4JV5M

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4jv5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4jv5M02
2F5PA 4ITQA 4GKKM 4PDIA 5BR8M 3T1YM 3A46A 4GKJM 2UXDM 4MB7A 1I94M 5A2QS 3U6LA 1TDZA 1L1ZA 4NRVA 2XZUA 4OX9M 2F5NA 3SASA 1MX0A 5ITXE 4DV3M 1TDHA 3GO8A 4PD2A 4G4NA 3U6CA 3VK7A 4DV2M 4LF7M 4KHPM 4DUYM 2UXCM 2HHHM 4LF8M 1XNQM 4DR7M 4CISA 1PJIA 4LFAM 2F5QA 3J7AS 4AQYM 3A45A 4JI0M 2VQFM 3SAWA 3VK8A 2UUAM 1HR0M 4G4RA 1NNJA 1R2YA 5ITYA 4DV5M 1IBKM 4LFCM 1MU5A 1IBLM 1N33M 1J5EM 2E5LM 2HKJA 3U6PA 4DUZM 1PM5A 1FJGM 4LFBM 1Z5CA 4X65M 3TWMA 5IT9S 5IWAM 3TWLA 4JI8M 4LF6M 4YHHM 3U6DA 4JI2M 4JI3M 4DR2M 5ITTA 3GQ3A 2EA0A 2Q2EB 3GQ4A 3U6QA 3U6SA 3U6EA 1Z59A 4X66M 1L2CA 4LF4M 1XMQM 3TWKA 1K82A 4YY3M 2XZFA 4K0KM 1IBMM 1XMOM 3GP1A 4DV4M 1XC8A 1N34M 1EE8A 1R2ZA 1HNWM 3SARA 3J80S 1Q3BA 4DV0M 4JI1M 5ITXA 3DOAA 3U6MA 1Z5BA 3SAVA 4NRWA 4X64M 4NXNM 1PJJA 4JI4M 3GPUA 4B3RM 2UU9M 5ITUA 4JI7M 3SBJA 5ITRA 4DV1M 4DV7M 3T1HM 2UXBM 5FLXS 2UUBM 2OPFA 4LF9M 1HNZM 3J81S 5ITQA 2VQEM 4B3MM 3JR4A 4DR4M 1N36M 4DR5M 1HNXM 2F5SA 4JI5M 1XNRM 2UUCM 4JYAM 5LMUM 1L2DA 1Q3CA 4JI6M 4X62M 4DR1M 1Q39A 1L1TA 1KFVA 1N32M 3C58A 1Z5AA 3GPYA 3GPPA 3A42A 4B3TM 3OTOM 4DV6M 4G4QA 3W0FA 3JR5A 4G4OA 3GPXA 5LMNM 3SAUA 4JV5M 4LF5M 4NXMM 4PDGA 1K3WA 2ZBKB 3JAMS 2OQ4A 2F5OA 3SATA 3GQ5A 4DR3M 1L2BA 4PCZA 3U6OA 2F4VM 2ZM6M 4B3SM 1K3XA 4DR6M
chains in the Genus database with same CATH superfamily
1YE9A 4NL4H 2QNJA 2R62A 3EIHA 1LV7A 3FTFA 2VF8A 3GLIB 3KXEC 3T1YM 3AKZA 3A46A 3GLFA 3AJIB 3MHVC 2CE7A 4IBFA 2DZOB 3PXGA 2RKOA 4IJFA 3GLIA 1TDZA 1AUAA 1PJQA 3B7ZA 2LVOC 3J2PB 3HHYA 3L2AA 2K47A 1LTMA 5KPZA 1TDHA 4JN6A 3VK7A 4LGYA 3U6CA 2DAEA 1W5SA 4DUYM 4KHPM 2DHYA 1GL6A 4GMQA 2J5YA 4DR7M 2KNVA 2DAKA 5FTLA 2I7NA 3KW6A 1PJIA 3LQQA 4PT5A 4CGYB 5FSWA 4DBGB 3J7AS 4FWGA 4AG6A 3RE8A 3MK6A 4GITA 2O5RA 3SHFA 3IECA 3FUTA 1Y8GA 3BXWA 3AOGA 1R2YA 4DV5M 3UJNA 5KPTA 2VDBB 1J7KA 2MR9A 3DZDA 1IBLM 2E5LM 1XHBA 3VLFB 2FH0A 2Z7JA 4L8RC 3HHWA 1PM5A 1FJGM 4X65M 2AHMA 4RKUF 1ZAEA 4JI8M 1G71A 1XXHE 4YHHM 3HX3A 4LZZA 3KP1E 1ZMUA 2DWZB 2EA0A 2Z4SA 4OW0A 8CATA 1Z59A 4X66M 2JA2A 1ZMVA 3MJ5A 5FTKA 1XMQM 2DAGA 3TWKA 1K82A 4ZPXA 1I4WA 1HJPA 5KO3A 1IN5A 2YNMD 3HY5A 1XXHB 1HQYE 3K9OA 2MROB 2D7HA 1X37A 1QAQA 1H6UA 1JQJC 3L27A 4KLNA 3SARA 4DV0M 4JI1M 1NJGA 1XXHA 1TR8A 4NRWA 4IBIA 1PJJA 3K8ZA 4QNMA 1WGLA 4B3RM 5ITUA 3U60B 4Q7JA 2Y20A 4MGHA 5ITRA 5F3WA 1NO1A 3K1JA 4LF9M 3THGA 4D81A 1AIPC 3J81S 5FTJA 1OJLA 4B3MM 4BBAA 5KQ8A 4JXJA 2UUCM 2KXEA 1XB2B 3FTDA 1P3QQ 5LMUM 4L78A 1L2DA 4JI6M 4QOSA 1IXRC 2CV1A 2JP7A 2R65A 1D2NA 2KNZA 5EP3A 1T6OA 2Z3XA 2LVAA 5EP2A 2XSZA 4QNRA 2DXIA 3T38A 1DGBA 2KZUA 3TL4X 4AW4A 3A42A 2Y21A 3GPPA 2CV0A 1VQ1A 3M6AA 1E94E 4RNAA 3SMSA 1JR3E 2X49A 3GPXA 3SHGB 1TF0B 3ZCBB 4EIWA 1VEJA 3B7QA 3VFDA 1MJGM 1YLAA 4LJ7A 2JY5A 3GLGE 4NXMM 4LJAA 3FTEA 1NJFA 1IN4A 3M0EA 2LHGA 5IREB 1NHWC 2LHCA 1QQWA 3U6OA 1J09A 1R6BX 2ZM6M 4B3SM 1K3XA 2XEPA 3KVWA 2F4VM 2QBYB 4ITQA 2CHQA 2K0BX 3HJ8A 2J7OA 3GLGB 2LNHC 3J27B 3LW5F 1WHCA 4FWHA 1OTRA 3RFWA 1JR3A 2I7PA 4CJ6A 2RRUA 1N75A 2JZ1A 3AFHA 1QAMA 2DI0A 3E9SA 2JY8A 3GLGA 3L29A 1MX0A 5C1BA 5ITXE 3FUWA 1A5TA 1VEKA 2XH9A 4HLQA 1R5LA 5E6JA 2HCBA 1KYIA 2DZNB 3FRHA 2BWBA 2V1UA 4AG5A 4IBJA 1IY0A 2EJSA 4II7A 1XNQM 3ZH9B 1C1KA 2WSEF 3HU2A 4GHAA 4MGKE 3UGJA 4LFAM 2F5QA 3LCUA 3DFZA 4AQYM 1VG5A 2KZSA 2QQ8A 1OIZA 2LH0A 2NQ8C 1ORYB 4REZA 2Z4RA 4FD2A 1PRBA 3CF6E 4JI2M 2P5TA 4LJ9A 3FRIA 1IXZA 4LFCM 1MU5A 1R4GA 2R18A 5BPVA 3U6PA 3LMMA 3AL0C 4LFBM 4L15A 1XWIA 1GL7A 2KDLA 2KHHA 2LVPC 2QENA 4L4UA 2ERCA 3L28A 1VEGA 1YUBA 4M0DA 4NSOB 4JI3M 5H37D 1JB0F 5ITTA 4IBGA 3C9PA 4P17A 3GQ4A 4RF1A 3U6EA 3U6SA 1G59A 1NSFA 3KOXE 2EO2A 2QP9X 1DGFA 2XZFA 1IBMM 4IIWA 3CGWA 1IFYA 3GP1A 3VDUA 1NHGC 3W67A 1XC8A 1BVSA 2RGHA 4P16A 1G8PA 2R45A 4MGIE 1F4IA 4WURA 1OAOC 1SXJD 2F5OA 3VKGA 2R0IA 4CIZA 3WHLA 1E9RA 2OO9A 1GABA 3DOAA 1Z5BA 