4JV5M

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4jv5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4jv5M02
3SATA 4LF7M 1I94M 3U6EA 3TWMA 4JI7M 2ZBKB 1XNRM 3J80S 4DR3M 3U6CA 4DR2M 4DV1M 3JR5A 1TDHA 4G4RA 1PJIA 5ITRA 1N36M 1IBLM 4LF8M 3U6MA 1XMQM 2XZUA 2VQEM 1L2BA 4DR7M 4JI2M 1Z5AA 2F5QA 4DUZM 4JI1M 3A45A 4B3TM 4NXMM 2F4VM 3A42A 3SAUA 2EA0A 3U6OA 3DOAA 2HHHM 4JI8M 1Z59A 3A46A 4DV2M 4G4QA 2UUAM 4JI5M 1L2DA 3J7AS 4LFAM 1K3XA 3U6QA 1L2CA 5ITUA 1Z5CA 1HNWM 5ITXE 3OTOM 3VK8A 3W0FA 5LMUM 5IWAM 2UUCM 3GQ3A 1HR0M 1K3WA 4GKKM 5FLXS 3TWKA 4LFBM 4DR4M 2OPFA 3JR4A 4LF6M 5A2QS 4DV7M 4X65M 4CISA 4JI3M 1XNQM 4DUYM 1Q39A 3U6SA 2UU9M 3T1HM 3TWLA 4LF5M 1N33M 2F5OA 3GPXA 1HNXM 1Z5BA 4NRVA 5BR8M 4G4NA 4PDIA 4DV5M 3SASA 4JI6M 2XZFA 1L1ZA 1HNZM 4DR6M 5ITTA 2UXDM 2F5PA 2VQFM 4YHHM 4MB7A 3GQ4A 1IBKM 4DV4M 3GO8A 3C58A 4OX9M 3VK7A 3J81S 4G4OA 1IBMM 3SBJA 1XC8A 4X64M 4JYAM 1N32M 1L1TA 5ITYA 2F5SA 1FJGM 1R2ZA 4YY3M 2OQ4A 1J5EM 4DR5M 1EE8A 4DR1M 4DV0M 2Q2EB 3SAWA 4ITQA 5ITXA 1KFVA 4PDGA 3GPYA 4X62M 4DV3M 1XMOM 4DV6M 4GKJM 1NNJA 2UXBM 1PJJA 3U6DA 5LMNM 2HKJA 1N34M 4JV5M 4NXNM 4PD2A 1PM5A 4K0KM 2E5LM 3GPUA 4B3SM 4AQYM 3SARA 4KHPM 4JI0M 4X66M 4JI4M 4LF9M 1Q3BA 3GP1A 1MX0A 3GPPA 3JAMS 5IT9S 1K82A 4B3RM 2F5NA 1TDZA 1Q3CA 5ITQA 3U6PA 4LFCM 4B3MM 4PCZA 2UUBM 2UXCM 3U6LA 2ZM6M 3T1YM 1MU5A 4NRWA 3SAVA 1R2YA 3GQ5A 4LF4M
chains in the Genus database with same CATH superfamily
3SATA 1I94M 5C1BA 3I01M 4TUWA 2Z8YM 2X8AA 2ZBKB 3KXEC 4XGIA 5EP1A 3T6PA 4F2LA 2KHHA 4IJFA 4EIWA 3GRUA 4KODA 2DKLA 4WP2A 2LVAA 4I4LA 4D80A 1WGNA 2JY8A 4JN6A 3HX3A 3JR5A 2DENA 5FTNA 1IBLM 2DWLA 1XMQM 1DGHB 4Q7JA 4CIZA 3D8LA 2XZUA 4DR7M 2GQFA 4AKHA 1Z5AA 2F5QA 4DUZM 3L25A 4FWDA 2Z7JA 2R65A 4B3TM 2F4VM 1DV0A 2KRKA 3UZUA 2EA0A 2LNHC 1IXSA 1G71A 1HT1E 2JWSA 1TH4A 3U61A 2UUAM 3AL0C 1L2DA 1NY5A 4WW0A 4OU7A 2KDLA 3GLFE 3UMMA 1DO0A 3U6QA 5ITUA 1K3XA 3L29A 3SYLA 4FW9A 3OTOM 3VK8A 2D7EA 2R45A 1QUTA 5IWAM 2XSZA 2UUCM 3B89A 4D82A 3MJ5A 1ZV1A 2VF8A 4L16A 1WXQA 2LVNC 3FRIA 5F3WA 1XXHB 3GRRA 3A98B 2Z4SA 4JI3M 2KNVA 1IXSB 1ZMWA 2VDBB 2X4AA 3K2LA 4RF1A 1VG5A 3VKGA 4FWHA 1R5LA 2N35A 3RFWA 4MGIE 4DUYM 1Q39A 4XK8F 3U6SA 4B7GA 2UU9M 5EQTA 1XWIA 1NNUC 3HU1A 3LCVB 3E9SA 3KFUG 3J27B 1HNXM 2CV1A 4G4NA 4OVZA 5BR8M 3SASA 4JI6M 2O01F 1HNZM 2X49A 2JY6B 5JI2E 3KSJA 2WZJA 5KQ8A 3FUXA 4M0WA 3HHXA 1E9SA 4A3VB 1WHCA 5E26A 1TF0B 5DNYA 3GO8A 3U5ZA 1YE9A 3FYDA 3M6AA 1NV9A 4IBJA 2FH0A 4M9SA 3UK6A 4JYAM 5ITYA 3R8FA 4IBKA 1J5EM 2XEPA 4DR5M 1RU3A 3C3EA 1VEKA 2HWJA 4DV0M 1TTEA 4QOSA 2DWMA 1Z6TA 2G3QA 3THGA 3VLFB 3MMPA 4IBDA 3KOZE 1HQCA 1PJQA 2M60A 4F1IA 4PDGA 1JB0F 2NQ8C 4HEOA 1NNJA 2UXBM 3U6DA 3Q8XA 3IG8A 1NV8A 2KRUA 3KSXA 4LJ6A 3EIHA 4M9XA 3DZDA 4NXNM 5KPRA 4NOOB 2MJ5B 2E5LM 1DGHA 2J5YA 1IFYA 2DHYA 4NSOB 4KHPM 1J09A 4MM3B 4X66M 4JI4M 1ZAEA 2DVWB 4FD2A 3H4JA 3GPPA 2L6OA 1OAOC 2O25A 2LVOC 4CHTB 3FUUA 4LRTA 2VIIA 3C9PA 5BPVA 4QNMA 2V6ZM 2QENA 4NC6A 2DHRA 2QSFX 4FCTA 4I5SA 2UUBM 3U6LA 1T43A 2RRUA 1MU5A 3GLIE 3SAVA 3T1YM 3U5ZB 1IN7A 3FTDA 2J7NA 3AOEC 4LRSA 2EUCA 3U6EA 3TWMA 1X37A 4JI7M 1SXJD 4IBEA 1DGBA 3J80S 3W0LB 1HQYE 1J7KA 2YNMD 3Q8GA 3M7GA 1LTMA 5GKNA 3AKZA 1W5TA 4DR2M 1TDHA 2KNZA 3RGSA 5ITRA 3U6MA 1D2NA 2DAKA 4JI2M 3PVSA 3GRVA 4NXMM 4P16A 4FCVA 3BBZA 1MN3A 3DFZA 1QQWA 4RNAA 1QYRA 2QBYA 3A46A 4GC5A 2R4EA 1R6BX 3GLGB 3HZJA 2CUZA 3W68A 2KZUA 4KO8A 4LFAM 3K9OA 5FTJA 3MK6A 4HL4A 1HNWM 3IG5A 4BB9A 2K47A 2W82A 3VDUA 2L4EA 1T6OA 2H5XA 2O5RA 2ZTDA 3WHLA 1E9RA 3PNYA 2LWXA 3FYCA 2JXNA 4WURA 3F92A 1YUBA 2JP7A 1QUSA 4DR4M 4LF6M 4OVZB 5A2QS 4MGZE 2ZANA 4IBCA 4Y28F 5FSWA 2LTUA 3FRHA 1YLAA 2DAGA 3SMPA 2ZAMA 4L8RC 1PJTA 1QZMA 1IN5A 2WSFF 4GIPA 2HAKA 1OJLA 1OTRA 4KLNA 5EJCA 1OFIA 1DO2A 3T1HM 4LF5M 1QAMA 3GPXA 2L4FA 2CWBA 3LVVA 3GLGA 1OIPA 5EXSA 1L1ZA 3K8ZA 1VDLA 5ITTA 2UXDM 2EJSA 3C3DA 1GL7A 3AFHA 3HJQA 1PGYA 4MB7A 3GQ4A 1G59A 3T15A 1SXJE 2ZTCA 2G5GX 