW A;  2RF2 A;  1YJW N;  2G8V A;  2V51 B;  3GDQ A;  4DQR A;  4DR4 K;  3SI6 A;  5EX5 A;  4FJ5 A;  4C8K A;  3KKS A;  3U3G A;  2B5J A;  3SAH A;  1QQN A;  4NLC A;  3DLR A;  4O44 A;  4LSL A;  5J2Q A;  3JYT A;  3ZET A;  1ATN A;  1SQK A;  3OYH A;  3WT0 A;  2A1R A;  3THY B;  3DI6 A;  1JCE A;  3O6W A;  1QE1 A;  5BPL A;  2O8F A;  1VSJ A;  1W9H A;  2UUB K;  3WNE A;  3H1Q A;  1VQN N;  1YVU A;  4DUZ K;  3H08 A;  4ISG A;  2UU9 K;  4B9S A;  1TKD A;  1VQL N;  3ZSQ A;  4DR6 K;  1HPM A;  5KRT A;  3M5R A;  3TAQ A;  1LWE A;  1TUU A;  1CZA N;  4CJR A;  2E4L A;  2WOM A;  3VQ8 A;  3T3F A;  3NFA A;  3SPY A;  3V4I A;  3VQ5 A;  4MDA A;  4E7L A;  3NAE A;  5J2M A;  3IMX A;  4GVM A;  4OPK A;  3PSI A;  3THY A;  3TWH A;  1YAG A;  1QS4 A;  1I39 A;  3VGK A;  1SS6 A;  1ATR A;  2KLA A;  2ZJQ L;  4KRF A;  4IWV A;  3R8E A;  4GY2 B;  3NGZ A;  1TL3 A;  4DUY K;  3EZW A;  4C8L A;  2J4R A;  3A5O C;  3F5T A;  2P9K A;  3BDP A;  3VTI A;  1JLC A;  3KLH A;  4V19 S;  4FJN A;  4X66 K;  3B6O A;  1QVF M;  5AR0 A;  1KCF A;  3C95 A;  3LAM A;  4DR5 K;  1S9E A;  1W7A A;  3NBP A;  3WNG A;  4AHC A;  3KLG A;  1BGX T;  4BGA A;  3VQ4 A;  2HHH K;  4EHT A;  3WXM B;  3JS6 A;  4FSV A;  1TYQ B;  4W5T A;  4BE2 A;  3MEC A;  3QIP A;  1NGC A;  4RWT A;  3O4W A;  1HX1 A;  4FM1 A;  4OKK A;  3QIN A;  1BU6 O;  4KHS A;  1TAU A;  3U9Z A;  5FRO A;  2PYJ A;  1NNE A;  4JRP A;  3ZSY A;  4F3T A;  1V4T A;  1EX4 A;  2DFE A;  3OBW A;  2ASP A;  1SKS A;  2HBK A;  1BO5 O;  4ZHR A;  3Q7C A;  4H5T A;  4LFC K;  1VRT A;  2RHK A;  4J2B A;  1JJ2 M;  5AQR A;  1IKV A;  3LAK A;  3HP9 A;  5BN8 A;  4DF4 A;  3L3U A;  3RMA A;  5KI6 A;  1HKG A;  4BR9 A;  3HPG A;  4FWO A;  3HL8 A;  2VWB A;  3HRG A;  4OJR A;  1S3X A;  3MWP A;  4FLV A;  2O8D B;  1EWR A;  4KHQ A;  3K9J A;  2Q3S A;  4JI3 K;  3CER A;  3VF4 A;  2A6A A;  4O4G A;  2GUI A;  5LL6 Z;  4AM6 A;  3BZC A;  3L2U A;  3SK3 A;  5AQO A;  3H3N O;  3T1H K;  2F96 A;  4CEZ A;  3I56 N;  1RTD A;  1T03 A;  2A40 A;  1C1A A;  3SQ2 A;  1J9A A;  1TV6 A;  1KXP A;  1W0H A;  3HYF A;  3MXI A;  5F0X A;  2I7N A;  1Q82 O;  1YJN N;  2G8W A;  2VG5 A;  4M3Y A;  4CZJ A;  4JS5 A;  2IVP A;  3L2V A;  5HP1 A;  1BUP A;  4CZK A;  4XIU A;  4N47 A;  3LM9 A;  2Y1J A;  3I33 A;  4CK2 A;  5GIN A;  2Z1G A;  4DQQ A;  3SUN A;  1UAX A;  4DQP A;  4E7I A;  4A57 A;  4JYA K;  3UKR B;  1W97 L;  5C2F A;  3I0R A;  3RMC A;  4LF4 K;  3OYM A;  1HPZ A;  4M3U A;  4OO1 J;  1NGE A;  3BZK A;  1NMN A;  4JKD A;  3O9T A;  3HPO A;  1VHX A;  2JGU A;  3SUP A;  3CCV N;  2LSN A;  4BG8 A;  1T3V A;  3C0B A;  4DSI A;  2Z1H A;  1ASU A;  4OLB A;  4MFB A;  3IAY A;  1QZ6 A;  3NF9 A;  4CHN A;  2P5G A;  2BAN A;  1RT6 A;  4DTR A;  4ZTJ A;  4B9N A;  