4JV5M

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4jv5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4jv5M02
4X64M 4DV3M 1IBLM 5ITXE 3SAVA 5ITTA 3SASA 1IBKM 4GKKM 3GPYA 4JI1M 3W0FA 4DV7M 4DR7M 4B3TM 2XZUA 4DR3M 4JI0M 3U6CA 1I94M 2E5LM 4OX9M 2UU9M 2HKJA 1PJIA 2VQEM 2F5PA 5A2QS 3U6EA 3TWKA 3GPPA 1FJGM 4GKJM 4JI2M 1K3WA 3J81S 4DR4M 3TWLA 1L1TA 4JI5M 4B3RM 4DR5M 1N32M 3C58A 3OTOM 2F5OA 4X66M 4MB7A 3T1HM 4DV5M 1Z5BA 1N33M 3VK8A 3VK7A 4JV5M 1XMOM 3SBJA 4JI8M 4LFBM 5IT9S 5IWAM 2OQ4A 4B3MM 1Z59A 4LF5M 4G4OA 2UUBM 3GQ4A 3A45A 4NRVA 3JAMS 2XZFA 3GPUA 3GQ5A 3SAUA 2Q2EB 1EE8A 4DV1M 5LMNM 2OPFA 4PD2A 4CISA 2ZBKB 3J80S 4DUZM 4AQYM 3GPXA 3U6MA 3U6QA 3U6OA 1K82A 4JI7M 5ITUA 1Q3CA 4DR2M 2F5QA 3SATA 1L1ZA 5BR8M 4DV6M 1Q3BA 3U6LA 4G4QA 2F5SA 2VQFM 1XNQM 1XNRM 4JYAM 3GP1A 4X62M 3A46A 1N34M 4LF6M 1MX0A 1MU5A 4DV0M 4DV2M 3GQ3A 1XC8A 4YHHM 3JR5A 2UUAM 1PM5A 1IBMM 4PDIA 4LF9M 4JI3M 2HHHM 2UXBM 1K3XA 4LF8M 3U6DA 3TWMA 5ITXA 5LMUM 3J7AS 4G4RA 1R2YA 1HR0M 1TDHA 1L2DA 4ITQA 1HNWM 1Z5AA 4X65M 1L2CA 4KHPM 1L2BA 2F5NA 2ZM6M 3A42A 4DV4M 1R2ZA 4G4NA 4NXMM 5ITRA 1Q39A 4DUYM 4K0KM 4JI4M 4NXNM 1N36M 2UUCM 3GO8A 4PDGA 5FLXS 1PJJA 2UXCM 4LFAM 3SARA 4LF7M 4DR6M 2UXDM 4DR1M 4YY3M 3U6SA 2F4VM 3DOAA 1J5EM 2EA0A 3SAWA 1HNXM 1XMQM 1TDZA 4JI6M 4B3SM 1KFVA 1NNJA 4LFCM 5ITQA 3U6PA 4NRWA 5ITYA 1HNZM 4PCZA 1Z5CA 3T1YM 4LF4M 3JR4A
chains in the Genus database with same CATH superfamily
4X64M 1XB2B 4HEOA 1OFIA 2DHYA 2DHRA 3GRVA 3W67A 3GLFA 1IBKM 4AI6A 4GKKM 4JI1M 4DR7M 3PXGA 2DNAA 3QYEA 3C3EA 5EXTA 1IM2A 1NNUC 2KHHA 3SYLA 2FNAA 1IN4A 2GQFA 4OX9M 1IN5A 2Z8YM 3HJQA 3R8FA 4FCVA 4KODA 3CTWB 1HT1E 2KEBA 5EXSA 3GLHB 1P3QQ 2C98A 3SFZA 4GKJM 1K3WA 1TH4A 3U61B 4M9ZA 3PFIA 4L16A 2LHGA 2JY7A 1F4IA 2DAGA 4DV5M 4KO8A 4EIWA 1VEJA 3LQQA 3VK7A 4JV5M 4ZPXA 1XMOM 4JI8M 3E46A 2OO9A 4IBIA 1DV0A 4D80A 3B7NA 3B74A 1D0LA 3H4JA 2OQ4A 3DA1A 3LCUA 3GQ4A 4KT0F 2L6OA 3U61A 3A45A 4B7HA 1SG9A 3FKEA 2DWZB 4I4LA 3FTDA 1VG5A 5EXXA 2X49A 3ZH9B 3C9PA 1DO2A 2Q2EB 1UM8A 2L7HA 1QDTA 4II7A 5LMNM 1N75A 1SXJC 2R6FA 2D7GA 5EP4A 5IZ7D 4MGIE 1DGGA 2JNHA 3MMPA 3PVSA 2I7NA 4CJ6A 5C1BA 4CISA 2QP9X 3GLHE 4QOZC 2BWBA 4NSRA 4QNRA 4AQYM 2L4EA 1HJPA 2DXIA 1I4WA 3J7BA 4QHSA 4LGMA 3W68A 2KZSA 4DR2M 1CUKA 2YR0A 3U6OA 1L1ZA 1ZMUA 3FRIA 3TQSA 2VQFM 4JYAM 4LF6M 1IY0A 4IBJA 1GL7A 1MX0A 4LJAA 1V33A 3LCVB 1DGHA 2XLJA 1QAOA 4B7FA 2JY8A 3V76A 3L26A 2P5TA 3VDPA 3QYBA 2YFQA 2UUAM 1NY5A 2V1CA 4LF9M 3VDUA 1HT2E 3MJ5A 2HHHM 3VFDA 4LF8M 3THGA 3U6DA 2DKLA 4WP2A 4I5SA 1OTRA 2FS1A 4ITQA 1HNWM 1TDHA 2R0IA 4AG5A 4M9XA 4A3VB 1JQJC 2DVWB 1L2BA 3A42A 1QDRA 3KOWE 4DV4M 3I51A 4NL4H 4NXMM 1Q39A 2MJ5B 4XGIA 4K0KM 4BLCA 1SXJB 4P16A 3KVWA 3CF0A 2WSCF 4IJEA 4LJ5A 4XK8F 3RFWA 4IBEA 2R18A 2MR9A 1XXHE 3GO8A 4TUWA 2KW0A 1QVRA 2WSEF 1OJLA 1PJJA 4L8RC 4IBCA 4KLNA 4JXJA 4YY3M 1WIVA 3AV0A 2EA0A 4LGYA 1TDZA 1GJTA 1WHCA 1S3SA 3H4MA 3J2PB 5ITQA 2DZNB 1IY1A 1X37A 4NSOB 1MJGM 1IFYA 3W0LB 4GITA 4M0DA 4LF4M 1IXRC 2QCUA 2D7EA 1Z6TA 3AKZA 3IECA 1Q02A 1G8PA 2HWJA 5FSWA 2RGHA 2ERCA 3GPYA 5KPTA 1WGLA 2H5XA 4B3TM 5E6JA 1J09A 5EP3A 2A5YB 4REZA 4AW4A 4DR3M 3FUTA 4LG2A 2KNVA 3I4YA 3HHZA 3U6CA 1I94M 2E5LM 3FUVA 2DZLA 5FTKA 3K92A 1ZAEA 2UU9M 2L4FA 5EP2A 2BJWA 3AOGA 3U6EA 3TWKA 1QANA 1FJGM 4JI2M 3K1JA 2C5RA 2XSZA 4DR5M 2LWXA 3C58A 4Y28F 3UK6A 3OTOM 3AL0C 2F5OA 5FTNA 2K6BA 3E4RA 3QWLA 1Z5BA 1N33M 3VK8A 3HX3A 3SBJA 3VKGA 2DENA 2G8LA 1VDLA 3C3DA 3L29A 3T38A 4GRIA 2JZ1A 4MGHA 2JP7A 4UN2B 4LFBM 3HHYA 5FTLA 4D81A 4G4OA 3BOSA 1GL6A 1RU3A 2QQ8A 3JAMS 2XZFA 3FUWA 5EXPA 4DV1M 3SC3A 1ZV1A 4MGYE 2OPFA 1TGUA 1QUSA 3E9SA 4LJ6A 4GC9A 1NHGC 2CFOA 2CUZA 3B9PA 7CATA 2CRUA 3GPXA 2QBYA 1WR1B 4IBDA 4JI7M 2HAKA 3PNYA 1QZMA 1G41A 1BVSA 4B7GA 1H6UA 3ZCBB 4I8OA 5BR8M 4DV6M 2F5SA 1DGBA 4OU7A 3GP1A 2HCBA 4LCBA 3EIEA 3KW6A 4LZZA 1MU5A 4DV0M 1DGFA 4AKHA 2R46A 1R5LA 2M5ZA 3GLGA 2LNHC 4L4UA 4YHHM 1IN6A 3SMPA 4AKIA 