4JV5T

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4jv5T00
1I94T 4K0KT 1N32T 2ZM6T 4DV5T 5IWAT 4JI1T 1IBKT 5LMUT 2UXBT 1HNZT 2UUBT 4KHPT 4DV4T 4X66T 4JI7T 1XMOT 4GKKT 4JI4T 4JI2T 4JI0T 4X62T 4LF4T 4NXNT 4DR3T 4B3MT 4JI3T 4LFBT 4X64T 4GKJT 2E5LT 4DV2T 2UXCT 1XNRT 4DR7T 4DR5T 4DV0T 1N33T 4B3ST 4DV1T 4DR2T 4JI6T 3T1YT 1HNXT 4LF5T 4LF6T 4B3TT 4DUZT 2UXDT 4DR4T 2VQFT 4JI5T 1HR0T 2UUCT 4AQYT 4DV7T 4YHHT 3T1HT 4DR6T 1XNQT 4LF9T 3OTOT 4DV6T 1HNWT 2VQET 1XMQT 2UU9T 4DV3T 1IBMT 4JYAT 4DR1T 4X65T 1IBLT 1N34T 5LMNT 4LF8T 4JV5T 2HHHT 4OX9T 2F4VT 4B3RT 2UUAT 1FJGT 4NXMT 4YY3T 4JI8T 4DUYT 4LFAT 1N36T 4LF7T 5BR8T 4LFCT 1J5ET
chains in the Genus database with same CATH superfamily
3QC9A 3ZYKA 1MIWA 1UCUA 3CX7B 3RYFE 1HS7A 2A3DA 5C3JA 2B76A 4YXDA 4QX8B 2V6YB 3O1JA 5ABFB 4DV4T 3IHRA 4X66T 4LMKA 3AAEB 2H7OA 4UVAB 5F8PA 2ODUA 4ILAA 4H63V 4YSXA 4PJLA 2BBJA 2DHRA 2NOXA 3A7MA 2KWIB 2Q9QA 2C5JA 2NW7A 4YTMA 5JVDE 3Q5WA 1E2AA 5FNVE 2L9QA 1FIOA 3PJAJ 5HXCA 5H6RB 2CA5A 4TZ4C 4YHHT 5GONE 2CCQA 1V9DA 2E9XD 2YN6A 1B7TA 4U3CA 2Y48B 1KNPA 1HX8A 4L5GA 3RIFA 3WAKA 3UUMA 4QXBB 3MZKB 4TV9E 2D9DA 4IDQA 2D0TA 4IE6A 3FXEB 1MIVA 4LF7T 3MJXA 1KFYA 3RIUA 1OXZA 4HEAA 4JI1T 5KX5E 4CXXA 3C4XA 3AE8A 3JAFA 1HFAA 4HFCA 2V7JA 3M65A 4I0UA 5L3DB 3UQ4A 3DP7A 4X62T 4HFHA 1ZV4X 4X64T 4EB6E 2WWVA 2VKDA 4HWFA 4DR2T 4N78D 4E7SA 2WQYA 2VQFT 3F57A 4JI5T 1HR0T 4V1Av 1JNZA 2ZM8A 5LGNB 3BQLA 2LHRA 2KINB 4EGWA 2N9DA 4TUYE 4YTNA 1MNEA 3MACA 2FJAA 2DWGA 3UUNA 3PUXF 4CZZB 4F8HA 3HL6A 5HEHA 2IC6A 1OEDE 3O4XE 2C0SA 2CMRA 2CXLA 3CKDA 3LK2B 2YU1A 2W66A 2LSKA 3RF1A 3P4RA 2ACZA 1E7PA 3UU5A 2YKSA 3RYIE 4BJMA 2E9XB 2X67A 3SFDA 3I0OA 3IA3A 3RYCE 3EAMA 3ZMSB 5FP3A 4UF0B 4OYKA 5HCMA 4AI6A 4NXNT 3OJAA 4EEBA 3ZJ2A 4EYYR 5FXVA 5LG4A 5HXSA 2W00A 3LBXB 2WSSV 2PG8A 3N9OA 3E22E 2VASA 3FZLB 1UK5A 1XDPA 1CUNA 4YHJA 3UU6A 3KV6A 5EK2A 2RPAA 2IHR1 2W61A 3PUAA 3L39A 3ZSTA 3ZC1A 2WWUA 1VCTA 3KINB 1D1CA 4AQFC 4BJNA 1J5WA 1NEKA 3ZJ1A 4ZZCA 3VKGA 4X65T 1SE7A 3HA4A 2BZBA 4ZS2A 1N34T 4CN1A 1KNRA 5EZYE 2VVSA 4KMCA 5L3GB 2M67A 2UUAT 4ZHQE 4H9PC 5LXTE 4HFIA 5ABGA 4O4HE 4PFOA 3A8YC 3UUXB 1Y01A 2OV9A 2WMNA 1D0ZA 2V26A 5HYAA 3ONJA 4PFPA 4GYSA 5EK4A 4TN7B 5AQMB 5AQSB 3AVSA 2LSJA 4JI0T 4P1NA 3R84B 4U33A 2XHEB 1HG2A 3FXDB 3PU8A 3NRXA 4DR5T 3AEBA 1MNDA 3ZKRA 3PV0F 3Q9DA 2WP9A 1YKHB 4DMVA 3MA9A 4HFEA 2ZM0A 3VRBA 4U31A 1VCSA 3N2GE 5ADXL 4ANJA 2HPJA 2XPKA 2ZM2A 3OTOT 1WYCA 2LRKA 4ZI3D 5J2UE 3ZC0A 2BG9E 2KMFA 4ILCA 4UVBB 3EUHA 2NW9A 5JQGE 2HPLA 2ODVA 2HHHT 2F4VT 3K3NA 2I0MA 2LOPA 4L9IA 3FBZA 3SOLA 2CBJA 4LFCT 4IGUA 1UX5A 3EDVA 2QYWA 5LGTB 4JLEA 5DABA 2NTXA 1Z8UA 1IBKT 3ZT5A 5EK3A 3HKCE 2LKHA 4P0AA 5TAOA 4PJMA 4KHPT 4ZXLA 2LT3A 3AE1A 2DL1A 4HN9A 4EV6A 4FI5A 3AECA 3TKLB 3ZSSA 3JCFA 4AKIA 4IE5A 4G2AA 2MTQA 4DR7T 1WRDA 4TV8E 2WAUA 5JDHA 3AE3A 3ZT6A 3AEAA 2GK9A 2SPCA 4J2CA 4P0BA 3I0QA 2XAGB 3CQGB 3NRYA 3LBXA 2H7VC 3UFEA 3RQUA 5JH7E 3IF8B 3RGLA 2XZEA 1OEDB 4ZS3A 4ZI2D 4H9SE 3ZCIA 5FXWA 4YFSA 5LGUB 2Y8DA 