4JV5O

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4jv5O00
4B3SO 1XNQO 1IBKO 1XEQA 4JI2O 1HNXO 2UU9O 4LF8O 4YHHO 2ZM6O 4JI5O 1XMQO 4LF9O 2F4VO 4LF4O 3OTOO 4DV2O 1R1BA 2AGAA 4B3TO 4JI7O 4GKKO 4LFBO 4DR5O 4NXNO 2DOSA 4JI1O 2UXDO 4DR4O 4DUZO 1HNZO 4JI8O 5IT9N 5LL6Y 3JAMN 5A2QN 4DR3O 4DR7O 2HHHO 4DV1O 4DR1O 4LFCO 1R6TA 2N74A 2LW7A 1FJGO 5BXZA 4DV0O 5LMNO 2VQEO 4B3MO 4LF6O 1AB3A 2UUAO 4OPHA 1NS1A 4NXMO 1XNRO 4OPAA 4DR6O 1HR0O 1FYJA 1N34O 4OX9O 1XMOO 5LMUO 5IWAO 1FKAO 1AILA 1J5EO 4JI3O 3J7AU 3SDLA 1DK1A 4JYAO 4JV5O 3RT3C 4K0KO 3T1HO 2UXBO 4LFAO 4YY3O 3R66A 4DV3O 5FLXN 2Z0AA 4DV7O 4LF7O 2UUCO 1F7YA 2E5LO 2UUBO 1G1XB 3J80N 4B3RO 4DR2O 3O65A 4JI6O 2FKXA 4X66O 4LF5O 1N33O 1A32A 2JRIA 2ZKOA 1N36O 1HNWO 1I94O 5BY1A 1YZBA 2VQFO 1D2DA 4JI4O 5H5NA 1N32O 1X59A 4JI0O 3J81N 4GKJO 4X62O 4DUYO 1KUQA 3M8AA 4KHPO 2UXCO 4DV4O 3T1YO 4AQYO 5BR8O 1IBLO 1IBMO 4DV5O 4A5UB 4X64O 4X65O 4DV6O 2DJVA 3F5TA
chains in the Genus database with same CATH superfamily
2R9IA 3L75H 4B3SO 1X4TA 5EBWC 1R1BA 2HJDA 2F1MA 4I55B 1HNZO 4IYIA 1MNGA 5IT9N 5EBMC 4Q20A 1PPJH 3MAQA 3VQVA 3RYFA 5K1XA 4K8ZA 4ZOLA 4J9YB 5EZYB 2VQEO 2B9ZA 2V7QG 4MT8A 3BA8A 3ZS8C 1BS3A 4FK5C 2BOCC 3RWRD 2WLIA 1FYJA 1FAFA 3B09A 2ZE5A 1J5EO 4I7ZB 2OTLV 4IIJB 2WLLB 4X9QA 1TUEB 3BY6A 4JI6B 2E3CA 1JJOA 5L3EA 3N2GB 3BEHA 5IYZB 3LSUA 1PNLA 2QKSA 3APQA 5K1PA 5CN0A 1K9MW 3R65A 5L3DA 1KYOF 2QKCA 1YTFB 3H1HH 2IW5A 3JARB 2H94A 3CCRV 3NXSA 3SPJA 4EKWA 1AVMA 5KAIZ 1YDXA 1LNQA 2HJFC 3UT5B 4UCUA 4UVAA 1IURA 2DYRC 3JAKA 5JJJB 2GTSA 3CEIA 1HNXB 1YHQV 1BGYH 4O4LA 4CS3A 3JD3A 4DR5B 4NXNB 4H37A 4WF9V 1IXBA 4X1YA 3L9DA 2QTSA 4J11A 4LFCB 3K58A 4JAUA 4UV9A 1V55B 3IAYA 4B3MB 1NH2B 2ZT9B 4X1IA 4B3TO 3T4ZA 4ASUG 1R3LC 2CH7A 4XDKA 5KMGA 1W0JG 5J2TA 1N8RW 2YUAA 4MVRA 2PGGA 5IE9A 4O4IA 2C2AA 2OCCC 5LMNO 2Q9LA 2UUAO 5JJEB 1NJIW 1S5JA 3FD9A 4K0KB 4WFAV 1AI4A 1KBHA 1YJWV 1H8EG 2W6JG 4WFGA 5CBFA 1N34O 4DV3B 2UUCB 3E89A 4C7UA 2OIGA 3A0RA 2AXTZ 2QWRB 2Y4TA 4TV8B 4EEQA 2WA4A 1FXKB 1VQ9V 1VQ7V 3TETA 2P6JA 4IL6Z 2N04A 4E2LA 1M5IA 3JD1A 1SA0A 4KFMA 2EILB 5FNVB 4X66O 3NR7A 4F6RA 4PJ0Z 1NVPD 2X6BA 1MA1A 1Q6HA 1D2DA 2EIKC 3ABLB 4EFEA 1X59A 4JI2B 2Q67A 4GX0A 4YHHB 5KX5B 1AI5A 1QNMA 4J10A 1SETA 1I5YA 1VQKV 1VF6A 4DUZB 4BWAA 5LP6A 5B1NA 4J7ZA 4KL1A 4CH5A 4JYAB 3LDCA 3AEIA 1GM9A 4Z1MG 1VQ8V 4MW3A 1DF5A 2ADQB 1QCEA 1K5SA 3D3QA 1H8HG 1OCRB 1K3EA 4UVCA 3ZJZA 2DOSA 1K92A 1UJWB 2W6IG 1HR0B 2DMXA 3ZX6A 1L0LH 1AP6A 1XMOB 3CSXA 5IWAB 5FPOA 5J2TB 3SR2C 4TUYA 2YDEA 3DXRA 3CP1A 3KKYA 3PJSK 4QNHB 4RUFA 2BE3A 1GTOA 4CBCA 4CC6A 2HR3A 1HDJA 2QGNA 2F23A 3KCXA 4OX9O 5B1BC 1JMKC 1MSWD 3VBBA 5CA0A 1FKAO 4JPRA 1KMIZ 2IBZH 4JYAO 2Z5UA 4JV5O 2LGWA 4LH6A 4GUNA 2FYUH 2UXBO 1FPOA 3R66A 3CCMV 5CA3A 4MVOA 1N33B 3FAVB 1OCZB 3ZCCA 1HNWB 4HAMA 1YITV 2IH1C 1OCCB 3E83A 2R9AA 4B3RO 3LDEA 3HKDA 3W7TA 1V9PA 2CGNA 1SS3A 1BT8A 4YXWG 1IZ3A 4AI8A 3ABMB 4X65B 3ABUA 4IHJA 3TJTA 4FPPA 2Q7EA 2VQFO 3RVZA 5CBHA 1Q43A 3OR7C 4CH4A 3AG3B 4WFEA 1RM1C 1ZWIC 3UQ8A 1RP3B 1L0NH 3HKBA 5L3GA 4X64O 1KB9F 1LUVA 1VQ5V 2CTRA 3IC9A 3AK2A 4I50A 3JAWA 3N2KB 1BCCH 2GHYA 1XEQA 2QM8A 2WLNA 1JVMA 1HW7A 1BHBA 1THZA 4XDJA 4LCUC 4F4LA 1F4NA 4JI1O 5IY5C 4DR4O 3FB6C 4G27B 4Q6GA 3W7WA 3ASOC 4DR1O 5LMUB 2QKAA 3E8GA 4YJ3B 2DYSB 2YI9A 4FLWA 1IDSA 3ZEDA 1RPRA 5EYPB 4F6EA 2R9RB 4DR6O 1NU1H 2LP7A 5C8YB 3B40A 4YY3B 4I0XA 1VQ6V 1TVKB 1Z5VA 1O9HA 1FFXA 3E86A 2Y4UA 4J9ZB 3W7XA 2WA3A 1QLNA 5ITZA 4L8JA 1ENVA 1JQ0A 1YCIA 2Q7HA 4BIOA 2P67A 4JZ2A 1SQPH 2IH3C 4LFAO 1R3KC 1ZUQA 4LF5B 1H2LA 1Q90D 1EZVH 2KG7A 2ETNA 3BHPA 4P2ZA 3H1IH 4PELA 2MK3A 3AG1C 2EIMB 1KP2A 4B7EA 5DM6V 4MTGA 1TA8A 2ZE7A 5CMUA 5BY1A 4GX5A 4E4EA 5LOVB 4RQFA 2O57A 3VQWA 3MD0A 1XNQB 4I9QA 2ZM6B 3K9AA 3K59A 1OCOC 4NTWA 1SQXH 3C3SA 5CBGA 4O4HA 2JGDB 4A5UB 4DV6O 1SQVH 3SJQC 1QU7A 3JD2A 5LGNA 2RJZA 3HKBB 4DK0A 4BW9A 2X6AA 3CS5A 2F4VO 1JPXA 1J95A 5J2UA 4O2AB 5JQGB 3OUSA 1SESA 1MABG 2AGAA 4X20A 3AG2B 1QR9A 3ZHSA 4CH3A 4JI8O 3G80A 5A2QN 2ZINA 4UCTA 4O2BB 2DYRB 2F95B 2N74A 2Y69B 4I5SA 1GM8A 4GX1A 5DEDA 1Y66A 1WAZA 3JCUZ 4HZ3A 2PTMA 2BCCH 4OPHA 1ZTEA 1B04A 2QWPB 1GN2A 1WA8A 3OD4A 1AI6A 3HKEA 3ZRXA 2E5LB 1B6QA 5H9CA 1MSDA 3RVYA 2Y0IA 4R7CA 3HKCA 1ZSPA 4R50A 1OV9A 2WAMA 2Q69A 3CE2A 