2QBYB 3DA1A 1N75A 4OX9M 3VK7A 1IBMM 3I4YA 3SBJA 1XC8A 2C99A 3KP0E 1N32M 1N78A 2M5ZA 2J7OA 4G3OA 5DFLA 1L1TA 2F5SA 1R2ZA 4YY3M 2DWZB 1P3QQ 1EE8A 4Z8XA 2DWNA 3FUVA 1KSFX 3K9PA 3U60A 2HCBA 2DAEA 4ITQA 4GHLA 3KS4A 2QPAA 2D7HA 3GPYA 1IY1A 1OAIA 2WSCF 3GLFA 4GHAA 2G8LA 1WJ7A 1N34M 5DYIA 1IN6A 3HKPA 2CV0A 4JV5M 1HT2E 4R3DA 3QWLA 2KEBA 1QANA 3I51A 1WGLA 2CHVA 3HHWA 1Q02A 3B9PA 4LJ9A 3VKHA 1TR8A 2QHOB 2L2DA 3E46A 3TPZA 4JI0M 1EFUB 3AOEA 2LVPC 2FE8A 2CRUA 3JAMS 2KZSA 2AHMA 2XGNA 1L8QA 2Z3XA 4B3RM 1NO1A 3GLGE 5L8RF 2OO9A 3PNVA 3GLIA 3U60B 2F5NA 3R9XB 1TDZA 4AKGA 1C1KA 2YQZA 3I04M 2DAIA 4AKIA 2Y20A 2DI0A 4II7A 2UXCM 4NRWA 2QP9X 3BOSA 2MH8A 3PXGA 2Y21A 3LCUA 1GVNA 1ZQ9A 2XFSA 4RKUF 5EP3A 4LF7M 2P5TA 4B7HA 2R0IA 4NSRA 3HU2A 2K0BX 3HJ8A 3CF6E 5EXPA 1IXZA 4JXJA 5EP4A 2C9CA 4QHTA 3FKEA 4M0DA 1PJIA 3SYKA 4G4RA 1N36M 2ERCA 2I7PA 4LF8M 3KOWE 3NWLA 3HWSA 1WR1B 4GRIA 1L2BA 1QDTA 3A45A 3GLIB 1SG9A 2JY5A 4KT0F 1N77A 1XXHE 3MHVC 3SAUA 3U6OA 3DOAA 3L2AA 2HHHM 3ZH9B 4JI8M 3CGWA 3VDPA 2RGHA 4CGYB 4DV2M 2H1RA 4LJ7A 4JI5M 3J7AS 1ZMUA 2Z4RA 1L2CA 4LZZA 1Z5CA 2CEAA 3FTEA 4AW4A 2V1CA 4LJ5A 1UFZA 4LGMA 5H37D 3PFIA 3W0FA 5LMUM 1NHGC 4FWGA 5IREB 4REZA 3SHFA 8CATA 3LQQA 5EXTA 1HR0M 4GKKM 1JR3D 4HLQA 2D7GA 3SHGB 3TWKA 5FTMA 3HHZA 2CP8A 4LCBA 4LFBM 1OIZA 3FD9A 4BLCA 2OPFA 3JR4A 5EP2A 4X65M 1IN4A 2DXIA 4L15A 2KA6B 2Y0TA 1XNQM 4B7FA 3CTWB 4NL4H 3TWLA 1N33M 1G3IA 4MH0E 4QHSA 1BVSA 2F5OA 1VDDA 2KNAA 1NSFA 1GKIA 1E94E 2XZFA 2C5RA 4G6ZA 2FNAA 2CHGA 2F5PA 2R44A 2V1UA 2K6BA 3UJNA 3E4RA 2WSEF 4YHHM 4CJ6A 3KP1E 4IBFA 4AZFA 2XSZD 1AIPC 3HJSA 1SXJC 2DAMA 1V92A 1Y8GA 2VF7A 3C58A 2QQ8A 2CFOA 1IXRC 3LMMA 1D0KA 1XHBA 1FJGM 3EIEA 1TH2A 1ZMVA 1IQPA 3SC3A 3FUTA 3TL4X 3KOXE 4DR1M 2APLA 1OQYA 5C18A 3SAWA 3W67A 4GC9A 1D0LA 3TE6A 1E32A 1W5SA 3SFZA 3I4VA 5ITXA 1QDRA 1XXHA 1DGGA 2ZAOA 4MGHA 1QAOA 2L09A 5KPZA 2BJVA 1PJJA 1QVRA 5LMNM 4AG5A 1TGUA 3B74A 1IY0A 3K92A 2GNOA 2JNHA 4PD2A 4K0KM 1GLNA 1VEJA 4B3SM 1S3SA 3KVWA 1NY6A 4Z6YA 4AQYM 3LVWA 1A5TA 3LW5F 4LG2A 4L6V6 5FTLA 4LF9M 2RKOA 3GP1A 2KW0A 3E21A 2LXEA 2BWEA 3AOGA 4M9ZA 5IT9S 4FCWA 1K82A 4I81A 1TH3A 4MGYE 4IIWA 3VFDA 3KW6A 2XH9A 1EIJA 1OFHA 1V34A 5ITQA 2L7HA 3RE8A 2MR9A 4RF0A 4LGYA 5DYGA 3FE3A 4ZPXA 3WHKA 1R2YA 3GQ5A 4LF4M 2C98A 4GH9A 1C7YA 2JUJA 2QZ4A 1XNRM 1I4WA 1G4AE 3H4MA 4LJ8A 1H6UA 2LH0A 4DR3M 3U6CA 2HL7A 1AUAA 2MROB 2I7NA 3ZC7B 3NBXX 2YR0A 2CE7A 2KXEA 4IBBA 2LBCA 1T3TA 3UGJA 3J7BA 2JZ1A 2B3TA 4DV1M 1QZEA 2DZNB 3L27A 2VQEM 3L28A 3TQSA 4LY6A 4JI1M 4D81A 4LJ4A 3IECA 3K1JA 4LJAA 1G41A 4DBGB 3A42A 2QCUA 3ILKA 1D0MA 4L78A 1NJFA 1Z59A 4XBOA 3BXWA 3FUWA 1WIVA 3IHPA 4G4QA 3GLHE 7CATA 5JI3E 1LV7A 4IBGA 4BBAA 2LHCA 1ORYB 2FS1A 2YFQA 3KS8A 3KDSE 2EO2A 3GLHA 5ITXE 1MJGM 1GL6A 3GQ3A 2QNJA 2EKFA 1JR3E 4P17A 1JQJC 1VQ1A 5FLXS 1OKSA 1K3WA 3QYBA 4L4UA 1SXJA 3FTFA 3U61B 3V76A 1R4GA 5EXXA 4DV7M 4GEWA 4CISA 2OOAA 1YSYA 1G8PA 3CF0A 1CUKA 3L26A 2MGWA 4ANRA 1XB2B 4AG6A 1R7RA 4IBIA 1PRBA 3GRYA 2FFJA 5E6JA 2Y0QA 3M0EA 1Z5BA 4NRVA 2BJWA 4PDIA 4GITA 4DV5M 4DR6M 2RGOA 4W5WA 2EKKA 2LVQD 2XF3A 4IJEA 3HY5A 1VEGA 4B08A 2JZ0A 1KYIA 2VQFM 1GABA 3GLFB 3CF2A 1IBKM 2DZOB 5KQDA 4DV4M 1QAQA 2R4JA 4I8OA 1GO5A 3B7QA 1JR3A 3J81S 4G4OA 3HU3A 2R18A 3QYEA 4X64M 3T38A 1V33A 3J2PB 1GJTA 4OW0A 3QAUA 1PJSA 3GLHB 4LZJA 2OQ4A 3AV0A 1UM8A 2A5YB 2Q2EB 2LHGA 1HJPA 3B7NA 4R71A 2C9OA 2JA2A 1KFVA 4FVMA 3ZCBB 4MGKE 4GMQA 4X62M 4DV3M 3D8BA 4DV6M 1XMOM 4GKJM 1FNNA 2DNAA 1SXJB 3LQRA 2HKJA 2R6FA 2R46A 2BNKA 3KOYE 1PM5A 1NHWC 3GPUA 3FTCA 2DZLA 3SARA 1NVMA 2OOBA 5FTKA 3SMSA 3ZQJA 1F4IA 2CHQA 4UN2B 4AI6A 1Q3BA 2XFTA 4S12A 1MX0A 3HGIA 1IN8A 5KO3A 1NJGA 3RGPA 1GJSA 2C96A 3NBIA 4PT5A 1IY2A 1DGFA 2XLJA 1Q3CA 4R7GA 3U6PA 1IM2A 4LFCM 4B3MM 2L7IA 4PCZA 2JY7A 2CV2A 4QOZC 2BWBA 4QNRA 5KPTA 2ZM6M 2FOIC 2R62A 5IZ7D 3HHYA 3AJIB 3B7ZA 2K9DA
chains in the Genus database with same CATH topology
