4JV5T

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4jv5T00
2VQFT 4GKKT 1FJGT 4DV4T 5LMUT 4DV6T 4X65T 4LF4T 4DR7T 4DR3T 4X62T 4JI8T 4AQYT 5IWAT 4DR5T 4YHHT 4DR1T 4LFCT 4B3RT 4DV5T 2UXDT 4JI5T 4DR6T 4GKJT 4LFBT 4NXMT 2F4VT 4DV0T 3T1HT 5LMNT 2UXBT 4DR4T 1HNWT 1IBLT 4B3TT 2UUAT 4OX9T 4LF6T 4B3ST 2UUCT 1IBKT 1N33T 4JI7T 3OTOT 1HR0T 4LF8T 1J5ET 2UUBT 1HNZT 4DV3T 4JI2T 1XMQT 4LFAT 4B3MT 4DUZT 4X64T 2UXCT 3T1YT 4JI6T 4LF9T 4YY3T 4X66T 4DV7T 2E5LT 2HHHT 4JI1T 1IBMT 4JV5T 4JYAT 1N36T 4DV2T 4JI0T 4LF7T 2UU9T 4DUYT 2ZM6T 4NXNT 1I94T 1XMOT 4JI4T 4KHPT 1N32T 4DR2T 4K0KT 5BR8T 1XNQT 1XNRT 4JI3T 2VQET 1N34T 4DV1T 4LF5T 1HNXT
chains in the Genus database with same CATH superfamily
1YKHB 5FXZA 4DV4T 3MZKB 3NRYA 5LNKA 4H9OC 3FZHB 3N9QA 5J2UE 3ZEFB 2Y6XA 1MIVA 5FY0A 3RKGA 3DP7A 5LGUB 2PTFA 3AE5A 3KV9A 5JDFA 3AA0B 4QXHB 2V1DB 3EABA 2X51A 1HCIA 4LF6T 1LRZA 3EDVA 4X1YE 3LG7A 1E1HB 1KK7A 4IDZA 5JDMA 2UUBT 2H88A 3CMLA 4CI3B 5J0ZA 4JI6T 2YDRA 3AEGA 1W9RA 3K8PC 1ZKEA 2JQ9A 1FMWA 1SHZC 2K9AA 2ZM6T 4YHJA 1UX4A 2DHRA 4IE7A 1XMOT 2V7LA 2XQ7A 3ZN1B 5JDNA 3VU7H 3ZYMA 4GK0E 5J2TE 2N9DA 5AQUB 2XAJB 3HL6A 1MIYA 3KVBA 3B5MA 3UU8A 4DNDA 3FXDB 1WCRA 2VKDA 4O4IE 5FYMA 1YXRA 3P4WA 2JMHA 1QLBA 5CA0E 3ONJA 4OFZA 3PU8A 1WR6A 2XAHB 3VR9A 3BQLA 4DR6T 4AQFC 3TLSA 2IDOB 2E8IA 5JVDE 4O4HE 3TKLB 3Q5EA 3IBPA 1V9DA 2E5VA 2N1GA 2UUCT 2CBIA 2WMNA 2Q9QC 3QC9A 3MKDA 4CI1B 4JLEA 4GK5E 2CLYB 1HR0T 2B76A 1MMDA 1HNZT 3PUSA 4PK4A 4E7SA 4XAXB 5JDHA 2BG9B 3AEBA 1UX5A 4AKLA 3O4XE 4DV2T 4YXDA 4U72A 2Q9QD 2CMRA 4H9RC 4NXNT 2H7VC 2V8SV 2XY8B 4IDQA 2YKSA 3NVOA 5JDLA 3RPUA 1NWMX 4QXCB 2XQ5A 2X9HA 3DJBA 3HR0A 5CJ5A 5HWXA 4HWCA 3ESLA 3L3PA 4A56A 2D0UA 3ANWB 2KMFA 4JI8T 4H63V 2HPJA 2L3LA 3RYHE 3LK3B 3AA7B 3JCFA 2XHEB 2A2FX 3UTKA 1WLXA 2Z6EA 1GQEA 2V6YB 5LP6E 4UEMA 2MYSA 5E0OA 2BKNA 2UUAT 3MACA 4OX9T 2LSJA 1NEKA 5LG4A 1S94A 3R84B 4JEUB 3O1JA 3AE7A 3PJAA 2W63A 4TWFA 5ABEA 5M4YA 2BVMA 4C91A 5H6RB 2X9YA 5JR9C 4HFBA 2XAFB 3I1AA 4UVBB 3Q5DA 3TLWA 3IA3A 3J7Yq 4L5GA 4LF7T 2GK9A 1Z0PA 2B1EA 2H3RA 2UXNB 5L4HA 3NZPA 4QX7B 3Q5WA 4LF5T 3P7IA 2J47A 3AXJB 3OVUA 4CN6A 3ZN0B 2VQFT 4AKIA 3AAIA 3C64A 2XM2A 2LSIA 3ZSSA 3AE2A 3LBXB 5TAOA 2HN2A 3CWZB 3ONXA 3GN5B 3PUZF 4DIDB 3AECA 3KDSE 2UXDT 4AQGA 5AQHB 5EK4A 2LSYA 4O4JE 3W15B 2MPKA 3UU5A 4NXMT 3KBTA 5LGTB 2BKOA 4Z90A 2RA1A 3RH3A 5ADXL 2EHOC 2DWGA 2D0TA 3E0ZA 1IBKT 1XDPA 4YFSA 4AKHA 4GYRA 3O9XA 3AEAA 3IEEA 3F31A 1HTJF 4ILBA 3I0QA 3HI2A 2EHOD 2N2NA 1G8XA 4F8HA 2ACZA 2XASB 3FZFB 3PUYF 3ZSTA 4HWHA 5FL1A 3LK42 2WM9A 4UVAB 4EB6E 3N9PA 2VL8A 5GONE 1U4QA 3OBVE 4OYKA 1E7PA 2VKJA 5C3JA 4MBQA 5AQIB 4U7YA 2XSAA 3UU6A 2FJAA 2K5BB 4EZHA 4ZI2C 1W0AA 4DR3T 3ZYKA 2XQ4A 4PK6A 5HXSA 4YHHT 4LFCT 1IJ5A 1OWAA 4TX5A 2XSBA 4L0RA 2C5IT 4K0UA 5LA6E 2C0SA 2J4GA 5LMNT 4ZI2D 3I9WA 2ZM8A 3L8RA 2LLYA 2XQ3A 1DU2A 5HCMA 5LYJE 5DQVA 4QH1A 3PV0F 2VASA 3K3NA 4IE5A 3U3IA 3PJAJ 4B3MT 3PUQA 2K48A 4ZS3A 4KI0F 1LVFA 2WMOA 3N9MA 4YJ2E 4LMLA 2WDQA 4ZI3C 4DO0A 4UELA 2XQAA 