4B9V A;  1LOT B;  3VN5 A;  3QEW A;  2ZF5 O;  5AZJ B;  4DU3 A;  3MCP A;  2JWK A;  5EOY A;  4MLH A;  1KLN A;  3M8P A;  3UKR A;  1GLL O;  3P31 A;  1BHL A;  3CPE A;  3TSP A;  4IOC L;  2QXL A;  1C0G A;  2NRT A;  3R9P A;  2P1J A;  1CLQ A;  3CC2 N;  2NRZ A;  4IBN A;  3LDP A;  1NJW A;  3V1O A;  1Z25 A;  3SUQ A;  4FL9 A;  5KGW A;  1VQM N;  3ZLJ A;  1KRP A;  4Q5V A;  1VQO N;  1N34 K;  2OCE A;  3RMB A;  3ATV A;  3FLC O;  4FO0 A;  4FLY A;  1L3U A;  1GOA A;  4E89 A;  1ZBS A;  1KVA A;  1MDU B;  2P51 A;  1X9S A;  1OH6 A;  2QTD A;  3SV3 A;  3CCU N;  2F9T A;  4DS4 A;  1BA0 A;  3DWL A;  5AQU A;  3OS0 A;  4FM2 A;  3MCA B;  1BL3 A;  4EZ6 A;  1NK7 A;  1R59 O;  3LWL A;  4IO8 A;  3TSQ A;  4AQY K;  3QNO A;  4FJX A;  4FLZ A;  5C0Y A;  4HHT A;  1B9D A;  4JKB A;  4QS7 A;  4DV3 K;  4I6M B;  1OVY A;  4KH6 A;  3CQ8 A;  3LP1 A;  2P9L B;  1LW0 A;  3T7Z A;  4YOV A;  4B3S K;  4DSE A;  1TKZ A;  4RG8 A;  1CXU A;  2FBT A;  4CGF A;  4B9Q A;  1TL1 A;  3LL3 A;  4ICL A;  3AO4 A;  1BQM A;  4JLH A;  4BRN A;  3OTO K;  2WTU A;  4KTZ A;  5HL7 L;  2ASM A;  4NO7 A;  4W5Q A;  3J80 O;  2VG6 A;  3DM2 A;  4JRQ A;  4FK4 A;  1BOT O;  2FBY A;  2KZM A;  2YHY A;  3I55 N;  3MX5 A;  1C0F A;  3U4L A;  1HMV A;  4WYB A;  4B9T A;  5M1O A;  1WUA A;  1SL2 A;  2CGJ A;  1NK5 A;  1NLV A;  1CXQ A;  1MA9 B;  2QWP A;  1KTQ A;  1TUY A;  2OA8 A;  3VET A;  1VSL A;  2YNG A;  2A1S A;  3V9W A;  1SL1 A;  1VQK N;  1C0U A;  4FJ8 A;  3U9D A;  3LDL A;  3D6R A;  2QWL A;  4WE1 A;  3DYA A;  3PO4 A;  1K8K B;  2A5X A;  2EX3 A;  4KPY A;  1VQ4 N;  4QAG A;  3O4Q A;  4PL7 A;  3VEV A;  2XHB A;  4CZH A;  1S6Q A;  2A3Z A;  4UQG A;  5LMU K;  4BR7 A;  1B9F A;  5JMV A;  3F2K A;  2IGI A;  4IJN A;  2OTL N;  4CZF A;  5HRP A;  3KZB A;  3NF6 A;  1Q86 O;  1K9M O;  2W40 A;  3CCJ N;  2OYQ A;  3WQT A;  3B6P A;  4CZG A;  1HKB A;  2CGL A;  1HRH A;  4BG9 A;  2X6N A;  2ZWH A;  3MK6 A;  4DV5 K;  1KAZ A;  1NKE A;  1BI4 B;  4E7H A;  1U45 A;  4JHD B;  1C1C A;  5E26 A;  1JXB A;  2PYL A;  3VF2 A;  3HST B;  5J2P A;  4FOE A;  3QER A;  4H5R A;  4AF1 A;  1XC3 A;  3PX6 A;  1YIT N;  4BRE A;  3RR7 A;  4OGE A;  5AQG A;  5JLH A;  4FW2 A;  3SJJ A;  4JI2 K;  1SKW A;  2HOE A;  3KKR A;  1Q9X A;  5JS2 A;  4FM0 A;  2VQF K;  1WLJ A;  2AJQ A;  1WSJ A;  2O8C B;  1KQS M;  2I7P A;  5AFU A;  3AGR A;  2O8F B;  3MEG A;  1TVR A;  3V6D A;  3ZSX A;  3RSE A;  4DQ8 A;  3HZ6 A;  4BR0 A;  1YHQ N;  2IDO A;  3TAF A;  4CD3 A;  3O4N A;  1RT5 A;  5AQJ A;  4M42 A;  3IUC A;  4BDZ A;  2E2Q A;  3O3F A;  4CED A;  2PBD A;  3FGU A;  1RDU A;  1JLE A;  3CJ1 A;  2OPQ A;  2A41 A;  3VEN A;  4B1X B;  1N36 K;  4RW7 A;  2O8E B;  4CJE A;  4FJG A;  3VQA A;  4KBO A;  3THW A;  2RKI A;  1R0A