3ZMUA 5LXTB 2MW2B 1NVPB 4LF7O 2DW4A 4LBEC 3RN4A 3CC2V 2OCCB 3D36A 3O65A 1KD1W 4TV9B 4QJFB 2E76B 3SJCC 1IBLB 2F43G 3LSQA 5B1OA 1R6KA 2QM7A 3BA9A 1I5XA 4P9OA 2LW1A 3CRMA 4B3SB 4FFKA 5TISZ 1N32O 4JI0O 1VF6C 3ABKC 1GN6A 4FMTA 3JATA 3AG4C 3PN1A 1P7BA 1HNZB 3STZC 1EN4A 3RYHA 3F5TA 4BIZA 2YEVB 1ZLZA 1ZX3A 2UU9O 4LF8O 1JFFA 3ASNC 3OTOO 4DV2O 2VQEB 3JD4A 2EZOA 4O4JA 2V4DA 5AG2A 4KUMA 3IJ4A 3DC5A 4X89A 3ZRWA 1XDCA 1J5EB 1FJGO 4MS2A 3B4SA 4LF6O 2QDOA 5DECA 1W2BU 1I94B 3CC4V 3RYIA 4OPAA 3QO5A 1HP8A 2DQ0A 3OT7A 4UVBA 5LBQA 4HBNA 2JEXA 3ETQA 4J7JA 3STLC 3LNMB 2JGUA 1RSOA 3OGCC 2HFEC 1RPOA 3HKEB 3GVMA 2YICA 3BRCA 2XAHA 3CWBH 3QO8A 4LP8A 5KA5A 4YJ2B 3HKCB 4PA4A 5FLXN 3L74H 1NT2B 1ZL8B 1GMGA 2UUBO 3E2EA 3J80N 2IJIA 2OTJV 2XNDG 3K5OA 1VQPV 3TGUH 1SQBH 5L3FA 2QSAA 3JALA 3U0ZA 3K04A 4ICGA 1I94O 2QE7G 1XHXA 2Q68A 5JVDA 3LNNA 1QVFU 2NN4A 3OGIB 3J81N 5LHGA 4KHPO 4B3TB 4D7TA 5JJNB 4CC5A 3QG5A 2GTAA 5B3SB 1H38A 1FD9A 4DW0A 4R8CA 2OCHA 3CRAA 5C93A 1CXZB 1IBKO 1XMQO 2A0LA 4X1KA 4MTOA 5LMNB 4FVMA 4PDVA 4UXNA 2UUAB 1GN3A 3ZRVA 1NKDA 1CP9A 2P7TC 1OJHA 2L35A 4D6TH 1N0NA 4ZI7A 3K57A 1N34B 1Q7YW 3WU2Z 1G6UA 2LW7A 4JGSA 3B8MA 3UCSC 4LWSB 5GONB 3I56V 2G38A 1WP7A 1WJZA 1QBZA 3SYAA 2EULA 4WBNA 3CCVV 1RM1B 2JK5C 1SZTA 4TQFA 4MVUA 3B77A 2WLHA 2JS3A 1R3IC 3FB7C 2FB5A 2CTQA 1MG1A 1K4DC 4J42A 4H0LB 5LHHA 1QLEB 2AW9A 1Q3EA 3SDLA 2W0FC 1PNMA 2XUMA 4PDRA 5IYBO 4J41A 3RYFB 1GKFA 4X66B 2EIJC 4EFBA 4ZOLB 1GAXA 2P4KA 2XASA 3ASOB 1BL8A 1F51A 1JCHA 1YXBA 2WLIB 5IJ0A 1XUQA 3E22A 3SYQA 3ZN0A 3L73H 2JJ1G 3G6EV 2N05A 2VWJA 2XOKG 2ZKOA 1Y4MA 3OUFA 2LFSA 2WLMA 1D5NA 1SQFA 1CEZA 4FZ1A 3FYEB 3FX7A 1DF4A 3JALB 4JAVA 2WWWA 3LSSA 2JS5A 1XL4A 1PNKA 1PKXA 3H1KH 3S3WA 4X62O 5D5QA 1LR1A 4FJCC 2YIDA 2UXCO 2K9PA 3F7VC 2B5UA 3S3XA 2YIAA 5JH7A 4MTXA 4UFZA 5JCOA 3CXCU 2EZPA 2GUZA 3AG7A 3U11A 4DXWA 3AG1B 1AROP 3CJHA 3WB0A 4FM0A 2ODMA 2V1DA 3WB1A 3JAKB 4K35A 2DN9A 3JYCA 1GN4A 4OX9B 3L71H 4X88A 1VARA 4N23A 4O4LB 1PM9A 3BVOA 5KHKA 1K97A 1H2KA 2ZIOA 4JV5B 1OCOB 2QWQB 4X1YB 1VF7A 3ZHVA 1NI8A 2UXBB 2ZR3A 5LYJA 2PY5A 3G6BA 3SYPA 5KHIA 1Y74A 5IDJA 4X1IB 1YEWA 3P3PA 2CH7B 3WFVA 1Q86W 1XL6A 5KMGB 3VOUA 4B3RB 2AZ2A 2XT9A 4FM2A 3CCJV 2AHZA 4O4IB 3APOA 3D36C 4DV7O 5IJ9A 3E8FA 2VQFB 2A3QA 2QWOB 4FLZA 5BMVA 3F5WC 1WN7A 2YIBD 3B8NA 3CC7V 1AR1B 4X64B 4HYOA 1SQGA 1H2SB 1M57B 4NTYA 4TSFG 5CB4A 3OAAG 1T5EA 3M99B 1SRYA 2M7WA 4NXMB 2A9HA 4GKJO 1QR8A 4JYCA 4DRXA 1DGSA 3ZBHA 5B1AC 4MW8A 3CCQV 4DV4O 2HP8A 4RQEA 4JI1B 5BR8O 4J7KA 4DR4B 1SA0B 4JYYA 2X7RB 4ZHQA 5JWPA 2ATKC 1WP8A 1E1RG 2HLDG 4DR1B 3TCUA 1VEWA 1XQ8A 2ZIMA 4F6RB 5IYDO 1QQCA 4JI7O 4LFBO 2IU3A 4DR6B 3SYOA 5LL6Y 4DR3O 3CMAV 3OM3B 3RFRA 4GLXA 1S76D 1KC8W 1R6TA 2CAZC 4R6ZA 2FMLA 4NYKA 1UPGA 5LP6B 3ABKB 2YSUB 5BZBA 1K34A 2VRZA 5HFMA 3K0DA 4CH6A 4NXMO 3A0HZ 5H6QA 4LFAB 3AG4B 1XI1A 5LYJB 4CS4A 4BIUA 4U3JA 1G8MA 4FLVA 2BSKA 1AI7A 2Q4PA 3Q4HA 1GM7A 4MVQA 4EB6A 1TAEA 2YI8A 3T1HO 3C3TA 3K08A 3OMNB 3OFNG 4LNUA 4UUJC 4TUYB 2ZNIA 3DXRB 2OT5A 2H8PC 1BMFG 1BE3H 5CA0B 3ICXA 2GBOA 2JEUA 1URFA 2Q73A 3RYCA 1JA8A 4PA7A 3SPIA 1FXHA 4DV6B 5KA6A 2ZE8A 3TXSA 4JI4O 1VQMV 2Y48A 2F4VB 1PV0A 1YIJV 1WPBA 1TUBA 2XTAA 3LUTB 3T1YO 4CZZA 4NR1A 4FLTA 2Y0PA 4JI8B 5LA6A 3ZHTA 2AZ0A 3FYIB 4ABMA 3E8HA 2ZDIC 5E79Z 2EILC 3HKDB 1VQOV 4AILC 1V54C 1M9NA 2WSSG 3O9OA 1XOUA 2D2CB 2GDSA 2RNBA 2A7WA 3UKMA 4IHJB 2UXDO 3ZN1A 2PI5A 3ABLC 1S77D 2HVKC 2QA4V 3OMAB 4HNAA 1FXVA 2HKOA 3QF7A 1S5LZ 1YSCA 5CA1A 4PA3A 3P32A 3JASA 1AB3A 4I50B 1BQZA 3JAWB 3OE7G 4PI2A 5LGTA 3EFFK 2W0XA 1YJ9V 2BTOA 3MHSC 4OGQB 5KUKA 4LF7B 4BR6A 4JI3O 3QVNA 2NR5A 1MZFA 1PD3A 3RT3C 4JTCB 3T1CA 2K1EA 2YIBA 3CPWU 3OEEG 1UFIA 2ILMA 1COWG 1WB7A 4D7SA 4WFHA 1LUWA 1Z5WA 1NTZH 1GRJA 2KSDA 1Z2GA 2ZXWC 1G1XB 1N32B 4JI0B 4I0XB 3CMEV 4DR2O 1FFXB 4UCSA 4NVPA 1NBMG 4IYHA 4LH7A 5KAFZ 3SJAC 3WG7C 1A32A 2JRIA 1N36O 5ITZB 1NR7A 2XAFA 2IU0A 3CHXA 1YI2V 3GB7C 2YC0A 4I55A 4TT3G 3ZIAG 4Z2WA 3RGBA 2UU9B 4LF8B 3SPCA 3OTOB 4DV2B 1RFYA 2IM9A 5JCOC 2KG7B 3M8AA 1S3JA 4WFFA 1WB8A 5EZYA 1TUBB 1OCCC 4DV5O 2EIJB 1NTMH 3X2QC 3VQXA 3A8TA 4JI5O 4LF9O 4LF4O 1FJGB 2R72A 2OWOA 1YJNV 2NNUA 4RAIA 1S0VA 1K5QA 2Q5ZA 4LF6B 3ABMC 4GKKO 3W7SA 4JF3A 5EBLC 2PYLA 2LGQA 4IIJA 2WLLA 3CCUV 3JAMN 3CB2A 3KZIZ 