5DFLA 4X64M 2C5RA 3FD9A 3KS4A 4JI4M 5EXXA 3FE3A 2UU9M 4JI7M 5E26A 4BB9A 1GJSA 2Y0QA 2L2DA 5C18A 5FLXS 1WGNA 4GIPA 2OPFA 1OFIA 1HNZM 3L25A 5EP4A 2VQEM 3JR4A 1DO0A 4DR5M 1N36M 1HNXM 1XNRM 2JY7A 4OU7A 2DWLA 2APLA 2FS1A 3HJQA 3GLFE 3H4JA 4D80A 1Q39A 3V76A 4IJEA 1GKIA 3KOZE 2ZTCA 3C58A 1PJTA 4G6ZA 3KOYE 4M9ZA 2WZJA 1EFUB 3AOEC 3HKPA 3OTOM 4DV6M 1QUTA 4G4QA 1DGGA 4AKGA 2XFTA 3GLFB 1RU3A 2CEAA 4MGYE 4FCVA 5LMNM 2JWSA 3LVWA 4LF5M 2MH8A 5JI3E 2R44A 4PDGA 3FUXA 2QZ4A 1SG9A 1TH2A 3TPZA 2H1RA 3JAMS 2OQ4A 2D7EA 1FNNA 2VIIA 5EJCA 3BOSA 1ZMWA 3GLHE 1GVNA 2H5XA 5KPRA 2XGNA 2GNOA 2CRUA 3KSJA 1IQPA 3B89A 3U60A 2ZAMA 3LCVB 2QSFX 2EKFA 2QHOB 1OQYA 2FE8A 2QCUA 3HZJA 4HEOA 3KP0E 3WHKA 4GKKM 2HL7A 3NBIA 1GLNA 2CUZA 3PFIA 1IM2A 5BR8M 3FTCA 3B9PA 4QHSA 4GKJM 2DAIA 2UXDM 4MB7A 1I94M 5A2QS 3GRRA 3U6LA 3GLHB 2MJ5B 1IN7A 3CTWB 4LRSA 3QAUA 2XZUA 1L1ZA 3QWLA 2F5NA 2CP8A 2G5GX 3GRVA 4KT0F 2XLJA 2DAMA 1YSYA 1OIPA 3GLHA 4G4NA 2OOBA 4A3VB 3U61B 4NOOB 3K9PA 1WJ7A 4CISA 1D0KA 4Y28F 3GQ5A 2A5YB 4LJ8A 1PGYA 1G4AE 3A45A 5EXPA 3U61A 2VQFM 3SAWA 1UM8A 1T3TA 1D0LA 3I51A 4G4RA 3I04M 3PNVA 3D8BA 1NNJA 4GRIA 3J7BA 1IBKM 4NC6A 4D82A 1R7RA 3M7GA 2QBYA 4B7GA 4DUZM 1QANA 3C3EA 4LF6M 3U6DA 4AI6A 3FYDA 4DR2M 3GQ3A 4GC5A 3U6QA 1OFHA 1N78A 3IG8A 4UN2B 4WP2A 5EP1A 3F92A 2VF7A 2L7HA 4S12A 1N77A 1L2CA 4LF4M 1VDLA 2BWEA 1PJSA 1G41A 4YY3M 4M0WA 1E9SA 2O25A 1XMOM 4IBDA 4DV4M 4IBCA 2Z8YM 4GC9A 2L4FA 1N34M 2K6BA 1WIVA 1TH3A 1MN3A 1R2ZA 4MGZE 1HNWM 2C98A 3J80S 1QYRA 2DNAA 2DZLA 1WR1B 5ITXA 5L8RF 1GJTA 3D8LA 1EIJA 4AKIA 1QVRA 4NXNM 1TH4A 4KO8A 1W5TA 1V34A 2LBCA 3TQSA 2V6ZM 2ZTDA 2G8LA 3QYBA 4GH9A 4IBEA 3LVVA 3SYKA 4DV1M 4FVMA 2D7GA 4ANRA 1NY6A 2UUBM 3UK6A 4GEWA 4DR4M 2F5SA 3KDSE 4F1IA 3HU3A 2BNKA 2JUJA 2Y0TA 2YQZA 3FUUA 1C7YA 1Q3CA 1OKSA 3HGIA 2LWXA 4LRTA 3NBXX 4DR1M 1QZEA 4FW9A 1L1TA 1QZMA 4GHLA 1IN6A 4R7GA 2HAKA 1KFVA 2CFOA 4LG2A 1N32M 3RGPA 1Z5AA 3C3DA 1CUKA 1L8QA 2N35A 3R8FA 4LZJA 4B3TM 2DHRA 2C96A 3B74A 3W0FA 4I81A 4AZFA 1IY2A 2L7IA 3A98B 3BBZA 4IBKA 2XSZD 2DWNA 3KSXA 3SAUA 3T15A 5DYGA 2FFJA 5JI2E 4JV5M 2R4EA 2X4AA 5IZ7D 2R6FA 1K3WA 1ZV1A 4XBOA 3SFZA 1ZQ9A 2ZANA 3Q8XA 4I5SA 3CF2A 4DR3M 2KEBA 2LXEA 4B7HA 4MM3B 2K9DA 1NY5A 4FWDA 3H4MA 2LVNC 3SC3A 3AOEA 2F5PA 4PDIA 3E21A 4LCBA 4L16A 1S3SA 1V92A 1DO2A 2XF3A 3GRUA 2KA6B 4Z8XA 1E32A 4WW0A 1VDDA 2DVWB 1NV8A 4NRVA 5EXTA 3FYCA 2JY6B 2YR0A 3QYEA 4OX9M 3SASA 2R46A 3MMPA 4W5WA 4DV3M 2KW0A 2DKLA 2FOIC 3DA1A 2O01F 1JR3D 4PD2A 5DNYA 3GO8A 4M9XA 4DV2M 3EIEA 1Z6TA 3HJSA 4XK8F 2HHHM 4LF7M 2UXCM 2DWMA 4LF8M 1KSFX 2FNAA 3I4YA 4I8OA 2J7NA 5DYIA 5KQDA 3CF0A 4LGMA 3ZQJA 2C9CA 4LJ4A 4QOZC 4F2LA 4JI0M 3AV0A 2BJVA 3VK8A 1Q02A 2UUAM 1QUSA 4KODA 2BJWA 3HU1A 1HR0M 1QDRA 1SXJE 3U5ZB 2XFSA 3PNYA 1NNUC 2C9OA 4LJ5A 2JZ0A 2V1CA 5ITYA 4B08A 5GKNA 2CV2A 1V33A 1N33M 3TE6A 1J5EM 2MGWA 3Q8GA 2HKJA 3KOWE 3U5ZA 3NWLA 4MH0E 1L2BA 3UZUA 1Z5CA 2ZAOA 3GRYA 1HT1E 3PVSA 1IXSB 5IWAM 3TWLA 3TWMA 5IT9S 2WSFF 2L09A 3W0LB 4RF0A 7CATA 1SXJB 5FTNA 2CWBA 2Q2EB 3VKHA 1DGHB 3SMPA 1IXSA 2YFQA 3I01M 1OAIA 2KRKA 1NVMA 1QAOA 1SXJA 2HWJA 4AKHA 1NV9A 1DGHA 2X8AA 4HL4A 4K0KM 4BLCA 5EXSA 3FUVA 4FCTA 4OVZB 2R4JA 3SYLA 3KS8A 3T6PA 1EE8A 4B7FA 1WXQA 2L4EA 1Q3BA 2CHVA 3E46A 4M9SA 1SXJC 2C99A 2B3TA 4OVZA 3U6MA 4I4LA 2KNAA 2L6OA 3K2LA 2JNHA 3SAVA 4CHTB 2M5ZA 2LTUA 3GPUA 2EKKA 3SBJA 4DV7M 3T1HM 2UXBM 1QDTA 1GO5A 2JXNA 1D0MA 3FKEA 5ITQA 2QPAA 3B7NA 4IBBA 4JI5M 4JYAM 2DENA 1DV0A 3I4VA 5EQTA 4TUWA 2W82A 3KFUG 4X62M 3W68A 1UFZA 4LJ6A 2LVQD 1G3IA 3HWSA 1IN8A 2M60A 3RGSA 4LY6A 3VDPA 1IY1A 3UMMA 1HQCA 3GPYA 2EUCA 2WSCF 1HT2E 3R9XB 3IHPA 3ZC7B 4R71A 1T43A 3JR5A 2OOAA 4G4OA 2G3QA 3L26A 2RGOA 4G3OA 3ILKA 4NSRA 5FTMA 3GLIE 1TGUA 4Z6YA 4R3DA 2ZBKB 3E4RA 3HHXA 2KRUA 3SATA 2GQFA 2CHGA 3LQRA 4L6V6 4FCWA 3HHZA 4PCZA 3IG5A 4QHTA 3K92A 1TTEA 4XGIA 4DR6M
chains in the Genus database with same CATH topology