A;  2HMP A;  4E0D A;  3L6Q A;  5ELZ A;  5HRN A;  2QK9 A;  3E66 A;  5AZI A;  2D0C A;  2KHO A;  3BGR A;  1S22 A;  3O1B A;  4RW9 A;  3EEQ A;  3O9S A;  2ETJ A;  3VTH A;  4OKJ A;  4F8R A;  2BDP A;  2GV9 A;  4JI8 K;  4DTS A;  2D4W A;  3L0Q A;  3P1G A;  2ZGZ A;  1NG9 A;  2FLO A;  4LC9 B;  3N4P A;  3VEO A;  2P9S B;  5AQX A;  1ZBL A;  4CER A;  1YTA A;  4BRP A;  1CZB A;  2NZT A;  4UY8 O;  4E19 A;  1M90 O;  1A5W A;  3D2E B;  4CVN E;  3ZYY X;  1ZBH A;  4CF8 A;  5BRD A;  4HVJ A;  3VGL A;  3VPZ A;  4DV0 K;  2QXF A;  3T69 A;  1RBR A;  4DTX A;  4FWK A;  1IKY A;  3LP3 A;  4M3R A;  4DLG A;  2YJF A;  3L4I A;  3KK3 A;  4B9U A;  4M3T A;  3AY9 A;  4JKG B;  3PIP L;  1SV5 A;  4HWI A;  3M8R A;  3BEX A;  3G10 A;  4JV5 K;  1RT1 A;  5HRR A;  4BVP A;  4KI4 A;  3VA0 A;  4N56 A;  5FPM A;  1VSD A;  2FBX A;  2IS3 A;  2UXD K;  3ENB A;  3ZX0 A;  4XH4 A;  3O5B A;  3K2P A;  3DOL A;  1KAY A;  1IJJ A;  4FXD A;  2KKZ A;  5FPD A;  4MLE A;  3RR8 A;  1X9M A;  1BIS A;  3HOS A;  3W3D A;  1NK6 A;  3KHY A;  4K0K K;  1VQP N;  3V1R A;  2F8S A;  1J54 A;  4JK7 A;  4JD2 B;  1YI2 N;  1RTH A;  4E7K A;  2OPP A;  5EXW A;  4CEF A;  1BQN A;  4WCE L;  4AHV A;  4JEP A;  3V9X A;  1XHZ A;  2YHW A;  1XC9 A;  4FWL A;  4WQ5 C;  2IVN A;  4PA1 A;  4H5W A;  4BWM A;  3OJS A;  2GEM A;  3CFP A;  3V1Q A;  2HND A;  3C6H A;  4LF8 K;  1RGI A;  3MMV A;  1RBT A;  1DEJ A;  4FZZ A;  4BRO A;  1K73 O;  4LF9 K;  4PKG A;  4KKO A;  3OHR A;  2YV0 X;  3MN6 A;  4LD0 A;  3NVM A;  3F9M A;  2E2N A;  3A0I X;  1KC8 O;  2W6L A;  3ID8 A;  3WNH A;  5AQI A;  1UA1 A;  1WOQ A;  3WXI A;  2HHW A;  1JCF A;  4I6M A;  3RVC A;  5AQW A;  1EP4 A;  4ID1 A;  4FWM A;  4JK8 A;  2HMI A;  1X3N A;  2RPI A;  2VCP A;  5C15 A;  1OH8 A;  4EAH D;  2ZM6 K;  3CI5 A;  4DG1 A;  2P9N A;  4FLX A;  2IVO A;  2Y1I A;  3IFR A;  5BPN A;  1BA1 A;  2YX6 A;  2QA4 N;  1KSP A;  3O8M A;  4CEB A;  3TAB A;  3LZI A;  1HNV A;  2AP1 A;  1S1V A;  1S1U A;  3ITH A;  4ELU A;  1GLC G;  4ID5 A;  1J6Z A;  4NCG A;  3AVI A;  3R6M A;  3O9Q A;  3HPH A;  4JI6 K;  1U2V B;  3QB0 A;  2KFZ A;  1VSE A;  4RW6 A;  1C0T A;  5F2R A;  1ILY A;  1NJZ A;  3AA4 A;  3K58 A;  3EY1 A;  3VES A;  2P5O A;  2QM1 A;  3QEP A;  5KRS A;  3WXJ A;  3IRX A;  2UYT A;  1HQU A;  5M1Q A;  3KVG A;  3ZCM A;  4BC3 A;  4E3S A;  4CFD A;  3JAM O;  3V9Z A;  1VSF A;  3I8B A;  1RFQ A;  1QTM A;  4H0P A;  4FJH A;  3CCM N;  4WF9 L;  1BI4 A;  1O13 A;  2EHG A;  3CJC A;  1NGF A;  1TKT A;  3H6E A;  4C8M A;  4YOU A;  3FZK A;  4H0T B;  4PWD A;  2FSK A;  4ILJ A;  5KQD A;  4JS4 A;  2NRV A;  3MN9 A;  1GLJ O;  3OS2 A;  4FK0 A;  3DRP A;  2DFF A;  5M1F A;  4DFM A;  2FF3 B;  3TAN A;  2W41 A;  3KLI A;  4XEI A;  3CJA A;  4IEE A;  3CC4 