3FD9A 3DFZA 8CATA 1R4GA 3FYCA 4FD2A 4LJ8A 4PDIA 2CV1A 3SMSA 3GLHA 2JZ0A 4WURA 2UXBM 1J7KA 2KRKA 2W82A 3LW5F 4OVZB 3KP0E 1TH2A 3CGWA 1IQPA 3M6AA 3MK6A 3TWMA 2N35A 4AZFA 1HR0M 2LVAA 3KOYE 1E9RA 1OKSA 3U5ZA 3K8ZA 1T43A 2ZM6M 3ZQJA 3KP1E 4R71A 2ZAOA 1PRBA 1V92A 3FTCA 3IG8A 2DWNA 4DUYM 2KRUA 1XXHB 2DAMA 4JI4M 2R4EA 1XWIA 3B89A 3FYDA 2CV0A 3L28A 3K9OA 2KNAA 3HHXA 3WHLA 3B7QA 2CE7A 1FNNA 2G3QA 2Z4SA 4FCTA 3GRRA 4GC5A 4LF7M 1QYRA 2KNZA 2MGWA 3UJNA 1NJGA 3U6SA 1JR3A 4IBBA 3KOZE 3BBZA 3KOXE 1XMQM 4JI6M 3I4VA 4B3SM 4RKUF 3HJ8A 2YNMD 2VIIA 1GVNA 1E94E 1Y8GA 5ITYA 1HNZM 4NRWA 4RF1A 1Z5CA 1DGHB 1OIZA 3D8BA 3T1YM 2GNOA 1N77A 1MN3A 2KA6B 3QAUA 3GLGB 1K3XA 5ITXE 1IBLM 3SAVA 2WZJA 5JI3E 2LH0A 2YQZA 4LRTA 3ZC7B 2CEAA 2LTUA 3W0FA 1OAIA 4LJ7A 3KFUG 1VEGA 3GLIE 1QQWA 4JI0M 2RRUA 3U60A 3AJIB 2V1UA 2ZTCA 1GJSA 3HGIA 4RNAA 3UGJA 2HKJA 1PJIA 4WW0A 2LHCA 3DZDA 5A2QS 3HZJA 3RGPA 3GRYA 3GPPA 1NHWC 1PJTA 1QAQA 3J81S 3TWLA 5BPVA 2JXNA 4BBAA 2JY6B 4JI5M 4RF0A 1IY2A 1ZQ9A 2G5GX 3M0EA 4LJ9A 3T1HM 3FTEA 2J5YA 1L8QA 1HQYE 3M7GA 3MHVC 3GLFE 1TH3A 3A98B 2RGOA 4LRSA 4Z6YA 1OIPA 1AIPC 3F92A 4BB9A 4CIZA 4B3MM 1Z59A 2C99A 4NC6A 3NWLA 1V34A 3LQRA 4L78A 2CHVA 4NRVA 5FTJA 3KXEC 3Q8GA 3L2AA 3GPUA 3B7ZA 3SAUA 3AOEA 1EE8A 2V6ZM 1PJSA 2DAIA 4HLQA 1YLAA 3PNVA 1IN8A 2J7OA 3FRHA 1AUAA 4PD2A 2ZBKB 2CWBA 2CV2A 3CF6E 4DUZM 4MGKE 1KYIA 4QOSA 3UZUA 3U6MA 1UFZA 1Q3CA 3SATA 3KSXA 3UMMA 3SYKA 5DYIA 1Q3BA 3U6LA 5H37D 1XNRM 3NBXX 1NSFA 4R3DA 3A46A 4X62M 1N78A 2OOAA 2JY5A 1N34M 2CP8A 3HJSA 1SXJD 3GLIB 2APLA 4FCWA 1XC8A 2Y20A 1PGYA 2JA2A 3HY5A 1G4AE 2AHMA 1PM5A 1ORYB 4AKGA 4AG6A 2LXEA 3TL4X 1IBMM 2B3TA 4JI3M 4MM3B 1GO5A 1TF0B 1ZMWA 2K47A 2LVOC 3J7AS 3HHWA 2C9CA 2DAEA 1L2DA 1NO1A 3BXWA 4NOOB 4L6V6 3HU2A 4M0WA 3LVVA 4OW0A 4XBOA 1EFUB 3GLGE 4CHTB 2XH9A 5C18A 5ITRA 4IBGA 2BNKA 4GEWA 4GH9A 4R7GA 4F1IA 5F3WA 4I81A 2BJVA 1JR3E 1NV9A 1G3IA 1NV8A 1LTMA 1SXJA 2I7PA 2L2DA 4D82A 3NBIA 2Y21A 4S12A 2UUCM 2O25A 1W5SA 2DZOB 2EKFA 2O01F 2VDBB 4HL4A 5KPZA 2UXCM 3FE3A 1SXJE 4DR6M 1YSYA 2F4VM 4JN6A 2DI0A 1J5EM 1WXQA 2DWMA 2Y0TA 1TR8A 5GKNA 1IXSB 4FW9A 2KXEA 3WHKA 4W5WA 4FWDA 1NNJA 1GABA 4FWHA 3U6PA 2Z4RA 4FVMA 1IXZA 2Z7JA 4IBFA 2O5RA 4M9SA 3JR4A 3GLFB 3I04M 3IG5A 1JB0F 3GRUA 4IIWA 2EO2A 1OFHA 1QAMA 1OAOC 4DV3M 5ITTA 3SASA 2NQ8C 3LVWA 4DV7M 5L8RF 1DO0A 2DAKA 2XZUA 5JI2E 2QBYB 4GHAA 1LV7A 3Q8XA 1D2NA 2FFJA 4MH0E 5DYGA 4QNMA 3K9PA 4L15A 4F2LA 1D0KA 1KSFX 1XHBA 1T6OA 2LVNC 1A5TA 2XEPA 4IBKA 1VEKA 4LZJA 2VQEM 2F5PA 2MH8A 1W5TA 2LVPC 5KQDA 2K0BX 2H1RA 3KDSE 2FH0A 1G59A 3SHFA 4DR4M 4DBGB 1L1TA 1N32M 1YUBA 4B3RM 3T6PA 3RE8A 2KDLA 5KO3A 2Z3XA 4X66M 2ZANA 3HKPA 4MB7A 4Q7JA 1XXHA 4GHLA 3GLIA 2R45A 4CGYB 3KS4A 4G3OA 2C96A 1NVMA 5E26A 5IT9S 2R44A 3U5ZB 1HQCA 1NY6A 5IWAM 4LF5M 1QZEA 2UUBM 5DNYA 3E21A 3D8LA 1R7RA 2X8AA 3GQ5A 1JR3D 2QNJA 4LY6A 5KPRA 1R6BX 5EQTA 4GIPA 1E32A 3J80S 1D0MA 2LBCA 2FE8A 2D7HA 2X4AA 3VLFB 3HU1A 1TTEA 2EUCA 4Z8XA 5EP1A 3U6QA 1K82A 4FWGA 5ITUA 2FOIC 2F5QA 2OOBA 3I01M 4G4QA 2JUJA 1VDDA 1C1KA 3HU3A 1XNQM 1GLNA 3TPZA 3VKHA 2CHQA 4G6ZA 4DV2M 2QPAA 3GQ3A 3KSJA 2CHGA 5EJCA 1T3TA 3JR5A 2XF3A 4PT5A 3LMMA 3IHPA 4P17A 3T15A 1IN7A 5KQ8A 2M60A 1EIJA 4LJ4A 2LVQD 4MGZE 1GKIA 2VF8A 2XGNA 2RKOA 2KZUA 2L7IA 1WGNA 2VF7A 5FTMA 5ITXA 5LMUM 4G4RA 1R2YA 1G71A 1Z5AA 2WSFF 1NJFA 3FUXA 4X65M 1L2CA 4IJFA 1YE9A 3R9XB 2XSZD 3U60B 4GMQA 2QENA 2QZ4A 2F5NA 4KHPM 3SHGB 3L25A 1R2ZA 2QSFX 4G4NA 2DWLA 2R65A 1OQYA 3KS8A 3K2LA 3HWSA 3AFHA 2R62A 2XFSA 5IREB 4NXNM 3TE6A 2C9OA 2L09A 1QUTA 1VQ1A 3RGSA 1N36M 2J7NA 2K9DA 3CF2A 4PDGA 2ZTDA 5FLXS 4LFAM 3J27B 3SARA 4QHTA 2HL7A 2EJSA 2UXDM 4DR1M 2MROB 3DOAA 1WJ7A 1ZMVA 1IXSA 4ANRA 4B08A 3SAWA 2ZAMA 1HNXM 3EIHA 2XFTA 3FUUA 2BWEA 2Y0QA 1KFVA 4LFCM 2JWSA 1E9SA 4OVZA 2QHOB 3L27A 1C7YA 1PJQA 5DFLA 3AOEC 4PCZA 3FTFA 2R4JA 3ILKA 2EKKA
chains in the Genus database with same CATH topology