3SATA 1I94M 5C1BA 4TUWA 2X8AA 2ZBKB 3KXEC 4XGIA 5EP1A 4IJFA 4EIWA 3GRUA 4KODA 4I4LA 4D80A 4JN6A 3JR5A 5FTNA 1IBLM 2DWLA 1XMQM 1DGHB 4AKHA 2XZUA 3D8LA 4DR7M 1Z5AA 2F5QA 4DUZM 3L25A 4FWDA 2Z7JA 2R65A 4B3TM 2F4VM 2KRKA 3UZUA 2EA0A 2LNHC 1HT1E 3U61A 1TH4A 2UUAM 3AL0C 1L2DA 1NY5A 4WW0A 4OU7A 3UMMA 1DO0A 3U6QA 5ITUA 1K3XA 3L29A 3SYLA 4FW9A 3OTOM 3VK8A 2D7EA 2R45A 5IWAM 2XSZA 2UUCM 4D82A 3MJ5A 4L16A 1WXQA 5F3WA 1XXHB 3GRRA 3A98B 2Z4SA 4JI3M 2X4AA 1IXSB 3K2LA 3VKGA 4RF1A 4FWHA 3RFWA 4MGIE 4DUYM 1Q39A 3U6SA 4B7GA 2UU9M 5EQTA 1XWIA 1NNUC 3HU1A 3KFUG 3E9SA 3J27B 1HNXM 2CV1A 4G4NA 4OVZA 5BR8M 3SASA 4JI6M 1HNZM 2X49A 5JI2E 3KSJA 5KQ8A 3FUXA 4M0WA 3HHXA 1E9SA 4A3VB 5E26A 5DNYA 3GO8A 3U5ZA 1YE9A 3FYDA 3M6AA 4IBJA 4M9SA 3UK6A 4JYAM 5ITYA 3R8FA 4IBKA 1J5EM 2XEPA 4DR5M 4DV0M 2DWMA 4QOSA 1Z6TA 3THGA 3VLFB 4IBDA 3KOZE 1HQCA 2M60A 4PDGA 2NQ8C 1NNJA 2UXBM 3U6DA 3Q8XA 3IG8A 2KRUA 3KSXA 4LJ6A 3EIHA 4M9XA 3DZDA 4NXNM 5KPRA 4NOOB 2E5LM 1DGHA 4NSOB 4KHPM 1J09A 4MM3B 4X66M 4JI4M 1ZAEA 2DVWB 4FD2A 3GPPA 2L6OA 4CHTB 3FUUA 4LRTA 2VIIA 5BPVA 4QNMA 2V6ZM 2QENA 2DHRA 4I5SA 4FCTA 2UUBM 3U6LA 3T1YM 3U5ZB 1MU5A 3SAVA 1IN7A 3FTDA 3AOEC 2J7NA 4LRSA 2EUCA 3U6EA 3TWMA 1X37A 4JI7M 1SXJD 4IBEA 1DGBA 3J80S 3W0LB 1HQYE 1J7KA 2YNMD 3M7GA 5GKNA 3AKZA 1W5TA 4DR2M 1TDHA 3RGSA 5ITRA 3U6MA 1D2NA 4JI2M 3PVSA 3GRVA 4NXMM 4P16A 4FCVA 3DFZA 1QQWA 4RNAA 1QYRA 2QBYA 3A46A 4GC5A 2R4EA 1R6BX 3GLGB 2CUZA 2KZUA 4KO8A 4LFAM 5FTJA 3MK6A 4HL4A 1HNWM 3IG5A 4BB9A 2K47A 2W82A 3VDUA 2O5RA 3WHLA 1E9RA 3PNYA 2LWXA 3FYCA 4WURA 1YUBA 4DR4M 4LF6M 4OVZB 5A2QS 4MGZE 2ZANA 4IBCA 5FSWA 3SMPA 2ZAMA 4L8RC 1QZMA 1IN5A 4GIPA 1OJLA 4KLNA 5EJCA 1OFIA 1DO2A 3T1HM 4LF5M 1QAMA 3GPXA 3LVVA 3GLGA 5EXSA 1L1ZA 3K8ZA 5ITTA 2UXDM 1GL7A 3AFHA 3HJQA 4MB7A 3GQ4A 1G59A 3T15A 1SXJE 2G5GX 2QBYB 3DA1A 1N75A 4OX9M 3VK7A 1IBMM 3I4YA 3SBJA 1XC8A 2C99A 3KP0E 1N32M 1N78A 2M5ZA 2J7OA 1L1TA 2F5SA 1R2ZA 4YY3M 2DWZB 1EE8A 4Z8XA 2DWNA 3FUVA 1KSFX 3U60A 2HCBA 4ITQA 4GHLA 3KS4A 2QPAA 2D7HA 3GPYA 1IY1A 3GLFA 4GHAA 2G8LA 1N34M 5DYIA 1IN6A 3HKPA 2CV0A 4JV5M 1HT2E 4R3DA 3QWLA 2KEBA 1QANA 3I51A 2CHVA 3HHWA 4LJ9A 3B9PA 3VKHA 3TPZA 4JI0M 3AOEA 2FE8A 3JAMS 2KZSA 2AHMA 2XGNA 1L8QA 2Z3XA 4B3RM 3U60B 3GLIA 3R9XB 4AKGA 3PNVA 2F5NA 1TDZA 1C1KA 2YQZA 4AKIA 2Y20A 4II7A 2UXCM 4NRWA 2QP9X 3BOSA 3PXGA 2Y21A 1GVNA 1ZQ9A 2XFSA 5EP3A 4LF7M 2P5TA 4B7HA 4NSRA 3HU2A 3HJ8A 3CF6E 5EXPA 1IXZA 4JXJA 5EP4A 2C9CA 4QHTA 3FKEA 4M0DA 1PJIA 3SYKA 4G4RA 1N36M 2ERCA 2I7PA 4LF8M 3KOWE 3NWLA 3HWSA 4GRIA 1L2BA 3A45A 3GLIB 1N77A 3MHVC 3SAUA 3U6OA 3DOAA 3L2AA 2HHHM 3ZH9B 4JI8M 3VDPA 2RGHA 4CGYB 4DV2M 2H1RA 4LJ7A 4JI5M 3J7AS 2Z4RA 1L2CA 4LZZA 1Z5CA 2CEAA 3FTEA 4AW4A 2V1CA 4LJ5A 4LGMA 5H37D 3PFIA 3W0FA 5LMUM 1NHGC 4FWGA 5IREB 4REZA 3SHFA 8CATA 3LQQA 5EXTA 1HR0M 4GKKM 1JR3D 4HLQA 2D7GA 3SHGB 3TWKA 5FTMA 3HHZA 4LCBA 4LFBM 3FD9A 4BLCA 2OPFA 3JR4A 5EP2A 4X65M 1IN4A 2DXIA 4L15A 2KA6B 2Y0TA 1XNQM 4B7FA 3CTWB 4NL4H 3TWLA 1N33M 1G3IA 4MH0E 4QHSA 2F5OA 1VDDA 1NSFA 1GKIA 1E94E 2XZFA 2C5RA 4G6ZA 2FNAA 2CHGA 2F5PA 2V1UA 3UJNA 3E4RA 4YHHM 3KP1E 4IBFA 4AZFA 2XSZD 3HJSA 1SXJC 3C58A 2CFOA 3LMMA 1XHBA 1FJGM 3EIEA 1TH2A 1IQPA 3SC3A 3FUTA 3TL4X 3KOXE 4DR1M 3SAWA 5C18A 4GC9A 3TE6A 1E32A 1W5SA 3SFZA 3I4VA 5ITXA 4MGHA 1XXHA 1DGGA 2ZAOA 1QAOA 2L09A 5KPZA 2BJVA 1PJJA 1QVRA 5LMNM 4AG5A 1TGUA 1IY0A 3K92A 4PD2A 4K0KM 1GLNA 4B3SM 1S3SA 3KVWA 1NY6A 4Z6YA 4AQYM 3LVWA 4LG2A 5FTLA 4LF9M 2RKOA 3GP1A 2KW0A 4M9ZA 2LXEA 3AOGA 5IT9S 4FCWA 1K82A 4I81A 1TH3A 4MGYE 4IIWA 3VFDA 3KW6A 2XH9A 1OFHA 5ITQA 2L7HA 3RE8A 4RF0A 4LGYA 5DYGA 4ZPXA 3WHKA 1R2YA 3GQ5A 4LF4M 2C98A 4GH9A 2QZ4A 1XNRM 1I4WA 1G4AE 3H4MA 4LJ8A 1H6UA 2LH0A 4DR3M 3U6CA 2HL7A 2I7NA 3ZC7B 2YR0A 2CE7A 2KXEA 4IBBA 1T3TA 3UGJA 3J7BA 4DV1M 2DZNB 3L27A 2VQEM 3L28A 3TQSA 4LY6A 4JI1M 4D81A 4LJ4A 3K1JA 4LJAA 1G41A 3A42A 2QCUA 3ILKA 4L78A 1NJFA 1Z59A 4XBOA 3FUWA 4G4QA 7CATA 5JI3E 1LV7A 4IBGA 4BBAA 1ORYB 2YFQA 