3ETDA 4DV1O 4K3AA 4KP4A 1XILA 1Y67A 1FS0G 3N2GA 4O4HB 4DV0O 4ZKIA 5IYZA 4MVMA 2F93B 1DTOA 3G71V 1XNRO 2KB1A 1N0JA 3JCZA 2BTQA 3JARA 5J2UB 1NQTA 2YXYA 3ZHUA 3K5MA 1Q82W 5GTIZ 1W0KG 3QNEA 4X20B 1M1KW 2UUBB 4WFBV 3UT5A 3JSLA 2EIKB 1N4CA 4FFBA 2CTWA 4XBFA 3CCSV 3RBZA 4N21A 1M93A 3LDDA 3K5LA 3WB2A 1IVSA 4P9PA 2YXLA 4H33A 2IJHA 3ZHQA 3ZMVA 2JJ2G 2KKWA 1WA8B 4KHPB 1XBLA 2EJRA 1EN6A 1VQ4V 1PL0A 4H44B 1IBKB 2CUGA 1XMQB 3UM7A 2D3OW 5LHIA 4DUYO 2GV9A 4KXRA 1KP3A 4RUEA 4AQYO 3I55V 1IBMO 1GH6A 4IGGA 3SGIA 2EIMC 1ZAUA 4YIOA 2LFRA 5B1BB 1L8DA 1U97A 3IGAC 1M56C 1Y76A 3CYOA 4ZIBA 3K79A 5H6RA 1HWYA 4BAYA 4DR7O 4TV8A 4J80A 2ZCEA 1FXKA 3JATB 4DW1A 3BFRA 3K3WA 2CE4A 2EBOA 2P5OA 5BXZA 1QHTA 4JTAB 1WLEA 4GCZA 3RYHB 4QPJA 5B1AB 4I4TA 1JFFB 3QTCA 2ZDIA 1SF9A 2BTQB 1AILA 2ZR2A 4P30A 5FNVA 4O4JB 3AG2C 1D5AA 2LQTA 1DK1A 1AP5A 3ZRWB 5KX5A 2Y69C 3P3NA 4FFBB 3I5DA 2RN9A 4PA6A 1BHAA 4RWUA 1AR5A 2KQXA 3RYIB 2LJ2A 4X62B 4BW5A 2UXNA 4JI6O 2UXCB 2YS8A 1RSOB 4MVZA 1YZBA 3ZMSA 2HEPA 5IY5B 4UV8A 1Q5OA 1SZXA 2NLJC 2EINC 1AJQA 5D5PA 4QPKA 5B5EZ 3N27A 1S72V 3GWOA 1WNSA 4JASA 1KU9A 5GW7A 5FPRA 1VMGA 1GK9A 2EJ7A 3VQYA 2DJVA 2XHBA 3M7MX 1KKDA 3DGEA 4UCVA 1HNXO 1EZJA 4XDLA 4B08A 3H01A 3BABA 3MHHC 2L6LA 1BSMA 3CCLV 1KQSU 4LR3A 4DR5O 4NXNO 5JVDB 3CXHF 1MMMA 1Y76B 4FLXA 1JX9A 1Q8IA 1NZ6A 4LFCO 4PDLA 3EXAA 3FKSG 2ITCC 3FAVA 4B3MO 5EC1C 4GX2A 1BZKA 3BAAA 3K03A 3KG2A 4X1KB 3KCYA 4DV7B 4I4TB 2LO1A 1SC5B 3ZMTA 4G28B 4NKGB 4QE9A 2PI4A 1V54B 5LGUA 4UB6Z 4ZI7B 2ZQMA 4K0KO 3FB8C 3H1LH 4DYLA 2Q0OC 2HG5C 2OIEA 3SJBC 2QJ1A 4DV3O 5E1AC 4RO2A 2UUCO 2XAGA 3BPZA 4WBNB 1G4YB 5HFLA 4FIPC 5A9GA 4GKJB 4YIPA 3N2KA 2WLJA 4MTFA 4DV4B 2XAQA 3CRCA 2CTPA 5KLVH 5BR8B 1K73W 4UCRA 3L72H 3IFXA 4G2KA 1XHZA 2DWEC 2E74B 1Y6XA 1P49A 2OYQA 1KUQA 4QIWF 4AHCA 2FTKA 1L1FA 4YJ3A 4JI7B 4FM1A 4LFBB 2Q0AA 3SYCA 3ETGA 1W59A 4DR3B 1SERA 3ETEA 5EYPA 5F2VO 5IJ0B 3E22B 4WCEV 4JI2O 5C8YA 4Z1VA 4YHHO 2ZXWB 4NB5A 1EM1A 1TVKA 3UO2A 3SPGA 3MDSA 3QO7A 3CD6V 3OMIB 4DUZO 3WG7B 3SPHA 1M90W 2Q6AA 4PD4F 3TXQA 5IYCO 3CRQA 3OEHG 1TGOA 1XREA 2YXHA 2QR4A 5JH7B 4GZRB 1IX9A 5B3SC 2B1IA 2AHYA 1F23A 1NS1A 1AJNA 5KHHA 3T1HB 1HR0O 2GUZB 1K4CC 2RMKB 5GTHZ 4MSWC 3W7UA 4GYCB 1XMOO 4PDMA 4W4KA 5IWAO 3CJHB 3X2QB 4TOIA 2PYJA 2ADPA 3A2FA 3THOA 1VF5B 5LOVA 1QVGU 1E79G 1P4RA 1B3QA 3EHBB 5EK0A 2P90A 5KHGA 3CX5F 4U7NA 1DLBA 2JGDA 1V55C 4JI4B 1KECA 2XAJA 1WPXA 4DO2A 1I7FA 1R6NA 1Y74B 2JDIG 3D8CA 3ASNB 3T1YB 1N33O 2VS0A 1HNWO 1QLEC 4O2AA 5JQGA 3BCCH 4GT1A 3UO3A 1VQNV 3GWKC 1I08A 1SKVA 1YTFD 4W4LA 1JJ2U 3IC7A 3HPLC 3D3IA 4O2BA 2IJJA 1O9GA 4FZ0A 5IJ9B 2P22C 1U96A 1P84F 3ML0A 2UXDB 3DSQA 3B2EE 1EBOA 2P06A 4X65O 1I0HA 5BMVB 3H9VA 5DN6G 3RW0A 2FL4A 2Z3YA 1SQQH 2WLKA 2IJKA 1KKCA 3DTUB 2F66C 1FXKC 4H13B 4JTDB 3U10A 4PI0A 4CS2A 5CB4B 5EC2C 4UCOA 3K06A 2QM4A 4DRXB 2QWNB 1H2GA 3L70H 3G4SV 4JI3B 1AJPA 4DK1A 1NH2D 2CDYA 4JAAA 4ZHQB 5LXTA 2DE0X 3P30A 4NTXA 1H2MA 3TK1A 5EIBC 3G67A 3E35A 1CPYA 5LMUO 3OTFA 4TQDA 1E1QG 2UXXA 4TV9A 1M4UA 3ABTA 1P7GA 1S5HC 3JSNA 1K7DA 4DR2B 1M56B 1K33A 1R73A 4YY3O 4B7KA 1VQLV 1N36B 2VWKA 3AK1A 1F7YA 4PV1B 2X0LA 1PL4A 2EX3A 1OCRC 1GO3F 2YEVA 2HHHB 4LF5O 4U3JB 1ORQC 2BSKB 4DV5B 3C90A 3Q4HB 2A06H 1B06A 4EB6B 1US6A 1NR1A 5H5NA 1Q81W 4JI5B 3FB5C 4LF9B 4LF4B 4LNUB 2H3OA 1VP7A 3K5NA 1YF2A 5EIBD 3ZMZA 1MZEA 1VIBA 4GKKB 5KUMA 2ZE6A 4U7OA 5KHJA 2M6YA 1K8AW 4DV1B 1XNQO 4X8AA 3RYCB 2ZM6O 2PF4E 4DV0B 3E8BA 3CRRA 4U3FH 4L87A 3HR0A 2P4VA 2X6CA 1XNRB 1PP9H 2JIZG 1AR4A 1FFTB 1M57C 1MOFA 1OCZC 4QE7A 5FL7G 2PZSA 1OZ0A 1Q6UA 2HHHO 1F4MA 2B1GA 1JR9A 4MVSA 4YJ2A 3K9SA 1Q6IA 5LA6B 2EINB 2ARHA 1ZL8A 3A0BZ 4TWKA 2BOBC 5L3CA 1NTKH 1H2NA 5J9PC 3AK3A 3ZHRA 4PA9A 1EFRG 4JZGA 4JYBA 2A79B 2RQ6A 2QEXV 3J7AU 2QTOA 3AG3C 2RDCA 4OXSA 5L3BA 2DQ3A 4HNAB 4I9WA 3CCEV 2ITDC 3OR6C 2ZNJA 5CA1B 4FLUA 2Q7GA 2WPDG 2Z0AA 3JASB 5LP6C 3ZRSA 4LC1A 4UB8Z 3FFQA 3H1JH 1YVWA 2CGOA 2PUSA 4IT5A 2E5LO 2DWDC 2JVDA 2GSMB 3OW2U 4DUYB 2ZD9A 2FKXA 4AQYB 3T4DA 1IBMB 4ZBMA 1JOYA 1EN5A 1IXMA 3HB3B 2R70A 2HVJC 2RCVA 2DYSC 3F7YC 1OHHG 2CK3G 3T2MA 1ROPA 3EVKA 3K0GA 4PHZA 1BQ0A 5B66Z 3JD0A 2Q8VA 4LWSA 5GONA 1IBLO 4K8XA 4QGPA 5H2FZ 4DR7B 4FLYA 2E75B 1R3JC 3DC6A
chains in the Genus database with same CATH topology