N;  2YNI A;  1SUQ A;  3IG1 A;  2UUC K;  4B08 A;  5C10 A;  3L4Q A;  1XHX A;  3CJ9 A;  2YI1 A;  3AO3 A;  3ATU A;  1LCU A;  1MWM A;  4DS5 A;  5M1K A;  1UWB A;  5M1P A;  1K8A O;  3CXC M;  4ISF A;  3A5L C;  4IOX A;  1W2B M;  2XRI A;  3GBT A;  3DLE A;  4A62 A;  3AVL A;  4FWN A;  2WFB A;  4CJW A;  3J81 O;  2P9I A;  2X74 A;  4Y1C A;  3SJH A;  1JLB A;  1K8K A;  2YNF A;  4GVE A;  2VGN A;  3DRS A;  3KJV A;  3ID6 A;  4C1N I;  3CCR N;  4NLB A;  2OTJ N;  3ZET B;  1EXQ A;  3VQQ A;  1X3M A;  4K25 A;  3VQD A;  1S1W A;  3T19 A;  3LZJ A;  4NXM K;  4AH9 A;  3NH1 A;  4WQ5 A;  4M45 A;  3SQ1 A;  1VSH A;  1WNS A;  4O8K A;  1ESV A;  4Z94 A;  5KTQ A;  4FVU A;  3LPU A;  3TAP A;  2XO7 A;  1WBB A;  4FJ9 A;  3S3O A;  5D3G A;  1KLM A;  2NLX A;  2FSN A;  3A8Y A;  4TSX A;  2YKN A;  3GL1 A;  4YOW A;  2UUA K;  3U3Y A;  4BQL A;  3OS1 A;  1YJ9 N;  2P9S A;  1HYV A;  3SUO A;  3LAN A;  3OW2 M;  3QET A;  5F1X A;  4PL8 A;  2GWJ A;  1E4F T;  1ZC6 A;  2NRR A;  4IFV A;  2HHU A;  2F9W A;  4CCH A;  4H5N A;  2CH6 A;  2H3G X;  3SMS A;  4IFE A;  5BR9 A;  3CQY A;  3OJU A;  2B4J A;  3QEI A;  3VGM A;  2E8A A;  4HUE A;  4EFH A;  1V4S A;  3DMJ A;  4JN4 A;  2F8T A;  2HHV A;  3MED A;  5BRE A;  3DLG A;  1U47 A;  1T6D A;  2WUS A;  3SLC A;  4HUF A;  3O08 A;  4DTM A;  5FPN A;  5C25 A;  2O8B A;  4BE0 A;  3TR8 A;  2QWN A;  5CYQ A;  4A5B A;  3QO9 A;  3PO5 A;  1GOC A;  1VQ9 N;  4PY5 A;  1RBV A;  3JSM A;  3AA5 X;  3HM8 A;  4YDU C;  3QEX A;  5CZ2 A;  1HJO A;  3VQC A;  2D0P A;  3TTF A;  4I2P A;  4U7B A;  2FBV A;  4BC2 A;  2QWO A;  1WSI A;  1QQC A;  4KB0 A;  4OPJ A;  3ZX2 A;  3A5N C;  3DXM A;  4ELT A;  4PKH A;  3UKU B;  3HJF A;  5JLF A;  3PUF A;  3DLB A;  3OYE A;  4OKE A;  3E1Y A;  4FZX C;  2D0B A;  3AVM A;  3DXK B;  2B6A A;  2YCH A;  1Q18 A;  5AQF A;  4DSL A;  3LDN A;  4FVM A;  3DXM B;  2EWS A;  1BIU A;  2ITM A;  5C42 A;  5E41 A;  4BWJ A;  1NOZ A;  3OYB A;  1XI1 A;  3AAP A;  3THW B;  3AO1 A;  2WBN A;  5J1E A;  2PAV A;  3T1A A;  1U04 A;  3DOK A;  4G1Q A;  3C94 A;  4J2E A;  3TAE A;  1FW6 A;  3MXM A;  4YDU A;  1ASV A;  4B8C A;  3E01 A;  3M1F A;  3CFO A;  1S9G A;  1ZBU A;  3EO3 A;  1ZXO A;  3MDQ A;  4J8F A;  4DSK A;  3D2F B;  1WB9 A;  1HNW K;  5A2Q O;  4Z4H A;  4BGB A;  3F73 A;  4O5B A;  3OYC A;  3CCL N;  4C8O A;  4KHW A;  5H1S Q;  4F4K A;  3K5N A;  4RCH A;  4CJP A;  4BDY A;  1JKH A;  4A2A A;  4CHO A;  2GBZ A;  2Q0U A;  5GAG P;  4BRA A;  5AZJ A;  3ZEU B;  2DY4 A;  1NJY A;  3LPT A;  5DK5 A;  4CEC A;  3NVK A;  3OVN A;  1L5U A;  4CGI A;  3DLH A;  1WSF A;  3SNN A;  4DFP A;  3LM2 A;  2FSJ A;  3HSC A;  1IBL K;  2CGK A;  4IKF A;  2NUB A;  3OYF A;  2RN2 A;  4DKW A;  4H0Y B;  3D45 A;  4DB3 A;  3I0S A;  