4JV5M

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4jv5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4jv5M02
4LF6M 3GQ3A 1EE8A 4G4NA 4X66M 4JI8M 1Q3BA 5LMNM 1XNQM 2ZM6M 4X62M 2UXCM 1XMOM 4CISA 2F5QA 4MB7A 3C58A 4PD2A 1FJGM 4JI2M 1K82A 4NXMM 3DOAA 5BR8M 3SAVA 2VQEM 4DR3M 2EA0A 4DUZM 5A2QS 3GP1A 3GO8A 4DUYM 1KFVA 2UUCM 2XZFA 4K0KM 3U6QA 3SAUA 2UUBM 4GKKM 1N33M 2Q2EB 3U6EA 5ITTA 4PDGA 4DV6M 1TDHA 1N36M 2F5PA 4LF7M 1HNXM 1N34M 2UXBM 1HR0M 4G4QA 4DV3M 4PDIA 1I94M 4LFBM 4JYAM 4JI0M 1MU5A 4JI3M 4X65M 4DR6M 1L1TA 1MX0A 2E5LM 3SBJA 2F5NA 2F4VM 4DR1M 5IT9S 3W0FA 1PM5A 1K3WA 1TDZA 4OX9M 3GQ5A 4PCZA 2UUAM 1PJIA 4JI1M 4LFCM 1Q3CA 4DR4M 3J81S 4B3SM 4GKJM 4DR7M 4LFAM 5ITYA 1IBMM 4B3RM 2UU9M 3GQ4A 3A46A 4B3MM 3J80S 3GPYA 4NRVA 5IWAM 3T1HM 1L2DA 3T1YM 1XC8A 4YHHM 1L2CA 2OPFA 3U6OA 3JR5A 5ITRA 4ITQA 3TWKA 4JI4M 4YY3M 3U6DA 5ITXE 3U6MA 4DR2M 1XNRM 4KHPM 5ITQA 2OQ4A 1L1ZA 3SASA 3U6CA 3SATA 1N32M 3SAWA 4DV5M 3U6LA 4LF4M 4B3TM 2HHHM 3GPPA 4AQYM 3U6SA 4DR5M 2XZUA 3SARA 4LF9M 4DV0M 3U6PA 4DV1M 2VQFM 3J7AS 3JAMS 3VK8A 5ITXA 1Z5CA 4LF5M 3GPUA 4JI5M 1Z59A 4NRWA 3A42A 3TWMA 4G4RA 1Z5AA 4G4OA 4JI6M 1HNWM 4X64M 1NNJA 4JI7M 2F5OA 4NXNM 3OTOM 1J5EM 5ITUA 1R2ZA 1Z5BA 1L2BA 1HNZM 5FLXS 3JR4A 4DV2M 3VK7A 4DV4M 3GPXA 5LMUM 1K3XA 2HKJA 4JV5M 1R2YA 1IBKM 2F5SA 3TWLA 1Q39A 2ZBKB 1PJJA 2UXDM 4LF8M 3A45A 1IBLM 1XMQM 4DV7M
chains in the Genus database with same CATH superfamily
4RKUF 2CP8A 2P5TA 2Y21A 3E9SA 1NVMA 1XNQM 3TL4X 3LQRA 3VKHA 2QNJA 7CATA 2K6BA 1TH2A 3GLGA 3C58A 3HKPA 3HX3A 4G6ZA 1QZEA 3THGA 1GJSA 1V33A 1IXZA 5BPVA 1K82A 4NXMM 3DOAA 2VF8A 5BR8M 3VLFB 4LJ6A 4Y28F 2JY6B 2JUJA 1QAMA 2C98A 8CATA 4LJ8A 5A2QS 3T38A 2LVQD 3GLFB 4DUYM 1TGUA 1NSFA 2X4AA 3DZDA 5FTKA 3KXEC 2GNOA 2KZUA 2ZANA 3U6EA 4RF0A 1JQJC 3K9PA 2DNAA 2HWJA 4RNAA 1IFYA 2C99A 2QQ8A 1DGHA 4IBIA 4DV3M 4LFBM 1G8PA 2L7IA 2J5YA 3FRIA 2CEAA 2G8LA 4Z6YA 3PXGA 2LXEA 4IBEA 1TTEA 2L6OA 3A98B 1L1TA 1C1KA 3SBJA 2F5NA 5IT9S 4DR1M 2A5YB 3HHZA 3QYEA 1YE9A 3J7BA 4QHTA 4GKJM 4P16A 3I4YA 3GLGB 1D0KA 1IN7A 1OAIA 3GLIB 3VFDA 1VEJA 2EKKA 3J80S 1DO2A 2ZAOA 2YR0A 4OU7A 3GLHE 1JR3D 4MGHA 1GO5A 1LV7A 1SXJB 4YHHM 3U6OA 5ITRA 2XSZD 3HY5A 2C9OA 2RGHA 4JI4M 2KRKA 5ITXE 2XGNA 2XLJA 4B7GA 1L1ZA 3SATA 3BBZA 3I01M 3J27B 1N32M 3W68A 1IN5A 4GC9A 4LF4M 1JB0F 2I7NA 1GVNA 1W5TA 3AL0C 4AZFA 4AQYM 2XFSA 2Z3XA 1V34A 2KW0A 1W5SA 3EIEA 4XK8F 4DV0M 4FCVA 4FW9A 3JAMS 2DHRA 1IN6A 1T3TA 1QDTA 4LF5M 2C96A 1C7YA 2YQZA 1NNUC 5DYIA 4JI5M 4IBDA 2X49A 3U60A 3V76A 3B74A 1HNWM 3RFWA 4QNRA 4QOSA 3RGPA 4JI7M 2F5OA 2DENA 2DI0A 3HZJA 4NXNM 3TE6A 1YLAA 4GC5A 1R6BX 5JI3E 2ZAMA 1ZMVA 4AKGA 3MK6A 1YSYA 4FD2A 4GHAA 2KHHA 1K3XA 3GLHA 2DZOB 3I51A 2RRUA 3K1JA 1BVSA 1XXHB 2LVAA 3BXWA 2LVOC 1SXJE 1VEKA 2ZBKB 3PNYA 4OW0A 4LZJA 3GLIE 3LCVB 4HL4A 3K92A 5KQDA 4NL4H 1ZQ9A 2XEPA 1WR1B 2YNMD 2DWLA 3LVWA 4G4NA 5EXSA 1AUAA 1WHCA 2XF3A 3B7QA 3UZUA 2BJWA 2Z4SA 1NV8A 1D0MA 4KLNA 4R3DA 3HGIA 3FE3A 3FUWA 3LQQA 1GL7A 1GLNA 1DO0A 4M9ZA 5EP3A 3HU3A 2K0BX 1E9RA 2WSCF 2JY8A 1N78A 3U61A 4FCWA 3GP1A 2DWNA 3C9PA 1QUTA 1T6OA 2UUCM 4I5SA 3SAUA 2UUBM 4AI6A 3E46A 4F2LA 4MH0E 1IN4A 3E21A 3IECA 3AFHA 3QWLA 5ITTA 4PDGA 1N36M 4LF7M 3AKZA 3ZCBB 1Z6TA 2QHOB 1ZAEA 2M5ZA 2Y0QA 1OFIA 4LJ5A 1OJLA 3SHFA 2CHQA 1QZMA 1G4AE 2L4FA 2VDBB 1MU5A 4WW0A 2KNZA 4LRSA 4NSOB 1DGGA 4DR6M 1R7RA 1GKIA 2F4VM 3KSXA 4M9XA 4FWHA 3GLFA 4MM3B 3HHWA 1R5LA 3GQ5A 1UM8A 1Q3CA 2WSFF 3GRVA 1QQWA 4QOZC 2FS1A 2JXNA 1YUBA 4LFAM 1P3QQ 2Y0TA 4MGYE 5ITYA 2UU9M 5EXXA 3GQ4A 5FTMA 3GRRA 4KO8A 3GPYA 3CGWA 4NRVA 5C1BA 3T1HM 2HL7A 1HT2E 3L25A 4CIZA 1L2DA 4FWGA 1XC8A 2OPFA 1Y8GA 2FOIC 3TWKA 4MGKE 3HJSA 2KXEA 3AOGA 4DR2M 1NHGC 2EJSA 5ITQA 2OQ4A 4L6V6 3CF2A 1V92A 4B7HA 3U6CA 3U60B 1TH3A 3SMSA 2DWMA 1OTRA 1GABA 3U5ZB 1VG5A 3C3DA 5EP1A 1CUKA 3GPPA 4IBFA 4OVZB 3GLIA 1PJTA 3VDPA 2LHGA 3SMPA 4DR5M 1IM2A 1J09A 3FYCA 4M9SA 4CJ6A 4GRIA 3B89A 2VQFM 1MJGM 