4B3SO 1XNQO 1IBKO 1XEQA 4JI2O 1HNXO 2UU9O 4LF8O 4YHHO 2ZM6O 4JI5O 1XMQO 4LF9O 2F4VO 4LF4O 3OTOO 4DV2O 1R1BA 2AGAA 4B3TO 4JI7O 4GKKO 4LFBO 4DR5O 4NXNO 2DOSA 4JI1O 2UXDO 4DR4O 4DUZO 1HNZO 4JI8O 5IT9N 5LL6Y 3JAMN 5A2QN 4DR3O 4DR7O 2HHHO 4DV1O 4DR1O 4LFCO 1R6TA 2N74A 2LW7A 1FJGO 5BXZA 4DV0O 5LMNO 2VQEO 4B3MO 4LF6O 1AB3A 2UUAO 4OPHA 1NS1A 4NXMO 1XNRO 4OPAA 4DR6O 1HR0O 1FYJA 1N34O 4OX9O 1XMOO 5LMUO 5IWAO 1FKAO 1AILA 1J5EO 4JI3O 3J7AU 3SDLA 1DK1A 4JYAO 4JV5O 3RT3C 4K0KO 3T1HO 2UXBO 4LFAO 4YY3O 3R66A 4DV3O 5FLXN 2Z0AA 4DV7O 4LF7O 2UUCO 1F7YA 2E5LO 2UUBO 1G1XB 3J80N 4B3RO 4DR2O 3O65A 4JI6O 2FKXA 4X66O 4LF5O 1N33O 1A32A 2JRIA 2ZKOA 1N36O 1HNWO 1I94O 5BY1A 1YZBA 2VQFO 1D2DA 4JI4O 5H5NA 1N32O 1X59A 4JI0O 3J81N 4GKJO 4X62O 4DUYO 1KUQA 3M8AA 4KHPO 2UXCO 4DV4O 3T1YO 4AQYO 5BR8O 1IBLO 1IBMO 4DV5O 4A5UB 4X64O 4X65O 4DV6O 2DJVA 3F5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S O;  1XNQ O;  1IBK O;  1XEQ A;  4JI2 O;  1HNX O;  2UU9 O;  4LF8 O;  4YHH O;  2ZM6 O;  4JI5 O;  1XMQ O;  4LF9 O;  2F4V O;  4LF4 O;  3OTO O;  4DV2 O;  1R1B A;  2AGA A;  4B3T O;  4JI7 O;  4GKK O;  4LFB O;  4DR5 O;  4NXN O;  2DOS A;  4JI1 O;  2UXD O;  4DR4 O;  4DUZ O;  1HNZ O;  4JI8 O;  5IT9 N;  5LL6 Y;  3JAM N;  5A2Q N;  4DR3 O;  4DR7 O;  2HHH O;  4DV1 O;  4DR1 O;  4LFC O;  1R6T A;  2N74 A;  2LW7 A;  1FJG O;  5BXZ A;  4DV0 O;  5LMN O;  2VQE O;  4B3M O;  4LF6 O;  1AB3 A;  2UUA O;  4OPH A;  1NS1 A;  4NXM O;  1XNR O;  4OPA A;  4DR6 O;  1HR0 O;  1FYJ A;  1N34 O;  4OX9 O;  1XMO O;  5LMU O;  5IWA O;  1FKA O;  1AIL A;  1J5E O;  4JI3 O;  3J7A U;  3SDL A;  1DK1 A;  4JYA O;  4JV5 O;  3RT3 C;  4K0K O;  3T1H O;  2UXB O;  4LFA O;  4YY3 O;  3R66 A;  4DV3 O;  5FLX N;  2Z0A A;  4DV7 O;  4LF7 O;  2UUC O;  1F7Y A;  2E5L O;  2UUB O;  1G1X B;  3J80 N;  4B3R O;  4DR2 O;  3O65 A;  4JI6 O;  2FKX A;  4X66 O;  4LF5 O;  1N33 O;  1A32 A;  2JRI A;  2ZKO A;  1N36 O;  1HNW O;  1I94 O;  5BY1 A;  1YZB A;  2VQF O;  1D2D A;  4JI4 O;  5H5N A;  1N32 O;  1X59 A;  4JI0 O;  3J81 N;  4GKJ O;  4X62 O;  4DUY O;  1KUQ A;  3M8A A;  4KHP O;  2UXC O;  4DV4 O;  3T1Y O;  4AQY O;  5BR8 O;  1IBL O;  1IBM O;  4DV5 O;  4A5U B;  4X64 O;  4X65 O;  4DV6 O;  2DJV A;  3F5T A; 
#chains in the Genus database with same CATH topology
 2R9I A;  3L75 H;  4B3S O;  1X4T A;  5EBW C;  1R1B A;  2HJD A;  2F1M A;  4I55 B;  1HNZ O;  4IYI A;  1MNG A;  5IT9 N;  5EBM C;  4Q20 A;  1PPJ H;  3MAQ A;  3VQV A;  3RYF A;  5K1X A;  4K8Z A;  4ZOL A;  4J9Y B;  5EZY B;  2VQE O;  2B9Z A;  2V7Q G;  4MT8 A;  3BA8 A;  3ZS8 C;  1BS3 A;  4FK5 C;  2BOC C;  3RWR D;  2WLI A;  1FYJ A;  1FAF A;  3B09 A;  2ZE5 A;  1J5E O;  4I7Z B;  2OTL V;  4IIJ B;  2WLL B;  4X9Q A;  1TUE B;  3BY6 A;  4JI6 B;  2E3C A;  1JJO A;  5L3E A;  3N2G B;  3BEH A;  5IYZ B;  3LSU A;  1PNL A;  2QKS A;  3APQ A;  5K1P A;  5CN0 A;  1K9M W;  3R65 A;  5L3D A;  1KYO F;  2QKC A;  1YTF B;  3H1H H;  2IW5 A;  3JAR B;  2H94 A;  3CCR V;  3NXS A;  3SPJ A;  4EKW A;  1AVM A;  5KAI Z;  1YDX A;  1LNQ A;  2HJF C;  3UT5 B;  4UCU A;  4UVA A;  1IUR A;  2DYR C;  3JAK A;  5JJJ B;  2GTS A;  3CEI A;  1HNX B;  1YHQ V;  1BGY H;  4O4L A;  4CS3 A;  3JD3 A;  4DR5 B;  4NXN B;  4H37 A;  4WF9 V;  1IXB A;  4X1Y A;  3L9D A;  2QTS A;  4J11 A;  4LFC B;  3K58 A;  4JAU A;  4UV9 A;  1V55 B;  3IAY A;  4B3M B;  1NH2 B;  2ZT9 B;  4X1I A;  4B3T O;  3T4Z A;  4ASU G;  1R3L C;  2CH7 A;  4XDK A;  5KMG A;  1W0J G;  5J2T A;  1N8R W;  2YUA A;  4MVR A;  2PGG A;  5IE9 A;  4O4I A;  2C2A A;  2OCC C;  5LMN O;  2Q9L A;  2UUA O;  5JJE B;  1NJI W;  1S5J A;  3FD9 A;  4K0K B;  4WFA V;  1AI4 A;  1KBH A;  1YJW V;  1H8E G;  2W6J G;  4WFG A;  5CBF A;  1N34 O;  4DV3 B;  2UUC B;  3E89 A;  4C7U A;  2OIG A;  3A0R A;  2AXT Z;  2QWR B;  2Y4T A;  4TV8 B;  4EEQ A;  2WA4 A;  1FXK B;  1VQ9 V;  1VQ7 V;  3TET A;  2P6J A;  4IL6 Z;  2N04 A;  4E2L A;  1M5I A;  3JD1 A;  1SA0 A;  4KFM A;  2EIL B;  5FNV B;  4X66 O;  3NR7 A;  4F6R A;  4PJ0 Z;  1NVP D;  2X6B A;  1MA1 A;  1Q6H A;  1D2D A;  2EIK C;  3ABL B;  4EFE A;  1X59 A;  4JI2 B;  2Q67 A;  4GX0 A;  4YHH B;  5KX5 B;  1AI5 A;  1QNM A;  4J10 A;  1SET A;  1I5Y A;  1VQK V;  1VF6 A;  4DUZ B;  4BWA A;  5LP6 A;  5B1N A;  4J7Z A;  4KL1 A;  4CH5 