3KS8A 3KDSE 2EO2A 3GLHA 5ITXE 1GL6A 3GQ3A 1K3WA 1JQJC 5FLXS 4L4UA 1SXJA 3FTFA 3U61B 5EXXA 4DV7M 4CISA 1YSYA 1G8PA 3CF0A 3L26A 4AG6A 1R7RA 4IBIA 3GRYA 2FFJA 5E6JA 2Y0QA 3M0EA 1Z5BA 4NRVA 2BJWA 4PDIA 4GITA 4DV5M 4DR6M 2RGOA 4W5WA 2XF3A 4IJEA 4B08A 1KYIA 2VQFM 3GLFB 3CF2A 1IBKM 2DZOB 5KQDA 4DV4M 1QAQA 2R4JA 4I8OA 1JR3A 3J81S 4G4OA 3HU3A 2R18A 4X64M 3T38A 3J2PB 4OW0A 3QAUA 3GLHB 4LZJA 2OQ4A 3AV0A 1UM8A 2A5YB 2Q2EB 2C9OA 2JA2A 1KFVA 4FVMA 3ZCBB 4MGKE 4GMQA 4X62M 4DV3M 3D8BA 4DV6M 1XMOM 4GKJM 1FNNA 1SXJB 3LQRA 2HKJA 2R46A 2BNKA 3KOYE 1PM5A 1NHWC 3GPUA 3FTCA 3SARA 1NVMA 5FTKA 3SMSA 2CHQA 4AI6A 1Q3BA 2XFTA 4S12A 1MX0A 3HGIA 1IN8A 5KO3A 1NJGA 3RGPA 2C96A 3NBIA 4PT5A 1IY2A 1DGFA 2XLJA 1Q3CA 4R7GA 3U6PA 1IM2A 4LFCM 4B3MM 2L7IA 4PCZA 2CV2A 4QOZC 4QNRA 5KPTA 2ZM6M 2FOIC 2R62A 5IZ7D 3HHYA 3AJIB 1IXRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAT A;  4LF7 M;  1I94 M;  3U6E A;  3TWM A;  4JI7 M;  2ZBK B;  1XNR M;  3J80 S;  4DR3 M;  3U6C A;  4DR2 M;  4DV1 M;  3JR5 A;  1TDH A;  4G4R A;  1PJI A;  5ITR A;  1N36 M;  1IBL M;  4LF8 M;  3U6M A;  1XMQ M;  2XZU A;  2VQE M;  1L2B A;  4DR7 M;  4JI2 M;  1Z5A A;  2F5Q A;  4DUZ M;  4JI1 M;  3A45 A;  4B3T M;  4NXM M;  2F4V M;  3A42 A;  3SAU A;  2EA0 A;  3U6O A;  3DOA A;  2HHH M;  4JI8 M;  1Z59 A;  3A46 A;  4DV2 M;  4G4Q A;  2UUA M;  4JI5 M;  1L2D A;  3J7A S;  4LFA M;  1K3X A;  3U6Q A;  1L2C A;  5ITU A;  1Z5C A;  1HNW M;  5ITX E;  3OTO M;  3VK8 A;  3W0F A;  5LMU M;  5IWA M;  2UUC M;  3GQ3 A;  1HR0 M;  1K3W A;  4GKK M;  5FLX S;  3TWK A;  4LFB M;  4DR4 M;  2OPF A;  3JR4 A;  4LF6 M;  5A2Q S;  4DV7 M;  4X65 M;  4CIS A;  4JI3 M;  1XNQ M;  4DUY M;  1Q39 A;  3U6S A;  2UU9 M;  3T1H M;  3TWL A;  4LF5 M;  1N33 M;  2F5O A;  3GPX A;  1HNX M;  1Z5B A;  4NRV A;  5BR8 M;  4G4N A;  4PDI A;  4DV5 M;  3SAS A;  4JI6 M;  2XZF A;  1L1Z A;  1HNZ M;  4DR6 M;  5ITT A;  2UXD M;  2F5P A;  2VQF M;  4YHH M;  4MB7 A;  3GQ4 A;  1IBK M;  4DV4 M;  3GO8 A;  3C58 A;  4OX9 M;  3VK7 A;  3J81 S;  4G4O A;  1IBM M;  3SBJ A;  1XC8 A;  4X64 M;  4JYA M;  1N32 M;  1L1T A;  5ITY A;  2F5S A;  1FJG M;  1R2Z A;  4YY3 M;  2OQ4 A;  1J5E M;  4DR5 M;  1EE8 A;  4DR1 M;  4DV0 M;  2Q2E B;  3SAW A;  4ITQ A;  5ITX A;  1KFV A;  4PDG A;  3GPY A;  4X62 M;  4DV3 M;  1XMO M;  4DV6 M;  4GKJ M;  1NNJ A;  2UXB M;  1PJJ A;  3U6D A;  5LMN M;  2HKJ A;  1N34 M;  4JV5 M;  4NXN M;  4PD2 A;  1PM5 A;  4K0K M;  2E5L M;  3GPU A;  4B3S M;  4AQY M;  3SAR A;  4KHP M;  4JI0 M;  4X66 M;  4JI4 M;  4LF9 M;  1Q3B A;  3GP1 A;  1MX0 A;  3GPP A;  3JAM S;  5IT9 S;  1K82 A;  4B3R M;  2F5N A;  1TDZ A;  1Q3C A;  5ITQ A;  3U6P A;  4LFC M;  4B3M M;  4PCZ A;  2UUB M;  2UXC M;  3U6L A;  2ZM6 M;  3T1Y M;  1MU5 A;  4NRW A;  3SAV A;  1R2Y A;  3GQ5 A;  4LF4 M; 
#chains in the Genus database with same CATH topology
 3SAT A;  1I94 M;  5C1B A;  3I01 M;  4TUW A;  2Z8Y M;  2X8A A;  2ZBK B;  3KXE C;  4XGI A;  5EP1 A;  3T6P A;  4F2L A;  2KHH A;  4IJF A;  4EIW A;  3GRU A;  4KOD A;  2DKL A;  4WP2 A;  2LVA A;  4I4L A;  4D80 A;  1WGN A;  2JY8 A;  4JN6 A;  3HX3 A;  3JR5 A;  2DEN A;  5FTN A;  1IBL M;  2DWL A;  1XMQ M;  1DGH B;  4Q7J A;  4CIZ A;  3D8L A;  2XZU A;  4DR7 M;  2GQF A;  4AKH A;  1Z5A A;  2F5Q A;  4DUZ M;  3L25 A;  4FWD A;  2Z7J A;  2R65 A;  4B3T M;  2F4V M;  1DV0 A;  2KRK A;  3UZU A;  2EA0 A;  2LNH C;  1IXS A;  1G71 A;  1HT1 E;  2JWS A;  1TH4 A;  3U61 A;  2UUA M;  3AL0 C;  1L2D A;  1NY5 A;  4WW0 A;  4OU7 A;  2KDL A;  3GLF E;  3UMM A;  1DO0 A;  3U6Q A;  5ITU A;  1K3X A;  3L29 A;  3SYL A;  4FW9 A;  3OTO M;  3VK8 A;  2D7E A;  2R45 A;  1QUT A;  5IWA M;  2XSZ A;  2UUC M;  3B89 A;  4D82 A;  3MJ5 A;  1ZV1 A;  2VF8 A;  4L16 A;  1WXQ A;  2LVN C;  3FRI A;  5F3W A;  1XXH B;  3GRR A;  3A98 B;  2Z4S A;  4JI3 M;  2KNV A;  1IXS B;  1ZMW A;  2VDB B;  2X4A A;  3K2L A;  4RF1 A;  1VG5 A;  3VKG A;  4FWH A;  1R5L A;  2N35 A;  3RFW