1YE9A 4NL4H 2R62A 3EIHA 1LV7A 3FTFA 3GLIB 3KXEC 3T1YM 3AKZA 3A46A 3AJIB 3MHVC 2CE7A 4IBFA 2DZOB 3PXGA 2RKOA 4IJFA 3GLIA 1TDZA 3J2PB 3HHYA 3L2AA 2K47A 5KPZA 1TDHA 4JN6A 3VK7A 4LGYA 3U6CA 1W5SA 4DUYM 4KHPM 1GL6A 4GMQA 4DR7M 5FTLA 2I7NA 3KW6A 1PJIA 3LQQA 4PT5A 4CGYB 5FSWA 3J7AS 4FWGA 4AG6A 3RE8A 3MK6A 4GITA 2O5RA 3SHFA 3FUTA 3AOGA 1R2YA 4DV5M 3UJNA 5KPTA 1J7KA 3DZDA 1IBLM 2E5LM 1XHBA 3VLFB 2Z7JA 4L8RC 3HHWA 1PM5A 1FJGM 4X65M 2AHMA 1ZAEA 4JI8M 4YHHM 4LZZA 3KP1E 2DWZB 2EA0A 2Z4SA 4OW0A 8CATA 1Z59A 4X66M 2JA2A 5FTKA 3MJ5A 1XMQM 3TWKA 1K82A 4ZPXA 1I4WA 5KO3A 1IN5A 2YNMD 1XXHB 1HQYE 2D7HA 1X37A 1QAQA 1H6UA 1JQJC 3L27A 4KLNA 3SARA 4DV0M 4JI1M 1NJGA 1XXHA 4NRWA 4IBIA 1PJJA 3K8ZA 4QNMA 4B3RM 5ITUA 3U60B 4MGHA 2Y20A 5ITRA 5F3WA 3K1JA 4LF9M 3THGA 4D81A 3J81S 5FTJA 1OJLA 4B3MM 4BBAA 5KQ8A 4JXJA 2UUCM 2KXEA 3FTDA 5LMUM 4L78A 1L2DA 4JI6M 4QOSA 1IXRC 2CV1A 2R65A 1D2NA 5EP3A 2Z3XA 5EP2A 2XSZA 4QNRA 2DXIA 3T38A 1DGBA 2KZUA 3TL4X 4AW4A 3A42A 2Y21A 3GPPA 2CV0A 3M6AA 1E94E 4RNAA 3SMSA 2X49A 3GPXA 3SHGB 3ZCBB 4EIWA 3VFDA 4LJ7A 4NXMM 4LJAA 3FTEA 1NJFA 1IN4A 3M0EA 5IREB 1NHWC 1QQWA 3U6OA 1J09A 1R6BX 2ZM6M 4B3SM 1K3XA 2XEPA 3KVWA 2F4VM 2QBYB 4ITQA 2CHQA 3HJ8A 2J7OA 3GLGB 2LNHC 3J27B 4FWHA 3RFWA 1JR3A 2I7PA 1N75A 3AFHA 1QAMA 3E9SA 3GLGA 3L29A 1MX0A 5C1BA 5ITXE 3FUWA 2XH9A 4HLQA 5E6JA 2HCBA 1KYIA 2DZNB 2V1UA 4AG5A 4IBJA 1IY0A 4II7A 1XNQM 3ZH9B 3HU2A 4GHAA 4MGKE 3UGJA 4LFAM 2F5QA 3DFZA 4AQYM 2KZSA 2LH0A 2NQ8C 1ORYB 4REZA 2Z4RA 4FD2A 3CF6E 2P5TA 4LJ9A 1IXZA 4LFCM 1MU5A 2R18A 5BPVA 3U6PA 3LMMA 3AL0C 4LFBM 4L15A 1XWIA 1GL7A 4L4UA 2QENA 2ERCA 3L28A 1YUBA 4JI2M 4M0DA 4NSOB 4JI3M 5H37D 5ITTA 3U6SA 4IBGA 3GQ4A 1G59A 4RF1A 3U6EA 1NSFA 3KOXE 2EO2A 2QP9X 1DGFA 2XZFA 1IBMM 4IIWA 3GP1A 3VDUA 1NHGC 1XC8A 4P16A 2RGHA 1G8PA 2R45A 4MGIE 4WURA 1SXJD 2F5OA 3VKGA 3WHLA 1E9RA 3DOAA 1Z5BA 4X64M 2C5RA 3FD9A 3KS4A 4JI4M 5EXXA 2UU9M 4JI7M 5E26A 4BB9A 2Y0QA 5C18A 5FLXS 4GIPA 2OPFA 1OFIA 1HNZM 3L25A 5EP4A 2VQEM 3JR4A 1DO0A 4DR5M 1N36M 1HNXM 1XNRM 4OU7A 2DWLA 3HJQA 4D80A 1Q39A 4IJEA 1GKIA 3KOZE 3C58A 4G6ZA 4M9ZA 3KOYE 3AOEC 3HKPA 3OTOM 4DV6M 4G4QA 1DGGA 4AKGA 2XFTA 3GLFB 2CEAA 4MGYE 4FCVA 5LMNM 3LVWA 4LF5M 5JI3E 4PDGA 3FUXA 2QZ4A 1TH2A 3TPZA 2H1RA 3JAMS 2OQ4A 2D7EA 1FNNA 2VIIA 5EJCA 3BOSA 5KPRA 3GQ5A 1GVNA 3GLFA 1L2BA 2XGNA 3KSJA 1IQPA 3U60A 2ZAMA 4GKKM 2QCUA 2FE8A 3WHKA 3KP0E 2HL7A 3NBIA 1GLNA 2CUZA 3PFIA 1IM2A 5BR8M 3FTCA 3B9PA 4QHSA 4GKJM 2UXDM 4MB7A 1I94M 5A2QS 3GRRA 3U6LA 3GLHB 1IN7A 3CTWB 4LRSA 3QAUA 2XZUA 1L1ZA 3QWLA 2F5NA 2G5GX 3GRVA 2XLJA 3GLHA 1YSYA 4G4NA 4A3VB 3U61B 4NOOB 4CISA 2A5YB 4LJ8A 1G4AE 3A45A 5EXPA 3U61A 2VQFM 3SAWA 1UM8A 1T3TA 3I51A 4G4RA 3PNVA 3D8BA 1NNJA 4GRIA 3J7BA 1IBKM 4D82A 1R7RA 3M7GA 2QBYA 4B7GA 4DUZM 1QANA 4LF6M 3U6DA 4AI6A 3FYDA 4DR2M 3GQ3A 4GC5A 3U6QA 1OFHA 1N78A 3IG8A 5EP1A 4S12A 2L7HA 1L2CA 1N77A 4LF4M 1G41A 4YY3M 4M0WA 1E9SA 1XMOM 4IBDA 4DV4M 4IBCA 4GC9A 1N34M 1TH3A 1R2ZA 4MGZE 1HNWM 2C98A 3J80S 1QYRA 5ITXA 3D8LA 4AKIA 1QVRA 4NXNM 1TH4A 4KO8A 1W5TA 3TQSA 2V6ZM 4GH9A 2G8LA 4IBEA 3SYKA 4DV1M 3LVVA 4FVMA 2D7GA 1NY6A 2UUBM 3UK6A 4DR4M 2F5SA 3KDSE 3HU3A 2BNKA 2Y0TA 2YQZA 3FUUA 1Q3CA 3HGIA 2LWXA 4LRTA 4DR1M 4FW9A 1L1TA 1QZMA 4GHLA 1IN6A 4R7GA 1KFVA 2CFOA 4LG2A 1N32M 3RGPA 1Z5AA 1L8QA 3R8FA 4LZJA 4B3TM 2DHRA 2C96A 3W0FA 4I81A 4AZFA 1IY2A 2L7IA 3A98B 4IBKA 2DWNA 2XSZD 3KSXA 3SAUA 3T15A 5DYGA 2FFJA 5JI2E 4JV5M 2R4EA 2X4AA 5IZ7D 1K3WA 4XBOA 3SFZA 1ZQ9A 2ZANA 3Q8XA 4I5SA 3CF2A 4DR3M 2KEBA 2LXEA 4B7HA 4MM3B 1NY5A 4FWDA 3H4MA 3SC3A 3AOEA 2F5PA 4PDIA 4LCBA 4L16A 1S3SA 2XF3A 1DO2A 3GRUA 2KA6B 4Z8XA 1E32A 4WW0A 1VDDA 2DVWB 4NRVA 5EXTA 3FYCA 2YR0A 4OX9M 3SASA 2R46A 4W5WA 4DV3M 2KW0A 3GO8A 2FOIC 3DA1A 4PD2A 1JR3D 5DNYA 4DV2M 4M9XA 4LF7M 3EIEA 1Z6TA 3HJSA 2UXCM 2HHHM 2DWMA 4LF8M 1KSFX 2FNAA 3I4YA 4I8OA 2J7NA 5DYIA 5KQDA 3CF0A 4LGMA 2C9CA 4LJ4A 4QOZC 4JI0M 3AV0A 2BJVA 3VK8A 2UUAM 4KODA 2BJWA 3HU1A 1HR0M 1SXJE 