5KXJA 4ZZBA 4JI4T 2VB6A 2IMLA 1ZOYA 2YK0A 4JI3T 4OK0A 2BG9A 1HX8A 3LFMA 3BQIA 1CUNA 2W00A 1UK5A 4M1PA 5FKYA 3M3ZB 2LEHA 3F2EA 3WAJA 1G73A 4ZI3D 3UU3A 3ZC1A 5L47A 4KHZF 2K3WA 3C4XA 2JJ9A 3WAKA 4AQYT 4DR5T 2KNDA 3ZJ1A 2KINB 4I55E 3OYZA 2Y48B 2XQ9A 1KFYA 5HAXA 3AEFA 5JDGA 5C2TA 1T8BA 3ZT6A 1AJ3A 5DQWA 3CK6A 4HFHA 4EAHA 1VRBA 5JDQA 4EXTA 3O1IA 3ANWA 4F6RC 3FZMB 4HN9A 1IBLT 3DTOA 3VKHA 4B3ST 2QRXA 5FVLA 1W0BA 2H7OA 2QYWA 2EHOB 3OYXA 5J1GA 1ZP0A 4LFAT 3H3MA 4COFA 2NOXA 2ES0A 1UCUA 4HFVA 3EVYA 4TV9E 4WBNE 2VKOA 1X9BA 3PE0A 2HHHT 1OEDB 4AISA 4JYAT 4TWHA 2RP4A 4N78D 4DUYT 1QSDA 2BS3A 1I94T 2NP9A 3RYFE 4ZZCA 5JH7E 4O2BE 5FY1A 3H37A 3ZMSB 3NBXX 2LE8A 3PUGA 3RRCA 3SFEA 1HNXT 5KMGP 5LMUT 1FMVA 3UUMA 2WU2A 2VVNA 4HGAA 4XBFB 3KV5A 4J2CA 5LJNA 3FHNA 3RKOA 2XTLA 5LJMA 3HKDE 2DLRA 2WWUA 3AXJA 4PNIA 4UXNB 3V5UA 4PJNA 1UGOA 2I59A 1H7CA 3P4SA 3TLUA 2NWBA 2E9XA 2LKGA 3P8CD 1NAFA 2FBWA 4GKJT 5ABGA 5L3EB 5AQOB 1VOMA 3AE9A 3RQWA 3RC8A 3LBXA 2V26A 1IJ6A 2WY2A 4IDNA 2QVAA 2YEVC 5IHYA 3GN5A 3BQKA 3ZMUB 3N5LA 3ZKRA 4I43B 1US7B 4KBMB 4MLKA 5FXXA 1D0ZA 1N33T 2R6GF 4IE4A 4LF8T 4PJLA 2M6IA 4DV3T 4JI2T 2DI4A 2YU2A 3L09A 2MBGA 4WZXA 3UT5E 4YY3T 3I0OA 4JV5T 1JNRA 5C8YE 4EGWA 2FJDA 4U31A 3PU3A 2YINA 5F3JA 4G63A 3JC6C 2LSKA 4QX8B 4E7ZA 4YTNA 3ZCIA 3KV6A 5L4EA 5JRCB 5LHIB 4PJJA 1QUUA 2JQQA 3KINB 4ZI7E 2M67A 3KVAA 2XUEA 1SA0E 5HEUA 2UXXB 2CA5A 3JC6D 2KWIB 2NW7A 2OV9A 3FBLA 3QK6A 2MAWA 2BKPA 2WZHA 5IWAT 1LVKA 4ISTA 4HFIA 1YQ4A 4B3RT 4YTPA 4IIJE 1MIWA 3ZT7A 4IE0A 4HWFA 4TN7B 5HYAA 4I4TE 4X20E 2LM2A 2CHNA 2XZEA 1WYBA 4UIGA 4L9IA 4CI2B 4OYJA 3IF8B 3SRZA 2X0LB 4BJNA 2Y8DA 3P4QA 3RQUA 3OKQA 4B6XA 2LJLA 4QH5A 1WRDA 5CGMA 1SE7A 2PG8A 3Q9DA 3P50A 4P09A 3N9OA 2RPAA 2XJ7A 1MMAA 4IL9A 3CPZA 3UFGA 4EEBA 2LHNA 2WB5A 4UF0A 2WCAA 4HTEA 5FXVA 2H89A 4DV1T 4U2YA 2IHR1 3CX8B 4AKGA 4UV8B 2CE7A 2FUPA 5LCYA 1BR4A 4X62T 4H9QC 3AEEA 3M65A 4IDOA 3Q5XA 5DJQC 4GIWA 2J1DG 5JQGE 1IAPA 2KWHA 3UUXB 3WI3A 3NKZA 3CQCB 2I6HA 3C4ZA 3L39A 4WBOA 2JQKA 2XQYA 2F4VT 2KLQA 2NTXA 4YJ3E 5DABA 2WSSV 4H9SE 3QNUA 4G2AA 2C5JA 4WYVA 2YOEA 3N2KE 2L9QA 4HFCA 2ODUA 2JIWA 3OPCA 4PK5A 3OTOT 3RHWA 4QWNB 5FVKA 4KUMB 1YW0A 2VVSA 4U7IA 3IHRA 3SFDA 1D0XA 3AVSA 1KNPA 3ZJ2A 2JQHA 2E5LT 3A5XA 4ZHQE 1N36T 1NENA 2A3DA 2LM9A 3JAEA 2DL1A 4EIWA 3MXZA 5AQSB 5FP3A 2Q9QB 1XNQT 1O3XA 3RIUA 2AE9A 3UFEA 5L3BB 4JBWF 4BJMA 1N34T 5AQQB 2XQ8A 3ZMTB 5F8PA 4OHFA 4TV8E 3O1HA 1ZEEA 4EYYR 3RRWA 2DNXA 2CXDA 1MMGA 4HWIB 3NRXA 3MA9A 5BMVE 1OXZA 1HG5A 4H63H 1D1BA 3AB3B 4DR1T 4UR9A 3I9YA 3HKBE 5EK2A 4GOUA 3A7MA 5ABFB 4Z91A 4DV5T 5JTGA 1BR1A 4CZZB 2D5UA 5AQJB 3QB5A 4BA9A 5AQKB 3VRAA 4LFBT 2X67A 3Q2MA 4DV0T 2JPFA 1M7KA 3R6NA 1ZHCA 2V7JA 5HEJA 3HKCE 2DCFA 1KEYA 2VWAA 2W62A 2A9UA 2WDRA 2YDSA 5HWYA 1YD8G 4DMVA 2CXLA 4YSYA 1FEWA 5LXTE 2VURA 3VHLA 3T1YT 1IZNB 3MJXA 4TNWA 2HN1A 2P9BA 5JREA 2LRKA 2W66A 2UU9T 2NR4A 4NUUA 3ZT5A 2ZLYA 3J9X1 4NUVA 4KP3C 5HCJA 3AE8A 3K3QC 2IAKA 3PUAA 3GMIA 2X68A 4TZ4C 4EEDA 1BR0A 5JR9B 2OLTA 5HXHA 4X65T 