1OEDC 3FZHB 2EHOC 2LLYA 2PFVA 4AQFA 2X0HA 4U2YA 1IZNB 3CQXC 1KF6A 5L4HA 1IBLT 3QNUA 5BMVE 2W67A 4CI2B 2XAQB 3VR8A 4CQIA 2M6BA 4UELA 1ZEEA 2CM0A 1I94T 1Y64B 3N9PA 1EZ3A 2YU2A 2AE9A 4QXCB 2J1DG 2V7IA 4H9NC 3O1IA 5M4YA 1D0XA 5AQVB 4MBQA 4CI1B 2IUBA 4JI7T 4GKKT 2VVNA 4UEMA 4PNIA 5JDLA 1XDOA 4JI3T 2X0YA 5J1GA 2E5LT 5C2TA 5FXXA 4DV0T 2XSAA 3C50A 3B5MA 2BVLA 1WCRA 4B3ST 3GMIA 1XWMA 2I59A 1HNXT 2BS2A 3C4WA 3AEDA 4YSYA 4IE0A 3NWIA 2IMLA 3B13A 4EXTA 2X9WA 4DVDA 4CN4A 2K3WA 4X1IE 3NBXX 4Q25A 4LF9T 2KXPB 3PU3A 3E0ZA 3KV5A 3QUJA 2BS3A 2E2AA 4LMJA 3L3PA 3LK3B 2FUPA 2NR4A 2XQAA 5IYZE 5LMNT 3AA6B 4B3RT 2L3LA 3EHZA 4LFAT 2XQ3A 5BR8T 2XQ6A 3IEEA 4PJNA 1S35A 1KEYA 2YDRA 5FXZA 2V1DB 5KMGP 4AIUA 4E7ZA 1BR4A 2FBWA 3P50A 3RX6A 3QK6A 3V5SA 2WM9A 4H9QC 3UQ7A 3CK6A 1XMOT 2UXNB 3NZPA 2CWOA 1X79A 4JEHB 4LMLA 3AE5A 3TLTA 4H9OC 2BG9B 2X68A 5HEUA 1M62A 2K24A 2J4GA 5ABEA 4XAXB 2VL0A 1NAFA 2E8IA 2VL8A 5HXRA 4MHCA 2QRXA 2YOEA 4HKAA 3KVAA 2BBHA 1WYBA 4H63H 3RYHE 3K3OA 2CE7A 1OEDA 4PJJA 5HWXA 3PUVF 4PAGA 2EHOA 5JTGA 2FJEA 2XQ7A 5LHIB 4DV3T 3PTRB 2YDSA 1VOMA 2WCAA 4UXNB 2DI4A 4MFRA 3D0TA 4DO0A 1QUUA 2KSRA 3RHWA 2W62A 5AQNB 2WB5A 4OHFA 1UGOA 4WZXA 5HEOA 3RKOA 5FY1A 3AB3B 4DMWA 2XASB 3AEEA 4AXPA 5E0OA 5HAXA 5FL0A 3OVUA 2E5VA 2RP4A 1W0AA 3PURA 2W4XA 2JRKA 4NUUA 2XAJB 2WBLA 5AQLB 4JBWF 3AXJA 1W0BA 3P7IA 4ILBA 5JRCB 1QLBA 1JNRA 3AEGA 3UU3A 4LFBT 4GKJT 2UXCT 3CMLA 2MBGA 4PK4A 1G8XA 4G63A 2V6YA 2CXDA 5ABFA 3ONXA 3TLUA 5AQUB 2E9XC 1IJ5A 4LF5T 1BR0A 3NZQA 3VHLA 5J0ZA 2Q9QD 2UUCT 3LJCA 3SS1A 1KK7A 3HR0A 3AVRA 4GOUA 5CFBA 3ABVA 2KNDA 4AQGA 2XQ9A 4CI3B 2BDEA 3CVRA 3LK42 2VKHA 2A9UA 3HKBE 4EYUA 2D0UA 5KDMC 4CXWA 5L4EA 3A5XA 5HXHA 2JMHA 2YK0A 4ERRA 4BAYB 4C90A 5FYMA 5F3JA 5JR9B 4UIGA 1NWMX 2XM1A 3C4ZA 4HGAA 5IWAT 2BKOA 2LSIA 1HG5A 2UXBT 4KBMB 2X51A 4EZ4A 4BA9A 4X5TA 4AKRB 2D2SA 3O9XA 4NPPA 5AQIB 3N2OA 2CBIA 1W9RA 4HWIB 5HEJA 2LHNA 5CA0E 5LJMA 5FVKA 2V6XA 3U78A 2OLTA 3ONLC 1XZYA 2JQKA 2MAWA 2QVAA 2UXDT 2V8SV 1UURA 4O8SA 4ISTA 4EIWA 3OKQA 2A72A 3OBVE 3PUGA 2JQHA 3KFWX 1QSDA 5AQKB 4WYVA 3JADA 2JPFA 3FZKB 2WU5A 4U74A 4JYAT 2VKJA 5HEGA 2R6GF 3ETVA 1HTJF 5FL1A 3ESLA 2VB6A 4L0RA 3KBTA 3UT5E 2VKOA 5HWYA 3TLSA 2CRBA 4DV5T 3FZMB 5JDQA 5AQQB 4PK5A 1D1AA 5AQGB 2Q9QB 5FY7A 2IC9A 4IDPA 1HNZT 4O2BE 3V5UA 2CHNA 5L3EB 2D5UA 4FJOA 2WS3A 4GK5E 2C5KT 4HFDA 2XAFB 2DLRA 4I50E 3VKHA 2CEAA 4B3MT 2LRLA 3L09A 3H3MA 3K1SA 3H37A 4UVCB 5C8YE 4O4JE 2M6IA 3N9MA 1LRZA 2E9XA 3FB2A 3T1YT 2DCFA 3J7Yq 3CWZB 2K5BB 3EDUA 1HX1B 3HI2A 4UF0A 4IE7A 3P4SA 2WMOA 3ZMVB 1ZP0A 3OYXA 4QKNA 4IHJE 3HKDE 1MMGA 2DNXA 4O4IE 2XUEA 4F6RC 3GN5B 1HNWT 2CLYB 5L3CB 2IDOB 2CPTA 5FMNA 3F2EA 4TX5A 2KT9A 2LJLA 1DU2A 1D0YA 4Z8XA 3SRZA 2H3RA 4QH5A 4JI8T 5FKYA 2BS4A 4C91A 2MPKA 1WLXA 4YT0A 1O3XA 4XZCA 3PUZF 1SHZC 3QOFA 3PDYA 4TWFA 3AA1B 2H89A 4TNVA 3F31A 2JMKA 1WFDA 4IDOA 2UUBT 3KV4A 4KUMB 2IW5B 4AKGA 4IDZA 5LHHB 4ILUA 4X20E 4HFBA 2X9XA 3LFMA 3ANWB 2YEVC 4QH4A 5AQHB 2YDQA 3PE0A 4JEUB 2MOZA 3VU7H 2N1GA 3C64A 4KX6A 