2Z1J A;  3WQU A;  3PX0 A;  4H4M A;  3CG7 A;  1G99 A;  5BRH A;  3L2Q A;  3C7N A;  3MN5 A;  3CM5 A;  2HVH A;  3EKS A;  4DTO A;  1ZBF A;  1KFD A;  3P83 D;  4K8X A;  3HBT A;  4X65 K;  1D4X A;  1HKC A;  1QHT A;  3O9U A;  3OYL A;  2OPR A;  4K42 A;  3NH0 A;  4AHU A;  3BF1 A;  4JI1 K;  1RDD A;  3ALY A;  3D7E O;  1FKP A;  1HYS A;  2OAN A;  3VA3 A;  4B3T K;  1JL1 A;  4CIF A;  2V7Z A;  4AIL C;  5AQH A;  1IG9 A;  4DV6 K;  1D8Y A;  3KK7 A;  4FWS A;  3VQ7 A;  1YT3 A;  3L8B A;  1HQE A;  2CH5 A;  3O80 A;  4FLT A;  3KLF A;  4CGD A;  4DLE A;  5J2N A;  3ZX3 A;  3JXU A;  4BC4 A;  2OZS A;  2PFU A;  1IH7 A;  5FRN A;  1BDG A;  3A2F A;  1EKE A;  3O3H A;  4C8N A;  1UA0 A;  5LMN K;  2X78 A;  3VOV A;  2P9P A;  3L3V A;  4CK3 A;  3P38 A;  4J2D A;  5AJ3 K;  3SQ4 A;  3C6T A;  2ITG A;  4B3O A;  1L3T A;  3THX B;  4CGJ A;  3EYZ A;  3KD1 E;  4FOI A;  1BWF O;  3P5J A;  1NGB A;  1QHA A;  3OYN A;  3DLL L;  4CZL A;  2QKK A;  3C65 A;  4DCH A;  4E1M A;  3FE1 A;  2FC0 A;  1S1X A;  4IG3 A;  3MWT A;  3TTD A;  4BRI A;  3RWU A;  2HF4 A;  2QKB A;  3TU5 A;  2QW9 A;  4A2B A;  4JI0 K;  1A5X A;  3WEE B;  1N33 K;  1OKJ A;  5SWM A;  3K5L A;  3HTV A;  1GOB A;  4FK2 A;  3EZ5 A;  2YKM A;  4DV2 K;  3S3M A;  3EN9 A;  3FZF A;  3NGI A;  1NJX A;  1REV A;  3FR0 A;  3C7N B;  4BRC A;  3V81 A;  2YHB A;  4OLA A;  4KO0 A;  4YHH K;  2KFN A;  1KFS A;  1IKX A;  3ZSO A;  3WEE A;  1QQO A;  4DFJ A;  4K43 A;  4BQZ A;  4DTN A;  2VYP A;  1S72 N;  4JHD A;  4CJF A;  4H8K A;  4KV8 A;  4Z4G A;  4Z4C A;  1Z26 A;  2WON A;  3G6E N;  4CJ4 A;  3VER A;  3KD5 E;  1RT2 A;  5AQP A;  5DM6 L;  2Q0R A;  3VQB A;  3CQX A;  4NCA A;  1IBM K;  4CEQ A;  3SAF A;  3OYI A;  4LF5 K;  3AA2 A;  4PQU A;  1I3A A;  2GX9 A;  3CYM A;  1GLE G;  4O5F A;  5MLC Q;  3QES A;  3WXK A;  3CME N;  2A42 A;  4AHS A;  3OYG A;  1C1B A;  4RW8 A;  2RE2 A;  4CE9 A;  5E84 A;  4CJK A;  2HNY A;  1N5Y A;  4DFK A;  4B1Z A;  5BR8 K;  3CPW M;  3TAG A;  2G8H A;  4Z4I A;  3HI0 A;  1NGG A;  4BR2 A;  3U6F A;  4G9Z A;  3ZSZ A;  4ZTF A;  1EET A;  1IV0 A;  3OBY A;  3ULE A;  2KTQ A;  3EE8 A;  3WXL A;  3AA3 A;  5LJV A;  2YNH A;  2UXC K;  2BUP A;  4KTQ A;  4BRH A;  1YVN A;  4JI5 K;  1YXQ A;  3AO5 A;  1X9W A;  2BTF A;  3K9K A;  1D9D A;  3HM9 A;  2GUP A;  4IJA A;  4BRK A;  4CF0 A;  3HXM A;  3PV8 A;  1JL2 A;  2O8B B;  1OVQ A;  3ULE B;  5AQK A;  1T7P A;  3NF8 A;  4CIG A;  1NKB A;  4CHQ A;  3L2W A;  4LSN A;  3B8A X;  2XY5 A;  4FPA A;  3MAQ A;  2P9I B;  3ZSV A;  4BY9 C;  1TGO A;  1IG8 A;  2KQ2 A;  4M7Y A;  3K57 A;  2HST A;  4QOZ B;  2O4I A;  3MX2 A;  2GTD A;  3ULD A;  3ISN C;  2Q36 A;  4FWQ A;  3NCI A;  2HB5 A;  3NH2 A;  3CJ7 A;  4O0J A;  5GAE P;  4FLU A;  1JLA A;  4F2R A;  