A;  4JYA B;  3LDC A;  3AEI A;  1GM9 A;  4Z1M G;  1VQ8 V;  4MW3 A;  1DF5 A;  2ADQ B;  1QCE A;  1K5S A;  3D3Q A;  1H8H G;  1OCR B;  1K3E A;  4UVC A;  3ZJZ A;  2DOS A;  1K92 A;  1UJW B;  2W6I G;  1HR0 B;  2DMX A;  3ZX6 A;  1L0L H;  1AP6 A;  1XMO B;  3CSX A;  5IWA B;  5FPO A;  5J2T B;  3SR2 C;  4TUY A;  2YDE A;  3DXR A;  3CP1 A;  3KKY A;  3PJS K;  4QNH B;  4RUF A;  2BE3 A;  1GTO A;  4CBC A;  4CC6 A;  2HR3 A;  1HDJ A;  2QGN A;  2F23 A;  3KCX A;  4OX9 O;  5B1B C;  1JMK C;  1MSW D;  3VBB A;  5CA0 A;  1FKA O;  4JPR A;  1KMI Z;  2IBZ H;  4JYA O;  2Z5U A;  4JV5 O;  2LGW A;  4LH6 A;  4GUN A;  2FYU H;  2UXB O;  1FPO A;  3R66 A;  3CCM V;  5CA3 A;  4MVO A;  1N33 B;  3FAV B;  1OCZ B;  3ZCC A;  1HNW B;  4HAM A;  1YIT V;  2IH1 C;  1OCC B;  3E83 A;  2R9A A;  4B3R O;  3LDE A;  3HKD A;  3W7T A;  1V9P A;  2CGN A;  1SS3 A;  1BT8 A;  4YXW G;  1IZ3 A;  4AI8 A;  3ABM B;  4X65 B;  3ABU A;  4IHJ A;  3TJT A;  4FPP A;  2Q7E A;  2VQF O;  3RVZ A;  5CBH A;  1Q43 A;  3OR7 C;  4CH4 A;  3AG3 B;  4WFE A;  1RM1 C;  1ZWI C;  3UQ8 A;  1RP3 B;  1L0N H;  3HKB A;  5L3G A;  4X64 O;  1KB9 F;  1LUV A;  1VQ5 V;  2CTR A;  3IC9 A;  3AK2 A;  4I50 A;  3JAW A;  3N2K B;  1BCC H;  2GHY A;  1XEQ A;  2QM8 A;  2WLN A;  1JVM A;  1HW7 A;  1BHB A;  1THZ A;  4XDJ A;  4LCU C;  4F4L A;  1F4N A;  4JI1 O;  5IY5 C;  4DR4 O;  3FB6 C;  4G27 B;  4Q6G A;  3W7W A;  3ASO C;  4DR1 O;  5LMU B;  2QKA A;  3E8G A;  4YJ3 B;  2DYS B;  2YI9 A;  4FLW A;  1IDS A;  3ZED A;  1RPR A;  5EYP B;  4F6E A;  2R9R B;  4DR6 O;  1NU1 H;  2LP7 A;  5C8Y B;  3B40 A;  4YY3 B;  4I0X A;  1VQ6 V;  1TVK B;  1Z5V A;  1O9H A;  1FFX A;  3E86 A;  2Y4U A;  4J9Z B;  3W7X A;  2WA3 A;  1QLN A;  5ITZ A;  4L8J A;  1ENV A;  1JQ0 A;  1YCI A;  2Q7H A;  4BIO A;  2P67 A;  4JZ2 A;  1SQP H;  2IH3 C;  4LFA O;  1R3K C;  1ZUQ A;  4LF5 B;  1H2L A;  1Q90 D;  1EZV H;  2KG7 A;  2ETN A;  3BHP A;  4P2Z A;  3H1I H;  4PEL A;  2MK3 A;  3AG1 C;  2EIM B;  1KP2 A;  4B7E A;  5DM6 V;  4MTG A;  1TA8 A;  2ZE7 A;  5CMU A;  5BY1 A;  4GX5 A;  4E4E A;  5LOV B;  4RQF A;  2O57 A;  3VQW A;  3MD0 A;  1XNQ B;  4I9Q A;  2ZM6 B;  3K9A A;  3K59 A;  1OCO C;  4NTW A;  1SQX H;  3C3S A;  5CBG A;  4O4H A;  2JGD B;  4A5U B;  4DV6 O;  1SQV H;  3SJQ C;  1QU7 A;  3JD2 A;  5LGN A;  2RJZ A;  3HKB B;  4DK0 A;  4BW9 A;  2X6A A;  3CS5 A;  2F4V O;  1JPX A;  1J95 A;  5J2U A;  4O2A B;  5JQG B;  3OUS A;  1SES A;  1MAB G;  2AGA A;  4X20 A;  3AG2 B;  1QR9 A;  3ZHS A;  4CH3 A;  4JI8 O;  3G80 A;  5A2Q N;  2ZIN A;  4UCT A;  4O2B B;  2DYR B;  2F95 B;  2N74 A;  2Y69 B;  4I5S A;  1GM8 A;  4GX1 A;  5DED A;  1Y66 A;  1WAZ A;  3JCU Z;  4HZ3 A;  2PTM A;  2BCC H;  4OPH A;  1ZTE A;  1B04 A;  2QWP B;  1GN2 A;  1WA8 A;  3OD4 A;  1AI6 A;  3HKE A;  3ZRX A;  2E5L B;  1B6Q A;  5H9C A;  1MSD A;  3RVY A;  2Y0I A;  4R7C A;  3HKC A;  1ZSP A;  4R50 A;  1OV9 A;  2WAM A;  2Q69 A;  3CE2 A;  3ZMU A;  5LXT B;  2MW2 B;  1NVP B;  4LF7 O;  2DW4 A;  4LBE C;  3RN4 A;  3CC2 V;  2OCC B;  3D36 A;  3O65 A;  1KD1 W;  4TV9 B;  4QJF B;  2E76 B;  3SJC C;  1IBL B;  2F43 G;  3LSQ A;  5B1O A;  1R6K A;  2QM7 A;  3BA9 A;  1I5X A;  4P9O A;  2LW1 A;  3CRM A;  4B3S B;  4FFK A;  5TIS Z;  1N32 O;  4JI0 O;  1VF6 C;  3ABK C;  1GN6 A;  4FMT A;  3JAT A;  3AG4 C;  3PN1 A;  1P7B A;  1HNZ B;  3STZ C;  1EN4 A;  3RYH A;  3F5T A;  4BIZ A;  2YEV B;  1ZLZ A;  1ZX3 A;  2UU9 O;  4LF8 O;  1JFF A;  3ASN C;  3OTO O;  4DV2 O;  2VQE B;  3JD4 A;  2EZO A;  4O4J A;  2V4D A;  5AG2 A;  4KUM A;  3IJ4 A;  3DC5 A;  4X89 A;  3ZRW A;  1XDC A;  1J5E B;  1FJG O;  4MS2 A;  3B4S A;  4LF6 O;  2QDO A;  5DEC A;  1W2B U;  1I94 B;  3CC4 V;  3RYI A;  4OPA A;  3QO5 A;  1HP8 A;  2DQ0 A;  3OT7 A;  4UVB A;  5LBQ A;  4HBN A;  2JEX A;  3ETQ A;  4J7J A;  3STL C;  3LNM B;  2JGU A;  1RSO A;  3OGC C;  2HFE C;  1RPO A;  3HKE B;  3GVM A;  2YIC A;  3BRC A;  2XAH A;  3CWB H;  3QO8 A;  4LP8 A;  5KA5 A;  4YJ2 B;  3HKC B;  4PA4 A;  5FLX N;  3L74 H;  1NT2 B;  1ZL8 B;  1GMG A;  2UUB O;  3E2E A;  3J80 N;  2IJI A;  2OTJ V;  2XND G;  3K5O A;  1VQP V;  3TGU H;  1SQB H;  5L3F A;  2QSA A;  3JAL A;  3U0Z A;  3K04 A;  4ICG A;  1I94 O;  2QE7 G;  1XHX A;  2Q68 A;  5JVD A;  3LNN A;  1QVF U;  2NN4 A;  3OGI B;  3J81 N;  5LHG