4X64M 1OFIA 4AI6A 2DHRA 3GRVA 3GLFA 1IBKM 4GKKM 4JI1M 4DR7M 3PXGA 5EXTA 1IM2A 1NNUC 3SYLA 2FNAA 1IN4A 4OX9M 1IN5A 3HJQA 4FCVA 4KODA 3CTWB 1HT1E 2KEBA 5EXSA 3GLHB 2C98A 3SFZA 4GKJM 1K3WA 1TH4A 3U61B 4M9ZA 3PFIA 4L16A 4DV5M 4KO8A 4EIWA 3LQQA 3VK7A 4JV5M 4ZPXA 1XMOM 4JI8M 4IBIA 4D80A 2OQ4A 3DA1A 3GQ4A 3U61A 2L6OA 3A45A 4B7HA 3R8FA 3FKEA 2DWZB 4I4LA 3FTDA 3ZH9B 5EXXA 2X49A 1DO2A 2Q2EB 1UM8A 2L7HA 4II7A 5LMNM 1N75A 1SXJC 2D7GA 5EP4A 5IZ7D 4MGIE 1DGGA 3PVSA 5C1BA 2I7NA 4CISA 2QP9X 4QOZC 4NSRA 4QNRA 4AQYM 2DXIA 1I4WA 3J7BA 4QHSA 4LGMA 3U6OA 2KZSA 4DR2M 2YR0A 1L1ZA 3TQSA 2VQFM 4JYAM 4LF6M 1IY0A 4IBJA 1GL7A 1MX0A 4LJAA 1DGHA 2XLJA 1QAOA 4B7FA 3L26A 2P5TA 3VDPA 2YFQA 2UUAM 1NY5A 2V1CA 4LF9M 3VDUA 1HT2E 3MJ5A 2HHHM 3VFDA 4LF8M 3THGA 3U6DA 4I5SA 4ITQA 1HNWM 1TDHA 4AG5A 4M9XA 4A3VB 1JQJC 2DVWB 1L2BA 3A42A 3KOWE 4DV4M 3I51A 4NL4H 4NXMM 1Q39A 4XGIA 4K0KM 4BLCA 1SXJB 4P16A 3KVWA 3CF0A 4IJEA 4LJ5A 3RFWA 4IBEA 2R18A 3GO8A 4TUWA 2KW0A 1QVRA 1OJLA 1PJJA 4L8RC 4IBCA 4KLNA 4JXJA 4YY3M 3AV0A 2EA0A 4LGYA 1TDZA 1S3SA 3H4MA 3J2PB 5ITQA 2DZNB 1IY1A 1X37A 4NSOB 3W0LB 4GITA 4M0DA 4LF4M 1IXRC 2QCUA 2D7EA 1Z6TA 3AKZA 1G8PA 5FSWA 2RGHA 2ERCA 3GPYA 5KPTA 4B3TM 5E6JA 1J09A 5EP3A 2A5YB 4REZA 4AW4A 4DR3M 3FUTA 4LG2A 3I4YA 3HHZA 3U6CA 1I94M 2E5LM 3FUVA 5FTKA 3K92A 1ZAEA 2UU9M 5EP2A 2BJWA 3AOGA 3U6EA 3TWKA 1QANA 1FJGM 4JI2M 3K1JA 2C5RA 2XSZA 4DR5M 2LWXA 3C58A 3OTOM 3UK6A 3AL0C 2F5OA 5FTNA 3E4RA 3QWLA 1Z5BA 1N33M 3VK8A 3SBJA 3VKGA 2G8LA 3L29A 3T38A 4LFBM 4GRIA 4MGHA 3HHYA 5FTLA 4D81A 4G4OA 3BOSA 1GL6A 3JAMS 2XZFA 3FUWA 5EXPA 4DV1M 3SC3A 4MGYE 2OPFA 1TGUA 3E9SA 4LJ6A 4GC9A 1NHGC 2CFOA 2CUZA 3B9PA 7CATA 3GPXA 2QBYA 4IBDA 4JI7M 3PNYA 1QZMA 1G41A 4B7GA 1H6UA 3ZCBB 4I8OA 5BR8M 4DV6M 2F5SA 1DGBA 4OU7A 3GP1A 2HCBA 4LCBA 3EIEA 3KW6A 4LZZA 1MU5A 4DV0M 1DGFA 4AKHA 2R46A 2M5ZA 3GLGA 2LNHC 4L4UA 4YHHM 1IN6A 3SMPA 4AKIA 3FD9A 3DFZA 8CATA 3FYCA 4LJ8A 4FD2A 4PDIA 2CV1A 3SMSA 3GLHA 4WURA 2UXBM 1J7KA 2KRKA 2W82A 4OVZB 1K3XA 3KP0E 1TH2A 1IQPA 3M6AA 3MK6A 3TWMA 4AZFA 1HR0M 3KOYE 1E9RA 3U5ZA 3K8ZA 2ZM6M 3KP1E 2ZAOA 3IG8A 3FTCA 2DWNA 4DUYM 2KRUA 1XXHB 4JI4M 1XWIA 2R4EA 3FYDA 2CV0A 3L28A 3WHLA 3HHXA 2CE7A 1FNNA 2Z4SA 4FCTA 3GRRA 4GC5A 4LF7M 1QYRA 3U6SA 3UJNA 1NJGA 1JR3A 4IBBA 3KOZE 3KOXE 1XMQM 4JI6M 3I4VA 4B3SM 3HJ8A 2YNMD 2VIIA 1GVNA 1E94E 4NRWA 5ITYA 1HNZM 4RF1A 1Z5CA 1DGHB 3D8BA 3T1YM 1N77A 2KA6B 3QAUA 3GLGB 1IBLM 5ITXE 3SAVA 5JI3E 2LH0A 2YQZA 4LRTA 3ZC7B 2CEAA 3W0FA 3KFUG 4LJ7A 1QQWA 4JI0M 3U60A 3AJIB 2V1UA 3HGIA 4RNAA 3UGJA 2HKJA 1PJIA 4WW0A 3DZDA 5A2QS 3RGPA 3GRYA 3GPPA 1NHWC 1QAQA 3J81S 3TWLA 5BPVA 4BBAA 4JI5M 4RF0A 1IY2A 1ZQ9A 2G5GX 3M0EA 4LJ9A 3T1HM 3FTEA 1L8QA 1HQYE 3M7GA 3MHVC 1TH3A 3A98B 2RGOA 4LRSA 4Z6YA 4BB9A 4B3MM 1Z59A 2C99A 3NWLA 3LQRA 4L78A 2CHVA 4NRVA 5FTJA 3KXEC 3L2AA 3GPUA 3SAUA 3AOEA 1EE8A 2V6ZM 4HLQA 3PNVA 1IN8A 2J7OA 4PD2A 2ZBKB 2CV2A 3CF6E 4DUZM 4MGKE 1KYIA 4QOSA 3UZUA 3U6MA 1Q3CA 3SATA 3KSXA 3UMMA 3SYKA 5DYIA 1Q3BA 3U6LA 5H37D 1XNRM 1NSFA 4R3DA 3A46A 4X62M 1N78A 1N34M 3HJSA 1SXJD 3GLIB 4FCWA 1XC8A 2Y20A 2JA2A 1G4AE 2AHMA 1PM5A 1ORYB 4AKGA 4AG6A 2LXEA 3TL4X 1IBMM 4JI3M 4MM3B 2K47A 3J7AS 3HHWA 2C9CA 1L2DA 4NOOB 3HU2A 4M0WA 3LVVA 4OW0A 4XBOA 4CHTB 2XH9A 5C18A 5ITRA 4IBGA 2BNKA 4GH9A 4R7GA 5F3WA 4I81A 2BJVA 1G3IA 2I7PA 1SXJA 4D82A 3NBIA 2Y21A 4S12A 2UUCM 1W5SA 2DZOB 4HL4A 5KPZA 2UXCM 1SXJE 4DR6M 1YSYA 2F4VM 4JN6A 1J5EM 1WXQA 2DWMA 2Y0TA 5GKNA 1IXSB 4FW9A 2KXEA 3WHKA 4W5WA 4FWDA 1NNJA 4FWHA 3U6PA 4FVMA 2Z4RA 1IXZA 2Z7JA 4IBFA 2O5RA 4M9SA 3JR4A 3GLFB 3IG5A 3GRUA 4IIWA 2EO2A 1OFHA 1QAMA 4DV3M 5ITTA 3SASA 2NQ8C 3LVWA 4DV7M 1DO0A 2XZUA 5JI2E 2QBYB 4GHAA 1LV7A 3Q8XA 1D2NA 2FFJA 4MH0E 5DYGA 4QNMA 4L15A 1KSFX 1XHBA 2XEPA 4IBKA 4LZJA 2VQEM 2F5PA 1W5TA 5KQDA 2H1RA 3KDSE 1G59A 3SHFA 4DR4M 1L1TA 1N32M 1YUBA 4B3RM 3RE8A 5KO3A 2Z3XA 4X66M 2ZANA 3HKPA 4MB7A 4GHLA 1XXHA 3GLIA 2R45A 4CGYB 3KS4A 2C96A 1NVMA 5E26A 5IT9S 3U5ZB 