A;  4MGI E;  4DUY M;  1Q39 A;  4XK8 F;  3U6S A;  4B7G A;  2UU9 M;  5EQT A;  1XWI A;  1NNU C;  3HU1 A;  3LCV B;  3E9S A;  3KFU G;  3J27 B;  1HNX M;  2CV1 A;  4G4N A;  4OVZ A;  5BR8 M;  3SAS A;  4JI6 M;  2O01 F;  1HNZ M;  2X49 A;  2JY6 B;  5JI2 E;  3KSJ A;  2WZJ A;  5KQ8 A;  3FUX A;  4M0W A;  3HHX A;  1E9S A;  4A3V B;  1WHC A;  5E26 A;  1TF0 B;  5DNY A;  3GO8 A;  3U5Z A;  1YE9 A;  3FYD A;  3M6A A;  1NV9 A;  4IBJ A;  2FH0 A;  4M9S A;  3UK6 A;  4JYA M;  5ITY A;  3R8F A;  4IBK A;  1J5E M;  2XEP A;  4DR5 M;  1RU3 A;  3C3E A;  1VEK A;  2HWJ A;  4DV0 M;  1TTE A;  4QOS A;  2DWM A;  1Z6T A;  2G3Q A;  3THG A;  3VLF B;  3MMP A;  4IBD A;  3KOZ E;  1HQC A;  1PJQ A;  2M60 A;  4F1I A;  4PDG A;  1JB0 F;  2NQ8 C;  4HEO A;  1NNJ A;  2UXB M;  3U6D A;  3Q8X A;  3IG8 A;  1NV8 A;  2KRU A;  3KSX A;  4LJ6 A;  3EIH A;  4M9X A;  3DZD A;  4NXN M;  5KPR A;  4NOO B;  2MJ5 B;  2E5L M;  1DGH A;  2J5Y A;  1IFY A;  2DHY A;  4NSO B;  4KHP M;  1J09 A;  4MM3 B;  4X66 M;  4JI4 M;  1ZAE A;  2DVW B;  4FD2 A;  3H4J A;  3GPP A;  2L6O A;  1OAO C;  2O25 A;  2LVO C;  4CHT B;  3FUU A;  4LRT A;  2VII A;  3C9P A;  5BPV A;  4QNM A;  2V6Z M;  2QEN A;  4NC6 A;  2DHR A;  2QSF X;  4FCT A;  4I5S A;  2UUB M;  3U6L A;  1T43 A;  2RRU A;  1MU5 A;  3GLI E;  3SAV A;  3T1Y M;  3U5Z B;  1IN7 A;  3FTD A;  2J7N A;  3AOE C;  4LRS A;  2EUC A;  3U6E A;  3TWM A;  1X37 A;  4JI7 M;  1SXJ D;  4IBE A;  1DGB A;  3J80 S;  3W0L B;  1HQY E;  1J7K A;  2YNM D;  3Q8G A;  3M7G A;  1LTM A;  5GKN A;  3AKZ A;  1W5T A;  4DR2 M;  1TDH A;  2KNZ A;  3RGS A;  5ITR A;  3U6M A;  1D2N A;  2DAK A;  4JI2 M;  3PVS A;  3GRV A;  4NXM M;  4P16 A;  4FCV A;  3BBZ A;  1MN3 A;  3DFZ A;  1QQW A;  4RNA A;  1QYR A;  2QBY A;  3A46 A;  4GC5 A;  2R4E A;  1R6B X;  3GLG B;  3HZJ A;  2CUZ A;  3W68 A;  2KZU A;  4KO8 A;  4LFA M;  3K9O A;  5FTJ A;  3MK6 A;  4HL4 A;  1HNW M;  3IG5 A;  4BB9 A;  2K47 A;  2W82 A;  3VDU A;  2L4E A;  1T6O A;  2H5X A;  2O5R A;  2ZTD A;  3WHL A;  1E9R A;  3PNY A;  2LWX A;  3FYC A;  2JXN A;  4WUR A;  3F92 A;  1YUB A;  2JP7 A;  1QUS A;  4DR4 M;  4LF6 M;  4OVZ B;  5A2Q S;  4MGZ E;  2ZAN A;  4IBC A;  4Y28 F;  5FSW A;  2LTU A;  3FRH A;  1YLA A;  2DAG A;  3SMP A;  2ZAM A;  4L8R C;  1PJT A;  1QZM A;  1IN5 A;  2WSF F;  4GIP A;  2HAK A;  1OJL A;  1OTR A;  4KLN A;  5EJC A;  1OFI A;  1DO2 A;  3T1H M;  4LF5 M;  1QAM A;  3GPX A;  2L4F A;  2CWB A;  3LVV A;  3GLG A;  1OIP A;  5EXS A;  1L1Z A;  3K8Z A;  1VDL A;  5ITT A;  2UXD M;  2EJS A;  3C3D A;  1GL7 A;  3AFH A;  3HJQ A;  1PGY A;  4MB7 A;  3GQ4 A;  1G59 A;  3T15 A;  1SXJ E;  2ZTC A;  2G5G X;  2QBY B;  3DA1 A;  1N75 A;  4OX9 M;  3VK7 A;  1IBM M;  3I4Y A;  3SBJ A;  1XC8 A;  2C99 A;  3KP0 E;  1N32 M;  1N78 A;  2M5Z A;  2J7O A;  4G3O A;  5DFL A;  1L1T A;  2F5S A;  1R2Z A;  4YY3 M;  2DWZ B;  1P3Q Q;  1EE8 A;  4Z8X A;  2DWN A;  3FUV A;  1KSF X;  3K9P A;  3U60 A;  2HCB A;  2DAE A;  4ITQ A;  4GHL A;  3KS4 A;  2QPA A;  2D7H A;  3GPY A;  1IY1 A;  1OAI A;  2WSC F;  3GLF A;  4GHA A;  2G8L A;  1WJ7 A;  1N34 M;  5DYI A;  1IN6 A;  3HKP A;  2CV0 A;  4JV5 M;  1HT2 E;  4R3D A;  3QWL A;  2KEB A;  1QAN A;  3I51 A;  1WGL A;  2CHV A;  3HHW A;  1Q02 A;  3B9P A;  4LJ9 A;  3VKH A;  1TR8 A;  2QHO B;  2L2D A;  3E46 A;  3TPZ A;  4JI0 M;  1EFU B;  3AOE A;  2LVP C;  2FE8 A;  2CRU A;  3JAM S;  2KZS A;  2AHM A;  2XGN A;  1L8Q A;  2Z3X A;  4B3R M;  1NO1 A;  3GLG E;  5L8R F;  2OO9 A;  3PNV A;  3GLI A;  3U60 B;  2F5N A;  3R9X B;  1TDZ A;  4AKG A;  1C1K A;  2YQZ A;  3I04 M;  2DAI A;  4AKI A;  2Y20 A;  2DI0 A;  4II7 A;  2UXC M;  4NRW A;  2QP9 X;  3BOS A;  2MH8 A;  3PXG A;  2Y21 A;  3LCU A;  1GVN A;  1ZQ9 A;  2XFS A;  4RKU F;  5EP3 A;  4LF7 M;  2P5T A;  4B7H A;  2R0I A;  4NSR A;  3HU2 A;  2K0B X;  3HJ8 A;  3CF6 E;  5EXP A;  1IXZ A;  4JXJ A;  5EP4 A;  2C9C A;  4QHT A;  3FKE A;  4M0D A;  1PJI A;  3SYK A;  4G4R A;  1N36 M;  2ERC