4DR7T 4IREA 2CLYC 2WS3A 4HEAA 2WQYA 3HKEE 4X1KE 4P1NA 2BVLA 4HKAA 5HEGA 3KV4A 4CXWA 4AI6A 5FL0A 4I0UA 2BG9C 2WAUA 3T1HT 5KDMC 5FXWA 3K3OA 3EUHA 3QUJA 1YQ3A 2LHRA 4U33A 4YT0A 2XQ6A 4UV9B 1XDOA 1HG2A 4JI7T 4YTMA 3RYIE 4WNKA 1J5ET 2X0HA 1KNRA 3N2GE 4CN1A 3ZCJA 2QGSA 4PW8A 5CA1E 3CVRA 4V1Av 3AA1B 2UXCT 5AQGB 4QKNA 5HEHA 4AXPA 5HXCA 4PFOA 5HXEA 4PJMA 2V6YA 1X79A 4EV6A 2KT9A 2KSRA 3G06A 2HPLA 3RIAA 2ODVA 3X1DA 3HA4A 4A97A 1FJGT 4ADZA 3UU4A 5LB7B 1CHUA 1BR2A 2CPTA 3P4PA 4LMKA 2WZIA 4DVDA 3C51A 4O2AE 3PURA 1D0YA 4NPPA 1EZ3A 4P0AA 3AAAB 4ILUA 1U5PA 4BAYB 5ABHA 2JMKA 3JADA 4JI5T 5LG3A 2V7MA 1UURA 1E2AA 4NIQA 3OJAA 5LOVE 4QH4A 3RLFF 4Z8XA 1SUMB 4DR4T 3LK2B 4X5TA 1HNWT 3CX7B 2BG9E 1D1CA 1WR0A 3RX6A 1J1JA 3A8YC 5L3GB 4KMCA 3B57A 4X64T 4EZ4A 4IE6A 2E9XC 3ZPOA 4DV7T 1W09A 2HH7A 1MMNA 4WW0A 2YDQA 3PTRB 3SWHA 3FBZA 4I50E 1N32T 4AKRB 4TWDA 5HXRA 4U2ZA 4AQFA 2E9XD 3EI0A 2W67A 3ZC0A 4ASKA 2IIUA 1Y01A 4QXBB 4QHOA 3ABVA 4TUYE 4DV6T 3K1SA 4U74A 3AE3A 4ZS2A 3H3AA 3MK7C 1Y64B 2Q9QA 1KF6A 5LBQB 1MNDA 2D2SA 5FMNA 2YU1A 2W61A 3LJCA 2BZBA 2LSGA 4PFPA 3E22E 2FJEA 4X1IE 3UQ7A 1B7TA 5LHGB 3ETVA 2VK9A 1HF8A 5AQMB 1Z8UA 3TLVA 5H6QB 2XAQB 3VRBA 2DWKA 2WBLA 5ABFA 2OA5A 3V5SA 3FZKB 2IC9A 2KXPB 4O8SA 3PUXF 5AQVB 4EOZB 2XM1A 2V7KA 2IW5B 3JAFA 3AA6B 5F5WA 4MALA 1IBMT 5L3DB 3KFWX 5IUXA 2MOZA 4MFRA 3GA8A 2W0GA 3NWIA 2PBIA 4A98A 5L2LA 2K24A 4DR2T 2MTQA 1D1AA 2BBJA 5L3FB 2I0MA 2D9DA 5AQFB 1YKEB 5LHHB 1JNZA 2LT3A 3D0TA 2YN6A 3ZMZB 4PAGA 5A1LA 2CXFA 3TLTA 4ANJA 4AIUA 3C50A 3N2OA 3C4WA 5AQNB 4ZEYA 1R8IA 3ZMVB 3LSVA 3AE1A 1KNZA 4XZCA 4HE8A 2W2UA 5HEOA 5JR9A 1WFDA 1WYCA 2PJQA 3RI5A 1FIOA 3ETUA 2LOSA 2WWVA 3RYCE 2CCQA 2UXBT 5CFBA 3AAEB 3AE4A 4A5XA 2G0UA 4DBQA 2CWOA 4YLHA 4UVCB 3VR8A 5AFUL 4ZOLE 2V5DA 3UUNA 3SS1A 5KX5E 2E2AA 2A72A 4JUYA 2ZM0A 3CQGB 1ZV4X 2V5CA 4U3CA 4YSZA 4FI5A 3NZQA 4X66T 2VL0A 3U78A 2L8KA 4H9NC 4O4LE 1HS7A 2E9XB 3N9NA 3RC3A 2CWYA 4IT4A 5BR8T 2SPCA 1XNRT 3QOFA 1HFAA 4GKKT 3EAMA 2EHOA 2X9XA 4LF4T 3RF1A 4DMWA 3GWHA 2X66A 2ZMAA 3C98B 1VCSA 3CX6B 4IGUA 4Q25A 4CN4A 2CHOA 1OEDA 3E08A 5AQLB 3ONLC 3RIUC 3S4UA 1M62A 2BS2A 1OEDC 2CBJA 2QA7A 3ZYLA 3KBUA 4MHCA 2X0YA 3F57A 2V6XA 4HFEA 2CEAA 1VCTA 3CQXC 4B3TT 2WDVA 3QB5K 2IC6A 4ILAA 5EZYE 2NTYA 4IDPA 3LDQB 4H9PC 1MNEA 5IYZE 4P0BA 1XMQT 3RGLA 3P4RA 3CIRA 2WU5A 4HFDA 3UUBA 3T8OA 2LOPA 3FZLB 5ETWA 3UULA 3N9LA 4JI0T 3AEDA 2C5KT 1T7SA 3BK9A 2V7IA 4EYUA 2XAGB 4K0KT 4LMJA 2LKHA 2VQET 1T98A 2ZM2A 2LRLA 2NW9A 3EDUA 5EK3A 4CXXA 4ERRA 3AVRA 3EHZA 4ZXLA 2CRBA 3PDYA 3ZLIA 2VKHA 3CKDA 4GYSA 1L0VA 1J5WA 4ISSA 4FJOA 3AE6A 1LKXA 2KZ7B 3B13A 5L3CB 2JRKA 2IUBA 5FY7A 2W4XA 2X9WA 4TNVA 1XZYA 4C90A 5AQPB 5AQRB 4UF0B 1UUSA 4ILCA 2ACXA 5JRCA 1XWMA 5CB4E 1OEDE 3RIFA 4CXYA 4IL4A 4DBRA 4HWDA 2BBHA 5LGNB 5LBMA 4YSXA 1T72A 2BDEA 2M6BA 2PFVA 2XPKA 4DUZT 3PUWF 5AQTB 1HX1B 4IHJE 3SOLA 2WP9A 1I6ZA 4LF9T 2CM0A 2BS4A 3FB2A 4JI1T 1S35A 5FNVE 3PUVF 4CQIA 3FXEB 2NW8A 4KX6A 3UQ4A 4KHPT 2AXDS 2J62A 4JEHB 3VKGA 2FJBA