4B3TT 4YTPA 4EZHA 1BR2A 4GYRA 5AQPB 3KVBA 4ZI3C 1HF8A 3ETUA 3RKGA 3UUBA 4KI0F 3VR9A 2XQYA 1FMVA 4IE4A 4CXYA 1T72A 4OFZA 4GK0E 4CN6A 1YD8G 4ZI7E 3H3AA 4YJ2E 4TWDA 4ZEYA 3I9YA 5AQTB 1FJGT 3LSVA 4YLHA 4DUYT 3M3ZB 2N2NA 3WAJA 1T8BA 3X1DA 4AKLA 1GQEA 3CX6B 1LVFA 3SWHA 3AE4A 3DJBA 4HWHA 4O2AE 3FZFB 2XAHB 3RLFF 3G06A 3K3QC 3ZYMA 3EABA 5ABHA 3GA8A 2FJBA 3KBUA 2ES0A 2BVMA 2W0GA 2G0UA 1MMNA 4A98A 2LSYA 2V5CA 1OWAA 4ZI2C 1D1BA 4MLKA 2VWAA 5JDFA 2KWHA 2WDVA 3O1HA 5HCJA 4JUYA 3TLWA 2K9AA 4EAHA 2RA1A 1S94A 5L3FB 4X1KE 4AQYT 4DV7T 1IJ6A 4ZZBA 3JC6C 2BG9C 5A1LA 2IIUA 5L2LA 2KZ7B 2XSBA 2HH7A 4HWDA 2YINA 2KLQA 3GN5A 4TNWA 5LP6E 1IBMT 5LCYA 2XQ8A 3NVOA 5CJ5A 1VRBA 5LBMA 3RC8A 1T7SA 2JIWA 5JREA 1N36T 1M7KA 2XJ7A 4IIJE 1I6ZA 2B1EA 5CB4E 3TLVA 3RRWA 5DQVA 3AEFA 3GWHA 3UU8A 4I43B 1ZHCA 2NW8A 4MALA 3CIRA 4JI4T 2XQ4A 4U2ZA 3B57A 3AE9A 4HFVA 4WNKA 3RRCA 3N2KE 3RPUA 4COFA 3ANWA 2LEHA 1J1JA 4DBRA 3K8PC 4NUVA 2X9HA 2JQQA 2V7KA 4JI6T 5LOVE 3P4PA 4DUZT 1T98A 2HN1A 4AISA 1WR0A 3PJAA 4DR4T 2C5IT 2DWKA 5FVLA 5AQOB 5HXEA 4IL4A 1MMDA 3AA0B 3HKEE 2V7LA 1U5PA 2V5DA 3AAIA 4Z91A 4DR6T 5LG3A 4X1YE 3PUSA 2X9YA 3CPZA 3DTOA 3N9NA 3FHNA 4DR1T 2VK9A 2X66A 3N9LA 1FMWA 2P9BA 3S4UA 2LSGA 3ZN1B 3ZYLA 5LYJE 1AJ3A 3QB5A 3P8CD 5LHGB 3RQWA 1NENA 2JQ9A 3I1AA 4QH1A 2WZIA 4Z90A 4XBFB 3N9QA 2LE8A 4ADZA 5LA6E 2J47A 4EOZB 5LJNA 4JI2T 1SA0E 2BKNA 2J62A 4U72A 4LF4T 3I9WA 2L8KA 2X0LB 3R6NA 5JR9C 2FJDA 2NTYA 1XNRT 4GIWA 4U7YA 3IBPA 3ZT7A 3ZN0B 3OPCA 1IAPA 4NIQA 3FBLA 4LF6T 1YQ4A 1ZKEA 5H6QB 1ZOYA 2CXFA 1E1HB 2WDQA 4M1PA 4I55E 2PBIA 3P4QA 3SFEA 2BG9A 1WR6A 2LOSA 4IREA 4UV8B 1YW0A 1FEWA 1G73A 1BR1A 1L0VA 3AE6A 4IL9A 2XTLA 1XNQT 4H9RC 4K0UA 4DV6T 1MMAA 4DNDA 3JAEA 1XMQT 3Q5EA 5L47A 2ZLYA 2EHOD 3PUYF 2UXXB 4PK6A 5JDGA 2PJQA 4YSZA 4OX9T 4UV9B 5FY0A 5J2TE 3E08A 4HTEA 5AQJB 1MIYA 2V7MA 1R8IA 1CHUA 4B6XA 3QB5K 4PW8A 3MXZA 2XQ5A 5LMUT 4QHOA 2Z6EA 1YKEB 1YXRA 2OA5A 4HWCA 3ZLIA 1YQ3A 1UX4A 4EEDA 1HCIA 3BK9A 5CA1E 2WU2A 3P4WA 4UR9A 1H7CA 3C51A 2CWYA 5CGMA 3CQCB 3OYZA 2A2FX 4DV2T 2AXDS 4WBNE 2Q9QC 2W63A 1N33T 4U7IA 5F5WA 4IT4A 2K48A 1W09A 2HN2A 5AQFB 3AE2A 5JDMA 4YJ3E 2LM9A 2WY2A 3C98B 2QGSA 2BKPA 3ZMZB 4OYJA 2WDRA 1LVKA 1LKXA 4ISSA 2PTFA 5JRCA 2H88A 3ZMUB 2JJ9A 2W2UA 5ETWA 4WBOA 1X9BA 4ASKA 3Q5XA 4ZOLE 3AAAB 2UU9T 4TWHA 5JDNA 3EVYA 1US7B 4JV5T 4QX7B 2CHOA 4P09A 4NXMT 4YY3T 3BQIA 3LG7A 4K0KT 1N32T 3RIUC 2ZM6T 4OK0A 4WW0A 3LDQB 3Q2MA 3KDSE 2XM2A 3RH3A 2Y6XA 2CLYC 4HE8A 4DBQA 1Z0PA 3ZEFB 4A97A 5KXJA 4KHZF 3KV9A 3W15B 3UULA 2LKGA 3J9X1 5LB7B 3ZMTB 2WZHA 3MKDA 4QWNB 4AKHA 3ZCJA 4O4LE 5JR9A 4DR3T 1U4QA 5LBQB 2EHOB 3NKZA 3MK7C 3RIAA 3AE7A 3UU4A 3UTKA 3AA7B 3N5LA 4I4TE 4DV1T 4QXHB 2ACXA 3EI0A 3T8OA 5AFUL 1KNZA 3PUWF 3JC6D 3VRAA 4KP3C 5IHYA 2XY8B 3PUQA 4A5XA 2IAKA 3UFGA 2LM2A 3T1HT 4A56A 2ZMAA 3WI3A 1SUMB 5DJQC 1UUSA 2VURA 3L8RA 2NWBA 2VQET 3U3IA 3Q5DA 5LNKA 3BQKA 5DQWA 2QA7A 4IDNA 2MYSA 2I6HA 3RC3A 3RI5A 4LF8T 5AQRB 3ZPOA 2NP9A 3AXJB 5IUXA 4DIDB 3CX8B 1J5ET 5L3BB