A;  2I7P A;  4LF8 M;  3KOW E;  3NWL A;  3HWS A;  1WR1 B;  4GRI A;  1L2B A;  1QDT A;  3A45 A;  3GLI B;  1SG9 A;  2JY5 A;  4KT0 F;  1N77 A;  1XXH E;  3MHV C;  3SAU A;  3U6O A;  3DOA A;  3L2A A;  2HHH M;  3ZH9 B;  4JI8 M;  3CGW A;  3VDP A;  2RGH A;  4CGY B;  4DV2 M;  2H1R A;  4LJ7 A;  4JI5 M;  3J7A S;  1ZMU A;  2Z4R A;  1L2C A;  4LZZ A;  1Z5C A;  2CEA A;  3FTE A;  4AW4 A;  2V1C A;  4LJ5 A;  1UFZ A;  4LGM A;  5H37 D;  3PFI A;  3W0F A;  5LMU M;  1NHG C;  4FWG A;  5IRE B;  4REZ A;  3SHF A;  8CAT A;  3LQQ A;  5EXT A;  1HR0 M;  4GKK M;  1JR3 D;  4HLQ A;  2D7G A;  3SHG B;  3TWK A;  5FTM A;  3HHZ A;  2CP8 A;  4LCB A;  4LFB M;  1OIZ A;  3FD9 A;  4BLC A;  2OPF A;  3JR4 A;  5EP2 A;  4X65 M;  1IN4 A;  2DXI A;  4L15 A;  2KA6 B;  2Y0T A;  1XNQ M;  4B7F A;  3CTW B;  4NL4 H;  3TWL A;  1N33 M;  1G3I A;  4MH0 E;  4QHS A;  1BVS A;  2F5O A;  1VDD A;  2KNA A;  1NSF A;  1GKI A;  1E94 E;  2XZF A;  2C5R A;  4G6Z A;  2FNA A;  2CHG A;  2F5P A;  2R44 A;  2V1U A;  2K6B A;  3UJN A;  3E4R A;  2WSE F;  4YHH M;  4CJ6 A;  3KP1 E;  4IBF A;  4AZF A;  2XSZ D;  1AIP C;  3HJS A;  1SXJ C;  2DAM A;  1V92 A;  1Y8G A;  2VF7 A;  3C58 A;  2QQ8 A;  2CFO A;  1IXR C;  3LMM A;  1D0K A;  1XHB A;  1FJG M;  3EIE A;  1TH2 A;  1ZMV A;  1IQP A;  3SC3 A;  3FUT A;  3TL4 X;  3KOX E;  4DR1 M;  2APL A;  1OQY A;  5C18 A;  3SAW A;  3W67 A;  4GC9 A;  1D0L A;  3TE6 A;  1E32 A;  1W5S A;  3SFZ A;  3I4V A;  5ITX A;  1QDR A;  1XXH A;  1DGG A;  2ZAO A;  4MGH A;  1QAO A;  2L09 A;  5KPZ A;  2BJV A;  1PJJ A;  1QVR A;  5LMN M;  4AG5 A;  1TGU A;  3B74 A;  1IY0 A;  3K92 A;  2GNO A;  2JNH A;  4PD2 A;  4K0K M;  1GLN A;  1VEJ A;  4B3S M;  1S3S A;  3KVW A;  1NY6 A;  4Z6Y A;  4AQY M;  3LVW A;  1A5T A;  3LW5 F;  4LG2 A;  4L6V 6;  5FTL A;  4LF9 M;  2RKO A;  3GP1 A;  2KW0 A;  3E21 A;  2LXE A;  2BWE A;  3AOG A;  4M9Z A;  5IT9 S;  4FCW A;  1K82 A;  4I81 A;  1TH3 A;  4MGY E;  4IIW A;  3VFD A;  3KW6 A;  2XH9 A;  1EIJ A;  1OFH A;  1V34 A;  5ITQ A;  2L7H A;  3RE8 A;  2MR9 A;  4RF0 A;  4LGY A;  5DYG A;  3FE3 A;  4ZPX A;  3WHK A;  1R2Y A;  3GQ5 A;  4LF4 M;  2C98 A;  4GH9 A;  1C7Y A;  2JUJ A;  2QZ4 A;  1XNR M;  1I4W A;  1G4A E;  3H4M A;  4LJ8 A;  1H6U A;  2LH0 A;  4DR3 M;  3U6C A;  2HL7 A;  1AUA A;  2MRO B;  2I7N A;  3ZC7 B;  3NBX X;  2YR0 A;  2CE7 A;  2KXE A;  4IBB A;  2LBC A;  1T3T A;  3UGJ A;  3J7B A;  2JZ1 A;  2B3T A;  4DV1 M;  1QZE A;  2DZN B;  3L27 A;  2VQE M;  3L28 A;  3TQS A;  4LY6 A;  4JI1 M;  4D81 A;  4LJ4 A;  3IEC A;  3K1J A;  4LJA A;  1G41 A;  4DBG B;  3A42 A;  2QCU A;  3ILK A;  1D0M A;  4L78 A;  1NJF A;  1Z59 A;  4XBO A;  3BXW A;  3FUW A;  1WIV A;  3IHP A;  4G4Q A;  3GLH E;  7CAT A;  5JI3 E;  1LV7 A;  4IBG A;  4BBA A;  2LHC A;  1ORY B;  2FS1 A;  2YFQ A;  3KS8 A;  3KDS E;  2EO2 A;  3GLH A;  5ITX E;  1MJG M;  1GL6 A;  3GQ3 A;  2QNJ A;  2EKF A;  1JR3 E;  4P17 A;  1JQJ C;  1VQ1 A;  5FLX S;  1OKS A;  1K3W A;  3QYB A;  4L4U A;  1SXJ A;  3FTF A;  3U61 B;  3V76 A;  1R4G A;  5EXX A;  4DV7 M;  4GEW A;  4CIS A;  2OOA A;  1YSY A;  1G8P A;  3CF0 A;  1CUK A;  3L26 A;  2MGW A;  4ANR A;  1XB2 B;  4AG6 A;  1R7R A;  4IBI A;  1PRB A;  3GRY A;  2FFJ A;  5E6J A;  2Y0Q A;  3M0E A;  1Z5B A;  4NRV A;  2BJW A;  4PDI A;  4GIT A;  4DV5 M;  4DR6 M;  2RGO A;  4W5W A;  2EKK A;  2LVQ D;  2XF3 A;  4IJE A;  3HY5 A;  1VEG A;  4B08 A;  2JZ0 A;  1KYI A;  2VQF M;  1GAB A;  3GLF B;  3CF2 A;  1IBK M;  2DZO B;  5KQD A;  4DV4 M;  1QAQ A;  2R4J A;  4I8O A;  1GO5 A;  3B7Q A;  1JR3 A;  3J81 S;  4G4O A;  3HU3 A;  2R18 A;  3QYE A;  4X64 M;  3T38 A;  1V33 A;  3J2P B;  1GJT A;  4OW0 A;  3QAU A;  1PJS A;  3GLH B;  4LZJ A;  2OQ4 A;  3AV0 A;  1UM8 A;  2A5Y B;  2Q2E B;  2LHG A;  1HJP A;  3B7N A;  4R71 A;  2C9O A;  2JA2 A;  1KFV A;  4FVM A;  3ZCB B;  4MGK E;  4GMQ A;  4X62 M;  4DV3 M;  3D8B A;  4DV6 M;  1XMO M;  4GKJ M;  1FNN A;  2DNA A;  1SXJ B;  3LQR A;  2HKJ A;  2R6F A;  2R46 A;  2BNK A;  3KOY E;  1PM5 A;  1NHW C;  3GPU A;  3FTC A;  2DZL A;  3SAR A;  1NVM A;  2OOB A;  5FTK A;  3SMS A;  3ZQJ A;  1F4I A;  2CHQ A;  4UN2 B;  4AI6 A;  1Q3B A;  2XFT A;  4S12 A;  1MX0 A;  3HGI A;  1IN8 A;  5KO3 A;  1NJG A;  3RGP A;  1GJS A;  2C96 A;  3NBI A;  4PT5 A;  1IY2 A;  1DGF A;  2XLJ A;  1Q3C A;  4R7G A;  3U6P A;  1IM2 A;  4LFC M;  4B3M M;  2L7I A;  4PCZ A;  2JY7 A;  2CV2 A;  4QOZ C;  2BWB A;  4QNR A;  5KPT A;  2ZM6 M;  2FOI C;  2R62 A;  5IZ7 D;  3HHY A;  3AJI B;  3B7Z A;  2K9D A; 