1HQCA 1NY6A 5IWAM 4LF5M 2UUBM 5DNYA 3D8LA 1R7RA 2X8AA 3GQ5A 1JR3D 4LY6A 5KPRA 1R6BX 5EQTA 4GIPA 1E32A 3J80S 2FE8A 2D7HA 2X4AA 3VLFB 3HU1A 2EUCA 4Z8XA 3U6QA 5EP1A 1K82A 4FWGA 5ITUA 2FOIC 2F5QA 4G4QA 3HU3A 1VDDA 1C1KA 1XNQM 1GLNA 3TPZA 3VKHA 2CHQA 4G6ZA 4DV2M 2QPAA 3GQ3A 3KSJA 2CHGA 5EJCA 1T3TA 3JR5A 2XF3A 4PT5A 3LMMA 3T15A 1IN7A 5KQ8A 2M60A 4LJ4A 4MGZE 1GKIA 2XGNA 2RKOA 2KZUA 2L7IA 5FTMA 5ITXA 5LMUM 4G4RA 1R2YA 1Z5AA 3FUXA 1NJFA 4X65M 1L2CA 3R9XB 4IJFA 1YE9A 4KHPM 2XSZD 3U60B 4GMQA 2QENA 2QZ4A 2F5NA 3SHGB 3L25A 1R2ZA 4G4NA 2DWLA 2R65A 3KS8A 3K2LA 3HWSA 3AFHA 2R62A 2XFSA 5IREB 4NXNM 3TE6A 2C9OA 2L09A 3RGSA 1N36M 2J7NA 3CF2A 4PDGA 5FLXS 4LFAM 3J27B 3SARA 4QHTA 2HL7A 2UXDM 4DR1M 3DOAA 4B08A 3SAWA 1HNXM 2ZAMA 3EIHA 2XFTA 3FUUA 2Y0QA 1KFVA 4LFCM 1E9SA 4OVZA 3L27A 3AOEC 4PCZA 3FTFA 2R4JA 3ILKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 M;  4DV3 M;  1IBL M;  5ITX E;  3SAV A;  5ITT A;  3SAS A;  1IBK M;  4GKK M;  3GPY A;  4JI1 M;  3W0F A;  4DV7 M;  4DR7 M;  4B3T M;  2XZU A;  4DR3 M;  4JI0 M;  3U6C A;  1I94 M;  2E5L M;  4OX9 M;  2UU9 M;  2HKJ A;  1PJI A;  2VQE M;  2F5P A;  5A2Q S;  3U6E A;  3TWK A;  3GPP A;  1FJG M;  4GKJ M;  4JI2 M;  1K3W A;  3J81 S;  4DR4 M;  3TWL A;  1L1T A;  4JI5 M;  4B3R M;  4DR5 M;  1N32 M;  3C58 A;  3OTO M;  2F5O A;  4X66 M;  4MB7 A;  3T1H M;  4DV5 M;  1Z5B A;  1N33 M;  3VK8 A;  3VK7 A;  4JV5 M;  1XMO M;  3SBJ A;  4JI8 M;  4LFB M;  5IT9 S;  5IWA M;  2OQ4 A;  4B3M M;  1Z59 A;  4LF5 M;  4G4O A;  2UUB M;  3GQ4 A;  3A45 A;  4NRV A;  3JAM S;  2XZF A;  3GPU A;  3GQ5 A;  3SAU A;  2Q2E B;  1EE8 A;  4DV1 M;  5LMN M;  2OPF A;  4PD2 A;  4CIS A;  2ZBK B;  3J80 S;  4DUZ M;  4AQY M;  3GPX A;  3U6M A;  3U6Q A;  3U6O A;  1K82 A;  4JI7 M;  5ITU A;  1Q3C A;  4DR2 M;  2F5Q A;  3SAT A;  1L1Z A;  5BR8 M;  4DV6 M;  1Q3B A;  3U6L A;  4G4Q A;  2F5S A;  2VQF M;  1XNQ M;  1XNR M;  4JYA M;  3GP1 A;  4X62 M;  3A46 A;  1N34 M;  4LF6 M;  1MX0 A;  1MU5 A;  4DV0 M;  4DV2 M;  3GQ3 A;  1XC8 A;  4YHH M;  3JR5 A;  2UUA M;  1PM5 A;  1IBM M;  4PDI A;  4LF9 M;  4JI3 M;  2HHH M;  2UXB M;  1K3X A;  4LF8 M;  3U6D A;  3TWM A;  5ITX A;  5LMU M;  3J7A S;  4G4R A;  1R2Y A;  1HR0 M;  1TDH A;  1L2D A;  4ITQ A;  1HNW M;  1Z5A A;  4X65 M;  1L2C A;  4KHP M;  1L2B A;  2F5N A;  2ZM6 M;  3A42 A;  4DV4 M;  1R2Z A;  4G4N A;  4NXM M;  5ITR A;  1Q39 A;  4DUY M;  4K0K M;  4JI4 M;  4NXN M;  1N36 M;  2UUC M;  3GO8 A;  4PDG A;  5FLX S;  1PJJ A;  2UXC M;  4LFA M;  3SAR A;  4LF7 M;  4DR6 M;  2UXD M;  4DR1 M;  4YY3 M;  3U6S A;  2F4V M;  3DOA A;  1J5E M;  2EA0 A;  3SAW A;  1HNX M;  1XMQ M;  1TDZ A;  4JI6 M;  4B3S M;  1KFV A;  1NNJ A;  4LFC M;  5ITQ A;  3U6P A;  4NRW A;  5ITY A;  1HNZ M;  4PCZ A;  1Z5C A;  3T1Y M;  4LF4 M;  3JR4 A; 
#chains in the Genus database with same CATH topology
 4X64 M;  1XB2 B;  4HEO A;  1OFI A;  2DHY A;  2DHR A;  3GRV A;  3W67 A;  3GLF A;  1IBK M;  4AI6 A;  4GKK M;  4JI1 M;  4DR7 M;  3PXG A;  2DNA A;  3QYE A;  3C3E A;  5EXT A;  1IM2 A;  1NNU C;  2KHH A;  3SYL A;  2FNA A;  1IN4 A;  2GQF A;  4OX9 M;  1IN5 A;  2Z8Y M;  3HJQ A;  3R8F A;  4FCV A;  4KOD A;  3CTW B;  1HT1 E;  2KEB A;  5EXS A;  3GLH B;  1P3Q Q;  2C98 A;  3SFZ A;  4GKJ M;  1K3W A;  1TH4 A;  3U61 B;  4M9Z A;  3PFI A;  4L16 A;  2LHG A;  2JY7 A;  1F4I A;  2DAG A;  4DV5 M;  4KO8 A;  4EIW A;  1VEJ A;  3LQQ A;  3VK7 A;  4JV5 M;  4ZPX A;  1XMO M;  4JI8 M;  3E46 A;  2OO9 A;  4IBI A;  1DV0 A;  4D80 A;  3B7N A;  3B74 A;  1D0L A;  3H4J A;  2OQ4 A;  3DA1 A;  3LCU A;  3GQ4 A;  4KT0 F;  2L6O A;  3U61 A;  3A45 A;  4B7H A;  1SG9 A;  3FKE A;  2DWZ B;  4I4L A;  3FTD A;  1VG5 A;  5EXX A;  2X49 A;  3ZH9 B;  3C9P A;  1DO2 A;  2Q2E B;  1UM8 A;  2L7H A;  1QDT A;  4II7 A;  5LMN M;  1N75 A;  1SXJ C;  2R6F A;  2D7G A;  5EP4 A;  5IZ7 D;  4MGI E;  1DGG A;  2JNH A;  3MMP A;  3PVS A;  2I7N A;  4CJ6 A;  5C1B A;  4CIS A;  2QP9 X;  