chains in the Genus database with same CATH topology
1I94T 4K0KT 1N32T 2ZM6T 4DV5T 5IWAT 4JI1T 1IBKT 5LMUT 2UXBT 1HNZT 2UUBT 4KHPT 4DV4T 4X66T 4JI7T 1XMOT 4GKKT 4JI4T 4JI2T 4JI0T 4X62T 4LF4T 4NXNT 4DR3T 4B3MT 4JI3T 4LFBT 4X64T 4GKJT 2E5LT 4DV2T 2UXCT 1XNRT 4DR7T 4DR5T 4DV0T 1N33T 4B3ST 4DV1T 4DR2T 4JI6T 3T1YT 1HNXT 4LF5T 4LF6T 4B3TT 4DUZT 2UXDT 4DR4T 2VQFT 4JI5T 1HR0T 2UUCT 4AQYT 4DV7T 4YHHT 3T1HT 4DR6T 1XNQT 4LF9T 3OTOT 4DV6T 1HNWT 2VQET 1XMQT 2UU9T 4DV3T 1IBMT 4JYAT 4DR1T 4X65T 1IBLT 1N34T 5LMNT 4LF8T 4JV5T 2HHHT 4OX9T 2F4VT 4B3RT 2UUAT 1FJGT 4NXMT 4YY3T 4JI8T 4DUYT 4LFAT 1N36T 4LF7T 5BR8T 4LFCT 1J5ET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 T;  4K0K T;  1N32 T;  2ZM6 T;  4DV5 T;  5IWA T;  4JI1 T;  1IBK T;  5LMU T;  2UXB T;  1HNZ T;  2UUB T;  4KHP T;  4DV4 T;  4X66 T;  4JI7 T;  1XMO T;  4GKK T;  4JI4 T;  4JI2 T;  4JI0 T;  4X62 T;  4LF4 T;  4NXN T;  4DR3 T;  4B3M T;  4JI3 T;  4LFB T;  4X64 T;  4GKJ T;  2E5L T;  4DV2 T;  2UXC T;  1XNR T;  4DR7 T;  4DR5 T;  4DV0 T;  1N33 T;  4B3S T;  4DV1 T;  4DR2 T;  4JI6 T;  3T1Y T;  1HNX T;  4LF5 T;  4LF6 T;  4B3T T;  4DUZ T;  2UXD T;  4DR4 T;  2VQF T;  4JI5 T;  1HR0 T;  2UUC T;  4AQY T;  4DV7 T;  4YHH T;  3T1H T;  4DR6 T;  1XNQ T;  4LF9 T;  3OTO T;  4DV6 T;  1HNW T;  2VQE T;  1XMQ T;  2UU9 T;  4DV3 T;  1IBM T;  4JYA T;  4DR1 T;  4X65 T;  1IBL T;  1N34 T;  5LMN T;  4LF8 T;  4JV5 T;  2HHH T;  4OX9 T;  2F4V T;  4B3R T;  2UUA T;  1FJG T;  4NXM T;  4YY3 T;  4JI8 T;  4DUY T;  4LFA T;  1N36 T;  4LF7 T;  5BR8 T;  4LFC T;  1J5E T; 
#chains in the Genus database with same CATH topology
 3QC9 A;  3ZYK A;  1MIW A;  1UCU A;  3CX7 B;  3RYF E;  1HS7 A;  2A3D A;  5C3J A;  2B76 A;  4YXD A;  4QX8 B;  2V6Y B;  3O1J A;  5ABF B;  4DV4 T;  3IHR A;  4X66 T;  4LMK A;  3AAE B;  2H7O A;  4UVA B;  5F8P A;  2ODU A;  4ILA A;  4H63 V;  4YSX A;  4PJL A;  2BBJ A;  2DHR A;  2NOX A;  3A7M A;  2KWI B;  2Q9Q A;  2C5J A;  2NW7 A;  4YTM A;  5JVD E;  3Q5W A;  1E2A A;  5FNV E;  2L9Q A;  1FIO A;  3PJA J;  5HXC A;  5H6R B;  2CA5 A;  4TZ4 C;  4YHH T;  5GON E;  2CCQ A;  1V9D A;  2E9X D;  2YN6 A;  1B7T A;  4U3C A;  2Y48 B;  1KNP A;  1HX8 A;  4L5G A;  3RIF A;  3WAK A;  3UUM A;  4QXB B;  3MZK B;  4TV9 E;  2D9D A;  4IDQ A;  2D0T A;  4IE6 A;  3FXE B;  1MIV A;  4LF7 T;  3MJX A;  1KFY A;  3RIU A;  1OXZ A;  4HEA A;  4JI1 T;  5KX5 E;  4CXX A;  3C4X A;  3AE8 A;  3JAF A;  1HFA A;  4HFC A;  2V7J A;  3M65 A;  4I0U A;  5L3D B;  3UQ4 A;  3DP7 A;  4X62 T;  4HFH A;  1ZV4 X;  4X64 T;  4EB6 E;  2WWV A;  2VKD A;  4HWF A;  4DR2 T;  4N78 D;  4E7S A;  2WQY A;  2VQF T;  3F57 A;  4JI5 T;  1HR0 T;  4V1A v;  1JNZ A;  2ZM8 A;  5LGN B;  3BQL A;  2LHR A;  2KIN B;  4EGW A;  2N9D A;  4TUY E;  4YTN A;  1MNE A;  3MAC A;  2FJA A;  2DWG A;  3UUN A;  3PUX F;  4CZZ B;  4F8H A;  3HL6 A;  5HEH A;  2IC6 A;  1OED E;  3O4X E;  2C0S A;  2CMR A;  2CXL A;  3CKD A;  3LK2 B;  2YU1 A;  2W66 A;  2LSK A;  3RF1 A;  3P4R A;  2ACZ A;  1E7P A;  3UU5 A;  2YKS A;  3RYI