3U5ZB 2XFSA 3PNYA 1NNUC 2C9OA 4LJ5A 5ITYA 2V1CA 4B08A 5GKNA 2CV2A 1N33M 3TE6A 1J5EM 2HKJA 3KOWE 3U5ZA 3NWLA 4MH0E 3UZUA 1Z5CA 2ZAOA 3GRYA 1HT1E 3PVSA 1IXSB 5IWAM 3TWLA 3TWMA 5IT9S 2L09A 3W0LB 4RF0A 7CATA 1SXJB 5FTNA 2Q2EB 3VKHA 1DGHB 3SMPA 2YFQA 2KRKA 1NVMA 1QAOA 1SXJA 4AKHA 1DGHA 2X8AA 4HL4A 4K0KM 4BLCA 5EXSA 3FUVA 4FCTA 4OVZB 2R4JA 3SYLA 3KS8A 1EE8A 4B7FA 1WXQA 1Q3BA 2CHVA 4M9SA 1SXJC 2C99A 4OVZA 3U6MA 4I4LA 2L6OA 3K2LA 3SAVA 4CHTB 2M5ZA 3GPUA 3SBJA 4DV7M 3T1HM 2UXBM 3FKEA 5ITQA 2QPAA 4IBBA 4JI5M 4JYAM 3I4VA 5EQTA 4TUWA 2W82A 3KFUG 4X62M 4LJ6A 1G3IA 3HWSA 1IN8A 2M60A 3RGSA 4LY6A 3VDPA 1IY1A 3UMMA 1HQCA 3GPYA 2EUCA 1HT2E 3R9XB 3ZC7B 3JR5A 4G4OA 3L26A 2RGOA 4NSRA 3ILKA 5FTMA 1TGUA 4Z6YA 4R3DA 2ZBKB 3E4RA 3HHXA 2KRUA 3SATA 3HHZA 2CHGA 3LQRA 4FCWA 4PCZA 3IG5A 4QHTA 3K92A 1C1KA 4XGIA 4DR6M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5P A;  4ITQ A;  4GKK M;  4PDI A;  5BR8 M;  3T1Y M;  3A46 A;  4GKJ M;  2UXD M;  4MB7 A;  1I94 M;  5A2Q S;  3U6L A;  1TDZ A;  1L1Z A;  4NRV A;  2XZU A;  4OX9 M;  2F5N A;  3SAS A;  1MX0 A;  5ITX E;  4DV3 M;  1TDH A;  3GO8 A;  4PD2 A;  4G4N A;  3U6C A;  3VK7 A;  4DV2 M;  4LF7 M;  4KHP M;  4DUY M;  2UXC M;  2HHH M;  4LF8 M;  1XNQ M;  4DR7 M;  4CIS A;  1PJI A;  4LFA M;  2F5Q A;  3J7A S;  4AQY M;  3A45 A;  4JI0 M;  2VQF M;  3SAW A;  3VK8 A;  2UUA M;  1HR0 M;  4G4R A;  1NNJ A;  1R2Y A;  5ITY A;  4DV5 M;  1IBK M;  4LFC M;  1MU5 A;  1IBL M;  1N33 M;  1J5E M;  2E5L M;  2HKJ A;  3U6P A;  4DUZ M;  1PM5 A;  1FJG M;  4LFB M;  1Z5C A;  4X65 M;  3TWM A;  5IT9 S;  5IWA M;  3TWL A;  4JI8 M;  4LF6 M;  4YHH M;  3U6D A;  4JI2 M;  4JI3 M;  4DR2 M;  5ITT A;  3GQ3 A;  2EA0 A;  2Q2E B;  3GQ4 A;  3U6Q A;  3U6S A;  3U6E A;  1Z59 A;  4X66 M;  1L2C A;  4LF4 M;  1XMQ M;  3TWK A;  1K82 A;  4YY3 M;  2XZF A;  4K0K M;  1IBM M;  1XMO M;  3GP1 A;  4DV4 M;  1XC8 A;  1N34 M;  1EE8 A;  1R2Z A;  1HNW M;  3SAR A;  3J80 S;  1Q3B A;  4DV0 M;  4JI1 M;  5ITX A;  3DOA A;  3U6M A;  1Z5B A;  3SAV A;  4NRW A;  4X64 M;  4NXN M;  1PJJ A;  4JI4 M;  3GPU A;  4B3R M;  2UU9 M;  5ITU A;  4JI7 M;  3SBJ A;  5ITR A;  4DV1 M;  4DV7 M;  3T1H M;  2UXB M;  5FLX S;  2UUB M;  2OPF A;  4LF9 M;  1HNZ M;  3J81 S;  5ITQ A;  2VQE M;  4B3M M;  3JR4 A;  4DR4 M;  1N36 M;  4DR5 M;  1HNX M;  2F5S A;  4JI5 M;  1XNR M;  2UUC M;  4JYA M;  5LMU M;  1L2D A;  1Q3C A;  4JI6 M;  4X62 M;  4DR1 M;  1Q39 A;  1L1T A;  1KFV A;  1N32 M;  3C58 A;  1Z5A A;  3GPY A;  3GPP A;  3A42 A;  4B3T M;  3OTO M;  4DV6 M;  4G4Q A;  3W0F A;  3JR5 A;  4G4O A;  3GPX A;  5LMN M;  3SAU A;  4JV5 M;  4LF5 M;  4NXM M;  4PDG A;  1K3W A;  2ZBK B;  3JAM S;  2OQ4 A;  2F5O A;  3SAT A;  3GQ5 A;  4DR3 M;  1L2B A;  4PCZ A;  3U6O A;  2F4V M;  2ZM6 M;  4B3S M;  1K3X A;  4DR6 M; 
#chains in the Genus database with same CATH topology
 1YE9 A;  4NL4 H;  2QNJ A;  2R62 A;  3EIH A;  1LV7 A;  3FTF A;  2VF8 A;  3GLI B;  3KXE C;  3T1Y M;  3AKZ A;  3A46 A;  3GLF A;  3AJI B;  3MHV C;  2CE7 A;  4IBF A;  2DZO B;  3PXG A;  2RKO A;  4IJF A;  3GLI A;  1TDZ A;  1AUA A;  1PJQ A;  3B7Z A;  2LVO C;  3J2P B;  3HHY A;  3L2A A;  2K47 A;  1LTM A;  5KPZ A;  1TDH A;  4JN6 A;  3VK7 A;  4LGY A;  3U6C A;  2DAE A;  1W5S A;  4DUY M;  4KHP M;  2DHY A;  1GL6 A;  4GMQ A;  2J5Y A;  4DR7 M;  2KNV A;  2DAK A;  5FTL A;  2I7N A;  3KW6 A;  1PJI A;  3LQQ A;  4PT5 A;  4CGY B;  5FSW A;  4DBG B;  3J7A S;  4FWG A;  4AG6 A;  3RE8 A;  3MK6 A;  4GIT A;  2O5R A;  3SHF A;  3IEC A;  3FUT A;  1Y8G A;  3BXW A;  3AOG A;  1R2Y A;  4DV5 M;  3UJN A;  5KPT A;  2VDB B;  1J7K A;  2MR9 A;  3DZD A;  1IBL M;  2E5L M;  1XHB A;  3VLF B;  2FH0 A;  2Z7J A;  4L8R C;  3HHW A;  1PM5 A;  1FJG M;  4X65 M;  2AHM A;  4RKU F;  1ZAE A;  4JI8 M;  1G71 A;  1XXH E;  4YHH M;  3HX3 A;  4LZZ A;  3KP1 E;  1ZMU A;  2DWZ B;  2EA0 A;  2Z4S A;  4OW0 A;  8CAT A;  1Z59 A;  4X66 M;  2JA2 A;  1ZMV A;  3MJ5 A;  5FTK