5AZI B;  4EZ9 A;  4MDB A;  2Z1I A;  1RBU A;  1VQ7 N;  5CHI A;  5JVH L;  2DFH A;  2OZM A;  3CC7 N;  1NJI O;  1RT4 A;  4CJ7 A;  3J7Z O;  4DV1 K;  4LFA K;  2BGG A;  1J53 A;  3ZT3 A;  2UXB K;  4DV7 K;  3V9S A;  3ZT0 A;  3BY5 A;  4JI7 K;  4KH5 A;  4M41 A;  1TYQ A;  4B3M K;  2ZJR L;  2HHT A;  4A61 A;  4IDK A;  4JKE A;  4EP4 A;  4B1Y B;  1TK0 A;  1EQY A;  1RBS A;  3L2R A;  4ISE A;  1WBD A;  2QI2 A;  3CCE N;  3ENH A;  1LV5 A;  2E88 A;  4H0V B;  1BG3 A;  2HBM A;  4BVO A;  1I94 K;  1NOY A;  4U67 L;  1S6P A;  2O8E A;  3TAR A;  1IBK K;  1HNZ K;  1YF5 L;  4JKG A;  3ZEU A;  1FKO A;  1OH7 A;  5DMR A;  2HNZ A;  3K0S A;  1ATS A;  5C12 A;  2NRW A;  3VEY A;  5I3U A;  1C0M A;  4B1W B;  4DR2 K;  4DR7 K;  3OYD A;  2D0A A;  3CFR A;  1F21 A;  1JXE A;  3AAR A;  3DRR A;  1VQ8 N;  1JLF A;  2E20 A;  3QFP A;  4CZM A;  5CYM A;  3SYZ A;  3QFU A;  1T44 A;  4HTU A;  3FZH A;  2HW3 A;  4W5R A;  1NU0 A;  3UKU A;  4I9Q A;  4Z0U A;  1QSY A;  1U49 A;  4OPH A;  3SQ0 A;  2KZZ A;  4DMN A;  3ZSW A;  2HF3 A;  1RTI A;  4JKC A;  3RRH A;  1RDB A;  4AHR A;  1P90 A;  1RNH A;  3QBX A;  3PSF A;  4Z4F A;  1GLB G;  3H3O B;  3DXK A;  3AAQ A;  1HUX A;  2G8I A;  1NGJ A;  4OX9 K;  1TKX A;  3BUZ B;  3CHW A;  1X1P A;  5AFU H;  2Q2R A;  3E9P A;  1P8Z A;  4WQ4 C;  4GMJ B;  5GAH P;  4CFA A;  3AVG A;  3RRG A;  3PIO L;  4KB1 A;  1IKW A;  4IXC A;  3TSU A;  4CHP A;  2X6S A;  4N76 A;  2E1Z A;  3CJB A;  4JK9 A;  4PHT X;  4AM7 A;  3KTQ A;  3NE6 A;  1OH5 A;  5FPE A;  4E7J A;  2XY8 A;  3P4I A;  4M63 C;  4CJ3 A;  4DSF A;  5AQS A;  4H0X B;  3QIO A;  3VQ6 A;  4E1J A;  1XUP O;  1HNX K;  4QS8 A;  3LDO A;  4LH4 A;  3K59 A;  4FWP A;  4PUO A;  4FJJ A;  2HBL A;  3UE5 A;  2QWR A;  5I42 A;  4CBW A;  1VQ6 N;  3NMU A;  3E9O A;  1NWK A;  4GW6 A;  5FRM A;  5CY4 A;  4JNE A;  4CJS A;  4KHN A;  1UOC A;  4CJL A;  3H45 C;  2O4G A;  5FDL A;  4R79 A;  4IG0 A;  1QSL A;  2PY5 A;  1DT9 A;  3M8Q A;  4JAX A;  4GV6 A;  3R1X A;  5EY4 A;  2ZE2 A;  4K41 A;  5JVG L;  3J7A P;  2HVI A;  4CK1 A;  3KK2 A;  4FJL A;  2HHX A;  4QS9 A;  4C23 A;  4FJM A;  4KRE A;  2Q97 A;  4HCC A;  2D1K A;  4FJI A;  1XWL A;  1TAQ A;  2ASO A;  3EL2 A;  4CD1 A;  4CHZ A;  4CHY A;  3RMD A;  3OY9 A;  3UIQ A;  5EVZ A;  4CEE A;  3G71 N;  5CR4 A;  4OPA A;  1WAF A;  3TI0 A;  4MQ3 A;  2YHX A;  1JCG A;  1D5A A;  4H03 B;  4CJV A;  5B8H A;  4N5S A;  3SMP A;  4GNI A;  1K6Y A;  3AVK A;  4ILH A;  5IT9 O;  1SKR A;  1VSI A;  5BN9 A;  4DSJ A;  3LDS A;  3A5M C;  1YTU A;  1T6C A;  1G15 A;  2JWL A;  3O1W A;  4M3W A;  3NGY A;  4HTL A;  1RDA A;  4GKJ K;  4BRF A;  2D0O A;  1WSE A;  1Y64 A;  3MXJ A;  2FXU A;  4CJQ A;  3SBG A;  2IIR A;  1JLG A;  4W5N A;  2KW4 A;  5IWA K;  1VSM