E;  4BJM A;  2E9X B;  2X67 A;  3SFD A;  3I0O A;  3IA3 A;  3RYC E;  3EAM A;  3ZMS B;  5FP3 A;  4UF0 B;  4OYK A;  5HCM A;  4AI6 A;  4NXN T;  3OJA A;  4EEB A;  3ZJ2 A;  4EYY R;  5FXV A;  5LG4 A;  5HXS A;  2W00 A;  3LBX B;  2WSS V;  2PG8 A;  3N9O A;  3E22 E;  2VAS A;  3FZL B;  1UK5 A;  1XDP A;  1CUN A;  4YHJ A;  3UU6 A;  3KV6 A;  5EK2 A;  2RPA A;  2IHR 1;  2W61 A;  3PUA A;  3L39 A;  3ZST A;  3ZC1 A;  2WWU A;  1VCT A;  3KIN B;  1D1C A;  4AQF C;  4BJN A;  1J5W A;  1NEK A;  3ZJ1 A;  4ZZC A;  3VKG A;  4X65 T;  1SE7 A;  3HA4 A;  2BZB A;  4ZS2 A;  1N34 T;  4CN1 A;  1KNR A;  5EZY E;  2VVS A;  4KMC A;  5L3G B;  2M67 A;  2UUA T;  4ZHQ E;  4H9P C;  5LXT E;  4HFI A;  5ABG A;  4O4H E;  4PFO A;  3A8Y C;  3UUX B;  1Y01 A;  2OV9 A;  2WMN A;  1D0Z A;  2V26 A;  5HYA A;  3ONJ A;  4PFP A;  4GYS A;  5EK4 A;  4TN7 B;  5AQM B;  5AQS B;  3AVS A;  2LSJ A;  4JI0 T;  4P1N A;  3R84 B;  4U33 A;  2XHE B;  1HG2 A;  3FXD B;  3PU8 A;  3NRX A;  4DR5 T;  3AEB A;  1MND A;  3ZKR A;  3PV0 F;  3Q9D A;  2WP9 A;  1YKH B;  4DMV A;  3MA9 A;  4HFE A;  2ZM0 A;  3VRB A;  4U31 A;  1VCS A;  3N2G E;  5ADX L;  4ANJ A;  2HPJ A;  2XPK A;  2ZM2 A;  3OTO T;  1WYC A;  2LRK A;  4ZI3 D;  5J2U E;  3ZC0 A;  2BG9 E;  2KMF A;  4ILC A;  4UVB B;  3EUH A;  2NW9 A;  5JQG E;  2HPL A;  2ODV A;  2HHH T;  2F4V T;  3K3N A;  2I0M A;  2LOP A;  4L9I A;  3FBZ A;  3SOL A;  2CBJ A;  4LFC T;  4IGU A;  1UX5 A;  3EDV A;  2QYW A;  5LGT B;  4JLE A;  5DAB A;  2NTX A;  1Z8U A;  1IBK T;  3ZT5 A;  5EK3 A;  3HKC E;  2LKH A;  4P0A A;  5TAO A;  4PJM A;  4KHP T;  4ZXL A;  2LT3 A;  3AE1 A;  2DL1 A;  4HN9 A;  4EV6 A;  4FI5 A;  3AEC A;  3TKL B;  3ZSS A;  3JCF A;  4AKI A;  4IE5 A;  4G2A A;  2MTQ A;  4DR7 T;  1WRD A;  4TV8 E;  2WAU A;  5JDH A;  3AE3 A;  3ZT6 A;  3AEA A;  2GK9 A;  2SPC A;  4J2C A;  4P0B A;  3I0Q A;  2XAG B;  3CQG B;  3NRY A;  3LBX A;  2H7V C;  3UFE A;  3RQU A;  5JH7 E;  3IF8 B;  3RGL A;  2XZE A;  1OED B;  4ZS3 A;  4ZI2 D;  4H9S E;  3ZCI A;  5FXW A;  4YFS A;  5LGU B;  2Y8D A;  1OED C;  3FZH B;  2EHO C;  2LLY A;  2PFV A;  4AQF A;  2X0H A;  4U2Y A;  1IZN B;  3CQX C;  1KF6 A;  5L4H A;  1IBL T;  3QNU A;  5BMV E;  2W67 A;  4CI2 B;  2XAQ B;  3VR8 A;  4CQI A;  2M6B A;  4UEL A;  1ZEE A;  2CM0 A;  1I94 T;  1Y64 B;  3N9P A;  1EZ3 A;  2YU2 A;  2AE9 A;  4QXC B;  2J1D G;  2V7I A;  4H9N C;  3O1I A;  5M4Y A;  1D0X A;  5AQV B;  4MBQ A;  4CI1 B;  2IUB A;  4JI7 T;  4GKK T;  2VVN A;  4UEM A;  4PNI A;  5JDL A;  1XDO A;  4JI3 T;  2X0Y A;  5J1G A;  2E5L T;  5C2T A;  5FXX A;  4DV0 T;  2XSA A;  3C50 A;  3B5M A;  2BVL A;  1WCR A;  4B3S T;  3GMI A;  1XWM A;  2I59 A;  1HNX T;  2BS2 A;  3C4W A;  3AED A;  4YSY A;  4IE0 A;  3NWI A;  2IML A;  3B13 A;  4EXT A;  2X9W A;  4DVD A;  4CN4 A;  2K3W A;  4X1I E;  3NBX X;  4Q25 A;  4LF9 T;  2KXP B;  3PU3 A;  3E0Z A;  3KV5 A;  3QUJ A;  2BS3 A;  2E2A A;  4LMJ A;  3L3P A;  3LK3 B;  2FUP A;  2NR4 A;  2XQA A;  5IYZ E;  5LMN T;  3AA6 B;  4B3R T;  2L3L A;  3EHZ A;  4LFA T;  