2O25A 1GL6A 2KZSA 3D8LA 3I04M 4Z8XA 2BWEA 3WHKA 1XB2B 1VDDA 5ITXA 3IG5A 3SHGB 3RGSA 4LJAA 2MJ5B 1Z5CA 2RKOA 1QAOA 2LNHC 3AOEC 3FUUA 1Z59A 2W82A 4NSRA 1NHWC 4G4RA 1Z5AA 3KP0E 1UFZA 2WZJA 3CF6E 4JI6M 3GRYA 3ZC7B 2KNAA 5L8RF 5EP4A 3PVSA 4NC6A 3UJNA 3UGJA 3OTOM 1J5EM 4LY6A 5KPTA 1D0LA 2F5SA 1WGLA 3AJIB 3BOSA 3MJ5A 1L2BA 5FLXS 4DUZM 4GMQA 1E94E 4DV4M 4M0WA 3GPXA 5LMUM 2HKJA 2K47A 1R2YA 3AV0A 3Q8XA 3RE8A 1TR8A 2EUCA 3F92A 4LJ4A 2H5XA 3KS4A 2NQ8C 3SC3A 4LF8M 2VIIA 1FNNA 2CFOA 3A45A 3HU1A 1IBLM 4L78A 4PT5A 4Q7JA 3IHPA 3KSJA 3M6AA 4DV7M 4LF6M 1TF0B 2RGOA 3K9OA 4IBGA 4B7FA 4X66M 2QBYB 4JI8M 2V6ZM 4BLCA 1NJFA 3M0EA 4X62M 2UXCM 2EO2A 1NY6A 1T43A 1ZMWA 5KPRA 1XMOM 1VQ1A 2F5QA 3LW5F 3T6PA 1SG9A 4LJ7A 5FTNA 4JI2M 3MHVC 1F4IA 2R4EA 1IXSB 2VQEM 2JNHA 1QUSA 1VDLA 2B3TA 2BJVA 4DR3M 2I7PA 4MGIE 5DYGA 3CTWB 2EA0A 1L8QA 3K8ZA 2L09A 2XZFA 3KOXE 4QNMA 4K0KM 3U6QA 4L8RC 3H4MA 1NY5A 4GKKM 1N33M 3LMMA 1G41A 3Q8GA 2DAIA 2MROB 4DV6M 1TDHA 2CV0A 4KODA 1HNXM 5KO3A 3KW6A 1N34M 4FCTA 1HR0M 4G4QA 2UXBM 1JR3E 4HLQA 2R18A 4PDIA 4ZPXA 1I94M 4JYAM 4JXJA 4JI0M 2CV2A 4IBBA 1PRBA 3FKEA 3I4VA 2KA6B 3FUXA 3W0FA 4L4UA 1OQYA 1PM5A 2CHVA 1OIPA 1QVRA 4A3VB 1K3WA 4OX9M 3K2LA 2UUAM 3ZH9B 1PJIA 4JI1M 1ORYB 2D7HA 1WGNA 3J81S 3W0LB 4OVZA 1QANA 5FTJA 4DR7M 2X8AA 4B3RM 4GIPA 1SXJD 1A5TA 3A46A 2XSZA 3L2AA 3MMPA 2JWSA 2DKLA 5IWAM 1TH4A 2C9CA 2JY7A 2LBCA 4AKHA 3FUTA 4II7A 2OOBA 3T1YM 5C18A 3JR5A 2DAGA 2JZ1A 4HEOA 3HWSA 1KYIA 1IXRC 1G71A 2D7EA 2KRUA 3L29A 4P17A 2G5GX 4YY3M 3U6DA 3U6MA 4LCBA 4ANRA 2WSEF 3W67A 5H37D 1HQYE 4IBJA 1NV9A 3U5ZA 1XXHA 4B3TM 1H6UA 2CV1A 1WXQA 4LF9M 3PNVA 2MR9A 2V1UA 2K9DA 3SARA 4D81A 2XFTA 3VDUA 4IBCA 5EXTA 2AHMA 1S3SA 1XWIA 2BWBA 2L2DA 2M60A 3SASA 4W5WA 5EXPA 4AW4A 3QYBA 3GRUA 1QDRA 2CHGA 2CRUA 5E26A 2R0IA 3A42A 3CF0A 2LTUA 3R8FA 4LZZA 2HCBA 1J7KA 3ZQJA 2LHCA 1OFHA 4BB9A 4CGYB 4IJEA 5KPZA 3R9XB 2R6FA 2QBYA 2OO9A 5EQTA 2ZTDA 3C3EA 3LVVA 1Z5BA 3KFUG 4F1IA 1JR3A 4S12A 1HNZM 3JR4A 4R71A 3EIHA 3U61B 2R45A 2FE8A 3DFZA 3KOWE 1QYRA 5JI2E 3J2PB 2LVPC 2KEBA 1IBKM 1PJQA 4I81A 3QAUA 1HT1E 4XGIA 2DZNB 2MH8A 3E4RA 1IY2A 4RF1A 1WIVA 3L26A 1PJJA 4REZA 3ILKA 2GQFA 2KNVA 3M7GA 2QSFX 1X37A 1XXHE 2DAKA 4QHSA 5E6JA 3GQ3A 1EE8A 1VEGA 4IJFA 2JY5A 1Q3BA 5LMNM 2DZLA 2ZM6M 3NBIA 4CISA 4MB7A 3FTEA 1DGFA 1MN3A 3WHLA 4PD2A 1Q02A 2HAKA 4R7GA 3TPZA 1FJGM 4IBKA 4NOOB 3SYKA 1EIJA 3HHXA 3FYDA 2R62A 3FD9A 4LRTA 5FTLA 3SAVA 1I4WA 3IG8A 2R44A 2N35A 4B08A 2VF7A 1PJSA 3GO8A 2FNAA 3HHYA 4KT0F 1G3IA 1KFVA 2QZ4A 2DVWB 4CHTB 2Q2EB 3KDSE 4FVMA 4JN6A 3D8BA 2DHYA 2R46A 2F5PA 4M0DA 2DXIA 2Y20A 3SFZA 5EP2A 1N75A 4WP2A 3UMMA 2L4EA 2XH9A 4I8OA 4MGZE 3H4JA 4AG5A 4GEWA 4JI3M 4X65M 1DGBA 1MX0A 4IIWA 2E5LM 4AG6A 3FTDA 4GITA 2APLA 1TDZA 3LCUA 4LG2A 1XHBA 1OKSA 4PCZA 5F3WA 1OIZA 1IN8A 4LFCM 1IXSA 4B3SM 4DR4M 3FTFA 1IBMM 2DAMA 4D80A 2KDLA 4B3MM 3GLHB 4EIWA 1RU3A 2JP7A 2EKFA 3NWLA 1DGHB 2D7GA 3HJ8A 5IREB 1L2CA 4GH9A 1E32A 4WURA 3GLGE 2LH0A 2QCUA 4ITQA 1QAQA 4FWDA 5DFLA 3B9PA 3KVWA 1XNRM 4KHPM 1IY1A 2YFQA 1NJGA 2CUZA 4D82A 3AOEA 2QPAA 3TQSA 2ERCA 1OAOC 5KQ8A 1NO1A 1WJ7A 3SAWA 4DV5M 2J7OA 3U6LA 4L16A 2HHHM 3VKGA 3UK6A 4DBGB 3HJQA 1E9SA 3L28A 2LWXA 4I4LA 4LGYA 3U6SA 3B7NA 1ZMUA 3KS8A 2O01F 4L15A 3SYLA 2XZUA 2JZ0A 3U6PA 4BBAA 4DV1M 1EFUB 5FSWA 1HJPA 3J7AS 2Z4RA 2O5RA 1G59A 2MGWA 3B7ZA 3VK8A 2C5RA 2J7NA 2LVNC 2Z8YM 3FTCA 4LJ9A 2FFJA 2QP9X 3GPUA 2L7HA 4NRWA 3DA1A 1PGYA 3TWMA 1SXJC 4G4OA 3GLFE 1LTMA 3L27A 4X64M 1SXJA 1R4GA 2H1RA 1N77A 1NNJA 3FUVA 2DAEA 5EJCA 1IY0A 3FRHA 3PFIA 2JA2A 2R4JA 5ITUA 1R2ZA 4AKIA 2FH0A 1HQCA 2BNKA 4GHLA 4DV2M 4UN2B 3VK7A 4TUWA 5GKNA 2R65A 3HU2A 3KOZE 1D2NA 2QENA 4JV5M 1DV0A 2ZTCA 5DNYA 2CE7A 2CWBA 2G3QA 1ZV1A 3KP1E 3KOYE 1GJTA 1AIPC 3NBXX 4G3OA 4LGMA 3TWLA 2DWZB 1KSFX 4XBOA 1Q39A 2OOAA 2UXDM 2V1CA 2Z7JA 1XMQM 3T15A 1IQPA 5IZ7D
chains in the Genus database with same CATH topology