A;  1XMQ M;  2DAG A;  3TWK A;  1K82 A;  4ZPX A;  1I4W A;  1HJP A;  5KO3 A;  1IN5 A;  2YNM D;  3HY5 A;  1XXH B;  1HQY E;  3K9O A;  2MRO B;  2D7H A;  1X37 A;  1QAQ A;  1H6U A;  1JQJ C;  3L27 A;  4KLN A;  3SAR A;  4DV0 M;  4JI1 M;  1NJG A;  1XXH A;  1TR8 A;  4NRW A;  4IBI A;  1PJJ A;  3K8Z A;  4QNM A;  1WGL A;  4B3R M;  5ITU A;  3U60 B;  4Q7J A;  2Y20 A;  4MGH A;  5ITR A;  5F3W A;  1NO1 A;  3K1J A;  4LF9 M;  3THG A;  4D81 A;  1AIP C;  3J81 S;  5FTJ A;  1OJL A;  4B3M M;  4BBA A;  5KQ8 A;  4JXJ A;  2UUC M;  2KXE A;  1XB2 B;  3FTD A;  1P3Q Q;  5LMU M;  4L78 A;  1L2D A;  4JI6 M;  4QOS A;  1IXR C;  2CV1 A;  2JP7 A;  2R65 A;  1D2N A;  2KNZ A;  5EP3 A;  1T6O A;  2Z3X A;  2LVA A;  5EP2 A;  2XSZ A;  4QNR A;  2DXI A;  3T38 A;  1DGB A;  2KZU A;  3TL4 X;  4AW4 A;  3A42 A;  2Y21 A;  3GPP A;  2CV0 A;  1VQ1 A;  3M6A A;  1E94 E;  4RNA A;  3SMS A;  1JR3 E;  2X49 A;  3GPX A;  3SHG B;  1TF0 B;  3ZCB B;  4EIW A;  1VEJ A;  3B7Q A;  3VFD A;  1MJG M;  1YLA A;  4LJ7 A;  2JY5 A;  3GLG E;  4NXM M;  4LJA A;  3FTE A;  1NJF A;  1IN4 A;  3M0E A;  2LHG A;  5IRE B;  1NHW C;  2LHC A;  1QQW A;  3U6O A;  1J09 A;  1R6B X;  2ZM6 M;  4B3S M;  1K3X A;  2XEP A;  3KVW A;  2F4V M;  2QBY B;  4ITQ A;  2CHQ A;  2K0B X;  3HJ8 A;  2J7O A;  3GLG B;  2LNH C;  3J27 B;  3LW5 F;  1WHC A;  4FWH A;  1OTR A;  3RFW A;  1JR3 A;  2I7P A;  4CJ6 A;  2RRU A;  1N75 A;  2JZ1 A;  3AFH A;  1QAM A;  2DI0 A;  3E9S A;  2JY8 A;  3GLG A;  3L29 A;  1MX0 A;  5C1B A;  5ITX E;  3FUW A;  1A5T A;  1VEK A;  2XH9 A;  4HLQ A;  1R5L A;  5E6J A;  2HCB A;  1KYI A;  2DZN B;  3FRH A;  2BWB A;  2V1U A;  4AG5 A;  4IBJ A;  1IY0 A;  2EJS A;  4II7 A;  1XNQ M;  3ZH9 B;  1C1K A;  2WSE F;  3HU2 A;  4GHA A;  4MGK E;  3UGJ A;  4LFA M;  2F5Q A;  3LCU A;  3DFZ A;  4AQY M;  1VG5 A;  2KZS A;  2QQ8 A;  1OIZ A;  2LH0 A;  2NQ8 C;  1ORY B;  4REZ A;  2Z4R A;  4FD2 A;  1PRB A;  3CF6 E;  4JI2 M;  2P5T A;  4LJ9 A;  3FRI A;  1IXZ A;  4LFC M;  1MU5 A;  1R4G A;  2R18 A;  5BPV A;  3U6P A;  3LMM A;  3AL0 C;  4LFB M;  4L15 A;  1XWI A;  1GL7 A;  2KDL A;  2KHH A;  2LVP C;  2QEN A;  4L4U A;  2ERC A;  3L28 A;  1VEG A;  1YUB A;  4M0D A;  4NSO B;  4JI3 M;  5H37 D;  1JB0 F;  5ITT A;  4IBG A;  3C9P A;  4P17 A;  3GQ4 A;  4RF1 A;  3U6E A;  3U6S A;  1G59 A;  1NSF A;  3KOX E;  2EO2 A;  2QP9 X;  1DGF A;  2XZF A;  1IBM M;  4IIW A;  3CGW A;  1IFY A;  3GP1 A;  3VDU A;  1NHG C;  3W67 A;  1XC8 A;  1BVS A;  2RGH A;  4P16 A;  1G8P A;  2R45 A;  4MGI E;  1F4I A;  4WUR A;  1OAO C;  1SXJ D;  2F5O A;  3VKG A;  2R0I A;  4CIZ A;  3WHL A;  1E9R A;  2OO9 A;  1GAB A;  3DOA A;  1Z5B A;  5DFL A;  4X64 M;  2C5R A;  3FD9 A;  3KS4 A;  4JI4 M;  5EXX A;  3FE3 A;  2UU9 M;  4JI7 M;  5E26 A;  4BB9 A;  1GJS A;  2Y0Q A;  2L2D A;  5C18 A;  5FLX S;  1WGN A;  4GIP A;  2OPF A;  1OFI A;  1HNZ M;  3L25 A;  5EP4 A;  2VQE M;  3JR4 A;  1DO0 A;  4DR5 M;  1N36 M;  1HNX M;  1XNR M;  2JY7 A;  4OU7 A;  2DWL A;  2APL A;  2FS1 A;  3HJQ A;  3GLF E;  3H4J A;  4D80 A;  1Q39 A;  3V76 A;  4IJE A;  1GKI A;  3KOZ E;  2ZTC A;  3C58 A;  1PJT A;  4G6Z A;  3KOY E;  4M9Z A;  2WZJ A;  1EFU B;  3AOE C;  3HKP A;  3OTO M;  4DV6 M;  1QUT A;  4G4Q A;  1DGG A;  4AKG A;  2XFT A;  3GLF B;  1RU3 A;  2CEA A;  4MGY E;  4FCV A;  5LMN M;  2JWS A;  3LVW A;  4LF5 M;  2MH8 A;  5JI3 E;  2R44 A;  4PDG A;  3FUX A;  2QZ4 A;  1SG9 A;  1TH2 A;  3TPZ A;  2H1R A;  3JAM S;  2OQ4 A;  2D7E A;  1FNN A;  2VII A;  5EJC A;  3BOS A;  1ZMW A;  3GLH E;  1GVN A;  2H5X A;  5KPR A;  2XGN A;  2GNO A;  2CRU A;  3KSJ A;  1IQP A;  3B89 A;  3U60 A;  2ZAM A;  3LCV B;  2QSF X;  2EKF A;  2QHO B;  1OQY A;  2FE8 A;  2QCU A;  3HZJ A;  4HEO A;  3KP0 E;  3WHK A;  4GKK M;  2HL7 A;  3NBI A;  1GLN A;  2CUZ A;  3PFI A;  1IM2 A;  5BR8 M;  3FTC A;  3B9P A;  4QHS A;  4GKJ M;  2DAI A;  2UXD M;  4MB7 A;  1I94 M;  5A2Q S;  3GRR A;  3U6L A;  3GLH B;  2MJ5 B;  1IN7 A;  3CTW B;  4LRS A;  