2XQ3 A;  5BR8 T;  2XQ6 A;  3IEE A;  4PJN A;  1S35 A;  1KEY A;  2YDR A;  5FXZ A;  2V1D B;  5KMG P;  4AIU A;  4E7Z A;  1BR4 A;  2FBW A;  3P50 A;  3RX6 A;  3QK6 A;  3V5S A;  2WM9 A;  4H9Q C;  3UQ7 A;  3CK6 A;  1XMO T;  2UXN B;  3NZP A;  2CWO A;  1X79 A;  4JEH B;  4LML A;  3AE5 A;  3TLT A;  4H9O C;  2BG9 B;  2X68 A;  5HEU A;  1M62 A;  2K24 A;  2J4G A;  5ABE A;  4XAX B;  2VL0 A;  1NAF A;  2E8I A;  2VL8 A;  5HXR A;  4MHC A;  2QRX A;  2YOE A;  4HKA A;  3KVA A;  2BBH A;  1WYB A;  4H63 H;  3RYH E;  3K3O A;  2CE7 A;  1OED A;  4PJJ A;  5HWX A;  3PUV F;  4PAG A;  2EHO A;  5JTG A;  2FJE A;  2XQ7 A;  5LHI B;  4DV3 T;  3PTR B;  2YDS A;  1VOM A;  2WCA A;  4UXN B;  2DI4 A;  4MFR A;  3D0T A;  4DO0 A;  1QUU A;  2KSR A;  3RHW A;  2W62 A;  5AQN B;  2WB5 A;  4OHF A;  1UGO A;  4WZX A;  5HEO A;  3RKO A;  5FY1 A;  3AB3 B;  4DMW A;  2XAS B;  3AEE A;  4AXP A;  5E0O A;  5HAX A;  5FL0 A;  3OVU A;  2E5V A;  2RP4 A;  1W0A A;  3PUR A;  2W4X A;  2JRK A;  4NUU A;  2XAJ B;  2WBL A;  5AQL B;  4JBW F;  3AXJ A;  1W0B A;  3P7I A;  4ILB A;  5JRC B;  1QLB A;  1JNR A;  3AEG A;  3UU3 A;  4LFB T;  4GKJ T;  2UXC T;  3CML A;  2MBG A;  4PK4 A;  1G8X A;  4G63 A;  2V6Y A;  2CXD A;  5ABF A;  3ONX A;  3TLU A;  5AQU B;  2E9X C;  1IJ5 A;  4LF5 T;  1BR0 A;  3NZQ A;  3VHL A;  5J0Z A;  2Q9Q D;  2UUC T;  3LJC A;  3SS1 A;  1KK7 A;  3HR0 A;  3AVR A;  4GOU A;  5CFB A;  3ABV A;  2KND A;  4AQG A;  2XQ9 A;  4CI3 B;  2BDE A;  3CVR A;  3LK4 2;  2VKH A;  2A9U A;  3HKB E;  4EYU A;  2D0U A;  5KDM C;  4CXW A;  5L4E A;  3A5X A;  5HXH A;  2JMH A;  2YK0 A;  4ERR A;  4BAY B;  4C90 A;  5FYM A;  5F3J A;  5JR9 B;  4UIG A;  1NWM X;  2XM1 A;  3C4Z A;  4HGA A;  5IWA T;  2BKO A;  2LSI A;  1HG5 A;  2UXB T;  4KBM B;  2X51 A;  4EZ4 A;  4BA9 A;  4X5T A;  4AKR B;  2D2S A;  3O9X A;  4NPP A;  5AQI B;  3N2O A;  2CBI A;  1W9R A;  4HWI B;  5HEJ A;  2LHN A;  5CA0 E;  5LJM A;  5FVK A;  2V6X A;  3U78 A;  2OLT A;  3ONL C;  1XZY A;  2JQK A;  2MAW A;  2QVA A;  2UXD T;  2V8S V;  1UUR A;  4O8S A;  4IST A;  4EIW A;  3OKQ A;  2A72 A;  3OBV E;  3PUG A;  2JQH A;  3KFW X;  1QSD A;  5AQK B;  4WYV A;  3JAD A;  2JPF A;  3FZK B;  2WU5 A;  4U74 A;  4JYA T;  2VKJ A;  5HEG A;  2R6G F;  3ETV A;  1HTJ F;  5FL1 A;  3ESL A;  2VB6 A;  4L0R A;  3KBT A;  3UT5 E;  2VKO A;  5HWY A;  3TLS A;  2CRB A;  4DV5 T;  3FZM B;  5JDQ A;  5AQQ B;  4PK5 A;  1D1A A;  5AQG B;  2Q9Q B;  5FY7 A;  2IC9 A;  4IDP A;  1HNZ T;  4O2B E;  3V5U A;  2CHN A;  5L3E B;  2D5U A;  4FJO A;  2WS3 A;  4GK5 E;  2C5K T;  4HFD A;  2XAF B;  2DLR A;  4I50 E;  3VKH A;  2CEA A;  4B3M T;  2LRL A;  3L09 A;  3H3M A;  3K1S A;  3H37 A;  4UVC B;  5C8Y E;  4O4J E;  2M6I A;  3N9M A;  1LRZ A;  2E9X A;  3FB2 A;  3T1Y T;  2DCF A;  3J7Y q;  3CWZ B;  2K5B B;  3EDU A;  1HX1 B;  3HI2 A;  4UF0 A;  4IE7 A;  3P4S A;  2WMO A;  3ZMV B;  1ZP0 A;  3OYX A;  4QKN A;  4IHJ E;  3HKD E;  1MMG A;  2DNX A;  4O4I E;  2XUE A;  4F6R C;  3GN5 B;  1HNW T;  2CLY B;  5L3C B;  2IDO B;  2CPT