A;  4KHP O;  4B3T B;  4D7T A;  5JJN B;  4CC5 A;  3QG5 A;  2GTA A;  5B3S B;  1H38 A;  1FD9 A;  4DW0 A;  4R8C A;  2OCH A;  3CRA A;  5C93 A;  1CXZ B;  1IBK O;  1XMQ O;  2A0L A;  4X1K A;  4MTO A;  5LMN B;  4FVM A;  4PDV A;  4UXN A;  2UUA B;  1GN3 A;  3ZRV A;  1NKD A;  1CP9 A;  2P7T C;  1OJH A;  2L35 A;  4D6T H;  1N0N A;  4ZI7 A;  3K57 A;  1N34 B;  1Q7Y W;  3WU2 Z;  1G6U A;  2LW7 A;  4JGS A;  3B8M A;  3UCS C;  4LWS B;  5GON B;  3I56 V;  2G38 A;  1WP7 A;  1WJZ A;  1QBZ A;  3SYA A;  2EUL A;  4WBN A;  3CCV V;  1RM1 B;  2JK5 C;  1SZT A;  4TQF A;  4MVU A;  3B77 A;  2WLH A;  2JS3 A;  1R3I C;  3FB7 C;  2FB5 A;  2CTQ A;  1MG1 A;  1K4D C;  4J42 A;  4H0L B;  5LHH A;  1QLE B;  2AW9 A;  1Q3E A;  3SDL A;  2W0F C;  1PNM A;  2XUM A;  4PDR A;  5IYB O;  4J41 A;  3RYF B;  1GKF A;  4X66 B;  2EIJ C;  4EFB A;  4ZOL B;  1GAX A;  2P4K A;  2XAS A;  3ASO B;  1BL8 A;  1F51 A;  1JCH A;  1YXB A;  2WLI B;  5IJ0 A;  1XUQ A;  3E22 A;  3SYQ A;  3ZN0 A;  3L73 H;  2JJ1 G;  3G6E V;  2N05 A;  2VWJ A;  2XOK G;  2ZKO A;  1Y4M A;  3OUF A;  2LFS A;  2WLM A;  1D5N A;  1SQF A;  1CEZ A;  4FZ1 A;  3FYE B;  3FX7 A;  1DF4 A;  3JAL B;  4JAV A;  2WWW A;  3LSS A;  2JS5 A;  1XL4 A;  1PNK A;  1PKX A;  3H1K H;  3S3W A;  4X62 O;  5D5Q A;  1LR1 A;  4FJC C;  2YID A;  2UXC O;  2K9P A;  3F7V C;  2B5U A;  3S3X A;  2YIA A;  5JH7 A;  4MTX A;  4UFZ A;  5JCO A;  3CXC U;  2EZP A;  2GUZ A;  3AG7 A;  3U11 A;  4DXW A;  3AG1 B;  1ARO P;  3CJH A;  3WB0 A;  4FM0 A;  2ODM A;  2V1D A;  3WB1 A;  3JAK B;  4K35 A;  2DN9 A;  3JYC A;  1GN4 A;  4OX9 B;  3L71 H;  4X88 A;  1VAR A;  4N23 A;  4O4L B;  1PM9 A;  3BVO A;  5KHK A;  1K97 A;  1H2K A;  2ZIO A;  4JV5 B;  1OCO B;  2QWQ B;  4X1Y B;  1VF7 A;  3ZHV A;  1NI8 A;  2UXB B;  2ZR3 A;  5LYJ A;  2PY5 A;  3G6B A;  3SYP A;  5KHI A;  1Y74 A;  5IDJ A;  4X1I B;  1YEW A;  3P3P A;  2CH7 B;  3WFV A;  1Q86 W;  1XL6 A;  5KMG B;  3VOU A;  4B3R B;  2AZ2 A;  2XT9 A;  4FM2 A;  3CCJ V;  2AHZ A;  4O4I B;  3APO A;  3D36 C;  4DV7 O;  5IJ9 A;  3E8F A;  2VQF B;  2A3Q A;  2QWO B;  4FLZ A;  5BMV A;  3F5W C;  1WN7 A;  2YIB D;  3B8N A;  3CC7 V;  1AR1 B;  4X64 B;  4HYO A;  1SQG A;  1H2S B;  1M57 B;  4NTY A;  4TSF G;  5CB4 A;  3OAA G;  1T5E A;  3M99 B;  1SRY A;  2M7W A;  4NXM B;  2A9H A;  4GKJ O;  1QR8 A;  4JYC A;  4DRX A;  1DGS A;  3ZBH A;  5B1A C;  4MW8 A;  3CCQ V;  4DV4 O;  2HP8 A;  4RQE A;  4JI1 B;  5BR8 O;  4J7K A;  4DR4 B;  1SA0 B;  4JYY A;  2X7R B;  4ZHQ A;  5JWP A;  2ATK C;  1WP8 A;  1E1R G;  2HLD G;  4DR1 B;  3TCU A;  1VEW A;  1XQ8 A;  2ZIM A;  4F6R B;  5IYD O;  1QQC A;  4JI7 O;  4LFB O;  2IU3 A;  4DR6 B;  3SYO A;  5LL6 Y;  4DR3 O;  3CMA V;  3OM3 B;  3RFR A;  4GLX A;  1S76 D;  1KC8 W;  1R6T A;  2CAZ C;  4R6Z A;  2FML A;  4NYK A;  1UPG A;  5LP6 B;  3ABK B;  2YSU B;  5BZB A;  1K34 A;  2VRZ A;  5HFM A;  3K0D A;  4CH6 A;  4NXM O;  3A0H Z;  5H6Q A;  4LFA B;  3AG4 B;  1XI1 A;  5LYJ B;  4CS4 A;  4BIU A;  4U3J A;  1G8M A;  4FLV A;  2BSK A;  1AI7 A;  2Q4P A;  3Q4H A;  1GM7 A;  4MVQ A;  4EB6 A;  1TAE A;  2YI8 A;  3T1H O;  3C3T A;  3K08 A;  3OMN B;  3OFN G;  4LNU A;  4UUJ C;  4TUY B;  2ZNI A;  3DXR B;  2OT5 A;  2H8P C;  1BMF G;  1BE3 H;  5CA0 B;  3ICX A;  2GBO A;  2JEU A;  1URF A;  2Q73 A;  3RYC A;  1JA8 A;  4PA7 A;  3SPI A;  1FXH A;  4DV6 B;  5KA6 A;  2ZE8 A;  3TXS A;  4JI4 O;  1VQM V;  2Y48 A;  2F4V B;  1PV0 A;  1YIJ V;  1WPB A;  1TUB A;  2XTA A;  3LUT B;  3T1Y O;  4CZZ A;  4NR1 A;  4FLT A;  2Y0P A;  4JI8 B;  5LA6 A;  3ZHT A;  2AZ0 A;  3FYI B;  4ABM A;  3E8H A;  2ZDI C;  5E79 Z;  2EIL C;  3HKD B;  1VQO V;  4AIL C;  1V54 C;  1M9N A;  2WSS G;  3O9O A;  1XOU A;  2D2C B;  2GDS A;  2RNB A;  2A7W A;  3UKM A;  4IHJ B;  2UXD O;  3ZN1 A;  2PI5 A;  3ABL C;  1S77 D;  2HVK C;  2QA4 V;  3OMA B;  4HNA A;  1FXV A;  2HKO A;  3QF7 A;  1S5L Z;  1YSC A;  5CA1 A;  4PA3 A;  3P32 A;  3JAS A;  1AB3 A;  4I50 B;  1BQZ A;  3JAW B;  3OE7 G;  4PI2 A;  5LGT A;  3EFF K;  2W0X A;  1YJ9 V;  2BTO A;  3MHS C;  4OGQ B;  5KUK A;  4LF7 B;  4BR6 A;  4JI3 O;  3QVN A;  2NR5 A;  1MZF A;  1PD3 A;  3RT3 C;  4JTC B;  3T1C A;  2K1E A;  2YIB A;  3CPW U;  3OEE G;  1UFI A;  2ILM A;  1COW G;  1WB7 A;  4D7S A;  4WFH A;  1LUW A;  1Z5W A;  1NTZ H;  