3GLH E;  4QOZ C;  2BWB A;  4NSR A;  4QNR A;  4AQY M;  2L4E A;  1HJP A;  2DXI A;  1I4W A;  3J7B A;  4QHS A;  4LGM A;  3W68 A;  2KZS A;  4DR2 M;  1CUK A;  2YR0 A;  3U6O A;  1L1Z A;  1ZMU A;  3FRI A;  3TQS A;  2VQF M;  4JYA M;  4LF6 M;  1IY0 A;  4IBJ A;  1GL7 A;  1MX0 A;  4LJA A;  1V33 A;  3LCV B;  1DGH A;  2XLJ A;  1QAO A;  4B7F A;  2JY8 A;  3V76 A;  3L26 A;  2P5T A;  3VDP A;  3QYB A;  2YFQ A;  2UUA M;  1NY5 A;  2V1C A;  4LF9 M;  3VDU A;  1HT2 E;  3MJ5 A;  2HHH M;  3VFD A;  4LF8 M;  3THG A;  3U6D A;  2DKL A;  4WP2 A;  4I5S A;  1OTR A;  2FS1 A;  4ITQ A;  1HNW M;  1TDH A;  2R0I A;  4AG5 A;  4M9X A;  4A3V B;  1JQJ C;  2DVW B;  1L2B A;  3A42 A;  1QDR A;  3KOW E;  4DV4 M;  3I51 A;  4NL4 H;  4NXM M;  1Q39 A;  2MJ5 B;  4XGI A;  4K0K M;  4BLC A;  1SXJ B;  4P16 A;  3KVW A;  3CF0 A;  2WSC F;  4IJE A;  4LJ5 A;  4XK8 F;  3RFW A;  4IBE A;  2R18 A;  2MR9 A;  1XXH E;  3GO8 A;  4TUW A;  2KW0 A;  1QVR A;  2WSE F;  1OJL A;  1PJJ A;  4L8R C;  4IBC A;  4KLN A;  4JXJ A;  4YY3 M;  1WIV A;  3AV0 A;  2EA0 A;  4LGY A;  1TDZ A;  1GJT A;  1WHC A;  1S3S A;  3H4M A;  3J2P B;  5ITQ A;  2DZN B;  1IY1 A;  1X37 A;  4NSO B;  1MJG M;  1IFY A;  3W0L B;  4GIT A;  4M0D A;  4LF4 M;  1IXR C;  2QCU A;  2D7E A;  1Z6T A;  3AKZ A;  3IEC A;  1Q02 A;  1G8P A;  2HWJ A;  5FSW A;  2RGH A;  2ERC A;  3GPY A;  5KPT A;  1WGL A;  2H5X A;  4B3T M;  5E6J A;  1J09 A;  5EP3 A;  2A5Y B;  4REZ A;  4AW4 A;  4DR3 M;  3FUT A;  4LG2 A;  2KNV A;  3I4Y A;  3HHZ A;  3U6C A;  1I94 M;  2E5L M;  3FUV A;  2DZL A;  5FTK A;  3K92 A;  1ZAE A;  2UU9 M;  2L4F A;  5EP2 A;  2BJW A;  3AOG A;  3U6E A;  3TWK A;  1QAN A;  1FJG M;  4JI2 M;  3K1J A;  2C5R A;  2XSZ A;  4DR5 M;  2LWX A;  3C58 A;  4Y28 F;  3UK6 A;  3OTO M;  3AL0 C;  2F5O A;  5FTN A;  2K6B A;  3E4R A;  3QWL A;  1Z5B A;  1N33 M;  3VK8 A;  3HX3 A;  3SBJ A;  3VKG A;  2DEN A;  2G8L A;  1VDL A;  3C3D A;  3L29 A;  3T38 A;  4GRI A;  2JZ1 A;  4MGH A;  2JP7 A;  4UN2 B;  4LFB M;  3HHY A;  5FTL A;  4D81 A;  4G4O A;  3BOS A;  1GL6 A;  1RU3 A;  2QQ8 A;  3JAM S;  2XZF A;  3FUW A;  5EXP A;  4DV1 M;  3SC3 A;  1ZV1 A;  4MGY E;  2OPF A;  1TGU A;  1QUS A;  3E9S A;  4LJ6 A;  4GC9 A;  1NHG C;  2CFO A;  2CUZ A;  3B9P A;  7CAT A;  2CRU A;  3GPX A;  2QBY A;  1WR1 B;  4IBD A;  4JI7 M;  2HAK A;  3PNY A;  1QZM A;  1G41 A;  1BVS A;  4B7G A;  1H6U A;  3ZCB B;  4I8O A;  5BR8 M;  4DV6 M;  2F5S A;  1DGB A;  4OU7 A;  3GP1 A;  2HCB A;  4LCB A;  3EIE A;  3KW6 A;  4LZZ A;  1MU5 A;  4DV0 M;  1DGF A;  4AKH A;  2R46 A;  1R5L A;  2M5Z A;  3GLG A;  2LNH C;  4L4U A;  4YHH M;  1IN6 A;  3SMP A;  4AKI A;  3FD9 A;  3DFZ A;  8CAT A;  1R4G A;  3FYC A;  4FD2 A;  4LJ8 A;  4PDI A;  2CV1 A;  3SMS A;  3GLH A;  2JZ0 A;  4WUR A;  2UXB M;  1J7K A;  2KRK A;  2W82 A;  3LW5 F;  4OVZ B;  3KP0 E;  1TH2 A;  3CGW A;  1IQP A;  3M6A A;  3MK6 A;  3TWM A;  2N35 A;  4AZF A;  1HR0 M;  2LVA A;  3KOY E;  1E9R A;  1OKS A;  3U5Z A;  3K8Z A;  1T43 A;  2ZM6 M;  3ZQJ A;  3KP1 E;  4R71 A;  2ZAO A;  1PRB A;  1V92 A;  3FTC A;  3IG8 A;  2DWN A;  4DUY M;  2KRU A;  1XXH B;  2DAM A;  4JI4 M;  2R4E A;  1XWI A;  3B89 A;  3FYD A;  2CV0 A;  3L28 A;  3K9O A;  2KNA A;  3HHX A;  3WHL A;  3B7Q A;  2CE7 A;  1FNN A;  2G3Q A;  2Z4S A;  4FCT A;  3GRR A;  4GC5 A;  4LF7 M;  1QYR A;  2KNZ A;  2MGW A;  3UJN A;  1NJG A;  3U6S A;  1JR3 A;  4IBB A;  3KOZ E;  3BBZ A;  3KOX E;  1XMQ M;  4JI6 M;  3I4V A;  4B3S M;  4RKU F;  3HJ8 A;  2YNM D;  2VII A;  1GVN A;  1E94 E;  1Y8G A;  5ITY A;  1HNZ M;  4NRW A;  4RF1 A;  1Z5C A;  1DGH B;  1OIZ A;  3D8B A;  3T1Y M;  2GNO A;  1N77 A;  1MN3 A;  2KA6 B;  3QAU A;  3GLG B;  1K3X A;  5ITX E;  1IBL M;  3SAV A;  2WZJ A;  5JI3 E;  2LH0 A;  2YQZ A;  4LRT A;  3ZC7 B;  2CEA A;  2LTU A;  3W0F A;  1OAI A;  4LJ7 A;  3KFU G;  1VEG A;  3GLI E;  1QQW A;  4JI0 M;  2RRU A;  3U60 A;  3AJI B;  2V1U A;  2ZTC A;  1GJS A;  3HGI A;  4RNA A;  3UGJ A;  