chains in the Genus database with same CATH topology
2VQFT 4GKKT 1FJGT 4DV4T 5LMUT 4DV6T 4X65T 4LF4T 4DR7T 4DR3T 4X62T 4JI8T 4AQYT 5IWAT 4DR5T 4YHHT 4DR1T 4LFCT 4B3RT 4DV5T 2UXDT 4JI5T 4DR6T 4GKJT 4LFBT 4NXMT 2F4VT 4DV0T 3T1HT 5LMNT 2UXBT 4DR4T 1HNWT 1IBLT 4B3TT 2UUAT 4OX9T 4LF6T 4B3ST 2UUCT 1IBKT 1N33T 4JI7T 3OTOT 1HR0T 4LF8T 1J5ET 2UUBT 1HNZT 4DV3T 4JI2T 1XMQT 4LFAT 4B3MT 4DUZT 4X64T 2UXCT 3T1YT 4JI6T 4LF9T 4YY3T 4X66T 4DV7T 2E5LT 2HHHT 4JI1T 1IBMT 4JV5T 4JYAT 1N36T 4DV2T 4JI0T 4LF7T 2UU9T 4DUYT 2ZM6T 4NXNT 1I94T 1XMOT 4JI4T 4KHPT 1N32T 4DR2T 4K0KT 5BR8T 1XNQT 1XNRT 4JI3T 2VQET 1N34T 4DV1T 4LF5T 1HNXT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF T;  4GKK T;  1FJG T;  4DV4 T;  5LMU T;  4DV6 T;  4X65 T;  4LF4 T;  4DR7 T;  4DR3 T;  4X62 T;  4JI8 T;  4AQY T;  5IWA T;  4DR5 T;  4YHH T;  4DR1 T;  4LFC T;  4B3R T;  4DV5 T;  2UXD T;  4JI5 T;  4DR6 T;  4GKJ T;  4LFB T;  4NXM T;  2F4V T;  4DV0 T;  3T1H T;  5LMN T;  2UXB T;  4DR4 T;  1HNW T;  1IBL T;  4B3T T;  2UUA T;  4OX9 T;  4LF6 T;  4B3S T;  2UUC T;  1IBK T;  1N33 T;  4JI7 T;  3OTO T;  1HR0 T;  4LF8 T;  1J5E T;  2UUB T;  1HNZ T;  4DV3 T;  4JI2 T;  1XMQ T;  4LFA T;  4B3M T;  4DUZ T;  4X64 T;  2UXC T;  3T1Y T;  4JI6 T;  4LF9 T;  4YY3 T;  4X66 T;  4DV7 T;  2E5L T;  2HHH T;  4JI1 T;  1IBM T;  4JV5 T;  4JYA T;  1N36 T;  4DV2 T;  4JI0 T;  4LF7 T;  2UU9 T;  4DUY T;  2ZM6 T;  4NXN T;  1I94 T;  1XMO T;  4JI4 T;  4KHP T;  1N32 T;  4DR2 T;  4K0K T;  5BR8 T;  1XNQ T;  1XNR T;  4JI3 T;  2VQE T;  1N34 T;  4DV1 T;  4LF5 T;  1HNX T; 
#chains in the Genus database with same CATH topology
 1YKH B;  5FXZ A;  4DV4 T;  3MZK B;  3NRY A;  5LNK A;  4H9O C;  3FZH B;  3N9Q A;  5J2U E;  3ZEF B;  2Y6X A;  1MIV A;  5FY0 A;  3RKG A;  3DP7 A;  5LGU B;  2PTF A;  3AE5 A;  3KV9 A;  5JDF A;  3AA0 B;  4QXH B;  2V1D B;  3EAB A;  2X51 A;  1HCI A;  4LF6 T;  1LRZ A;  3EDV A;  4X1Y E;  3LG7 A;  1E1H B;  1KK7 A;  4IDZ A;  5JDM A;  2UUB T;  2H88 A;  3CML A;  4CI3 B;  5J0Z A;  4JI6 T;  2YDR A;  3AEG A;  1W9R A;  3K8P C;  1ZKE A;  2JQ9 A;  1FMW A;  1SHZ C;  2K9A A;  2ZM6 T;  4YHJ A;  1UX4 A;  2DHR A;  4IE7 A;  1XMO T;  2V7L A;  2XQ7 A;  3ZN1 B;  5JDN A;  3VU7 H;  3ZYM A;  4GK0 E;  5J2T E;  2N9D A;  5AQU B;  2XAJ B;  3HL6 A;  1MIY A;  3KVB A;  3B5M A;  3UU8 A;  4DND A;  3FXD B;  1WCR A;  2VKD A;  4O4I E;  5FYM A;  1YXR A;  3P4W A;  2JMH A;  1QLB A;  5CA0 E;  3ONJ A;  4OFZ A;  3PU8 A;  1WR6 A;  2XAH B;  3VR9 A;  3BQL A;  4DR6 T;  4AQF C;  3TLS A;  2IDO B;  2E8I A;  5JVD E;  4O4H E;  3TKL B;  3Q5E A;  3IBP A;  1V9D A;  2E5V A;  2N1G A;  2UUC T;  2CBI A;  2WMN A;  2Q9Q C;  3QC9 A;  3MKD A;  4CI1 B;  4JLE A;  4GK5 E;  2CLY B;  1HR0 T;  2B76 A;  1MMD A;  1HNZ T;  3PUS A;  4PK4 A;  4E7S A;  4XAX B;  5JDH A;  2BG9 B;  3AEB A;  1UX5 A;  4AKL A;  3O4X E;  4DV2 T;  4YXD A;  4U72 A;  2Q9Q D;  2CMR A;  4H9R C;  4NXN T;  2H7V C;  2V8S V;  2XY8 B;  4IDQ A;  2YKS A;  3NVO A;  5JDL A;  3RPU A;  1NWM X;  4QXC B;  2XQ5 A;  2X9H