A;  4NYF A;  4KHP K;  2BH1 A;  2G8U A;  1DTQ A;  4I9L A;  1LW2 A;  4X62 K;  3SBT A;  4F2S A;  4B3R K;  4DV4 K;  1EWQ A;  3FFI A;  4GKK K;  4LY7 A;  4RW4 A;  1GLD G;  3HVR A;  3FZM A;  2IOC A;  4LH5 A;  5HOO A;  1O1W A;  1Q7Y O;  1CZ9 A;  3KWG A;  3J8A A;  3ZT2 A;  4CGG A;  1X9J A;  3DJC A;  2HHS A;  4MO4 A;  5M1N A;  4NXN K;  2G8K A;  4WFN L;  1N32 K;  3H46 O;  1VRU A;  4B9L A;  5ADX H;  2W6K A;  1NGH A;  3O9R A;  1U6Z A;  4NB4 A;  2G8F A;  3AVB A;  1Q81 O;  3ASM A;  3QLH A;  4DQI A;  2O8C A;  5TKY A;  4BRM A;  4EIA A;  4WQ4 A;  1KVC A;  4YOX A;  3LWM A;  4PKI A;  3QBW A;  4RTF D;  4JKA A;  1J5E K;  3LP0 A;  4IDH A;  3KK1 A;  2XY6 A;  4OGC A;  3TAM A;  4IO9 L;  1LAV A;  3VQE A;  4R5P A;  2P9N B;  5GIP A;  1L3V A;  3CD6 N;  3N4Q A;  3VQP A;  1T8E A;  4FYD A;  3GOI A;  5GIO A;  5CE3 A;  3LP2 A;  4Y1D A;  1KVB A;  1MU2 A;  2V52 B;  3UB5 A;  4EHU A;  3BP8 A;  4CF9 A;  3J7Y P;  3VEW A;  1S5J A;  1U4B A;  1HYZ A;  3CMA N;  3EE9 A;  4H0O A;  2W42 A;  2F7T A;  4DU1 A;  3P39 A;  1HR0 K;  2QWQ A;  4CF1 A;  3GE1 A;  1H1V A;  4I7F A;  4CI6 A;  2F4V K;  3AVH A;  4LF6 K;  3AV9 A;  5HLF A;  1U2V A;  1BIZ A;  4B8A B;  1DLO A;  1T05 A;  4QCL A;  1MWK A;  4DTU A;  3K5O A;  3CM6 A;  1YIJ N;  2V7Y A;  1GLA G;  1WAJ A;  5I9E B;  4YOY A;  1RT7 A;  5KPT A;  4CW7 B;  1ZBI A;  3HO1 A;  1ASW A;  1JLQ A;  2P9K B;  4BC5 A;  5AQT A;  4IOA L;  4WFB L;  2QEX N;  2R7Y A;  4X64 K;  1KD1 O;  1D9F A;  3OA9 A;  1EO1 A;  3F9K A;  4Y0W A;  2GEL A;  3RSE B;  4KH4 A;  1HJR A;  3SCX A;  2VQE K;  4DTP A;  4LFB K;  5JIC A;  4BE1 A;  2FF6 A;  4N41 A;  3PLA A;  2YHA A;  2IC3 A;  1Q9Y A;  1RDC A;  1KAX A;  2Q31 A;  3SAG A;  4BR4 A;  3QIC A;  4NYN A;  3T1Y K;  1ITG A;  1Q8I A;  3HP6 A;  4CZI A;  1DGK N;  4BR5 A;  4JKH A;  1HNI A;  1DKG D;  4CZE A;  1FXX A;  3G25 A;  3AGK A;  4CEA A;  5AQZ A;  3PX4 A;  4CIE A;  3NHG A;  3VEX A;  4E1N A;  1QZ5 A;  4IEI A;  4DR1 K;  3M8S A;  3ZSR A;  2P9U A;  4CFC A;  1VQ5 N;  3U8X A;  1TK5 A;  4YOT A;  4FWR A;  3THV A;  1U48 A;  4CF2 A;  3FZL A;  2JLE A;  5K14 A;  1NK4 A;  5LJW A;  2VWJ A;  4A59 A;  5GAD P;  4ELV A;  3BF3 A;  3LDQ A;  1FK9 A;  3HOT A;  4L3Q A;  3I8D A;  4FJK A;  3QEV A;  5KGX A;  3D2E A;  1NGD A;  3S9H A;  4I2Q A;  1XMO K;  4HCB A;  4DQS A;  4O8U A;  4O0I A;  1Z6R A;  3O3G A;  4DF8 A;  2E6L A;  2O8D A;  2HHQ A;  3VF6 A;  1NGA A;  2HBJ A;  1NMD A;  1SL0 A;  4BDP A;  1YUW A;  5ADX A;  2E1Y A;  2VG7 A;  3ZT4 A;  4CFB A;  4DTJ A;  4B9M A;  1SZ2 A;  2I5J A;  3H1V X;  3VMF B;  3CCQ N;  5HBM A;  2NNW A;  2ZJP L;  3QDK A;  2D5R A;  1NK8 A;  3OYJ A;  4KAZ A;  3D2F A;  1NKC A;  4ILG B;  1DTT A;  1RIL A;  1E3M A;  3HK2 A;  1XQS C;  4EP5 