2HKJ A;  1PJI A;  4WW0 A;  2LHC A;  3DZD A;  5A2Q S;  3HZJ A;  3RGP A;  3GRY A;  3GPP A;  1NHW C;  1PJT A;  1QAQ A;  3J81 S;  3TWL A;  5BPV A;  2JXN A;  4BBA A;  2JY6 B;  4JI5 M;  4RF0 A;  1IY2 A;  1ZQ9 A;  2G5G X;  3M0E A;  4LJ9 A;  3T1H M;  3FTE A;  2J5Y A;  1L8Q A;  1HQY E;  3M7G A;  3MHV C;  3GLF E;  1TH3 A;  3A98 B;  2RGO A;  4LRS A;  4Z6Y A;  1OIP A;  1AIP C;  3F92 A;  4BB9 A;  4CIZ A;  4B3M M;  1Z59 A;  2C99 A;  4NC6 A;  3NWL A;  1V34 A;  3LQR A;  4L78 A;  2CHV A;  4NRV A;  5FTJ A;  3KXE C;  3Q8G A;  3L2A A;  3GPU A;  3B7Z A;  3SAU A;  3AOE A;  1EE8 A;  2V6Z M;  1PJS A;  2DAI A;  4HLQ A;  1YLA A;  3PNV A;  1IN8 A;  2J7O A;  3FRH A;  1AUA A;  4PD2 A;  2ZBK B;  2CWB A;  2CV2 A;  3CF6 E;  4DUZ M;  4MGK E;  1KYI A;  4QOS A;  3UZU A;  3U6M A;  1UFZ A;  1Q3C A;  3SAT A;  3KSX A;  3UMM A;  3SYK A;  5DYI A;  1Q3B A;  3U6L A;  5H37 D;  1XNR M;  3NBX X;  1NSF A;  4R3D A;  3A46 A;  4X62 M;  1N78 A;  2OOA A;  2JY5 A;  1N34 M;  2CP8 A;  3HJS A;  1SXJ D;  3GLI B;  2APL A;  4FCW A;  1XC8 A;  2Y20 A;  1PGY A;  2JA2 A;  3HY5 A;  1G4A E;  2AHM A;  1PM5 A;  1ORY B;  4AKG A;  4AG6 A;  2LXE A;  3TL4 X;  1IBM M;  2B3T A;  4JI3 M;  4MM3 B;  1GO5 A;  1TF0 B;  1ZMW A;  2K47 A;  2LVO C;  3J7A S;  3HHW A;  2C9C A;  2DAE A;  1L2D A;  1NO1 A;  3BXW A;  4NOO B;  4L6V 6;  3HU2 A;  4M0W A;  3LVV A;  4OW0 A;  4XBO A;  1EFU B;  3GLG E;  4CHT B;  2XH9 A;  5C18 A;  5ITR A;  4IBG A;  2BNK A;  4GEW A;  4GH9 A;  4R7G A;  4F1I A;  5F3W A;  4I81 A;  2BJV A;  1JR3 E;  1NV9 A;  1G3I A;  1NV8 A;  1LTM A;  1SXJ A;  2I7P A;  2L2D A;  4D82 A;  3NBI A;  2Y21 A;  4S12 A;  2UUC M;  2O25 A;  1W5S A;  2DZO B;  2EKF A;  2O01 F;  2VDB B;  4HL4 A;  5KPZ A;  2UXC M;  3FE3 A;  1SXJ E;  4DR6 M;  1YSY A;  2F4V M;  4JN6 A;  2DI0 A;  1J5E M;  1WXQ A;  2DWM A;  2Y0T A;  1TR8 A;  5GKN A;  1IXS B;  4FW9 A;  2KXE A;  3WHK A;  4W5W A;  4FWD A;  1NNJ A;  1GAB A;  4FWH A;  3U6P A;  2Z4R A;  4FVM A;  1IXZ A;  2Z7J A;  4IBF A;  2O5R A;  4M9S A;  3JR4 A;  3GLF B;  3I04 M;  3IG5 A;  1JB0 F;  3GRU A;  4IIW A;  2EO2 A;  1OFH A;  1QAM A;  1OAO C;  4DV3 M;  5ITT A;  3SAS A;  2NQ8 C;  3LVW A;  4DV7 M;  5L8R F;  1DO0 A;  2DAK A;  2XZU A;  5JI2 E;  2QBY B;  4GHA A;  1LV7 A;  3Q8X A;  1D2N A;  2FFJ A;  4MH0 E;  5DYG A;  4QNM A;  3K9P A;  4L15 A;  4F2L A;  1D0K A;  1KSF X;  1XHB A;  1T6O A;  2LVN C;  1A5T A;  2XEP A;  4IBK A;  1VEK A;  4LZJ A;  2VQE M;  2F5P A;  2MH8 A;  1W5T A;  2LVP C;  5KQD A;  2K0B X;  2H1R A;  3KDS E;  2FH0 A;  1G59 A;  3SHF A;  4DR4 M;  4DBG B;  1L1T A;  1N32 M;  1YUB A;  4B3R M;  3T6P A;  3RE8 A;  2KDL A;  5KO3 A;  2Z3X A;  4X66 M;  2ZAN A;  3HKP A;  4MB7 A;  4Q7J A;  1XXH A;  4GHL A;  3GLI A;  2R45 A;  4CGY B;  3KS4 A;  4G3O A;  2C96 A;  1NVM A;  5E26 A;  5IT9 S;  2R44 A;  3U5Z B;  1HQC A;  1NY6 A;  5IWA M;  4LF5 M;  1QZE A;  2UUB M;  5DNY A;  3E21 A;  3D8L A;  1R7R A;  2X8A A;  3GQ5 A;  1JR3 D;  2QNJ A;  4LY6 A;  5KPR A;  1R6B X;  5EQT A;  4GIP A;  1E32 A;  3J80 S;  1D0M A;  2LBC A;  2FE8 A;  2D7H A;  2X4A A;  3VLF B;  3HU1 A;  1TTE A;  2EUC A;  4Z8X A;  5EP1 A;  3U6Q A;  1K82 A;  4FWG A;  5ITU A;  2FOI C;  2F5Q A;  2OOB A;  3I01 M;  4G4Q A;  2JUJ A;  1VDD A;  1C1K A;  3HU3 A;  1XNQ M;  1GLN A;  3TPZ A;  3VKH A;  2CHQ A;  4G6Z A;  4DV2 M;  2QPA A;  3GQ3 A;  3KSJ A;  2CHG A;  5EJC A;  1T3T A;  3JR5 A;  2XF3 A;  4PT5 A;  3LMM A;  3IHP A;  4P17 A;  3T15 A;  1IN7 A;  5KQ8 A;  2M60 A;  1EIJ A;  4LJ4 A;  2LVQ D;  4MGZ E;  1GKI A;  2VF8 A;  2XGN A;  2RKO A;  2KZU A;  2L7I A;  1WGN A;  2VF7 A;  5FTM A;  5ITX A;  5LMU M;  4G4R A;  1R2Y A;  1G71 A;  1Z5A A;  2WSF F;  1NJF A;  3FUX A;  4X65 M;  1L2C A;  4IJF A;  1YE9 A;  3R9X B;  2XSZ D;  3U60 B;  4GMQ A;  2QEN A;  2QZ4 A;  2F5N A;  4KHP M;  3SHG B;  3L25 A;  1R2Z A;  2QSF X;  4G4N A;  2DWL A;  2R65 A;  1OQY A;  3KS8 A;  3K2L A;  3HWS A;  3AFH A;  2R62 A;  2XFS A;  5IRE B;  4NXN M;  3TE6 A;  2C9O A;  2L09 A;  1QUT A;  1VQ1 A;  3RGS A;  1N36 M;  2J7N A;  2K9D A;  3CF2 A;  4PDG A;  2ZTD A;  5FLX S;  4LFA M;  3J27 B;  3SAR A;  4QHT A;  2HL7 A;  2EJS A;  2UXD M;  4DR1 M;  2MRO B;  3DOA A;  1WJ7 A;  1ZMV A;  1IXS A;  4ANR A;  4B08 A;  3SAW A;  2ZAM A;  1HNX M;  3EIH A;  2XFT A;  3FUU A;  2BWE A;  2Y0Q A;  1KFV A;  4LFC M;  2JWS A;  1E9S A;  4OVZ A;  2QHO B;  3L27 A;  1C7Y A;  1PJQ A;  5DFL A;  3AOE C;  4PCZ A;  3FTF A;  2R4J A;  3ILK A;  2EKK A; 