A;  5FMN A;  3F2E A;  4TX5 A;  2KT9 A;  2LJL A;  1DU2 A;  1D0Y A;  4Z8X A;  3SRZ A;  2H3R A;  4QH5 A;  4JI8 T;  5FKY A;  2BS4 A;  4C91 A;  2MPK A;  1WLX A;  4YT0 A;  1O3X A;  4XZC A;  3PUZ F;  1SHZ C;  3QOF A;  3PDY A;  4TWF A;  3AA1 B;  2H89 A;  4TNV A;  3F31 A;  2JMK A;  1WFD A;  4IDO A;  2UUB T;  3KV4 A;  4KUM B;  2IW5 B;  4AKG A;  4IDZ A;  5LHH B;  4ILU A;  4X20 E;  4HFB A;  2X9X A;  3LFM A;  3ANW B;  2YEV C;  4QH4 A;  5AQH B;  2YDQ A;  3PE0 A;  4JEU B;  2MOZ A;  3VU7 H;  2N1G A;  3C64 A;  4KX6 A;  4B3T T;  4YTP A;  4EZH A;  1BR2 A;  4GYR A;  5AQP B;  3KVB A;  4ZI3 C;  1HF8 A;  3ETU A;  3RKG A;  3UUB A;  4KI0 F;  3VR9 A;  2XQY A;  1FMV A;  4IE4 A;  4CXY A;  1T72 A;  4OFZ A;  4GK0 E;  4CN6 A;  1YD8 G;  4ZI7 E;  3H3A A;  4YJ2 E;  4TWD A;  4ZEY A;  3I9Y A;  5AQT B;  1FJG T;  3LSV A;  4YLH A;  4DUY T;  3M3Z B;  2N2N A;  3WAJ A;  1T8B A;  3X1D A;  4AKL A;  1GQE A;  3CX6 B;  1LVF A;  3SWH A;  3AE4 A;  3DJB A;  4HWH A;  4O2A E;  3FZF B;  2XAH B;  3RLF F;  3G06 A;  3K3Q C;  3ZYM A;  3EAB A;  5ABH A;  3GA8 A;  2FJB A;  3KBU A;  2ES0 A;  2BVM A;  2W0G A;  2G0U A;  1MMN A;  4A98 A;  2LSY A;  2V5C A;  1OWA A;  4ZI2 C;  1D1B A;  4MLK A;  2VWA A;  5JDF A;  2KWH A;  2WDV A;  3O1H A;  5HCJ A;  4JUY A;  3TLW A;  2K9A A;  4EAH A;  2RA1 A;  1S94 A;  5L3F B;  4X1K E;  4AQY T;  4DV7 T;  1IJ6 A;  4ZZB A;  3JC6 C;  2BG9 C;  5A1L A;  2IIU A;  5L2L A;  2KZ7 B;  2XSB A;  2HH7 A;  4HWD A;  2YIN A;  2KLQ A;  3GN5 A;  4TNW A;  5LP6 E;  1IBM T;  5LCY A;  2XQ8 A;  3NVO A;  5CJ5 A;  1VRB A;  5LBM A;  3RC8 A;  1T7S A;  2JIW A;  5JRE A;  1N36 T;  1M7K A;  2XJ7 A;  4IIJ E;  1I6Z A;  2B1E A;  5CB4 E;  3TLV A;  3RRW A;  5DQV A;  3AEF A;  3GWH A;  3UU8 A;  4I43 B;  1ZHC A;  2NW8 A;  4MAL A;  3CIR A;  4JI4 T;  2XQ4 A;  4U2Z A;  3B57 A;  3AE9 A;  4HFV A;  4WNK A;  3RRC A;  3N2K E;  3RPU A;  4COF A;  3ANW A;  2LEH A;  1J1J A;  4DBR A;  3K8P C;  4NUV A;  2X9H A;  2JQQ A;  2V7K A;  4JI6 T;  5LOV E;  3P4P A;  4DUZ T;  1T98 A;  2HN1 A;  4AIS A;  1WR0 A;  3PJA A;  4DR4 T;  2C5I T;  2DWK A;  5FVL A;  5AQO B;  5HXE A;  4IL4 A;  1MMD A;  3AA0 B;  3HKE E;  2V7L A;  1U5P A;  2V5D A;  3AAI A;  4Z91 A;  4DR6 T;  5LG3 A;  4X1Y E;  3PUS A;  2X9Y A;  3CPZ A;  3DTO A;  3N9N A;  3FHN A;  4DR1 T;  2VK9 A;  2X66 A;  3N9L A;  1FMW A;  2P9B A;  3S4U A;  2LSG A;  3ZN1 B;  3ZYL A;  5LYJ E;  1AJ3 A;  3QB5 A;  3P8C D;  5LHG B;  3RQW A;  1NEN A;  2JQ9 A;  3I1A A;  4QH1 A;  2WZI A;  4Z90 A;  4XBF B;  3N9Q A;  2LE8 A;  4ADZ A;  5LA6 E;  2J47 A;  4EOZ B;  5LJN A;  4JI2 T;  1SA0 E;  2BKN A;  2J62 A;  4U72 A;  4LF4 T;  3I9W A;  2L8K A;  2X0L B;  3R6N A;  5JR9 C;  2FJD A;  2NTY A;  1XNR T;  4GIW A;  4U7Y A;  3IBP A;  3ZT7 A;  3ZN0 B;  3OPC A;  1IAP A;  4NIQ A;  3FBL A;  4LF6 T;  1YQ4 A;  1ZKE A;  5H6Q B;  1ZOY A;  2CXF A;  1E1H B;  2WDQ A;  4M1P A;  4I55 E;  2PBI A;  3P4Q A;  3SFE A;  2BG9 A;  1WR6 A;  2LOS A;  4IRE A;  4UV8 B;  1YW0 A;  1FEW A;  1G73 A;  1BR1 A;  1L0V