1GRJ A;  2KSD A;  1Z2G A;  2ZXW C;  1G1X B;  1N32 B;  4JI0 B;  4I0X B;  3CME V;  4DR2 O;  1FFX B;  4UCS A;  4NVP A;  1NBM G;  4IYH A;  4LH7 A;  5KAF Z;  3SJA C;  3WG7 C;  1A32 A;  2JRI A;  1N36 O;  5ITZ B;  1NR7 A;  2XAF A;  2IU0 A;  3CHX A;  1YI2 V;  3GB7 C;  2YC0 A;  4I55 A;  4TT3 G;  3ZIA G;  4Z2W A;  3RGB A;  2UU9 B;  4LF8 B;  3SPC A;  3OTO B;  4DV2 B;  1RFY A;  2IM9 A;  5JCO C;  2KG7 B;  3M8A A;  1S3J A;  4WFF A;  1WB8 A;  5EZY A;  1TUB B;  1OCC C;  4DV5 O;  2EIJ B;  1NTM H;  3X2Q C;  3VQX A;  3A8T A;  4JI5 O;  4LF9 O;  4LF4 O;  1FJG B;  2R72 A;  2OWO A;  1YJN V;  2NNU A;  4RAI A;  1S0V A;  1K5Q A;  2Q5Z A;  4LF6 B;  3ABM C;  4GKK O;  3W7S A;  4JF3 A;  5EBL C;  2PYL A;  2LGQ A;  4IIJ A;  2WLL A;  3CCU V;  3JAM N;  3CB2 A;  3KZI Z;  3ETD A;  4DV1 O;  4K3A A;  4KP4 A;  1XIL A;  1Y67 A;  1FS0 G;  3N2G A;  4O4H B;  4DV0 O;  4ZKI A;  5IYZ A;  4MVM A;  2F93 B;  1DTO A;  3G71 V;  1XNR O;  2KB1 A;  1N0J A;  3JCZ A;  2BTQ A;  3JAR A;  5J2U B;  1NQT A;  2YXY A;  3ZHU A;  3K5M A;  1Q82 W;  5GTI Z;  1W0K G;  3QNE A;  4X20 B;  1M1K W;  2UUB B;  4WFB V;  3UT5 A;  3JSL A;  2EIK B;  1N4C A;  4FFB A;  2CTW A;  4XBF A;  3CCS V;  3RBZ A;  4N21 A;  1M93 A;  3LDD A;  3K5L A;  3WB2 A;  1IVS A;  4P9P A;  2YXL A;  4H33 A;  2IJH A;  3ZHQ A;  3ZMV A;  2JJ2 G;  2KKW A;  1WA8 B;  4KHP B;  1XBL A;  2EJR A;  1EN6 A;  1VQ4 V;  1PL0 A;  4H44 B;  1IBK B;  2CUG A;  1XMQ B;  3UM7 A;  2D3O W;  5LHI A;  4DUY O;  2GV9 A;  4KXR A;  1KP3 A;  4RUE A;  4AQY O;  3I55 V;  1IBM O;  1GH6 A;  4IGG A;  3SGI A;  2EIM C;  1ZAU A;  4YIO A;  2LFR A;  5B1B B;  1L8D A;  1U97 A;  3IGA C;  1M56 C;  1Y76 A;  3CYO A;  4ZIB A;  3K79 A;  5H6R A;  1HWY A;  4BAY A;  4DR7 O;  4TV8 A;  4J80 A;  2ZCE A;  1FXK A;  3JAT B;  4DW1 A;  3BFR A;  3K3W A;  2CE4 A;  2EBO A;  2P5O A;  5BXZ A;  1QHT A;  4JTA B;  1WLE A;  4GCZ A;  3RYH B;  4QPJ A;  5B1A B;  4I4T A;  1JFF B;  3QTC A;  2ZDI A;  1SF9 A;  2BTQ B;  1AIL A;  2ZR2 A;  4P30 A;  5FNV A;  4O4J B;  3AG2 C;  1D5A A;  2LQT A;  1DK1 A;  1AP5 A;  3ZRW B;  5KX5 A;  2Y69 C;  3P3N A;  4FFB B;  3I5D A;  2RN9 A;  4PA6 A;  1BHA A;  4RWU A;  1AR5 A;  2KQX A;  3RYI B;  2LJ2 A;  4X62 B;  4BW5 A;  2UXN A;  4JI6 O;  2UXC B;  2YS8 A;  1RSO B;  4MVZ A;  1YZB A;  3ZMS A;  2HEP A;  5IY5 B;  4UV8 A;  1Q5O A;  1SZX A;  2NLJ C;  2EIN C;  1AJQ A;  5D5P A;  4QPK A;  5B5E Z;  3N27 A;  1S72 V;  3GWO A;  1WNS A;  4JAS A;  1KU9 A;  5GW7 A;  5FPR A;  1VMG A;  1GK9 A;  2EJ7 A;  3VQY A;  2DJV A;  2XHB A;  3M7M X;  1KKD A;  3DGE A;  4UCV A;  1HNX O;  1EZJ A;  4XDL A;  4B08 A;  3H01 A;  3BAB A;  3MHH C;  2L6L A;  1BSM A;  3CCL V;  1KQS U;  4LR3 A;  4DR5 O;  4NXN O;  5JVD B;  3CXH F;  1MMM A;  1Y76 B;  4FLX A;  1JX9 A;  1Q8I A;  1NZ6 A;  4LFC O;  4PDL A;  3EXA A;  3FKS G;  2ITC C;  3FAV A;  4B3M O;  5EC1 C;  4GX2 A;  1BZK A;  3BAA A;  3K03 A;  3KG2 A;  4X1K B;  3KCY A;  4DV7 B;  4I4T B;  2LO1 A;  1SC5 B;  3ZMT A;  4G28 B;  4NKG B;  4QE9 A;  2PI4 A;  1V54 B;  5LGU A;  4UB6 Z;  4ZI7 B;  2ZQM A;  4K0K O;  3FB8 C;  3H1L H;  4DYL A;  2Q0O C;  2HG5 C;  2OIE A;  3SJB C;  2QJ1 A;  4DV3 O;  5E1A C;  4RO2 A;  2UUC O;  2XAG A;  3BPZ A;  4WBN B;  1G4Y B;  5HFL A;  4FIP C;  5A9G A;  4GKJ B;  4YIP A;  3N2K A;  2WLJ A;  4MTF A;  4DV4 B;  2XAQ A;  3CRC A;  2CTP A;  5KLV H;  5BR8 B;  1K73 W;  4UCR A;  3L72 H;  3IFX A;  4G2K A;  1XHZ A;  2DWE C;  2E74 B;  1Y6X A;  1P49 A;  2OYQ A;  1KUQ A;  4QIW F;  4AHC A;  2FTK A;  1L1F A;  4YJ3 A;  4JI7 B;  4FM1 A;  4LFB B;  2Q0A A;  3SYC A;  3ETG A;  1W59 A;  4DR3 B;  1SER A;  3ETE A;  5EYP A;  5F2V O;  5IJ0 B;  3E22 B;  4WCE V;  4JI2 O;  5C8Y A;  4Z1V A;  4YHH O;  2ZXW B;  4NB5 A;  1EM1 A;  1TVK A;  3UO2 A;  3SPG A;  3MDS A;  3QO7 A;  3CD6 V;  3OMI B;  4DUZ O;  3WG7 B;  3SPH A;  1M90 W;  2Q6A A;  4PD4 F;  3TXQ A;  5IYC O;  3CRQ A;  3OEH G;  1TGO A;  1XRE A;  2YXH A;  2QR4 A;  5JH7 B;  4GZR B;  1IX9 A;  5B3S C;  2B1I A;  2AHY A;  1F23 A;  1NS1 A;  1AJN A;  5KHH A;  3T1H B;  1HR0 O;  2GUZ B;  1K4C C;  2RMK B;  5GTH Z;  4MSW C;  3W7U A;  4GYC B;  1XMO O;  4PDM A;  4W4K A;  5IWA O;  3CJH B;  3X2Q B;  4TOI A;  2PYJ A;  2ADP A;  3A2F A;  3THO A;  1VF5 B;  5LOV A;  1QVG U;  