#chains in the Genus database with same CATH homology
 4X64 M;  1OFI A;  4AI6 A;  2DHR A;  3GRV A;  3GLF A;  1IBK M;  4GKK M;  4JI1 M;  4DR7 M;  3PXG A;  5EXT A;  1IM2 A;  1NNU C;  3SYL A;  2FNA A;  1IN4 A;  4OX9 M;  1IN5 A;  3HJQ A;  4FCV A;  4KOD A;  3CTW B;  1HT1 E;  2KEB A;  5EXS A;  3GLH B;  2C98 A;  3SFZ A;  4GKJ M;  1K3W A;  1TH4 A;  3U61 B;  4M9Z A;  3PFI A;  4L16 A;  4DV5 M;  4KO8 A;  4EIW A;  3LQQ A;  3VK7 A;  4JV5 M;  4ZPX A;  1XMO M;  4JI8 M;  4IBI A;  4D80 A;  2OQ4 A;  3DA1 A;  3GQ4 A;  3U61 A;  2L6O A;  3A45 A;  4B7H A;  3R8F A;  3FKE A;  2DWZ B;  4I4L A;  3FTD A;  3ZH9 B;  5EXX A;  2X49 A;  1DO2 A;  2Q2E B;  1UM8 A;  2L7H A;  4II7 A;  5LMN M;  1N75 A;  1SXJ C;  2D7G A;  5EP4 A;  5IZ7 D;  4MGI E;  1DGG A;  3PVS A;  5C1B A;  2I7N A;  4CIS A;  2QP9 X;  4QOZ C;  4NSR A;  4QNR A;  4AQY M;  2DXI A;  1I4W A;  3J7B A;  4QHS A;  4LGM A;  3U6O A;  2KZS A;  4DR2 M;  2YR0 A;  1L1Z A;  3TQS A;  2VQF M;  4JYA M;  4LF6 M;  1IY0 A;  4IBJ A;  1GL7 A;  1MX0 A;  4LJA A;  1DGH A;  2XLJ A;  1QAO A;  4B7F A;  3L26 A;  2P5T A;  3VDP A;  2YFQ A;  2UUA M;  1NY5 A;  2V1C A;  4LF9 M;  3VDU A;  1HT2 E;  3MJ5 A;  2HHH M;  3VFD A;  4LF8 M;  3THG A;  3U6D A;  4I5S A;  4ITQ A;  1HNW M;  1TDH A;  4AG5 A;  4M9X A;  4A3V B;  1JQJ C;  2DVW B;  1L2B A;  3A42 A;  3KOW E;  4DV4 M;  3I51 A;  4NL4 H;  4NXM M;  1Q39 A;  4XGI A;  4K0K M;  4BLC A;  1SXJ B;  4P16 A;  3KVW A;  3CF0 A;  4IJE A;  4LJ5 A;  3RFW A;  4IBE A;  2R18 A;  3GO8 A;  4TUW A;  2KW0 A;  1QVR A;  1OJL A;  1PJJ A;  4L8R C;  4IBC A;  4KLN A;  4JXJ A;  4YY3 M;  3AV0 A;  2EA0 A;  4LGY A;  1TDZ A;  1S3S A;  3H4M A;  3J2P B;  5ITQ A;  2DZN B;  1IY1 A;  1X37 A;  4NSO B;  3W0L B;  4GIT A;  4M0D A;  4LF4 M;  1IXR C;  2QCU A;  2D7E A;  1Z6T A;  3AKZ A;  1G8P A;  5FSW A;  2RGH A;  2ERC A;  3GPY A;  5KPT A;  4B3T M;  5E6J A;  1J09 A;  5EP3 A;  2A5Y B;  4REZ A;  4AW4 A;  4DR3 M;  3FUT A;  4LG2 A;  3I4Y A;  3HHZ A;  3U6C A;  1I94 M;  2E5L M;  3FUV A;  5FTK A;  3K92 A;  1ZAE A;  2UU9 M;  5EP2 A;  2BJW A;  3AOG A;  3U6E A;  3TWK A;  1QAN A;  1FJG M;  4JI2 M;  3K1J A;  2C5R A;  2XSZ A;  4DR5 M;  2LWX A;  3C58 A;  3OTO M;  3UK6 A;  3AL0 C;  2F5O A;  5FTN A;  3E4R A;  3QWL A;  1Z5B A;  1N33 M;  3VK8 A;  3SBJ A;  3VKG A;  2G8L A;  3L29 A;  3T38 A;  4LFB M;  4GRI A;  4MGH A;  3HHY A;  5FTL A;  4D81 A;  4G4O A;  3BOS A;  1GL6 A;  3JAM S;  2XZF A;  3FUW A;  5EXP A;  4DV1 M;  3SC3 A;  4MGY E;  2OPF A;  1TGU A;  3E9S A;  4LJ6 A;  4GC9 A;  1NHG C;  2CFO A;  2CUZ A;  3B9P A;  7CAT A;  3GPX A;  2QBY A;  4IBD A;  4JI7 M;  3PNY A;  1QZM A;  1G41 A;  4B7G A;  1H6U A;  3ZCB B;  4I8O A;  5BR8 M;  4DV6 M;  2F5S A;  1DGB A;  4OU7 A;  3GP1 A;  2HCB A;  4LCB A;  3EIE A;  3KW6 A;  4LZZ A;  1MU5 A;  4DV0 M;  1DGF A;  4AKH A;  2R46 A;  2M5Z A;  3GLG A;  2LNH C;  4L4U A;  4YHH M;  1IN6 A;  3SMP A;  4AKI A;  3FD9 A;  3DFZ A;  8CAT A;  3FYC A;  4LJ8 A;  4FD2 A;  4PDI A;  2CV1 A;  3SMS A;  3GLH A;  4WUR A;  2UXB M;  1J7K A;  2KRK A;  2W82 A;  4OVZ B;  1K3X A;  3KP0 E;  1TH2 A;  1IQP A;  3M6A A;  3MK6 A;  3TWM A;  4AZF A;  1HR0 M;  3KOY E;  1E9R A;  3U5Z A;  3K8Z A;  2ZM6 M;  3KP1 E;  2ZAO A;  3IG8 A;  3FTC A;  2DWN A;  4DUY M;  2KRU A;  1XXH B;  4JI4 M;  1XWI A;  2R4E A;  3FYD A;  2CV0 A;  3L28 A;  3WHL A;  3HHX A;  2CE7 A;  1FNN A;  2Z4S A;  4FCT