A;  3DJB A;  3HR0 A;  5CJ5 A;  5HWX A;  4HWC A;  3ESL A;  3L3P A;  4A56 A;  2D0U A;  3ANW B;  2KMF A;  4JI8 T;  4H63 V;  2HPJ A;  2L3L A;  3RYH E;  3LK3 B;  3AA7 B;  3JCF A;  2XHE B;  2A2F X;  3UTK A;  1WLX A;  2Z6E A;  1GQE A;  2V6Y B;  5LP6 E;  4UEM A;  2MYS A;  5E0O A;  2BKN A;  2UUA T;  3MAC A;  4OX9 T;  2LSJ A;  1NEK A;  5LG4 A;  1S94 A;  3R84 B;  4JEU B;  3O1J A;  3AE7 A;  3PJA A;  2W63 A;  4TWF A;  5ABE A;  5M4Y A;  2BVM A;  4C91 A;  5H6R B;  2X9Y A;  5JR9 C;  4HFB A;  2XAF B;  3I1A A;  4UVB B;  3Q5D A;  3TLW A;  3IA3 A;  3J7Y q;  4L5G A;  4LF7 T;  2GK9 A;  1Z0P A;  2B1E A;  2H3R A;  2UXN B;  5L4H A;  3NZP A;  4QX7 B;  3Q5W A;  4LF5 T;  3P7I A;  2J47 A;  3AXJ B;  3OVU A;  4CN6 A;  3ZN0 B;  2VQF T;  4AKI A;  3AAI A;  3C64 A;  2XM2 A;  2LSI A;  3ZSS A;  3AE2 A;  3LBX B;  5TAO A;  2HN2 A;  3CWZ B;  3ONX A;  3GN5 B;  3PUZ F;  4DID B;  3AEC A;  3KDS E;  2UXD T;  4AQG A;  5AQH B;  5EK4 A;  2LSY A;  4O4J E;  3W15 B;  2MPK A;  3UU5 A;  4NXM T;  3KBT A;  5LGT B;  2BKO A;  4Z90 A;  2RA1 A;  3RH3 A;  5ADX L;  2EHO C;  2DWG A;  2D0T A;  3E0Z A;  1IBK T;  1XDP A;  4YFS A;  4AKH A;  4GYR A;  3O9X A;  3AEA A;  3IEE A;  3F31 A;  1HTJ F;  4ILB A;  3I0Q A;  3HI2 A;  2EHO D;  2N2N A;  1G8X A;  4F8H A;  2ACZ A;  2XAS B;  3FZF B;  3PUY F;  3ZST A;  4HWH A;  5FL1 A;  3LK4 2;  2WM9 A;  4UVA B;  4EB6 E;  3N9P A;  2VL8 A;  5GON E;  1U4Q A;  3OBV E;  4OYK A;  1E7P A;  2VKJ A;  5C3J A;  4MBQ A;  5AQI B;  4U7Y A;  2XSA A;  3UU6 A;  2FJA A;  2K5B B;  4EZH A;  4ZI2 C;  1W0A A;  4DR3 T;  3ZYK A;  2XQ4 A;  4PK6 A;  5HXS A;  4YHH T;  4LFC T;  1IJ5 A;  1OWA A;  4TX5 A;  2XSB A;  4L0R A;  2C5I T;  4K0U A;  5LA6 E;  2C0S A;  2J4G A;  5LMN T;  4ZI2 D;  3I9W A;  2ZM8 A;  3L8R A;  2LLY A;  2XQ3 A;  1DU2 A;  5HCM A;  5LYJ E;  5DQV A;  4QH1 A;  3PV0 F;  2VAS A;  3K3N A;  4IE5 A;  3U3I A;  3PJA J;  4B3M T;  3PUQ A;  2K48 A;  4ZS3 A;  4KI0 F;  1LVF A;  2WMO A;  3N9M A;  4YJ2 E;  4LML A;  2WDQ A;  4ZI3 C;  4DO0 A;  4UEL A;  2XQA A;  5KXJ A;  4ZZB A;  4JI4 T;  2VB6 A;  2IML A;  1ZOY A;  2YK0 A;  4JI3 T;  4OK0 A;  2BG9 A;  1HX8 A;  3LFM A;  3BQI A;  1CUN A;  2W00 A;  1UK5 A;  4M1P A;  5FKY A;  3M3Z B;  2LEH A;  3F2E A;  3WAJ A;  1G73 A;  4ZI3 D;  3UU3 A;  3ZC1 A;  5L47 A;  4KHZ F;  2K3W A;  3C4X A;  2JJ9 A;  3WAK A;  4AQY T;  4DR5 T;  2KND A;  3ZJ1 A;  2KIN B;  4I55 E;  3OYZ A;  2Y48 B;  2XQ9 A;  1KFY A;  5HAX A;  3AEF A;  5JDG A;  5C2T A;  1T8B A;  3ZT6 A;  1AJ3 A;  5DQW A;  3CK6 A;  4HFH A;  4EAH A;  1VRB A;  5JDQ A;  4EXT A;  3O1I A;  3ANW A;  4F6R C;  3FZM B;  4HN9 A;  1IBL T;  3DTO A;  3VKH A;  4B3S T;  2QRX A;  5FVL A;  1W0B A;  2H7O A;  2QYW A;  2EHO B;  3OYX A;  5J1G A;  1ZP0 A;  4LFA T;  3H3M A;  4COF A;  2NOX A;  2ES0 A;  1UCU A;  4HFV A;  3EVY A;  4TV9 E;  4WBN E;  2VKO A;  1X9B A;  3PE0 A;  2HHH T;  1OED B;  4AIS A;  4JYA T;  4TWH A;  2RP4 A;  4N78 D;  4DUY T;  1QSD A;  2BS3 A;  1I94 T;  2NP9 A;  3RYF E;  4ZZC A;  5JH7 E;  