3QAU A;  2XZU A;  1L1Z A;  3QWL A;  2F5N A;  2CP8 A;  2G5G X;  3GRV A;  4KT0 F;  2XLJ A;  2DAM A;  1YSY A;  1OIP A;  3GLH A;  4G4N A;  2OOB A;  4A3V B;  3U61 B;  4NOO B;  3K9P A;  1WJ7 A;  4CIS A;  1D0K A;  4Y28 F;  3GQ5 A;  2A5Y B;  4LJ8 A;  1PGY A;  1G4A E;  3A45 A;  5EXP A;  3U61 A;  2VQF M;  3SAW A;  1UM8 A;  1T3T A;  1D0L A;  3I51 A;  4G4R A;  3I04 M;  3PNV A;  3D8B A;  1NNJ A;  4GRI A;  3J7B A;  1IBK M;  4NC6 A;  4D82 A;  1R7R A;  3M7G A;  2QBY A;  4B7G A;  4DUZ M;  1QAN A;  3C3E A;  4LF6 M;  3U6D A;  4AI6 A;  3FYD A;  4DR2 M;  3GQ3 A;  4GC5 A;  3U6Q A;  1OFH A;  1N78 A;  3IG8 A;  4UN2 B;  4WP2 A;  5EP1 A;  3F92 A;  2VF7 A;  2L7H A;  4S12 A;  1N77 A;  1L2C A;  4LF4 M;  1VDL A;  2BWE A;  1PJS A;  1G41 A;  4YY3 M;  4M0W A;  1E9S A;  2O25 A;  1XMO M;  4IBD A;  4DV4 M;  4IBC A;  2Z8Y M;  4GC9 A;  2L4F A;  1N34 M;  2K6B A;  1WIV A;  1TH3 A;  1MN3 A;  1R2Z A;  4MGZ E;  1HNW M;  2C98 A;  3J80 S;  1QYR A;  2DNA A;  2DZL A;  1WR1 B;  5ITX A;  5L8R F;  1GJT A;  3D8L A;  1EIJ A;  4AKI A;  1QVR A;  4NXN M;  1TH4 A;  4KO8 A;  1W5T A;  1V34 A;  2LBC A;  3TQS A;  2V6Z M;  2ZTD A;  2G8L A;  3QYB A;  4GH9 A;  4IBE A;  3LVV A;  3SYK A;  4DV1 M;  4FVM A;  2D7G A;  4ANR A;  1NY6 A;  2UUB M;  3UK6 A;  4GEW A;  4DR4 M;  2F5S A;  3KDS E;  4F1I A;  3HU3 A;  2BNK A;  2JUJ A;  2Y0T A;  2YQZ A;  3FUU A;  1C7Y A;  1Q3C A;  1OKS A;  3HGI A;  2LWX A;  4LRT A;  3NBX X;  4DR1 M;  1QZE A;  4FW9 A;  1L1T A;  1QZM A;  4GHL A;  1IN6 A;  4R7G A;  2HAK A;  1KFV A;  2CFO A;  4LG2 A;  1N32 M;  3RGP A;  1Z5A A;  3C3D A;  1CUK A;  1L8Q A;  2N35 A;  3R8F A;  4LZJ A;  4B3T M;  2DHR A;  2C96 A;  3B74 A;  3W0F A;  4I81 A;  4AZF A;  1IY2 A;  2L7I A;  3A98 B;  3BBZ A;  4IBK A;  2XSZ D;  2DWN A;  3KSX A;  3SAU A;  3T15 A;  5DYG A;  2FFJ A;  5JI2 E;  4JV5 M;  2R4E A;  2X4A A;  5IZ7 D;  2R6F A;  1K3W A;  1ZV1 A;  4XBO A;  3SFZ A;  1ZQ9 A;  2ZAN A;  3Q8X A;  4I5S A;  3CF2 A;  4DR3 M;  2KEB A;  2LXE A;  4B7H A;  4MM3 B;  2K9D A;  1NY5 A;  4FWD A;  3H4M A;  2LVN C;  3SC3 A;  3AOE A;  2F5P A;  4PDI A;  3E21 A;  4LCB A;  4L16 A;  1S3S A;  1V92 A;  1DO2 A;  2XF3 A;  3GRU A;  2KA6 B;  4Z8X A;  1E32 A;  4WW0 A;  1VDD A;  2DVW B;  1NV8 A;  4NRV A;  5EXT A;  3FYC A;  2JY6 B;  2YR0 A;  3QYE A;  4OX9 M;  3SAS A;  2R46 A;  3MMP A;  4W5W A;  4DV3 M;  2KW0 A;  2DKL A;  2FOI C;  3DA1 A;  2O01 F;  1JR3 D;  4PD2 A;  5DNY A;  3GO8 A;  4M9X A;  4DV2 M;  3EIE A;  1Z6T A;  3HJS A;  4XK8 F;  2HHH M;  4LF7 M;  2UXC M;  2DWM A;  4LF8 M;  1KSF X;  2FNA A;  3I4Y A;  4I8O A;  2J7N A;  5DYI A;  5KQD A;  3CF0 A;  4LGM A;  3ZQJ A;  2C9C A;  4LJ4 A;  4QOZ C;  4F2L A;  4JI0 M;  3AV0 A;  2BJV A;  3VK8 A;  1Q02 A;  2UUA M;  1QUS A;  4KOD A;  2BJW A;  3HU1 A;  1HR0 M;  1QDR A;  1SXJ E;  3U5Z B;  2XFS A;  3PNY A;  1NNU C;  2C9O A;  4LJ5 A;  2JZ0 A;  2V1C A;  5ITY A;  4B08 A;  5GKN A;  2CV2 A;  1V33 A;  1N33 M;  3TE6 A;  1J5E M;  2MGW A;  3Q8G A;  2HKJ A;  3KOW E;  3U5Z A;  3NWL A;  4MH0 E;  1L2B A;  3UZU A;  1Z5C A;  2ZAO A;  3GRY A;  1HT1 E;  3PVS A;  1IXS B;  5IWA M;  3TWL A;  3TWM A;  5IT9 S;  2WSF F;  2L09 A;  3W0L B;  4RF0 A;  7CAT A;  1SXJ B;  5FTN A;  2CWB A;  2Q2E B;  3VKH A;  1DGH B;  3SMP A;  1IXS A;  2YFQ A;  3I01 M;  1OAI A;  2KRK A;  1NVM A;  1QAO A;  1SXJ A;  2HWJ A;  4AKH A;  1NV9 A;  1DGH A;  2X8A A;  4HL4 A;  4K0K M;  4BLC A;  5EXS A;  3FUV A;  4FCT A;  4OVZ B;  2R4J A;  3SYL A;  3KS8 A;  3T6P A;  1EE8 A;  4B7F A;  1WXQ A;  2L4E A;  1Q3B A;  2CHV A;  3E46 A;  4M9S A;  1SXJ C;  2C99 A;  2B3T A;  4OVZ A;  3U6M A;  4I4L A;  2KNA A;  2L6O A;  3K2L A;  2JNH A;  3SAV A;  4CHT B;  2M5Z A;  2LTU A;  3GPU A;  2EKK A;  3SBJ A;  4DV7 M;  3T1H M;  2UXB M;  1QDT A;  1GO5 A;  2JXN A;  1D0M A;  3FKE A;  5ITQ A;  2QPA A;  3B7N A;  4IBB A;  4JI5 M;  4JYA M;  2DEN A;  1DV0 A;  3I4V A;  5EQT A;  4TUW A;  2W82 A;  3KFU G;  4X62 M;  3W68 A;  1UFZ A;  4LJ6 A;  2LVQ D;  1G3I A;  3HWS A;  1IN8 A;  2M60 A;  3RGS A;  4LY6 A;  3VDP A;  1IY1 A;  3UMM A;  1HQC A;  3GPY A;  2EUC A;  2WSC F;  1HT2 E;  3R9X B;  3IHP A;  3ZC7 B;  4R71 A;  1T43 A;  3JR5 A;  2OOA A;  4G4O A;  2G3Q A;  3L26 A;  2RGO A;  4G3O A;  3ILK A;  4NSR A;  5FTM A;  3GLI E;  1TGU A;  4Z6Y A;  4R3D A;  2ZBK B;  3E4R A;  3HHX A;  2KRU A;  3SAT A;  2GQF A;  2CHG A;  3LQR A;  4L6V 6;  4FCW A;  3HHZ A;  4PCZ A;  3IG5 A;  4QHT A;  3K92 A;  1TTE A;  4XGI A;  4DR6 M; 