2P5TA 2Y21A 3E9SA 1NVMA 1XNQM 3TL4X 3LQRA 3VKHA 7CATA 1TH2A 3GLGA 3C58A 3HKPA 4G6ZA 3THGA 1IXZA 5BPVA 1K82A 4NXMM 3DOAA 5BR8M 3VLFB 4LJ6A 1QAMA 2C98A 8CATA 4LJ8A 5A2QS 3T38A 3GLFB 4DUYM 1TGUA 1NSFA 2X4AA 3DZDA 5FTKA 3KXEC 2KZUA 2ZANA 3U6EA 4RF0A 1JQJC 4RNAA 2C99A 1DGHA 4IBIA 4DV3M 4LFBM 1G8PA 2L7IA 2CEAA 2G8LA 4Z6YA 3PXGA 2LXEA 4IBEA 2L6OA 1L1TA 3A98B 1C1KA 3SBJA 2F5NA 5IT9S 4DR1M 2A5YB 3HHZA 1YE9A 3J7BA 4QHTA 4GKJM 4P16A 3I4YA 3GLGB 1IN7A 3GLIB 3VFDA 3J80S 1DO2A 2ZAOA 2YR0A 4OU7A 1JR3D 4MGHA 1LV7A 1SXJB 4YHHM 3U6OA 5ITRA 2XSZD 2C9OA 2RGHA 4JI4M 2KRKA 5ITXE 2XGNA 2XLJA 4B7GA 1L1ZA 3SATA 1N32M 3J27B 1IN5A 4GC9A 4LF4M 2I7NA 1GVNA 1W5TA 3AL0C 4AZFA 4AQYM 2XFSA 2Z3XA 2KW0A 1W5SA 3EIEA 4DV0M 4FCVA 4FW9A 3JAMS 2DHRA 1IN6A 1T3TA 4LF5M 2C96A 2YQZA 1NNUC 5DYIA 4JI5M 4IBDA 2X49A 3U60A 1HNWM 3RFWA 4QNRA 4QOSA 3RGPA 4JI7M 2F5OA 3TE6A 4NXNM 4GC5A 1R6BX 5JI3E 2ZAMA 4AKGA 3MK6A 1YSYA 4FD2A 4GHAA 1K3XA 3GLHA 2DZOB 3I51A 3K1JA 1XXHB 1SXJE 2ZBKB 3PNYA 4OW0A 4LZJA 4HL4A 3K92A 5KQDA 4NL4H 2XEPA 1ZQ9A 2YNMD 2DWLA 3LVWA 4G4NA 5EXSA 2XF3A 3UZUA 2BJWA 2Z4SA 4KLNA 4R3DA 3HGIA 3FUWA 3LQQA 1GL7A 1GLNA 1DO0A 4M9ZA 5EP3A 3HU3A 1E9RA 1N78A 3U61A 4FCWA 3GP1A 2DWNA 2UUCM 4I5SA 3SAUA 2UUBM 4AI6A 4MH0E 1IN4A 3QWLA 3AFHA 5ITTA 4PDGA 1N36M 4LF7M 3AKZA 3ZCBB 1Z6TA 1ZAEA 2M5ZA 2Y0QA 1OFIA 4LJ5A 1OJLA 3SHFA 2CHQA 1QZMA 1G4AE 1MU5A 4WW0A 4LRSA 4NSOB 1DGGA 4DR6M 1R7RA 1GKIA 2F4VM 3KSXA 4M9XA 4FWHA 3GLFA 4MM3B 3HHWA 3GQ5A 1UM8A 1Q3CA 3GRVA 1QQWA 4QOZC 1YUBA 4LFAM 4MGYE 2Y0TA 5ITYA 2UU9M 5EXXA 3GQ4A 5FTMA 3GRRA 4KO8A 3GPYA 5C1BA 4NRVA 3T1HM 3L25A 2HL7A 1HT2E 1L2DA 4FWGA 1XC8A 2OPFA 2FOIC 3TWKA 4MGKE 3HJSA 2KXEA 3AOGA 4DR2M 1NHGC 5ITQA 2OQ4A 3U60B 3CF2A 4B7HA 3U6CA 1TH3A 3SMSA 2DWMA 3U5ZB 5EP1A 3GPPA 4IBFA 4OVZB 3GLIA 3VDPA 3SMPA 4DR5M 1IM2A 1J09A 3FYCA 4M9SA 4GRIA 2VQFM 1GL6A 2KZSA 3D8LA 4Z8XA 3WHKA 1VDDA 5ITXA 3IG5A 3SHGB 3RGSA 4LJAA 1Z5CA 2RKOA 1QAOA 2LNHC 3AOEC 3FUUA 1Z59A 2W82A 4NSRA 1NHWC 4G4RA 1Z5AA 3KP0E 4JI6M 3CF6E 3GRYA 3ZC7B 5EP4A 3PVSA 3UJNA 3UGJA 3OTOM 1J5EM 4LY6A 5KPTA 3AJIB 3BOSA 3MJ5A 1L2BA 5FLXS 4GMQA 1E94E 4DV4M 4M0WA 3GPXA 5LMUM 2HKJA 2K47A 1R2YA 3AV0A 3Q8XA 3RE8A 2EUCA 4LJ4A 3KS4A 2NQ8C 3SC3A 4LF8M 2VIIA 1FNNA 2CFOA 3A45A 3HU1A 1IBLM 4L78A 4PT5A 3KSJA 3M6AA 4DV7M 4LF6M 2RGOA 4IBGA 4B7FA 4X66M 2QBYB 4JI8M 2V6ZM 4BLCA 1NJFA 3M0EA 4X62M 2UXCM 2EO2A 1NY6A 5KPRA 1XMOM 2F5QA 4LJ7A 5FTNA 4JI2M 3MHVC 2R4EA 1IXSB 2VQEM 4DR3M 2BJVA 2I7PA 4MGIE 5DYGA 3CTWB 2EA0A 1L8QA 3K8ZA 2L09A 2XZFA 3KOXE 4QNMA 4K0KM 3U6QA 4L8RC 3H4MA 1NY5A 4GKKM 1N33M 3LMMA 1G41A 4DV6M 1TDHA 2CV0A 4KODA 1HNXM 5KO3A 3KW6A 1N34M 4FCTA 1HR0M 4G4QA 2UXBM 4HLQA 2R18A 4PDIA 4ZPXA 1I94M 4JYAM 4JXJA 4JI0M 2CV2A 4IBBA 3FKEA 3I4VA 2KA6B 3FUXA 3W0FA 4L4UA 1PM5A 1K3WA 2CHVA 1QVRA 4A3VB 4OX9M 3K2LA 2UUAM 3ZH9B 1PJIA 4JI1M 1ORYB 2D7HA 3J81S 3W0LB 4OVZA 1QANA 5FTJA 4DR7M 2X8AA 4B3RM 4GIPA 1SXJD 3A46A 2XSZA 3L2AA 5IWAM 1TH4A 2C9CA 4AKHA 3FUTA 4II7A 3T1YM 5C18A 3JR5A 3HWSA 1KYIA 1IXRC 2D7EA 2KRUA 3L29A 4YY3M 2G5GX 3U6DA 3U6MA 4LCBA 5H37D 1HQYE 4IBJA 1XXHA 4B3TM 1H6UA 2CV1A 1WXQA 4LF9M 3PNVA 2V1UA 3SARA 4D81A 2XFTA 3VDUA 4IBCA 5EXTA 2AHMA 1S3SA 1XWIA 2M60A 4W5WA 5EXPA 4AW4A 3GRUA 2CHGA 5E26A 3A42A 3CF0A 3R8FA 4LZZA 2HCBA 1J7KA 1OFHA 4BB9A 4CGYB 4IJEA 5KPZA 3R9XB 2QBYA 5EQTA 3LVVA 1Z5BA 3KFUG 1JR3A 4S12A 1HNZM 3JR4A 3EIHA 3U61B 2R45A 3KOWE 2FE8A 3DFZA 1QYRA 5JI2E 3J2PB 2KEBA 1IBKM 4I81A 3QAUA 1HT1E 4XGIA 2DZNB 3E4RA 1IY2A 4RF1A 3L26A 1PJJA 4REZA 3ILKA 3M7GA 1X37A 4QHSA 5E6JA 3GQ3A 1EE8A 4IJFA 1Q3BA 5LMNM 2ZM6M 3NBIA 4CISA 4MB7A 3FTEA 1DGFA 3WHLA 4PD2A 3TPZA 4R7GA 1FJGM 4IBKA 4NOOB 3SYKA 3HHXA 3FYDA 2R62A 3FD9A 4LRTA 5FTLA 3SAVA 1I4WA 3IG8A 4DUZM 4B08A 3GO8A 2FNAA 3HHYA 1KFVA 1G3IA 2QZ4A 2DVWB 4CHTB 2Q2EB 3KDSE 4FVMA 4JN6A 3D8BA 2R46A 2F5PA 4M0DA 2DXIA 2Y20A 3SFZA 5EP2A 1N75A 3UMMA 2XH9A 4I8OA 4MGZE 4AG5A 4JI3M 4X65M 1DGBA 1MX0A 4IIWA 2E5LM 4AG6A 3FTDA 