4O2B E;  5FY1 A;  3H37 A;  3ZMS B;  3NBX X;  2LE8 A;  3PUG A;  3RRC A;  3SFE A;  1HNX T;  5KMG P;  5LMU T;  1FMV A;  3UUM A;  2WU2 A;  2VVN A;  4HGA A;  4XBF B;  3KV5 A;  4J2C A;  5LJN A;  3FHN A;  3RKO A;  2XTL A;  5LJM A;  3HKD E;  2DLR A;  2WWU A;  3AXJ A;  4PNI A;  4UXN B;  3V5U A;  4PJN A;  1UGO A;  2I59 A;  1H7C A;  3P4S A;  3TLU A;  2NWB A;  2E9X A;  2LKG A;  3P8C D;  1NAF A;  2FBW A;  4GKJ T;  5ABG A;  5L3E B;  5AQO B;  1VOM A;  3AE9 A;  3RQW A;  3RC8 A;  3LBX A;  2V26 A;  1IJ6 A;  2WY2 A;  4IDN A;  2QVA A;  2YEV C;  5IHY A;  3GN5 A;  3BQK A;  3ZMU B;  3N5L A;  3ZKR A;  4I43 B;  1US7 B;  4KBM B;  4MLK A;  5FXX A;  1D0Z A;  1N33 T;  2R6G F;  4IE4 A;  4LF8 T;  4PJL A;  2M6I A;  4DV3 T;  4JI2 T;  2DI4 A;  2YU2 A;  3L09 A;  2MBG A;  4WZX A;  3UT5 E;  4YY3 T;  3I0O A;  4JV5 T;  1JNR A;  5C8Y E;  4EGW A;  2FJD A;  4U31 A;  3PU3 A;  2YIN A;  5F3J A;  4G63 A;  3JC6 C;  2LSK A;  4QX8 B;  4E7Z A;  4YTN A;  3ZCI A;  3KV6 A;  5L4E A;  5JRC B;  5LHI B;  4PJJ A;  1QUU A;  2JQQ A;  3KIN B;  4ZI7 E;  2M67 A;  3KVA A;  2XUE A;  1SA0 E;  5HEU A;  2UXX B;  2CA5 A;  3JC6 D;  2KWI B;  2NW7 A;  2OV9 A;  3FBL A;  3QK6 A;  2MAW A;  2BKP A;  2WZH A;  5IWA T;  1LVK A;  4IST A;  4HFI A;  1YQ4 A;  4B3R T;  4YTP A;  4IIJ E;  1MIW A;  3ZT7 A;  4IE0 A;  4HWF A;  4TN7 B;  5HYA A;  4I4T E;  4X20 E;  2LM2 A;  2CHN A;  2XZE A;  1WYB A;  4UIG A;  4L9I A;  4CI2 B;  4OYJ A;  3IF8 B;  3SRZ A;  2X0L B;  4BJN A;  2Y8D A;  3P4Q A;  3RQU A;  3OKQ A;  4B6X A;  2LJL A;  4QH5 A;  1WRD A;  5CGM A;  1SE7 A;  2PG8 A;  3Q9D A;  3P50 A;  4P09 A;  3N9O A;  2RPA A;  2XJ7 A;  1MMA A;  4IL9 A;  3CPZ A;  3UFG A;  4EEB A;  2LHN A;  2WB5 A;  4UF0 A;  2WCA A;  4HTE A;  5FXV A;  2H89 A;  4DV1 T;  4U2Y A;  2IHR 1;  3CX8 B;  4AKG A;  4UV8 B;  2CE7 A;  2FUP A;  5LCY A;  1BR4 A;  4X62 T;  4H9Q C;  3AEE A;  3M65 A;  4IDO A;  3Q5X A;  5DJQ C;  4GIW A;  2J1D G;  5JQG E;  1IAP A;  2KWH A;  3UUX B;  3WI3 A;  3NKZ A;  3CQC B;  2I6H A;  3C4Z A;  3L39 A;  4WBO A;  2JQK A;  2XQY A;  2F4V T;  2KLQ A;  2NTX A;  4YJ3 E;  5DAB A;  2WSS V;  4H9S E;  3QNU A;  4G2A A;  2C5J A;  4WYV A;  2YOE A;  3N2K E;  2L9Q A;  4HFC A;  2ODU A;  2JIW A;  3OPC A;  4PK5 A;  3OTO T;  3RHW A;  4QWN B;  5FVK A;  4KUM B;  1YW0 A;  2VVS A;  4U7I A;  3IHR A;  3SFD A;  1D0X A;  3AVS A;  1KNP A;  3ZJ2 A;  2JQH A;  2E5L T;  3A5X A;  4ZHQ E;  1N36 T;  1NEN A;  2A3D A;  2LM9 A;  3JAE A;  2DL1 A;  4EIW A;  3MXZ A;  5AQS B;  5FP3 A;  2Q9Q B;  1XNQ T;  1O3X A;  3RIU A;  2AE9 A;  3UFE A;  5L3B B;  4JBW F;  4BJM A;  1N34 T;  5AQQ B;  2XQ8 A;  3ZMT B;  5F8P A;  4OHF A;  4TV8 E;  3O1H A;  1ZEE A;  4EYY R;  3RRW A;  2DNX A;  2CXD A;  1MMG A;  4HWI B;  3NRX A;  3MA9 A;  5BMV E;  1OXZ A;  1HG5 A;  4H63 H;  1D1B A;  3AB3 B;  4DR1 T;  4UR9 A;  3I9Y A;  3HKB E;  5EK2 A;  4GOU A;  3A7M A;  5ABF B;  4Z91 A;  4DV5 T;  5JTG A;  1BR1 A;  4CZZ B;  2D5U A;  5AQJ B;  3QB5 A;  4BA9 A;  5AQK B;  3VRA A;  4LFB T;  2X67 