A;  2QWM A;  4XH5 A;  4WFA L;  3MN7 A;  5T7B A;  1HLU A;  4GV9 A;  5AQQ A;  3AVC A;  1SAZ A;  1WSH A;  4YOR A;  4FW1 A;  1VSK A;  3RTV A;  5AQY A;  4MO5 A;  1N6Q A;  4CEO A;  4M7X A;  4DWI A;  3CCS N;  1TK8 A;  1RTJ A;  3W0L A;  2NRH A;  3NF7 A;  4W5O A;  3ENO A;  4CGH A;  3HT3 A;  3Q7B A;  3G4S N;  3AVF A;  4YNQ A;  4F3O A;  4M3X A;  1Y97 A;  4FLW A;  1GLF O;  4A5A A;  3S3N A;  5JS1 A;  1C6V A;  3CF5 L;  4JKF A;  3M6G A;  4LF7 K;  2P9U B;  3GG4 A;  4CJ5 A;  3PY8 A;  3R3L A;  1RDW X;  1VAZ A;  2ATQ A;  4KHY A;  4CJT A;  3FFK B;  2P9L A;  4J2A A;  4FZY A;  1NK9 A;  3ZT1 A;  4YFU A;  3HVT A;  3WUH A;  4OVL A;  3VEZ A;  4DU4 A;  3CET A;  2DTU A;  2GWK A;  4JI4 K;  4BAC A;  4Q0B A;  2IAJ A;  2ZD1 A;  3OYA A;  3TPQ A;  5AQV A;  1BCO A;  2VWK A;  2VGM A;  3DAW A;  1ZYQ A;  2AA4 A;  5BPM A;  3IKM A;  1WSG A;  4L8R B;  1L3S A;  1FJG K;  2ZGY A;  4FCY A;  1VK0 A;  4GV3 A;  3QML A;  3M3Z A;  3NDK A;  5AQL A;  4IFY A;  5AQN A;  1RT3 A;  3MEE A;  1E4G T;  4CBU A;  3SZ2 A;  4KI6 A;  5KPR A;  4FPB A;  1QQM A;  1S1T A;  3VQ9 A;  2XY7 A;  5AQM A;  5KPZ A;  2P9P B;  1WN7 A;  4JD2 A;  4HUG A;  3C6U A;  1N8R O;  2NRX A;  1A5V A;  3AVJ A;  3V9U A;  3CIP A;  3THX A;  2E2P A;  4FJ7 A;  1RCH A;  5C24 A;  1LWF A;  4CES A;  4H5V A;  3IS9 A;  5DM7 L;  2E2O A;  3AVA A;  1NGI A;  3K5M A;  5LY3 A;  5KQ8 A;  3KIO A;  5HRS A;  3DLK A;  1IO2 A;  4XH1 A;  3EKU A;  4CJU A;  4H4O A;  3KWI A;  5C2D A;  1BCM A;  3C6A A;  4BRD A;  1J5O A;  4BRQ A;  3AVN A;  3TTC A;  4BRL A;  4F9O A;  4NCB A;  1XNR K;  2ZQB A;  4B1U B; 
#chains in the Genus database with same CATH homology
 3J7A P;  4AQY K;  4LF7 K;  1I94 K;  4DV3 K;  5BR8 K;  1IBK K;  4JI2 K;  1HNZ K;  1XMQ K;  4B3S K;  4NXM K;  1J5E K;  4DUY K;  2E5L K;  5LMN K;  4JV5 K;  2VQF K;  2UXC K;  5AJ3 K;  4DR2 K;  4DR7 K;  4V19 S;  4X66 K;  4JI5 K;  4JI4 K;  5FLX O;  3OTO K;  2UXD K;  4DR5 K;  3J80 O;  4JI6 K;  4YY3 K;  3J7Y P;  2HHH K;  1HNW K;  5A2Q O;  4JYA K;  2UUA K;  1FJG K;  1XMO K;  4LF4 K;  5IT9 O;  1HR0 K;  4K0K K;  2F4V K;  4LF6 K;  4DR3 K;  1XNQ K;  3JAM O;  1N36 K;  4JI0 K;  1N33 K;  4GKJ K;  4OX9 K;  4DR4 K;  1IBL K;  4CW7 B;  4DV2 K;  5IWA K;  4LFC K;  4KHP K;  4YHH K;  4X64 K;  4X62 K;  4LF8 K;  4B3R K;  4JI8 K;  4DV4 K;  5LMU K;  2UUB K;  4X65 K;  4DV1 K;  4GKK K;  4LFA K;  2VQE K;  4LF9 K;  4LFB K;  2UXB K;  4DUZ K;  4DV7 K;  2UUC K;  2UU9 K;  4JI7 K;  4JI1 K;  4B3M K;  1HNX K;  4DR6 K;  1N34 K;  3T1Y K;  1IBM K;  4CVN E;  4B3T K;  4DV5 K;  4LF5 K;  4JI3 K;  4NXN K;  4DV6 K;  1N32 K;  3J81 O;  5LL6 Z;  4DV0 K;  4DR1 K;  3T1H K;  2ZM6 K;  1XNR K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...