4GITA 1TDZA 4LG2A 1XHBA 4PCZA 5F3WA 4DR4M 1IN8A 4LFCM 4B3SM 3FTFA 1IBMM 4D80A 4B3MM 3GLHB 4EIWA 3NWLA 1DGHB 2D7GA 3HJ8A 5IREB 1L2CA 4GH9A 1E32A 4WURA 2LH0A 2QCUA 4ITQA 1QAQA 4FWDA 3B9PA 3KVWA 1XNRM 4KHPM 1IY1A 2YFQA 1NJGA 2CUZA 4D82A 3AOEA 2QPAA 3TQSA 2ERCA 5KQ8A 3SASA 3SAWA 4DV5M 2J7OA 3U6LA 4L16A 2HHHM 3VKGA 3UK6A 3HJQA 1E9SA 3L28A 2LWXA 4I4LA 4LGYA 3U6SA 3KS8A 4L15A 3SYLA 2XZUA 3U6PA 4BBAA 4DV1M 5FSWA 3J7AS 2Z4RA 2O5RA 1G59A 3VK8A 2C5RA 2J7NA 4LJ9A 3FTCA 2FFJA 2QP9X 3GPUA 2L7HA 4NRWA 3DA1A 3TWMA 1SXJC 4G4OA 3L27A 4X64M 1SXJA 2H1RA 1N77A 1NNJA 3FUVA 5EJCA 1IY0A 3PFIA 2JA2A 2R4JA 5ITUA 1R2ZA 4AKIA 1HQCA 2BNKA 4GHLA 4DV2M 3VK7A 4TUWA 5GKNA 2R65A 3HU2A 3KOZE 1D2NA 2QENA 4JV5M 5DNYA 2CE7A 3KOYE 3KP1E 4LGMA 3U5ZA 2F5SA 3TWLA 2DWZB 1KSFX 4XBOA 1Q39A 2UXDM 2V1CA 2Z7JA 1XMQM 3T15A 1IQPA 5IZ7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 M;  3GQ3 A;  1EE8 A;  4G4N A;  4X66 M;  4JI8 M;  1Q3B A;  5LMN M;  1XNQ M;  2ZM6 M;  4X62 M;  2UXC M;  1XMO M;  4CIS A;  2F5Q A;  4MB7 A;  3C58 A;  4PD2 A;  1FJG M;  4JI2 M;  1K82 A;  4NXM M;  3DOA A;  5BR8 M;  3SAV A;  2VQE M;  4DR3 M;  2EA0 A;  4DUZ M;  5A2Q S;  3GP1 A;  3GO8 A;  4DUY M;  1KFV A;  2UUC M;  2XZF A;  4K0K M;  3U6Q A;  3SAU A;  2UUB M;  4GKK M;  1N33 M;  2Q2E B;  3U6E A;  5ITT A;  4PDG A;  4DV6 M;  1TDH A;  1N36 M;  2F5P A;  4LF7 M;  1HNX M;  1N34 M;  2UXB M;  1HR0 M;  4G4Q A;  4DV3 M;  4PDI A;  1I94 M;  4LFB M;  4JYA M;  4JI0 M;  1MU5 A;  4JI3 M;  4X65 M;  4DR6 M;  1L1T A;  1MX0 A;  2E5L M;  3SBJ A;  2F5N A;  2F4V M;  4DR1 M;  5IT9 S;  3W0F A;  1PM5 A;  1K3W A;  1TDZ A;  4OX9 M;  3GQ5 A;  4PCZ A;  2UUA M;  1PJI A;  4JI1 M;  4LFC M;  1Q3C A;  4DR4 M;  3J81 S;  4B3S M;  4GKJ M;  4DR7 M;  4LFA M;  5ITY A;  1IBM M;  4B3R M;  2UU9 M;  3GQ4 A;  3A46 A;  4B3M M;  3J80 S;  3GPY A;  4NRV A;  5IWA M;  3T1H M;  1L2D A;  3T1Y M;  1XC8 A;  4YHH M;  1L2C A;  2OPF A;  3U6O A;  3JR5 A;  5ITR A;  4ITQ A;  3TWK A;  4JI4 M;  4YY3 M;  3U6D A;  5ITX E;  3U6M A;  4DR2 M;  1XNR M;  4KHP M;  5ITQ A;  2OQ4 A;  1L1Z A;  3SAS A;  3U6C A;  3SAT A;  1N32 M;  3SAW A;  4DV5 M;  3U6L A;  4LF4 M;  4B3T M;  2HHH M;  3GPP A;  4AQY M;  3U6S A;  4DR5 M;  2XZU A;  3SAR A;  4LF9 M;  4DV0 M;  3U6P A;  4DV1 M;  2VQF M;  3J7A S;  3JAM S;  3VK8 A;  5ITX A;  1Z5C A;  4LF5 M;  3GPU A;  4JI5 M;  1Z59 A;  4NRW A;  3A42 A;  3TWM A;  4G4R A;  1Z5A A;  4G4O A;  4JI6 M;  1HNW M;  4X64 M;  1NNJ A;  4JI7 M;  2F5O A;  4NXN M;  3OTO M;  1J5E M;  5ITU A;  1R2Z A;  1Z5B A;  1L2B A;  1HNZ M;  5FLX S;  3JR4 A;  4DV2 M;  3VK7 A;  4DV4 M;  3GPX A;  5LMU M;  1K3X A;  2HKJ A;  4JV5 M;  1R2Y A;  1IBK M;  2F5S A;  3TWL A;  1Q39 A;  2ZBK B;  1PJJ A;  2UXD M;  4LF8 M;  3A45 A;  1IBL M;  1XMQ M;  4DV7 M; 
#chains in the Genus database with same CATH topology
 4RKU F;  2CP8 A;  2P5T A;  2Y21 A;  3E9S A;  1NVM A;  1XNQ M;  3TL4 X;  3LQR A;  3VKH A;  2QNJ A;  7CAT A;  2K6B A;  1TH2 A;  3GLG A;  3C58 A;  3HKP A;  3HX3 A;  4G6Z A;  1QZE A;  3THG A;  1GJS A;  1V33 A;  1IXZ A;  5BPV A;  1K82 A;  4NXM M;  3DOA A;  2VF8 A;  5BR8 M;  3VLF B;  4LJ6 A;  4Y28 F;  2JY6 B;  2JUJ A;  1QAM A;  2C98 A;  8CAT A;  4LJ8 A;  5A2Q S;  3T38 A;  2LVQ D;  3GLF B;  4DUY M;  1TGU A;  1NSF A;  2X4A A;  3DZD A;  5FTK A;  3KXE C;  2GNO A;  2KZU A;  2ZAN A;  3U6E A;  4RF0 A;  1JQJ C;  3K9P A;  2DNA A;  2HWJ A;  4RNA A;  1IFY A;  2C99 A;  2QQ8 A;  1DGH A;  4IBI A;  4DV3 M;  4LFB M;  1G8P A;  2L7I A;  2J5Y A;  3FRI A;  2CEA A;  2G8L A;  4Z6Y A;  3PXG A;  2LXE A;  4IBE A;  1TTE A;  2L6O A;  3A98 B;  1L1T A;  1C1K A;  3SBJ A;  2F5N A;  5IT9 S;  4DR1 M;  2A5Y B;  3HHZ A;  3QYE A;  1YE9 A;  3J7B A;  4QHT A;  4GKJ M;  4P16 A;  3I4Y A;  3GLG B;  1D0K A;  1IN7 A;  1OAI A;  3GLI B;  3VFD A;  1VEJ A;  2EKK A;  3J80 S;  1DO2 A;  2ZAO A;  2YR0 A;  4OU7 A;  3GLH E;  1JR3 D;  4MGH A;  1GO5 A;  1LV7 A;  