#chains in the Genus database with same CATH homology
 1YE9 A;  4NL4 H;  2R62 A;  3EIH A;  1LV7 A;  3FTF A;  3GLI B;  3KXE C;  3T1Y M;  3AKZ A;  3A46 A;  3AJI B;  3MHV C;  2CE7 A;  4IBF A;  2DZO B;  3PXG A;  2RKO A;  4IJF A;  3GLI A;  1TDZ A;  3J2P B;  3HHY A;  3L2A A;  2K47 A;  5KPZ A;  1TDH A;  4JN6 A;  3VK7 A;  4LGY A;  3U6C A;  1W5S A;  4DUY M;  4KHP M;  1GL6 A;  4GMQ A;  4DR7 M;  5FTL A;  2I7N A;  3KW6 A;  1PJI A;  3LQQ A;  4PT5 A;  4CGY B;  5FSW A;  3J7A S;  4FWG A;  4AG6 A;  3RE8 A;  3MK6 A;  4GIT A;  2O5R A;  3SHF A;  3FUT A;  3AOG A;  1R2Y A;  4DV5 M;  3UJN A;  5KPT A;  1J7K A;  3DZD A;  1IBL M;  2E5L M;  1XHB A;  3VLF B;  2Z7J A;  4L8R C;  3HHW A;  1PM5 A;  1FJG M;  4X65 M;  2AHM A;  1ZAE A;  4JI8 M;  4YHH M;  4LZZ A;  3KP1 E;  2DWZ B;  2EA0 A;  2Z4S A;  4OW0 A;  8CAT A;  1Z59 A;  4X66 M;  2JA2 A;  5FTK A;  3MJ5 A;  1XMQ M;  3TWK A;  1K82 A;  4ZPX A;  1I4W A;  5KO3 A;  1IN5 A;  2YNM D;  1XXH B;  1HQY E;  2D7H A;  1X37 A;  1QAQ A;  1H6U A;  1JQJ C;  3L27 A;  4KLN A;  3SAR A;  4DV0 M;  4JI1 M;  1NJG A;  1XXH A;  4NRW A;  4IBI A;  1PJJ A;  3K8Z A;  4QNM A;  4B3R M;  5ITU A;  3U60 B;  4MGH A;  2Y20 A;  5ITR A;  5F3W A;  3K1J A;  4LF9 M;  3THG A;  4D81 A;  3J81 S;  5FTJ A;  1OJL A;  4B3M M;  4BBA A;  5KQ8 A;  4JXJ A;  2UUC M;  2KXE A;  3FTD A;  5LMU M;  4L78 A;  1L2D A;  4JI6 M;  4QOS A;  1IXR C;  2CV1 A;  2R65 A;  1D2N A;  5EP3 A;  2Z3X A;  5EP2 A;  2XSZ A;  4QNR A;  2DXI A;  3T38 A;  1DGB A;  2KZU A;  3TL4 X;  4AW4 A;  3A42 A;  2Y21 A;  3GPP A;  2CV0 A;  3M6A A;  1E94 E;  4RNA A;  3SMS A;  2X49 A;  3GPX A;  3SHG B;  3ZCB B;  4EIW A;  3VFD A;  4LJ7 A;  4NXM M;  4LJA A;  3FTE A;  1NJF A;  1IN4 A;  3M0E A;  5IRE B;  1NHW C;  1QQW A;  3U6O A;  1J09 A;  1R6B X;  2ZM6 M;  4B3S M;  1K3X A;  2XEP A;  3KVW A;  2F4V M;  2QBY B;  4ITQ A;  2CHQ A;  3HJ8 A;  2J7O A;  3GLG B;  2LNH C;  3J27 B;  4FWH A;  3RFW A;  1JR3 A;  2I7P A;  1N75 A;  3AFH A;  1QAM A;  3E9S A;  3GLG A;  3L29 A;  1MX0 A;  5C1B A;  5ITX E;  3FUW A;  2XH9 A;  4HLQ A;  5E6J A;  2HCB A;  1KYI A;  2DZN B;  2V1U A;  4AG5 A;  4IBJ A;  1IY0 A;  4II7 A;  1XNQ M;  3ZH9 B;  3HU2 A;  4GHA A;  4MGK E;  3UGJ A;  4LFA M;  2F5Q A;  3DFZ A;  4AQY M;  2KZS A;  2LH0 A;  2NQ8 C;  1ORY B;  4REZ A;  2Z4R A;  4FD2 A;  3CF6 E;  2P5T A;  4LJ9 A;  1IXZ A;  4LFC M;  1MU5 A;  2R18 A;  5BPV A;  3U6P A;  3LMM A;  3AL0 C;  4LFB M;  4L15 A;  1XWI A;  1GL7 A;  4L4U A;  2QEN A;  2ERC A;  3L28 A;  1YUB A;  4JI2 M;  4M0D A;  4NSO B;  4JI3 M;  5H37 D;  5ITT A;  3U6S A;  4IBG A;  3GQ4 A;  1G59 A;  4RF1 A;  3U6E A;  1NSF A;  3KOX E;  2EO2 A;  2QP9 X;  1DGF A;  2XZF A;  1IBM M;  4IIW A;  3GP1 A;  3VDU A;  1NHG C;  1XC8 A;  4P16 A;  2RGH A;  1G8P A;  2R45 A;  4MGI E;  4WUR A;  1SXJ D;  2F5O A;  3VKG A;  3WHL A;  1E9R A;  3DOA A;  1Z5B A;  4X64 M;  2C5R A;  3FD9 A;  3KS4 A;  4JI4 M;  5EXX A;  2UU9 M;  4JI7 M;  5E26 A;  4BB9 A;  2Y0Q A;  5C18 A;  5FLX S;  4GIP A;  2OPF A;  1OFI A;  1HNZ M;  3L25 A;  5EP4 A;  2VQE M;  3JR4 A;  1DO0 A;  4DR5 M;  1N36 M;  1HNX M;  1XNR M;  4OU7 A;  2DWL A;  3HJQ A;  4D80 A;  1Q39 A;  4IJE A;  1GKI A;  3KOZ E;  3C58 A;  4G6Z A;  4M9Z A;  3KOY E;  3AOE C;  3HKP A;  3OTO M;  4DV6 M;  4G4Q A;  1DGG A;  4AKG A;  2XFT A;  3GLF B;  2CEA A;  4MGY E;  4FCV A;  5LMN M;  3LVW A;  4LF5 M;  5JI3 E;  4PDG