A;  3AE6 A;  4IL9 A;  2XTL A;  1XNQ T;  4H9R C;  4K0U A;  4DV6 T;  1MMA A;  4DND A;  3JAE A;  1XMQ T;  3Q5E A;  5L47 A;  2ZLY A;  2EHO D;  3PUY F;  2UXX B;  4PK6 A;  5JDG A;  2PJQ A;  4YSZ A;  4OX9 T;  4UV9 B;  5FY0 A;  5J2T E;  3E08 A;  4HTE A;  5AQJ B;  1MIY A;  2V7M A;  1R8I A;  1CHU A;  4B6X A;  3QB5 K;  4PW8 A;  3MXZ A;  2XQ5 A;  5LMU T;  4QHO A;  2Z6E A;  1YKE B;  1YXR A;  2OA5 A;  4HWC A;  3ZLI A;  1YQ3 A;  1UX4 A;  4EED A;  1HCI A;  3BK9 A;  5CA1 E;  2WU2 A;  3P4W A;  4UR9 A;  1H7C A;  3C51 A;  2CWY A;  5CGM A;  3CQC B;  3OYZ A;  2A2F X;  4DV2 T;  2AXD S;  4WBN E;  2Q9Q C;  2W63 A;  1N33 T;  4U7I A;  5F5W A;  4IT4 A;  2K48 A;  1W09 A;  2HN2 A;  5AQF B;  3AE2 A;  5JDM A;  4YJ3 E;  2LM9 A;  2WY2 A;  3C98 B;  2QGS A;  2BKP A;  3ZMZ B;  4OYJ A;  2WDR A;  1LVK A;  1LKX A;  4ISS A;  2PTF A;  5JRC A;  2H88 A;  3ZMU B;  2JJ9 A;  2W2U A;  5ETW A;  4WBO A;  1X9B A;  4ASK A;  3Q5X A;  4ZOL E;  3AAA B;  2UU9 T;  4TWH A;  5JDN A;  3EVY A;  1US7 B;  4JV5 T;  4QX7 B;  2CHO A;  4P09 A;  4NXM T;  4YY3 T;  3BQI A;  3LG7 A;  4K0K T;  1N32 T;  3RIU C;  2ZM6 T;  4OK0 A;  4WW0 A;  3LDQ B;  3Q2M A;  3KDS E;  2XM2 A;  3RH3 A;  2Y6X A;  2CLY C;  4HE8 A;  4DBQ A;  1Z0P A;  3ZEF B;  4A97 A;  5KXJ A;  4KHZ F;  3KV9 A;  3W15 B;  3UUL A;  2LKG A;  3J9X 1;  5LB7 B;  3ZMT B;  2WZH A;  3MKD A;  4QWN B;  4AKH A;  3ZCJ A;  4O4L E;  5JR9 A;  4DR3 T;  1U4Q A;  5LBQ B;  2EHO B;  3NKZ A;  3MK7 C;  3RIA A;  3AE7 A;  3UU4 A;  3UTK A;  3AA7 B;  3N5L A;  4I4T E;  4DV1 T;  4QXH B;  2ACX A;  3EI0 A;  3T8O A;  5AFU L;  1KNZ A;  3PUW F;  3JC6 D;  3VRA A;  4KP3 C;  5IHY A;  2XY8 B;  3PUQ A;  4A5X A;  2IAK A;  3UFG A;  2LM2 A;  3T1H T;  4A56 A;  2ZMA A;  3WI3 A;  1SUM B;  5DJQ C;  1UUS A;  2VUR A;  3L8R A;  2NWB A;  2VQE T;  3U3I A;  3Q5D A;  5LNK A;  3BQK A;  5DQW A;  2QA7 A;  4IDN A;  2MYS A;  2I6H A;  3RC3 A;  3RI5 A;  4LF8 T;  5AQR B;  3ZPO A;  2NP9 A;  3AXJ B;  5IUX A;  4DID B;  3CX8 B;  1J5E T;  5L3B B; 
#chains in the Genus database with same CATH homology
 1I94 T;  4K0K T;  1N32 T;  2ZM6 T;  4DV5 T;  5IWA T;  4JI1 T;  1IBK T;  5LMU T;  2UXB T;  1HNZ T;  2UUB T;  4KHP T;  4DV4 T;  4X66 T;  4JI7 T;  1XMO T;  4GKK T;  4JI4 T;  4JI2 T;  4JI0 T;  4X62 T;  4LF4 T;  4NXN T;  4DR3 T;  4B3M T;  4JI3 T;  4LFB T;  4X64 T;  4GKJ T;  2E5L T;  4DV2 T;  2UXC T;  1XNR T;  4DR7 T;  4DR5 T;  4DV0 T;  1N33 T;  4B3S T;  4DV1 T;  4DR2 T;  4JI6 T;  3T1Y T;  1HNX T;  4LF5 T;  4LF6 T;  4B3T T;  4DUZ T;  2UXD T;  4DR4 T;  2VQF T;  4JI5 T;  1HR0 T;  2UUC T;  4AQY T;  4DV7 T;  4YHH T;  3T1H T;  4DR6 T;  1XNQ T;  4LF9 T;  3OTO T;  4DV6 T;  1HNW T;  2VQE T;  1XMQ T;  2UU9 T;  4DV3 T;  1IBM T;  4JYA T;  4DR1 T;  4X65 T;  1IBL T;  1N34 T;  5LMN T;  4LF8 T;  4JV5 T;  2HHH T;  4OX9 T;  2F4V T;  4B3R T;  2UUA T;  1FJG T;  4NXM T;  4YY3 T;  4JI8 T;  4DUY T;  4LFA T;  1N36 T;  4LF7 T;  5BR8 T;  4LFC T;  1J5E T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...