1SXJ B;  4YHH M;  3U6O A;  5ITR A;  2XSZ D;  3HY5 A;  2C9O A;  2RGH A;  4JI4 M;  2KRK A;  5ITX E;  2XGN A;  2XLJ A;  4B7G A;  1L1Z A;  3SAT A;  3BBZ A;  3I01 M;  3J27 B;  1N32 M;  3W68 A;  1IN5 A;  4GC9 A;  4LF4 M;  1JB0 F;  2I7N A;  1GVN A;  1W5T A;  3AL0 C;  4AZF A;  4AQY M;  2XFS A;  2Z3X A;  1V34 A;  2KW0 A;  1W5S A;  3EIE A;  4XK8 F;  4DV0 M;  4FCV A;  4FW9 A;  3JAM S;  2DHR A;  1IN6 A;  1T3T A;  1QDT A;  4LF5 M;  2C96 A;  1C7Y A;  2YQZ A;  1NNU C;  5DYI A;  4JI5 M;  4IBD A;  2X49 A;  3U60 A;  3V76 A;  3B74 A;  1HNW M;  3RFW A;  4QNR A;  4QOS A;  3RGP A;  4JI7 M;  2F5O A;  2DEN A;  2DI0 A;  3HZJ A;  4NXN M;  3TE6 A;  1YLA A;  4GC5 A;  1R6B X;  5JI3 E;  2ZAM A;  1ZMV A;  4AKG A;  3MK6 A;  1YSY A;  4FD2 A;  4GHA A;  2KHH A;  1K3X A;  3GLH A;  2DZO B;  3I51 A;  2RRU A;  3K1J A;  1BVS A;  1XXH B;  2LVA A;  3BXW A;  2LVO C;  1SXJ E;  1VEK A;  2ZBK B;  3PNY A;  4OW0 A;  4LZJ A;  3GLI E;  3LCV B;  4HL4 A;  3K92 A;  5KQD A;  4NL4 H;  1ZQ9 A;  2XEP A;  1WR1 B;  2YNM D;  2DWL A;  3LVW A;  4G4N A;  5EXS A;  1AUA A;  1WHC A;  2XF3 A;  3B7Q A;  3UZU A;  2BJW A;  2Z4S A;  1NV8 A;  1D0M A;  4KLN A;  4R3D A;  3HGI A;  3FE3 A;  3FUW A;  3LQQ A;  1GL7 A;  1GLN A;  1DO0 A;  4M9Z A;  5EP3 A;  3HU3 A;  2K0B X;  1E9R A;  2WSC F;  2JY8 A;  1N78 A;  3U61 A;  4FCW A;  3GP1 A;  2DWN A;  3C9P A;  1QUT A;  1T6O A;  2UUC M;  4I5S A;  3SAU A;  2UUB M;  4AI6 A;  3E46 A;  4F2L A;  4MH0 E;  1IN4 A;  3E21 A;  3IEC A;  3AFH A;  3QWL A;  5ITT A;  4PDG A;  1N36 M;  4LF7 M;  3AKZ A;  3ZCB B;  1Z6T A;  2QHO B;  1ZAE A;  2M5Z A;  2Y0Q A;  1OFI A;  4LJ5 A;  1OJL A;  3SHF A;  2CHQ A;  1QZM A;  1G4A E;  2L4F A;  2VDB B;  1MU5 A;  4WW0 A;  2KNZ A;  4LRS A;  4NSO B;  1DGG A;  4DR6 M;  1R7R A;  1GKI A;  2F4V M;  3KSX A;  4M9X A;  4FWH A;  3GLF A;  4MM3 B;  3HHW A;  1R5L A;  3GQ5 A;  1UM8 A;  1Q3C A;  2WSF F;  3GRV A;  1QQW A;  4QOZ C;  2FS1 A;  2JXN A;  1YUB A;  4LFA M;  1P3Q Q;  2Y0T A;  4MGY E;  5ITY A;  2UU9 M;  5EXX A;  3GQ4 A;  5FTM A;  3GRR A;  4KO8 A;  3GPY A;  3CGW A;  4NRV A;  5C1B A;  3T1H M;  2HL7 A;  1HT2 E;  3L25 A;  4CIZ A;  1L2D A;  4FWG A;  1XC8 A;  2OPF A;  1Y8G A;  2FOI C;  3TWK A;  4MGK E;  3HJS A;  2KXE A;  3AOG A;  4DR2 M;  1NHG C;  2EJS A;  5ITQ A;  2OQ4 A;  4L6V 6;  3CF2 A;  1V92 A;  4B7H A;  3U6C A;  3U60 B;  1TH3 A;  3SMS A;  2DWM A;  1OTR A;  1GAB A;  3U5Z B;  1VG5 A;  3C3D A;  5EP1 A;  1CUK A;  3GPP A;  4IBF A;  4OVZ B;  3GLI A;  1PJT A;  3VDP A;  2LHG A;  3SMP A;  4DR5 M;  1IM2 A;  1J09 A;  3FYC A;  4M9S A;  4CJ6 A;  4GRI A;  3B89 A;  2VQF M;  1MJG M;  2O25 A;  1GL6 A;  2KZS A;  3D8L A;  3I04 M;  4Z8X A;  2BWE A;  3WHK A;  1XB2 B;  1VDD A;  5ITX A;  3IG5 A;  3SHG B;  3RGS A;  4LJA A;  2MJ5 B;  1Z5C A;  2RKO A;  1QAO A;  2LNH C;  3AOE C;  3FUU A;  1Z59 A;  2W82 A;  4NSR A;  1NHW C;  4G4R A;  1Z5A A;  3KP0 E;  1UFZ A;  2WZJ A;  3CF6 E;  4JI6 M;  3GRY A;  3ZC7 B;  2KNA A;  5L8R F;  5EP4 A;  3PVS A;  4NC6 A;  3UJN A;  3UGJ A;  3OTO M;  1J5E M;  4LY6 A;  5KPT A;  1D0L A;  2F5S A;  1WGL A;  3AJI B;  3BOS A;  3MJ5 A;  1L2B A;  5FLX S;  4DUZ M;  4GMQ A;  1E94 E;  4DV4 M;  4M0W A;  3GPX A;  5LMU M;  2HKJ A;  2K47 A;  1R2Y A;  3AV0 A;  3Q8X A;  3RE8 A;  1TR8 A;  2EUC A;  3F92 A;  4LJ4 A;  2H5X A;  3KS4 A;  2NQ8 C;  3SC3 A;  4LF8 M;  2VII A;  1FNN A;  2CFO A;  3A45 A;  3HU1 A;  1IBL M;  4L78 A;  4PT5 A;  4Q7J A;  3IHP A;  3KSJ A;  3M6A A;  4DV7 M;  4LF6 M;  1TF0 B;  2RGO A;  3K9O A;  4IBG A;  4B7F A;  4X66 M;  2QBY B;  4JI8 M;  2V6Z M;  4BLC A;  1NJF A;  3M0E A;  4X62 M;  2UXC M;  2EO2 A;  1NY6 A;  1T43 A;  1ZMW A;  5KPR A;  1XMO M;  1VQ1 A;  2F5Q A;  3LW5 F;  3T6P A;  1SG9 A;  4LJ7 A;  5FTN A;  4JI2 M;  3MHV C;  1F4I A;  2R4E A;  1IXS B;  2VQE M;  2JNH A;  1QUS A;  1VDL A;  2B3T A;  2BJV A;  4DR3 M;  2I7P A;  4MGI E;  5DYG A;  3CTW B;  2EA0 A;  1L8Q A;  3K8Z A;  