A;  3Q2M A;  4DV0 T;  2JPF A;  1M7K A;  3R6N A;  1ZHC A;  2V7J A;  5HEJ A;  3HKC E;  2DCF A;  1KEY A;  2VWA A;  2W62 A;  2A9U A;  2WDR A;  2YDS A;  5HWY A;  1YD8 G;  4DMV A;  2CXL A;  4YSY A;  1FEW A;  5LXT E;  2VUR A;  3VHL A;  3T1Y T;  1IZN B;  3MJX A;  4TNW A;  2HN1 A;  2P9B A;  5JRE A;  2LRK A;  2W66 A;  2UU9 T;  2NR4 A;  4NUU A;  3ZT5 A;  2ZLY A;  3J9X 1;  4NUV A;  4KP3 C;  5HCJ A;  3AE8 A;  3K3Q C;  2IAK A;  3PUA A;  3GMI A;  2X68 A;  4TZ4 C;  4EED A;  1BR0 A;  5JR9 B;  2OLT A;  5HXH A;  4X65 T;  4DR7 T;  4IRE A;  2CLY C;  2WS3 A;  4HEA A;  2WQY A;  3HKE E;  4X1K E;  4P1N A;  2BVL A;  4HKA A;  5HEG A;  3KV4 A;  4CXW A;  4AI6 A;  5FL0 A;  4I0U A;  2BG9 C;  2WAU A;  3T1H T;  5KDM C;  5FXW A;  3K3O A;  3EUH A;  3QUJ A;  1YQ3 A;  2LHR A;  4U33 A;  4YT0 A;  2XQ6 A;  4UV9 B;  1XDO A;  1HG2 A;  4JI7 T;  4YTM A;  3RYI E;  4WNK A;  1J5E T;  2X0H A;  1KNR A;  3N2G E;  4CN1 A;  3ZCJ A;  2QGS A;  4PW8 A;  5CA1 E;  3CVR A;  4V1A v;  3AA1 B;  2UXC T;  5AQG B;  4QKN A;  5HEH A;  4AXP A;  5HXC A;  4PFO A;  5HXE A;  4PJM A;  2V6Y A;  1X79 A;  4EV6 A;  2KT9 A;  2KSR A;  3G06 A;  2HPL A;  3RIA A;  2ODV A;  3X1D A;  3HA4 A;  4A97 A;  1FJG T;  4ADZ A;  3UU4 A;  5LB7 B;  1CHU A;  1BR2 A;  2CPT A;  3P4P A;  4LMK A;  2WZI A;  4DVD A;  3C51 A;  4O2A E;  3PUR A;  1D0Y A;  4NPP A;  1EZ3 A;  4P0A A;  3AAA B;  4ILU A;  1U5P A;  4BAY B;  5ABH A;  2JMK A;  3JAD A;  4JI5 T;  5LG3 A;  2V7M A;  1UUR A;  1E2A A;  4NIQ A;  3OJA A;  5LOV E;  4QH4 A;  3RLF F;  4Z8X A;  1SUM B;  4DR4 T;  3LK2 B;  4X5T A;  1HNW T;  3CX7 B;  2BG9 E;  1D1C A;  1WR0 A;  3RX6 A;  1J1J A;  3A8Y C;  5L3G B;  4KMC A;  3B57 A;  4X64 T;  4EZ4 A;  4IE6 A;  2E9X C;  3ZPO A;  4DV7 T;  1W09 A;  2HH7 A;  1MMN A;  4WW0 A;  2YDQ A;  3PTR B;  3SWH A;  3FBZ A;  4I50 E;  1N32 T;  4AKR B;  4TWD A;  5HXR A;  4U2Z A;  4AQF A;  2E9X D;  3EI0 A;  2W67 A;  3ZC0 A;  4ASK A;  2IIU A;  1Y01 A;  4QXB B;  4QHO A;  3ABV A;  4TUY E;  4DV6 T;  3K1S A;  4U74 A;  3AE3 A;  4ZS2 A;  3H3A A;  3MK7 C;  1Y64 B;  2Q9Q A;  1KF6 A;  5LBQ B;  1MND A;  2D2S A;  5FMN A;  2YU1 A;  2W61 A;  3LJC A;  2BZB A;  2LSG A;  4PFP A;  3E22 E;  2FJE A;  4X1I E;  3UQ7 A;  1B7T A;  5LHG B;  3ETV A;  2VK9 A;  1HF8 A;  5AQM B;  1Z8U A;  3TLV A;  5H6Q B;  2XAQ B;  3VRB A;  2DWK A;  2WBL A;  5ABF A;  2OA5 A;  3V5S A;  3FZK B;  2IC9 A;  2KXP B;  4O8S A;  3PUX F;  5AQV B;  4EOZ B;  2XM1 A;  2V7K A;  2IW5 B;  3JAF A;  3AA6 B;  5F5W A;  4MAL A;  1IBM T;  5L3D B;  3KFW X;  5IUX A;  2MOZ A;  4MFR A;  3GA8 A;  2W0G A;  3NWI A;  2PBI A;  4A98 A;  5L2L A;  2K24 A;  4DR2 T;  2MTQ A;  1D1A A;  2BBJ A;  5L3F B;  2I0M A;  2D9D A;  5AQF B;  1YKE B;  5LHH B;  1JNZ A;  2LT3 A;  3D0T A;  2YN6 A;  3ZMZ B;  4PAG A;  5A1L A;  2CXF A;  3TLT A;  4ANJ A;  4AIU A;  3C50 A;  3N2O A;  3C4W A;  5AQN B;  4ZEY A;  1R8I A;  3ZMV B;  3LSV A;  3AE1 A;  1KNZ A;  4XZC A;  4HE8 A;  2W2U A;  5HEO A;  5JR9 A;  1WFD A;  1WYC A;  2PJQ A;  3RI5 A;  1FIO