1E79 G;  1P4R A;  1B3Q A;  3EHB B;  5EK0 A;  2P90 A;  5KHG A;  3CX5 F;  4U7N A;  1DLB A;  2JGD A;  1V55 C;  4JI4 B;  1KEC A;  2XAJ A;  1WPX A;  4DO2 A;  1I7F A;  1R6N A;  1Y74 B;  2JDI G;  3D8C A;  3ASN B;  3T1Y B;  1N33 O;  2VS0 A;  1HNW O;  1QLE C;  4O2A A;  5JQG A;  3BCC H;  4GT1 A;  3UO3 A;  1VQN V;  3GWK C;  1I08 A;  1SKV A;  1YTF D;  4W4L A;  1JJ2 U;  3IC7 A;  3HPL C;  3D3I A;  4O2B A;  2IJJ A;  1O9G A;  4FZ0 A;  5IJ9 B;  2P22 C;  1U96 A;  1P84 F;  3ML0 A;  2UXD B;  3DSQ A;  3B2E E;  1EBO A;  2P06 A;  4X65 O;  1I0H A;  5BMV B;  3H9V A;  5DN6 G;  3RW0 A;  2FL4 A;  2Z3Y A;  1SQQ H;  2WLK A;  2IJK A;  1KKC A;  3DTU B;  2F66 C;  1FXK C;  4H13 B;  4JTD B;  3U10 A;  4PI0 A;  4CS2 A;  5CB4 B;  5EC2 C;  4UCO A;  3K06 A;  2QM4 A;  4DRX B;  2QWN B;  1H2G A;  3L70 H;  3G4S V;  4JI3 B;  1AJP A;  4DK1 A;  1NH2 D;  2CDY A;  4JAA A;  4ZHQ B;  5LXT A;  2DE0 X;  3P30 A;  4NTX A;  1H2M A;  3TK1 A;  5EIB C;  3G67 A;  3E35 A;  1CPY A;  5LMU O;  3OTF A;  4TQD A;  1E1Q G;  2UXX A;  4TV9 A;  1M4U A;  3ABT A;  1P7G A;  1S5H C;  3JSN A;  1K7D A;  4DR2 B;  1M56 B;  1K33 A;  1R73 A;  4YY3 O;  4B7K A;  1VQL V;  1N36 B;  2VWK A;  3AK1 A;  1F7Y A;  4PV1 B;  2X0L A;  1PL4 A;  2EX3 A;  1OCR C;  1GO3 F;  2YEV A;  2HHH B;  4LF5 O;  4U3J B;  1ORQ C;  2BSK B;  4DV5 B;  3C90 A;  3Q4H B;  2A06 H;  1B06 A;  4EB6 B;  1US6 A;  1NR1 A;  5H5N A;  1Q81 W;  4JI5 B;  3FB5 C;  4LF9 B;  4LF4 B;  4LNU B;  2H3O A;  1VP7 A;  3K5N A;  1YF2 A;  5EIB D;  3ZMZ A;  1MZE A;  1VIB A;  4GKK B;  5KUM A;  2ZE6 A;  4U7O A;  5KHJ A;  2M6Y A;  1K8A W;  4DV1 B;  1XNQ O;  4X8A A;  3RYC B;  2ZM6 O;  2PF4 E;  4DV0 B;  3E8B A;  3CRR A;  4U3F H;  4L87 A;  3HR0 A;  2P4V A;  2X6C A;  1XNR B;  1PP9 H;  2JIZ G;  1AR4 A;  1FFT B;  1M57 C;  1MOF A;  1OCZ C;  4QE7 A;  5FL7 G;  2PZS A;  1OZ0 A;  1Q6U A;  2HHH O;  1F4M A;  2B1G A;  1JR9 A;  4MVS A;  4YJ2 A;  3K9S A;  1Q6I A;  5LA6 B;  2EIN B;  2ARH A;  1ZL8 A;  3A0B Z;  4TWK A;  2BOB C;  5L3C A;  1NTK H;  1H2N A;  5J9P C;  3AK3 A;  3ZHR A;  4PA9 A;  1EFR G;  4JZG A;  4JYB A;  2A79 B;  2RQ6 A;  2QEX V;  3J7A U;  2QTO A;  3AG3 C;  2RDC A;  4OXS A;  5L3B A;  2DQ3 A;  4HNA B;  4I9W A;  3CCE V;  2ITD C;  3OR6 C;  2ZNJ A;  5CA1 B;  4FLU A;  2Q7G A;  2WPD G;  2Z0A A;  3JAS B;  5LP6 C;  3ZRS A;  4LC1 A;  4UB8 Z;  3FFQ A;  3H1J H;  1YVW A;  2CGO A;  2PUS A;  4IT5 A;  2E5L O;  2DWD C;  2JVD A;  2GSM B;  3OW2 U;  4DUY B;  2ZD9 A;  2FKX A;  4AQY B;  3T4D A;  1IBM B;  4ZBM A;  1JOY A;  1EN5 A;  1IXM A;  3HB3 B;  2R70 A;  2HVJ C;  2RCV A;  2DYS C;  3F7Y C;  1OHH G;  2CK3 G;  3T2M A;  1ROP A;  3EVK A;  3K0G A;  4PHZ A;  1BQ0 A;  5B66 Z;  3JD0 A;  2Q8V A;  4LWS A;  5GON A;  1IBL O;  4K8X A;  4QGP A;  5H2F Z;  4DR7 B;  4FLY A;  2E75 B;  1R3J C;  3DC6 A; 
#chains in the Genus database with same CATH homology
 4B3S O;  1XNQ O;  1IBK O;  1XEQ A;  4JI2 O;  1HNX O;  2UU9 O;  4LF8 O;  4YHH O;  2ZM6 O;  4JI5 O;  1XMQ O;  4LF9 O;  2F4V O;  4LF4 O;  3OTO O;  4DV2 O;  1R1B A;  2AGA A;  4B3T O;  4JI7 O;  4GKK O;  4LFB O;  4DR5 O;  4NXN O;  2DOS A;  4JI1 O;  2UXD O;  4DR4 O;  4DUZ O;  1HNZ O;  4JI8 O;  5IT9 N;  5LL6 Y;  3JAM N;  5A2Q N;  4DR3 O;  4DR7 O;  2HHH O;  4DV1 O;  4DR1 O;  4LFC O;  1R6T A;  2N74 A;  2LW7 A;  1FJG O;  5BXZ A;  4DV0 O;  5LMN O;  2VQE O;  4B3M O;  4LF6 O;  1AB3 A;  2UUA O;  4OPH A;  1NS1 A;  4NXM O;  1XNR O;  4OPA A;  4DR6 O;  1HR0 O;  1FYJ A;  1N34 O;  4OX9 O;  1XMO O;  5LMU O;  5IWA O;  1FKA O;  1AIL A;  1J5E O;  4JI3 O;  3J7A U;  3SDL A;  1DK1 A;  4JYA O;  4JV5 O;  3RT3 C;  4K0K O;  3T1H O;  2UXB O;  4LFA O;  4YY3 O;  3R66 A;  4DV3 O;  5FLX N;  2Z0A A;  4DV7 O;  4LF7 O;  2UUC O;  1F7Y A;  2E5L O;  2UUB O;  1G1X B;  3J80 N;  4B3R O;  4DR2 O;  3O65 A;  4JI6 O;  2FKX A;  4X66 O;  4LF5 O;  1N33 O;  1A32 A;  2JRI A;  2ZKO A;  1N36 O;  1HNW O;  1I94 O;  5BY1 A;  1YZB A;  2VQF O;  1D2D A;  4JI4 O;  5H5N A;  1N32 O;  1X59 A;  4JI0 O;  3J81 N;  4GKJ O;  4X62 O;  4DUY O;  1KUQ A;  3M8A A;  4KHP O;  2UXC O;  4DV4 O;  3T1Y O;  4AQY O;  5BR8 O;  1IBL O;  1IBM O;  4DV5 O;  4A5U B;  4X64 O;  4X65 O;  4DV6 O;  2DJV A;  3F5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...