2L09 A;  2XZF A;  3KOX E;  4QNM A;  4K0K M;  3U6Q A;  4L8R C;  3H4M A;  1NY5 A;  4GKK M;  1N33 M;  3LMM A;  1G41 A;  3Q8G A;  2DAI A;  2MRO B;  4DV6 M;  1TDH A;  2CV0 A;  4KOD A;  1HNX M;  5KO3 A;  3KW6 A;  1N34 M;  4FCT A;  1HR0 M;  4G4Q A;  2UXB M;  1JR3 E;  4HLQ A;  2R18 A;  4PDI A;  4ZPX A;  1I94 M;  4JYA M;  4JXJ A;  4JI0 M;  2CV2 A;  4IBB A;  1PRB A;  3FKE A;  3I4V A;  2KA6 B;  3FUX A;  3W0F A;  4L4U A;  1OQY A;  1PM5 A;  2CHV A;  1OIP A;  1QVR A;  4A3V B;  1K3W A;  4OX9 M;  3K2L A;  2UUA M;  3ZH9 B;  1PJI A;  4JI1 M;  1ORY B;  2D7H A;  1WGN A;  3J81 S;  3W0L B;  4OVZ A;  1QAN A;  5FTJ A;  4DR7 M;  2X8A A;  4B3R M;  4GIP A;  1SXJ D;  1A5T A;  3A46 A;  2XSZ A;  3L2A A;  3MMP A;  2JWS A;  2DKL A;  5IWA M;  1TH4 A;  2C9C A;  2JY7 A;  2LBC A;  4AKH A;  3FUT A;  4II7 A;  2OOB A;  3T1Y M;  5C18 A;  3JR5 A;  2DAG A;  2JZ1 A;  4HEO A;  3HWS A;  1KYI A;  1IXR C;  1G71 A;  2D7E A;  2KRU A;  3L29 A;  4P17 A;  2G5G X;  4YY3 M;  3U6D A;  3U6M A;  4LCB A;  4ANR A;  2WSE F;  3W67 A;  5H37 D;  1HQY E;  4IBJ A;  1NV9 A;  3U5Z A;  1XXH A;  4B3T M;  1H6U A;  2CV1 A;  1WXQ A;  4LF9 M;  3PNV A;  2MR9 A;  2V1U A;  2K9D A;  3SAR A;  4D81 A;  2XFT A;  3VDU A;  4IBC A;  5EXT A;  2AHM A;  1S3S A;  1XWI A;  2BWB A;  2L2D A;  2M60 A;  3SAS A;  4W5W A;  5EXP A;  4AW4 A;  3QYB A;  3GRU A;  1QDR A;  2CHG A;  2CRU A;  5E26 A;  2R0I A;  3A42 A;  3CF0 A;  2LTU A;  3R8F A;  4LZZ A;  2HCB A;  1J7K A;  3ZQJ A;  2LHC A;  1OFH A;  4BB9 A;  4CGY B;  4IJE A;  5KPZ A;  3R9X B;  2R6F A;  2QBY A;  2OO9 A;  5EQT A;  2ZTD A;  3C3E A;  3LVV A;  1Z5B A;  3KFU G;  4F1I A;  1JR3 A;  4S12 A;  1HNZ M;  3JR4 A;  4R71 A;  3EIH A;  3U61 B;  2R45 A;  2FE8 A;  3DFZ A;  3KOW E;  1QYR A;  5JI2 E;  3J2P B;  2LVP C;  2KEB A;  1IBK M;  1PJQ A;  4I81 A;  3QAU A;  1HT1 E;  4XGI A;  2DZN B;  2MH8 A;  3E4R A;  1IY2 A;  4RF1 A;  1WIV A;  3L26 A;  1PJJ A;  4REZ A;  3ILK A;  2GQF A;  2KNV A;  3M7G A;  2QSF X;  1X37 A;  1XXH E;  2DAK A;  4QHS A;  5E6J A;  3GQ3 A;  1EE8 A;  1VEG A;  4IJF A;  2JY5 A;  1Q3B A;  5LMN M;  2DZL A;  2ZM6 M;  3NBI A;  4CIS A;  4MB7 A;  3FTE A;  1DGF A;  1MN3 A;  3WHL A;  4PD2 A;  1Q02 A;  2HAK A;  4R7G A;  3TPZ A;  1FJG M;  4IBK A;  4NOO B;  3SYK A;  1EIJ A;  3HHX A;  3FYD A;  2R62 A;  3FD9 A;  4LRT A;  5FTL A;  3SAV A;  1I4W A;  3IG8 A;  2R44 A;  2N35 A;  4B08 A;  2VF7 A;  1PJS A;  3GO8 A;  2FNA A;  3HHY A;  4KT0 F;  1G3I A;  1KFV A;  2QZ4 A;  2DVW B;  4CHT B;  2Q2E B;  3KDS E;  4FVM A;  4JN6 A;  3D8B A;  2DHY A;  2R46 A;  2F5P A;  4M0D A;  2DXI A;  2Y20 A;  3SFZ A;  5EP2 A;  1N75 A;  4WP2 A;  3UMM A;  2L4E A;  2XH9 A;  4I8O A;  4MGZ E;  3H4J A;  4AG5 A;  4GEW A;  4JI3 M;  4X65 M;  1DGB A;  1MX0 A;  4IIW A;  2E5L M;  4AG6 A;  3FTD A;  4GIT A;  2APL A;  1TDZ A;  3LCU A;  4LG2 A;  1XHB A;  1OKS A;  4PCZ A;  5F3W A;  1OIZ A;  1IN8 A;  4LFC M;  1IXS A;  4B3S M;  4DR4 M;  3FTF A;  1IBM M;  2DAM A;  4D80 A;  2KDL A;  4B3M M;  3GLH B;  4EIW A;  1RU3 A;  2JP7 A;  2EKF A;  3NWL A;  1DGH B;  2D7G A;  3HJ8 A;  5IRE B;  1L2C A;  4GH9 A;  1E32 A;  4WUR A;  3GLG E;  2LH0 A;  2QCU A;  4ITQ A;  1QAQ A;  4FWD A;  5DFL A;  3B9P A;  3KVW A;  1XNR M;  4KHP M;  1IY1 A;  2YFQ A;  1NJG A;  2CUZ A;  4D82 A;  3AOE A;  2QPA A;  3TQS A;  2ERC A;  1OAO C;  5KQ8 A;  1NO1 A;  1WJ7 A;  3SAW A;  4DV5 M;  2J7O A;  3U6L A;  4L16 A;  2HHH M;  3VKG A;  3UK6 A;  4DBG B;  3HJQ A;  1E9S A;  3L28 A;  2LWX A;  4I4L A;  4LGY A;  3U6S A;  3B7N A;  1ZMU A;  3KS8 A;  2O01 F;  4L15 A;  3SYL A;  2XZU A;  2JZ0 A;  3U6P A;  4BBA A;  4DV1 M;  1EFU B;  5FSW A;  1HJP A;  3J7A S;  2Z4R A;  2O5R A;  1G59 A;  2MGW A;  3B7Z A;  3VK8 A;  2C5R A;  2J7N A;  2LVN C;  2Z8Y M;  3FTC A;  4LJ9 A;  2FFJ A;  2QP9 X;  3GPU A;  2L7H A;  4NRW A;  3DA1 A;  1PGY A;  3TWM A;  1SXJ C;  4G4O A;  3GLF E;  1LTM A;  3L27 A;  4X64 M;  1SXJ A;  1R4G A;  2H1R A;  1N77 A;  1NNJ A;  3FUV A;  2DAE A;  5EJC A;  1IY0 A;  3FRH A;  3PFI A;  2JA2 A;  2R4J A;  5ITU A;  1R2Z A;  4AKI A;  2FH0 A;  1HQC A;  2BNK A;  4GHL A;  4DV2 M;  4UN2 B;  3VK7 A;  4TUW A;  5GKN A;  2R65 A;  3HU2 A;  3KOZ E;  1D2N A;  2QEN A;  4JV5 M;  1DV0 A;  2ZTC A;  5DNY A;  2CE7 A;  2CWB A;  2G3Q A;  1ZV1 A;  3KP1 E;  3KOY E;  1GJT A;  1AIP C;  3NBX X;  4G3O A;  4LGM A;  3TWL A;  2DWZ B;  1KSF X;  4XBO A;  1Q39 A;  2OOA A;  2UXD M;  2V1C A;  2Z7J A;  1XMQ M;  3T15 A;  1IQP A;  5IZ7 D; 