A;  3ETU A;  2LOS A;  2WWV A;  3RYC E;  2CCQ A;  2UXB T;  5CFB A;  3AAE B;  3AE4 A;  4A5X A;  2G0U A;  4DBQ A;  2CWO A;  4YLH A;  4UVC B;  3VR8 A;  5AFU L;  4ZOL E;  2V5D A;  3UUN A;  3SS1 A;  5KX5 E;  2E2A A;  2A72 A;  4JUY A;  2ZM0 A;  3CQG B;  1ZV4 X;  2V5C A;  4U3C A;  4YSZ A;  4FI5 A;  3NZQ A;  4X66 T;  2VL0 A;  3U78 A;  2L8K A;  4H9N C;  4O4L E;  1HS7 A;  2E9X B;  3N9N A;  3RC3 A;  2CWY A;  4IT4 A;  5BR8 T;  2SPC A;  1XNR T;  3QOF A;  1HFA A;  4GKK T;  3EAM A;  2EHO A;  2X9X A;  4LF4 T;  3RF1 A;  4DMW A;  3GWH A;  2X66 A;  2ZMA A;  3C98 B;  1VCS A;  3CX6 B;  4IGU A;  4Q25 A;  4CN4 A;  2CHO A;  1OED A;  3E08 A;  5AQL B;  3ONL C;  3RIU C;  3S4U A;  1M62 A;  2BS2 A;  1OED C;  2CBJ A;  2QA7 A;  3ZYL A;  3KBU A;  4MHC A;  2X0Y A;  3F57 A;  2V6X A;  4HFE A;  2CEA A;  1VCT A;  3CQX C;  4B3T T;  2WDV A;  3QB5 K;  2IC6 A;  4ILA A;  5EZY E;  2NTY A;  4IDP A;  3LDQ B;  4H9P C;  1MNE A;  5IYZ E;  4P0B A;  1XMQ T;  3RGL A;  3P4R A;  3CIR A;  2WU5 A;  4HFD A;  3UUB A;  3T8O A;  2LOP A;  3FZL B;  5ETW A;  3UUL A;  3N9L A;  4JI0 T;  3AED A;  2C5K T;  1T7S A;  3BK9 A;  2V7I A;  4EYU A;  2XAG B;  4K0K T;  4LMJ A;  2LKH A;  2VQE T;  1T98 A;  2ZM2 A;  2LRL A;  2NW9 A;  3EDU A;  5EK3 A;  4CXX A;  4ERR A;  3AVR A;  3EHZ A;  4ZXL A;  2CRB A;  3PDY A;  3ZLI A;  2VKH A;  3CKD A;  4GYS A;  1L0V A;  1J5W A;  4ISS A;  4FJO A;  3AE6 A;  1LKX A;  2KZ7 B;  3B13 A;  5L3C B;  2JRK A;  2IUB A;  5FY7 A;  2W4X A;  2X9W A;  4TNV A;  1XZY A;  4C90 A;  5AQP B;  5AQR B;  4UF0 B;  1UUS A;  4ILC A;  2ACX A;  5JRC A;  1XWM A;  5CB4 E;  1OED E;  3RIF A;  4CXY A;  4IL4 A;  4DBR A;  4HWD A;  2BBH A;  5LGN B;  5LBM A;  4YSX A;  1T72 A;  2BDE A;  2M6B A;  2PFV A;  2XPK A;  4DUZ T;  3PUW F;  5AQT B;  1HX1 B;  4IHJ E;  3SOL A;  2WP9 A;  1I6Z A;  4LF9 T;  2CM0 A;  2BS4 A;  3FB2 A;  4JI1 T;  1S35 A;  5FNV E;  3PUV F;  4CQI A;  3FXE B;  2NW8 A;  4KX6 A;  3UQ4 A;  4KHP T;  2AXD S;  2J62 A;  4JEH B;  3VKG A;  2FJB A; 
#chains in the Genus database with same CATH homology
 2VQF T;  4GKK T;  1FJG T;  4DV4 T;  5LMU T;  4DV6 T;  4X65 T;  4LF4 T;  4DR7 T;  4DR3 T;  4X62 T;  4JI8 T;  4AQY T;  5IWA T;  4DR5 T;  4YHH T;  4DR1 T;  4LFC T;  4B3R T;  4DV5 T;  2UXD T;  4JI5 T;  4DR6 T;  4GKJ T;  4LFB T;  4NXM T;  2F4V T;  4DV0 T;  3T1H T;  5LMN T;  2UXB T;  4DR4 T;  1HNW T;  1IBL T;  4B3T T;  2UUA T;  4OX9 T;  4LF6 T;  4B3S T;  2UUC T;  1IBK T;  1N33 T;  4JI7 T;  3OTO T;  1HR0 T;  4LF8 T;  1J5E T;  2UUB T;  1HNZ T;  4DV3 T;  4JI2 T;  1XMQ T;  4LFA T;  4B3M T;  4DUZ T;  4X64 T;  2UXC T;  3T1Y T;  4JI6 T;  4LF9 T;  4YY3 T;  4X66 T;  4DV7 T;  2E5L T;  2HHH T;  4JI1 T;  1IBM T;  4JV5 T;  4JYA T;  1N36 T;  4DV2 T;  4JI0 T;  4LF7 T;  2UU9 T;  4DUY T;  2ZM6 T;  4NXN T;  1I94 T;  1XMO T;  4JI4 T;  4KHP T;  1N32 T;  4DR2 T;  4K0K T;  5BR8 T;  1XNQ T;  1XNR T;  4JI3 T;  2VQE T;  1N34 T;  4DV1 T;  4LF5 T;  1HNX T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...