#chains in the Genus database with same CATH homology
 3SAT A;  1I94 M;  5C1B A;  4TUW A;  2X8A A;  2ZBK B;  3KXE C;  4XGI A;  5EP1 A;  4IJF A;  4EIW A;  3GRU A;  4KOD A;  4I4L A;  4D80 A;  4JN6 A;  3JR5 A;  5FTN A;  1IBL M;  2DWL A;  1XMQ M;  1DGH B;  4AKH A;  2XZU A;  3D8L A;  4DR7 M;  1Z5A A;  2F5Q A;  4DUZ M;  3L25 A;  4FWD A;  2Z7J A;  2R65 A;  4B3T M;  2F4V M;  2KRK A;  3UZU A;  2EA0 A;  2LNH C;  1HT1 E;  3U61 A;  1TH4 A;  2UUA M;  3AL0 C;  1L2D A;  1NY5 A;  4WW0 A;  4OU7 A;  3UMM A;  1DO0 A;  3U6Q A;  5ITU A;  1K3X A;  3L29 A;  3SYL A;  4FW9 A;  3OTO M;  3VK8 A;  2D7E A;  2R45 A;  5IWA M;  2XSZ A;  2UUC M;  4D82 A;  3MJ5 A;  4L16 A;  1WXQ A;  5F3W A;  1XXH B;  3GRR A;  3A98 B;  2Z4S A;  4JI3 M;  2X4A A;  1IXS B;  3K2L A;  3VKG A;  4RF1 A;  4FWH A;  3RFW A;  4MGI E;  4DUY M;  1Q39 A;  3U6S A;  4B7G A;  2UU9 M;  5EQT A;  1XWI A;  1NNU C;  3HU1 A;  3KFU G;  3E9S A;  3J27 B;  1HNX M;  2CV1 A;  4G4N A;  4OVZ A;  5BR8 M;  3SAS A;  4JI6 M;  1HNZ M;  2X49 A;  5JI2 E;  3KSJ A;  5KQ8 A;  3FUX A;  4M0W A;  3HHX A;  1E9S A;  4A3V B;  5E26 A;  5DNY A;  3GO8 A;  3U5Z A;  1YE9 A;  3FYD A;  3M6A A;  4IBJ A;  4M9S A;  3UK6 A;  4JYA M;  5ITY A;  3R8F A;  4IBK A;  1J5E M;  2XEP A;  4DR5 M;  4DV0 M;  2DWM A;  4QOS A;  1Z6T A;  3THG A;  3VLF B;  4IBD A;  3KOZ E;  1HQC A;  2M60 A;  4PDG A;  2NQ8 C;  1NNJ A;  2UXB M;  3U6D A;  3Q8X A;  3IG8 A;  2KRU A;  3KSX A;  4LJ6 A;  3EIH A;  4M9X A;  3DZD A;  4NXN M;  5KPR A;  4NOO B;  2E5L M;  1DGH A;  4NSO B;  4KHP M;  1J09 A;  4MM3 B;  4X66 M;  4JI4 M;  1ZAE A;  2DVW B;  4FD2 A;  3GPP A;  2L6O A;  4CHT B;  3FUU A;  4LRT A;  2VII A;  5BPV A;  4QNM A;  2V6Z M;  2QEN A;  2DHR A;  4I5S A;  4FCT A;  2UUB M;  3U6L A;  3T1Y M;  3U5Z B;  1MU5 A;  3SAV A;  1IN7 A;  3FTD A;  3AOE C;  2J7N A;  4LRS A;  2EUC A;  3U6E A;  3TWM A;  1X37 A;  4JI7 M;  1SXJ D;  4IBE A;  1DGB A;  3J80 S;  3W0L B;  1HQY E;  1J7K A;  2YNM D;  3M7G A;  5GKN A;  3AKZ A;  1W5T A;  4DR2 M;  1TDH A;  3RGS A;  5ITR A;  3U6M A;  1D2N A;  4JI2 M;  3PVS A;  3GRV A;  4NXM M;  4P16 A;  4FCV A;  3DFZ A;  1QQW A;  4RNA A;  1QYR A;  2QBY A;  3A46 A;  4GC5 A;  2R4E A;  1R6B X;  3GLG B;  2CUZ A;  2KZU A;  4KO8 A;  4LFA M;  5FTJ A;  3MK6 A;  4HL4 A;  1HNW M;  3IG5 A;  4BB9 A;  2K47 A;  2W82 A;  3VDU A;  2O5R A;  3WHL A;  1E9R A;  3PNY A;  2LWX A;  3FYC A;  4WUR A;  1YUB A;  4DR4 M;  4LF6 M;  4OVZ B;  5A2Q S;  4MGZ E;  2ZAN A;  4IBC A;  5FSW A;  3SMP A;  2ZAM A;  4L8R C;  1QZM A;  1IN5 A;  4GIP A;  1OJL A;  4KLN A;  5EJC A;  1OFI A;  1DO2 A;  3T1H M;  4LF5 M;  1QAM A;  3GPX A;  3LVV A;  3GLG A;  5EXS A;  1L1Z A;  3K8Z A;  5ITT A;  2UXD M;  1GL7 A;  3AFH A;  3HJQ A;  4MB7 A;  3GQ4 A;  1G59 A;  3T15 A;  1SXJ E;  2G5G X;  2QBY B;  3DA1 A;  1N75 A;  4OX9 M;  3VK7 A;  1IBM M;  3I4Y A;  3SBJ A;  1XC8 A;  2C99 A;  3KP0 E;  1N32 M;  1N78 A;  2M5Z A;  2J7O A;  1L1T A;  2F5S A;  1R2Z A;  4YY3 M;  2DWZ B;  1EE8 A;  4Z8X A;  2DWN A;  3FUV A;  1KSF X;  3U60 A;  2HCB A;  4ITQ A;  4GHL A;  3KS4 A;  2QPA A;  2D7H A;  3GPY A;  1IY1 A;  3GLF A;  4GHA A;  2G8L A;  1N34 M;  5DYI A;  1IN6 A;  3HKP A;  2CV0 A;  4JV5 M;  1HT2 E;  4R3D A;  3QWL A;  2KEB A;  1QAN A;  3I51 A;  2CHV A;  3HHW A;  4LJ9 A;  3B9P A;  3VKH A;  3TPZ A;  4JI0 M;  3AOE A;  2FE8 A;  3JAM S;  2KZS A;  2AHM A;  2XGN A;  1L8Q