#chains in the Genus database with same CATH homology
 2P5T A;  2Y21 A;  3E9S A;  1NVM A;  1XNQ M;  3TL4 X;  3LQR A;  3VKH A;  7CAT A;  1TH2 A;  3GLG A;  3C58 A;  3HKP A;  4G6Z A;  3THG A;  1IXZ A;  5BPV A;  1K82 A;  4NXM M;  3DOA A;  5BR8 M;  3VLF B;  4LJ6 A;  1QAM A;  2C98 A;  8CAT A;  4LJ8 A;  5A2Q S;  3T38 A;  3GLF B;  4DUY M;  1TGU A;  1NSF A;  2X4A A;  3DZD A;  5FTK A;  3KXE C;  2KZU A;  2ZAN A;  3U6E A;  4RF0 A;  1JQJ C;  4RNA A;  2C99 A;  1DGH A;  4IBI A;  4DV3 M;  4LFB M;  1G8P A;  2L7I A;  2CEA A;  2G8L A;  4Z6Y A;  3PXG A;  2LXE A;  4IBE A;  2L6O A;  1L1T A;  3A98 B;  1C1K A;  3SBJ A;  2F5N A;  5IT9 S;  4DR1 M;  2A5Y B;  3HHZ A;  1YE9 A;  3J7B A;  4QHT A;  4GKJ M;  4P16 A;  3I4Y A;  3GLG B;  1IN7 A;  3GLI B;  3VFD A;  3J80 S;  1DO2 A;  2ZAO A;  2YR0 A;  4OU7 A;  1JR3 D;  4MGH A;  1LV7 A;  1SXJ B;  4YHH M;  3U6O A;  5ITR A;  2XSZ D;  2C9O A;  2RGH A;  4JI4 M;  2KRK A;  5ITX E;  2XGN A;  2XLJ A;  4B7G A;  1L1Z A;  3SAT A;  1N32 M;  3J27 B;  1IN5 A;  4GC9 A;  4LF4 M;  2I7N A;  1GVN A;  1W5T A;  3AL0 C;  4AZF A;  4AQY M;  2XFS A;  2Z3X A;  2KW0 A;  1W5S A;  3EIE A;  4DV0 M;  4FCV A;  4FW9 A;  3JAM S;  2DHR A;  1IN6 A;  1T3T A;  4LF5 M;  2C96 A;  2YQZ A;  1NNU C;  5DYI A;  4JI5 M;  4IBD A;  2X49 A;  3U60 A;  1HNW M;  3RFW A;  4QNR A;  4QOS A;  3RGP A;  4JI7 M;  2F5O A;  3TE6 A;  4NXN M;  4GC5 A;  1R6B X;  5JI3 E;  2ZAM A;  4AKG A;  3MK6 A;  1YSY A;  4FD2 A;  4GHA A;  1K3X A;  3GLH A;  2DZO B;  3I51 A;  3K1J A;  1XXH B;  1SXJ E;  2ZBK B;  3PNY A;  4OW0 A;  4LZJ A;  4HL4 A;  3K92 A;  5KQD A;  4NL4 H;  2XEP A;  1ZQ9 A;  2YNM D;  2DWL A;  3LVW A;  4G4N A;  5EXS A;  2XF3 A;  3UZU A;  2BJW A;  2Z4S A;  4KLN A;  4R3D A;  3HGI A;  3FUW A;  3LQQ A;  1GL7 A;  1GLN A;  1DO0 A;  4M9Z A;  5EP3 A;  3HU3 A;  1E9R A;  1N78 A;  3U61 A;  4FCW A;  3GP1 A;  2DWN A;  2UUC M;  4I5S A;  3SAU A;  2UUB M;  4AI6 A;  4MH0 E;  1IN4 A;  3QWL A;  3AFH A;  5ITT A;  4PDG A;  1N36 M;  4LF7 M;  3AKZ A;  3ZCB B;  1Z6T A;  1ZAE A;  2M5Z A;  2Y0Q A;  1OFI A;  4LJ5 A;  1OJL A;  3SHF A;  2CHQ A;  1QZM A;  1G4A E;  1MU5 A;  4WW0 A;  4LRS A;  4NSO B;  1DGG A;  4DR6 M;  1R7R A;  1GKI A;  2F4V M;  3KSX A;  4M9X A;  4FWH A;  3GLF A;  4MM3 B;  3HHW A;  3GQ5 A;  1UM8 A;  1Q3C A;  3GRV A;  1QQW A;  4QOZ C;  1YUB A;  4LFA M;  4MGY E;  2Y0T A;  5ITY A;  2UU9 M;  5EXX A;  3GQ4 A;  5FTM A;  3GRR A;  4KO8 A;  3GPY A;  5C1B A;  4NRV A;  3T1H M;  3L25 A;  2HL7 A;  1HT2 E;  1L2D A;  4FWG A;  1XC8 A;  2OPF A;  2FOI C;  3TWK A;  4MGK E;  3HJS A;  2KXE A;  3AOG A;  4DR2 M;  1NHG C;  5ITQ A;  2OQ4 A;  3U60 B;  3CF2 A;  4B7H A;  3U6C A;  1TH3 A;  3SMS A;  2DWM A;  3U5Z B;  5EP1 A;  3GPP A;  4IBF A;  4OVZ B;  3GLI A;  3VDP A;  3SMP A;  4DR5 M;  1IM2 A;  1J09 A;  3FYC A;  4M9S A;  4GRI A;  2VQF M;  1GL6 A;  2KZS A;  3D8L A;  4Z8X A;  3WHK A;  1VDD A;  5ITX A;  3IG5 A;  3SHG B;  3RGS A;  4LJA A;  1Z5C A;  2RKO A;  1QAO A;  2LNH C;  3AOE C;  3FUU A;  1Z59 A;  2W82 A;  4NSR A;  1NHW C;  4G4R A;  1Z5A A;  3KP0 E;  4JI6 M;  3CF6 E;  3GRY A;  3ZC7 B;  5EP4 A;  3PVS A;  3UJN A;  3UGJ A;  3OTO M;  1J5E M;  4LY6 A;  5KPT A;  3AJI B;  3BOS A;  3MJ5 A;  1L2B A;  5FLX S;  4GMQ A;  1E94 E;  4DV4 M;  4M0W A;  3GPX A;  5LMU M;  2HKJ A;  2K47 A;  1R2Y A;  3AV0 A;  3Q8X A;  3RE8 A;  2EUC A;  4LJ4 A;  3KS4 A;  2NQ8 