A;  3GRR A;  4GC5 A;  4LF7 M;  1QYR A;  3U6S A;  3UJN A;  1NJG A;  1JR3 A;  4IBB A;  3KOZ E;  3KOX E;  1XMQ M;  4JI6 M;  3I4V A;  4B3S M;  3HJ8 A;  2YNM D;  2VII A;  1GVN A;  1E94 E;  4NRW A;  5ITY A;  1HNZ M;  4RF1 A;  1Z5C A;  1DGH B;  3D8B A;  3T1Y M;  1N77 A;  2KA6 B;  3QAU A;  3GLG B;  1IBL M;  5ITX E;  3SAV A;  5JI3 E;  2LH0 A;  2YQZ A;  4LRT A;  3ZC7 B;  2CEA A;  3W0F A;  3KFU G;  4LJ7 A;  1QQW A;  4JI0 M;  3U60 A;  3AJI B;  2V1U A;  3HGI A;  4RNA A;  3UGJ A;  2HKJ A;  1PJI A;  4WW0 A;  3DZD A;  5A2Q S;  3RGP A;  3GRY A;  3GPP A;  1NHW C;  1QAQ A;  3J81 S;  3TWL A;  5BPV A;  4BBA A;  4JI5 M;  4RF0 A;  1IY2 A;  1ZQ9 A;  2G5G X;  3M0E A;  4LJ9 A;  3T1H M;  3FTE A;  1L8Q A;  1HQY E;  3M7G A;  3MHV C;  1TH3 A;  3A98 B;  2RGO A;  4LRS A;  4Z6Y A;  4BB9 A;  4B3M M;  1Z59 A;  2C99 A;  3NWL A;  3LQR A;  4L78 A;  2CHV A;  4NRV A;  5FTJ A;  3KXE C;  3L2A A;  3GPU A;  3SAU A;  3AOE A;  1EE8 A;  2V6Z M;  4HLQ A;  3PNV A;  1IN8 A;  2J7O A;  4PD2 A;  2ZBK B;  2CV2 A;  3CF6 E;  4DUZ M;  4MGK E;  1KYI A;  4QOS A;  3UZU A;  3U6M A;  1Q3C A;  3SAT A;  3KSX A;  3UMM A;  3SYK A;  5DYI A;  1Q3B A;  3U6L A;  5H37 D;  1XNR M;  1NSF A;  4R3D A;  3A46 A;  4X62 M;  1N78 A;  1N34 M;  3HJS A;  1SXJ D;  3GLI B;  4FCW A;  1XC8 A;  2Y20 A;  2JA2 A;  1G4A E;  2AHM A;  1PM5 A;  1ORY B;  4AKG A;  4AG6 A;  2LXE A;  3TL4 X;  1IBM M;  4JI3 M;  4MM3 B;  2K47 A;  3J7A S;  3HHW A;  2C9C A;  1L2D A;  4NOO B;  3HU2 A;  4M0W A;  3LVV A;  4OW0 A;  4XBO A;  4CHT B;  2XH9 A;  5C18 A;  5ITR A;  4IBG A;  2BNK A;  4GH9 A;  4R7G A;  5F3W A;  4I81 A;  2BJV A;  1G3I A;  2I7P A;  1SXJ A;  4D82 A;  3NBI A;  2Y21 A;  4S12 A;  2UUC M;  1W5S A;  2DZO B;  4HL4 A;  5KPZ A;  2UXC M;  1SXJ E;  4DR6 M;  1YSY A;  2F4V M;  4JN6 A;  1J5E M;  1WXQ A;  2DWM A;  2Y0T A;  5GKN A;  1IXS B;  4FW9 A;  2KXE A;  3WHK A;  4W5W A;  4FWD A;  1NNJ A;  4FWH A;  3U6P A;  4FVM A;  2Z4R A;  1IXZ A;  2Z7J A;  4IBF A;  2O5R A;  4M9S A;  3JR4 A;  3GLF B;  3IG5 A;  3GRU A;  4IIW A;  2EO2 A;  1OFH A;  1QAM A;  4DV3 M;  5ITT A;  3SAS A;  2NQ8 C;  3LVW A;  4DV7 M;  1DO0 A;  2XZU A;  5JI2 E;  2QBY B;  4GHA A;  1LV7 A;  3Q8X A;  1D2N A;  2FFJ A;  4MH0 E;  5DYG A;  4QNM A;  4L15 A;  1KSF X;  1XHB A;  2XEP A;  4IBK A;  4LZJ A;  2VQE M;  2F5P A;  1W5T A;  5KQD A;  2H1R A;  3KDS E;  1G59 A;  3SHF A;  4DR4 M;  1L1T A;  1N32 M;  1YUB A;  4B3R M;  3RE8 A;  5KO3 A;  2Z3X A;  4X66 M;  2ZAN A;  3HKP A;  4MB7 A;  4GHL A;  1XXH A;  3GLI A;  2R45 A;  4CGY B;  3KS4 A;  2C96 A;  1NVM A;  5E26 A;  5IT9 S;  3U5Z B;  1HQC A;  1NY6 A;  5IWA M;  4LF5 M;  2UUB M;  5DNY A;  3D8L A;  1R7R A;  2X8A A;  3GQ5 A;  1JR3 D;  4LY6 A;  5KPR A;  1R6B X;  5EQT A;  4GIP A;  1E32 A;  3J80 S;  2FE8 A;  2D7H A;  2X4A A;  3VLF B;  3HU1 A;  2EUC A;  4Z8X A;  3U6Q A;  5EP1 A;  1K82 A;  4FWG A;  5ITU A;  2FOI C;  2F5Q A;  4G4Q A;  3HU3 A;  1VDD A;  1C1K A;  1XNQ M;  1GLN A;  3TPZ A;  3VKH A;  2CHQ A;  4G6Z A;  4DV2 M;  2QPA A;  3GQ3 A;  3KSJ A;  2CHG A;  5EJC A;  1T3T A;  3JR5 A;  2XF3 A;  4PT5 A;  3LMM A;  3T15 A;  1IN7 A;  5KQ8 A;  2M60 A;  4LJ4 A;  4MGZ E;  1GKI A;  2XGN A;  2RKO A;  2KZU A;  2L7I A;  5FTM A;  5ITX A;  5LMU M;  4G4R A;  1R2Y A;  1Z5A A;  3FUX A;  1NJF A;  4X65 M;  1L2C A;  3R9X B;  4IJF A;  1YE9 A;  4KHP M;  2XSZ D;  3U60 B;  4GMQ A;  2QEN A;  2QZ4 A;  2F5N A;  3SHG B;  3L25 A;  1R2Z A;  4G4N A;  2DWL A;  2R65 A;  3KS8 A;  3K2L A;  3HWS A;  3AFH A;  2R62 A;  2XFS A;  5IRE B;  4NXN M;  3TE6 A;  2C9O A;  2L09 A;  3RGS A;  1N36 M;  2J7N A;  3CF2 A;  4PDG A;  5FLX S;  4LFA M;  3J27 B;  3SAR A;  4QHT A;  2HL7 A;  2UXD M;  4DR1 M;  3DOA A;  4B08 A;  3SAW A;  1HNX M;  2ZAM A;  3EIH A;  2XFT A;  3FUU A;  2Y0Q A;  1KFV A;  4LFC M;  1E9S A;  4OVZ A;  3L27 A;  3AOE C;  4PCZ A;  3FTF A;  2R4J A;  3ILK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...