A;  2Z3X A;  4B3R M;  3U60 B;  3GLI A;  3R9X B;  4AKG A;  3PNV A;  2F5N A;  1TDZ A;  1C1K A;  2YQZ A;  4AKI A;  2Y20 A;  4II7 A;  2UXC M;  4NRW A;  2QP9 X;  3BOS A;  3PXG A;  2Y21 A;  1GVN A;  1ZQ9 A;  2XFS A;  5EP3 A;  4LF7 M;  2P5T A;  4B7H A;  4NSR A;  3HU2 A;  3HJ8 A;  3CF6 E;  5EXP A;  1IXZ A;  4JXJ A;  5EP4 A;  2C9C A;  4QHT A;  3FKE A;  4M0D A;  1PJI A;  3SYK A;  4G4R A;  1N36 M;  2ERC A;  2I7P A;  4LF8 M;  3KOW E;  3NWL A;  3HWS A;  4GRI A;  1L2B A;  3A45 A;  3GLI B;  1N77 A;  3MHV C;  3SAU A;  3U6O A;  3DOA A;  3L2A A;  2HHH M;  3ZH9 B;  4JI8 M;  3VDP A;  2RGH A;  4CGY B;  4DV2 M;  2H1R A;  4LJ7 A;  4JI5 M;  3J7A S;  2Z4R A;  1L2C A;  4LZZ A;  1Z5C A;  2CEA A;  3FTE A;  4AW4 A;  2V1C A;  4LJ5 A;  4LGM A;  5H37 D;  3PFI A;  3W0F A;  5LMU M;  1NHG C;  4FWG A;  5IRE B;  4REZ A;  3SHF A;  8CAT A;  3LQQ A;  5EXT A;  1HR0 M;  4GKK M;  1JR3 D;  4HLQ A;  2D7G A;  3SHG B;  3TWK A;  5FTM A;  3HHZ A;  4LCB A;  4LFB M;  3FD9 A;  4BLC A;  2OPF A;  3JR4 A;  5EP2 A;  4X65 M;  1IN4 A;  2DXI A;  4L15 A;  2KA6 B;  2Y0T A;  1XNQ M;  4B7F A;  3CTW B;  4NL4 H;  3TWL A;  1N33 M;  1G3I A;  4MH0 E;  4QHS A;  2F5O A;  1VDD A;  1NSF A;  1GKI A;  1E94 E;  2XZF A;  2C5R A;  4G6Z A;  2FNA A;  2CHG A;  2F5P A;  2V1U A;  3UJN A;  3E4R A;  4YHH M;  3KP1 E;  4IBF A;  4AZF A;  2XSZ D;  3HJS A;  1SXJ C;  3C58 A;  2CFO A;  3LMM A;  1XHB A;  1FJG M;  3EIE A;  1TH2 A;  1IQP A;  3SC3 A;  3FUT A;  3TL4 X;  3KOX E;  4DR1 M;  3SAW A;  5C18 A;  4GC9 A;  3TE6 A;  1E32 A;  1W5S A;  3SFZ A;  3I4V A;  5ITX A;  4MGH A;  1XXH A;  1DGG A;  2ZAO A;  1QAO A;  2L09 A;  5KPZ A;  2BJV A;  1PJJ A;  1QVR A;  5LMN M;  4AG5 A;  1TGU A;  1IY0 A;  3K92 A;  4PD2 A;  4K0K M;  1GLN A;  4B3S M;  1S3S A;  3KVW A;  1NY6 A;  4Z6Y A;  4AQY M;  3LVW A;  4LG2 A;  5FTL A;  4LF9 M;  2RKO A;  3GP1 A;  2KW0 A;  4M9Z A;  2LXE A;  3AOG A;  5IT9 S;  4FCW A;  1K82 A;  4I81 A;  1TH3 A;  4MGY E;  4IIW A;  3VFD A;  3KW6 A;  2XH9 A;  1OFH A;  5ITQ A;  2L7H A;  3RE8 A;  4RF0 A;  4LGY A;  5DYG A;  4ZPX A;  3WHK A;  1R2Y A;  3GQ5 A;  4LF4 M;  2C98 A;  4GH9 A;  2QZ4 A;  1XNR M;  1I4W A;  1G4A E;  3H4M A;  4LJ8 A;  1H6U A;  2LH0 A;  4DR3 M;  3U6C A;  2HL7 A;  2I7N A;  3ZC7 B;  2YR0 A;  2CE7 A;  2KXE A;  4IBB A;  1T3T A;  3UGJ A;  3J7B A;  4DV1 M;  2DZN B;  3L27 A;  2VQE M;  3L28 A;  3TQS A;  4LY6 A;  4JI1 M;  4D81 A;  4LJ4 A;  3K1J A;  4LJA A;  1G41 A;  3A42 A;  2QCU A;  3ILK A;  4L78 A;  1NJF A;  1Z59 A;  4XBO A;  3FUW A;  4G4Q A;  7CAT A;  5JI3 E;  1LV7 A;  4IBG A;  4BBA A;  1ORY B;  2YFQ A;  3KS8 A;  3KDS E;  2EO2 A;  3GLH A;  5ITX E;  1GL6 A;  3GQ3 A;  1K3W A;  1JQJ C;  5FLX S;  4L4U A;  1SXJ A;  3FTF A;  3U61 B;  5EXX A;  4DV7 M;  4CIS A;  1YSY A;  1G8P A;  3CF0 A;  3L26 A;  4AG6 A;  1R7R A;  4IBI A;  3GRY A;  2FFJ A;  5E6J A;  2Y0Q A;  3M0E A;  1Z5B A;  4NRV A;  2BJW A;  4PDI A;  4GIT A;  4DV5 M;  4DR6 M;  2RGO A;  4W5W A;  2XF3 A;  4IJE A;  4B08 A;  1KYI A;  2VQF M;  3GLF B;  3CF2 A;  1IBK M;  2DZO B;  5KQD A;  4DV4 M;  1QAQ A;  2R4J A;  4I8O A;  1JR3 A;  3J81 S;  4G4O A;  3HU3 A;  2R18 A;  4X64 M;  3T38 A;  3J2P B;  4OW0 A;  3QAU A;  3GLH B;  4LZJ A;  2OQ4 A;  3AV0 A;  1UM8 A;  2A5Y B;  2Q2E B;  2C9O A;  2JA2 A;  1KFV A;  4FVM A;  3ZCB B;  4MGK E;  4GMQ A;  4X62 M;  4DV3 M;  3D8B A;  4DV6 M;  1XMO M;  4GKJ M;  1FNN A;  1SXJ B;  3LQR A;  2HKJ A;  2R46 A;  2BNK A;  3KOY E;  1PM5 A;  1NHW C;  3GPU A;  3FTC A;  3SAR A;  1NVM A;  5FTK A;  3SMS A;  2CHQ A;  4AI6 A;  1Q3B A;  2XFT A;  4S12 A;  1MX0 A;  3HGI A;  1IN8 A;  5KO3 A;  1NJG A;  3RGP A;  2C96 A;  3NBI A;  4PT5 A;  1IY2 A;  1DGF A;  2XLJ A;  1Q3C A;  4R7G A;  3U6P A;  1IM2 A;  4LFC M;  4B3M M;  2L7I A;  4PCZ A;  2CV2 A;  4QOZ C;  4QNR A;  5KPT A;  2ZM6 M;  2FOI C;  2R62 A;  5IZ7 D;  3HHY A;  3AJI B;  1IXR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...