A;  3FUX A;  2QZ4 A;  1TH2 A;  3TPZ A;  2H1R A;  3JAM S;  2OQ4 A;  2D7E A;  1FNN A;  2VII A;  5EJC A;  3BOS A;  5KPR A;  3GQ5 A;  1GVN A;  3GLF A;  1L2B A;  2XGN A;  3KSJ A;  1IQP A;  3U60 A;  2ZAM A;  4GKK M;  2QCU A;  2FE8 A;  3WHK A;  3KP0 E;  2HL7 A;  3NBI A;  1GLN A;  2CUZ A;  3PFI A;  1IM2 A;  5BR8 M;  3FTC A;  3B9P A;  4QHS A;  4GKJ M;  2UXD M;  4MB7 A;  1I94 M;  5A2Q S;  3GRR A;  3U6L A;  3GLH B;  1IN7 A;  3CTW B;  4LRS A;  3QAU A;  2XZU A;  1L1Z A;  3QWL A;  2F5N A;  2G5G X;  3GRV A;  2XLJ A;  3GLH A;  1YSY A;  4G4N A;  4A3V B;  3U61 B;  4NOO B;  4CIS A;  2A5Y B;  4LJ8 A;  1G4A E;  3A45 A;  5EXP A;  3U61 A;  2VQF M;  3SAW A;  1UM8 A;  1T3T A;  3I51 A;  4G4R A;  3PNV A;  3D8B A;  1NNJ A;  4GRI A;  3J7B A;  1IBK M;  4D82 A;  1R7R A;  3M7G A;  2QBY A;  4B7G A;  4DUZ M;  1QAN A;  4LF6 M;  3U6D A;  4AI6 A;  3FYD A;  4DR2 M;  3GQ3 A;  4GC5 A;  3U6Q A;  1OFH A;  1N78 A;  3IG8 A;  5EP1 A;  4S12 A;  2L7H A;  1L2C A;  1N77 A;  4LF4 M;  1G41 A;  4YY3 M;  4M0W A;  1E9S A;  1XMO M;  4IBD A;  4DV4 M;  4IBC A;  4GC9 A;  1N34 M;  1TH3 A;  1R2Z A;  4MGZ E;  1HNW M;  2C98 A;  3J80 S;  1QYR A;  5ITX A;  3D8L A;  4AKI A;  1QVR A;  4NXN M;  1TH4 A;  4KO8 A;  1W5T A;  3TQS A;  2V6Z M;  4GH9 A;  2G8L A;  4IBE A;  3SYK A;  4DV1 M;  3LVV A;  4FVM A;  2D7G A;  1NY6 A;  2UUB M;  3UK6 A;  4DR4 M;  2F5S A;  3KDS E;  3HU3 A;  2BNK A;  2Y0T A;  2YQZ A;  3FUU A;  1Q3C A;  3HGI A;  2LWX A;  4LRT A;  4DR1 M;  4FW9 A;  1L1T A;  1QZM A;  4GHL A;  1IN6 A;  4R7G A;  1KFV A;  2CFO A;  4LG2 A;  1N32 M;  3RGP A;  1Z5A A;  1L8Q A;  3R8F A;  4LZJ A;  4B3T M;  2DHR A;  2C96 A;  3W0F A;  4I81 A;  4AZF A;  1IY2 A;  2L7I A;  3A98 B;  4IBK A;  2DWN A;  2XSZ D;  3KSX A;  3SAU A;  3T15 A;  5DYG A;  2FFJ A;  5JI2 E;  4JV5 M;  2R4E A;  2X4A A;  5IZ7 D;  1K3W A;  4XBO A;  3SFZ A;  1ZQ9 A;  2ZAN A;  3Q8X A;  4I5S A;  3CF2 A;  4DR3 M;  2KEB A;  2LXE A;  4B7H A;  4MM3 B;  1NY5 A;  4FWD A;  3H4M A;  3SC3 A;  3AOE A;  2F5P A;  4PDI A;  4LCB A;  4L16 A;  1S3S A;  2XF3 A;  1DO2 A;  3GRU A;  2KA6 B;  4Z8X A;  1E32 A;  4WW0 A;  1VDD A;  2DVW B;  4NRV A;  5EXT A;  3FYC A;  2YR0 A;  4OX9 M;  3SAS A;  2R46 A;  4W5W A;  4DV3 M;  2KW0 A;  3GO8 A;  2FOI C;  3DA1 A;  4PD2 A;  1JR3 D;  5DNY A;  4DV2 M;  4M9X A;  4LF7 M;  3EIE A;  1Z6T A;  3HJS A;  2UXC M;  2HHH M;  2DWM A;  4LF8 M;  1KSF X;  2FNA A;  3I4Y A;  4I8O A;  2J7N A;  5DYI A;  5KQD A;  3CF0 A;  4LGM A;  2C9C A;  4LJ4 A;  4QOZ C;  4JI0 M;  3AV0 A;  2BJV A;  3VK8 A;  2UUA M;  4KOD A;  2BJW A;  3HU1 A;  1HR0 M;  1SXJ E;  3U5Z B;  2XFS A;  3PNY A;  1NNU C;  2C9O A;  4LJ5 A;  5ITY A;  2V1C A;  4B08 A;  5GKN A;  2CV2 A;  1N33 M;  3TE6 A;  1J5E M;  2HKJ A;  3KOW E;  3U5Z A;  3NWL A;  4MH0 E;  3UZU A;  1Z5C A;  2ZAO A;  3GRY A;  1HT1 E;  3PVS A;  1IXS B;  5IWA M;  3TWL A;  3TWM A;  5IT9 S;  2L09 A;  3W0L B;  4RF0 A;  7CAT A;  1SXJ B;  5FTN A;  2Q2E B;  3VKH A;  1DGH B;  3SMP A;  2YFQ A;  2KRK A;  1NVM A;  1QAO A;  1SXJ A;  4AKH A;  1DGH A;  2X8A A;  4HL4 A;  4K0K M;  4BLC A;  5EXS A;  3FUV A;  4FCT A;  4OVZ B;  2R4J A;  3SYL A;  3KS8 A;  1EE8 A;  4B7F A;  1WXQ A;  1Q3B A;  2CHV A;  4M9S A;  1SXJ C;  2C99 A;  4OVZ A;  3U6M A;  4I4L A;  2L6O A;  3K2L A;  3SAV A;  4CHT B;  2M5Z A;  3GPU A;  3SBJ A;  4DV7 M;  3T1H M;  2UXB M;  3FKE A;  5ITQ A;  2QPA A;  4IBB A;  4JI5 M;  4JYA M;  3I4V A;  5EQT A;  4TUW A;  2W82 A;  3KFU G;  4X62 M;  4LJ6 A;  1G3I A;  3HWS A;  1IN8 A;  2M60 A;  3RGS A;  4LY6 A;  3VDP A;  1IY1 A;  3UMM A;  1HQC A;  3GPY A;  2EUC A;  1HT2 E;  3R9X B;  3ZC7 B;  3JR5 A;  4G4O A;  3L26 A;  2RGO A;  4NSR A;  3ILK A;  5FTM A;  1TGU A;  4Z6Y A;  4R3D A;  2ZBK B;  3E4R A;  3HHX A;  2KRU A;  3SAT A;  3HHZ A;  2CHG A;  3LQR A;  4FCW A;  4PCZ A;  3IG5 A;  4QHT A;  3K92 A;  1C1K A;  4XGI A;  4DR6 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...