C;  3SC3 A;  4LF8 M;  2VII A;  1FNN A;  2CFO A;  3A45 A;  3HU1 A;  1IBL M;  4L78 A;  4PT5 A;  3KSJ A;  3M6A A;  4DV7 M;  4LF6 M;  2RGO A;  4IBG A;  4B7F A;  4X66 M;  2QBY B;  4JI8 M;  2V6Z M;  4BLC A;  1NJF A;  3M0E A;  4X62 M;  2UXC M;  2EO2 A;  1NY6 A;  5KPR A;  1XMO M;  2F5Q A;  4LJ7 A;  5FTN A;  4JI2 M;  3MHV C;  2R4E A;  1IXS B;  2VQE M;  4DR3 M;  2BJV A;  2I7P A;  4MGI E;  5DYG A;  3CTW B;  2EA0 A;  1L8Q A;  3K8Z A;  2L09 A;  2XZF A;  3KOX E;  4QNM A;  4K0K M;  3U6Q A;  4L8R C;  3H4M A;  1NY5 A;  4GKK M;  1N33 M;  3LMM A;  1G41 A;  4DV6 M;  1TDH A;  2CV0 A;  4KOD A;  1HNX M;  5KO3 A;  3KW6 A;  1N34 M;  4FCT A;  1HR0 M;  4G4Q A;  2UXB M;  4HLQ A;  2R18 A;  4PDI A;  4ZPX A;  1I94 M;  4JYA M;  4JXJ A;  4JI0 M;  2CV2 A;  4IBB A;  3FKE A;  3I4V A;  2KA6 B;  3FUX A;  3W0F A;  4L4U A;  1PM5 A;  1K3W A;  2CHV A;  1QVR A;  4A3V B;  4OX9 M;  3K2L A;  2UUA M;  3ZH9 B;  1PJI A;  4JI1 M;  1ORY B;  2D7H A;  3J81 S;  3W0L B;  4OVZ A;  1QAN A;  5FTJ A;  4DR7 M;  2X8A A;  4B3R M;  4GIP A;  1SXJ D;  3A46 A;  2XSZ A;  3L2A A;  5IWA M;  1TH4 A;  2C9C A;  4AKH A;  3FUT A;  4II7 A;  3T1Y M;  5C18 A;  3JR5 A;  3HWS A;  1KYI A;  1IXR C;  2D7E A;  2KRU A;  3L29 A;  4YY3 M;  2G5G X;  3U6D A;  3U6M A;  4LCB A;  5H37 D;  1HQY E;  4IBJ A;  1XXH A;  4B3T M;  1H6U A;  2CV1 A;  1WXQ A;  4LF9 M;  3PNV A;  2V1U A;  3SAR A;  4D81 A;  2XFT A;  3VDU A;  4IBC A;  5EXT A;  2AHM A;  1S3S A;  1XWI A;  2M60 A;  4W5W A;  5EXP A;  4AW4 A;  3GRU A;  2CHG A;  5E26 A;  3A42 A;  3CF0 A;  3R8F A;  4LZZ A;  2HCB A;  1J7K A;  1OFH A;  4BB9 A;  4CGY B;  4IJE A;  5KPZ A;  3R9X B;  2QBY A;  5EQT A;  3LVV A;  1Z5B A;  3KFU G;  1JR3 A;  4S12 A;  1HNZ M;  3JR4 A;  3EIH A;  3U61 B;  2R45 A;  3KOW E;  2FE8 A;  3DFZ A;  1QYR A;  5JI2 E;  3J2P B;  2KEB A;  1IBK M;  4I81 A;  3QAU A;  1HT1 E;  4XGI A;  2DZN B;  3E4R A;  1IY2 A;  4RF1 A;  3L26 A;  1PJJ A;  4REZ A;  3ILK A;  3M7G A;  1X37 A;  4QHS A;  5E6J A;  3GQ3 A;  1EE8 A;  4IJF A;  1Q3B A;  5LMN M;  2ZM6 M;  3NBI A;  4CIS A;  4MB7 A;  3FTE A;  1DGF A;  3WHL A;  4PD2 A;  3TPZ A;  4R7G A;  1FJG M;  4IBK A;  4NOO B;  3SYK A;  3HHX A;  3FYD A;  2R62 A;  3FD9 A;  4LRT A;  5FTL A;  3SAV A;  1I4W A;  3IG8 A;  4DUZ M;  4B08 A;  3GO8 A;  2FNA A;  3HHY A;  1KFV A;  1G3I A;  2QZ4 A;  2DVW B;  4CHT B;  2Q2E B;  3KDS E;  4FVM A;  4JN6 A;  3D8B A;  2R46 A;  2F5P A;  4M0D A;  2DXI A;  2Y20 A;  3SFZ A;  5EP2 A;  1N75 A;  3UMM A;  2XH9 A;  4I8O A;  4MGZ E;  4AG5 A;  4JI3 M;  4X65 M;  1DGB A;  1MX0 A;  4IIW A;  2E5L M;  4AG6 A;  3FTD A;  4GIT A;  1TDZ A;  4LG2 A;  1XHB A;  4PCZ A;  5F3W A;  4DR4 M;  1IN8 A;  4LFC M;  4B3S M;  3FTF A;  1IBM M;  4D80 A;  4B3M M;  3GLH B;  4EIW A;  3NWL A;  1DGH B;  2D7G A;  3HJ8 A;  5IRE B;  1L2C A;  4GH9 A;  1E32 A;  4WUR A;  2LH0 A;  2QCU A;  4ITQ A;  1QAQ A;  4FWD A;  3B9P A;  3KVW A;  1XNR M;  4KHP M;  1IY1 A;  2YFQ A;  1NJG A;  2CUZ A;  4D82 A;  3AOE A;  2QPA A;  3TQS A;  2ERC A;  5KQ8 A;  3SAS A;  3SAW A;  4DV5 M;  2J7O A;  3U6L A;  4L16 A;  2HHH M;  3VKG A;  3UK6 A;  3HJQ A;  1E9S A;  3L28 A;  2LWX A;  4I4L A;  4LGY A;  3U6S A;  3KS8 A;  4L15 A;  3SYL A;  2XZU A;  3U6P A;  4BBA A;  4DV1 M;  5FSW A;  3J7A S;  2Z4R A;  2O5R A;  1G59 A;  3VK8 A;  2C5R A;  2J7N A;  4LJ9 A;  3FTC A;  2FFJ A;  2QP9 X;  3GPU A;  2L7H A;  4NRW A;  3DA1 A;  3TWM A;  1SXJ C;  4G4O A;  3L27 A;  4X64 M;  1SXJ A;  2H1R A;  1N77 A;  1NNJ A;  3FUV A;  5EJC A;  1IY0 A;  3PFI A;  2JA2 A;  2R4J A;  5ITU A;  1R2Z A;  4AKI A;  1HQC A;  2BNK A;  4GHL A;  4DV2 M;  3VK7 A;  4TUW A;  5GKN A;  2R65 A;  3HU2 A;  3KOZ E;  1D2N A;  2QEN A;  4JV5 M;  5DNY A;  2CE7 A;  3KOY E;  3KP1 E;  4LGM A;  3U5Z A;  2F5S A;  3TWL A;  2DWZ B;  1KSF X;  4XBO A;  1Q39 A;  2UXD M;  2V1C A;  2Z7J A;  1XMQ M;  3T15 A;  1IQP A;  5IZ7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...