4JV5T

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4jv5T00
1HNZT 4JI7T 4LF4T 4JI5T 4X62T 4JI2T 1N33T 4DUYT 1N36T 4LF6T 4KHPT 4JI0T 4DV1T 3T1HT 4DV4T 4LFCT 4NXNT 1I94T 4OX9T 4LF8T 3T1YT 2UU9T 1HNXT 4JI6T 4JV5T 4LF7T 4LFBT 4LFAT 2HHHT 4DV6T 2E5LT 2UXBT 4DV0T 4JI8T 2F4VT 4JYAT 4K0KT 4DV2T 4YHHT 4LF9T 4AQYT 4DR5T 2UUCT 4LF5T 4DV7T 2UXCT 1XNQT 4JI3T 4X65T 4DR1T 4YY3T 4B3ST 2VQET 1IBMT 1HNWT 4X64T 1IBKT 4DR6T 4GKJT 2VQFT 1N34T 1IBLT 1XMOT 2UXDT 4B3MT 5LMUT 2UUAT 1XNRT 4GKKT 4DR2T 1HR0T 4DV5T 5LMNT 1XMQT 4JI4T 2ZM6T 4JI1T 4B3TT 4DUZT 4DR7T 3OTOT 1FJGT 5IWAT 2UUBT 4B3RT 4NXMT 4DR3T 4DV3T 4DR4T 4X66T 1N32T 1J5ET 5BR8T
chains in the Genus database with same CATH superfamily
2CXDA 3P50A 2XZEA 4PFOA 3HA4A 3ZYKA 5ABHA 2V5DA 3HKDE 4X62T 4JI2T 4G63A 2PG8A 2VVSA 1Z8UA 2AE9A 2JJ9A 2WDVA 4IIJE 4X1YE 3CWZB 4EZ4A 2H89A 2C5IT 1LKXA 1N36T 4LF6T 4XBFB 3HR0A 2VKJA 3K1SA 3OYXA 4KBMB 3I1AA 2WZIA 5AQGB 3NZPA 1GQEA 1UK5A 2B76A 2ZM2A 3AEDA 3C4ZA 3NZQA 4I55E 3J7Yq 1SUMB 4WNKA 3EABA 3QB5K 4DV4T 3P4WA 3D0TA 3GN5A 4FI5A 2HPJA 3H37A 4MLKA 2ZLYA 3Q5XA 2UXXB 3UFGA 4ILUA 2VB6A 3GWHA 5ABFA 4NXNT 5AQUB 4H9SE 2A3DA 2KNDA 4HFEA 4ADZA 4UV8B 3ZMZB 2JQQA 2C5JA 3WAJA 2X67A 3CQCB 2ACZA 5FVKA 4DMVA 2CLYC 3ZT6A 4X5TA 3NVOA 3N9LA 4LF8T 3VHLA 2QRXA 2V6YA 2Y8DA 5LHHB 4QHOA 2XM2A 4LMKA 2J4GA 3MA9A 3RGLA 2Q9QA 3I0OA 3O1IA 3KVAA 3I9YA 3MJXA 5FMNA 3SOLA 3LK42 3P7IA 3RQUA 4AQFA 5JDHA 5JQGE 1NEKA 2WMOA 2X0HA 3JADA 2K9AA 3JAEA 3UU5A 3CQGB 1JNRA 3VR8A 4AKGA 1Z0PA 4IE7A 4IT4A 4TWFA 4CQIA 3ZEFB 4IE4A 5LJMA 2V7JA 2RP4A 2QA7A 4PW8A 5L3BB 4YTPA 3OTOT 3UUBA 1SE7A 2YDSA 2WBLA 2V7KA 4QWNB 2JPFA 3VRBA 1E2AA 5AQIB 2X66A 3GA8A 4PK5A 2WSSV 5HXEA 1T72A 4P09A 4HWHA 2FJDA 2X68A 4Q25A 4ZXLA 4V1Av 2VURA 4EXTA 4YTNA 5HWXA 4JYAT 2V26A 4MBQA 3AEFA 4AISA 4WBNE 4U33A 2XAFB 3AE4A 2H7VC 3O1JA 2LKGA 4O4HE 2HN2A 3CX7B 3K3NA 4U74A 4X1IE 2BBHA 3N9QA 4I4TE 4Z8XA 3F57A 5JDLA 2QGSA 1XNQT 3AAEB 2LSKA 3CQXC 4A56A 4N78D 4IL4A 5DQVA 5FXWA 1VOMA 3ZSTA 4YXDA 2LT3A 1UUSA 2GK9A 3AB3B 3AE8A 2E5VA 4KUMB 5CGMA 5FL1A 4B3ST 4DNDA 2HH7A 4HEAA 3PUSA 3UQ7A 2XM1A 3PUWF 1YXRA 2FBWA 5GONE 4AQGA 1IBKT 4CN1A 2RA1A 3AA7B 3JC6D 1N34T 1FIOA 4LMJA 1IBLT 3W15B 3AVSA 2V6YB 2DI4A 4ZEYA 4TNVA 4KHZF 5ABEA 2W66A 3CMLA 4E7SA 2X0LB 4PJNA 1DU2A 1LRZA 2ZMAA 3FZHB 1I6ZA 1KK7A 1LVFA 1B7TA 3OJAA 2XY8B 4XZCA 4DR2T 4X20E 4EEBA 3NKZA 3PV0F 5DQWA 4ZI3D 2H3RA 4JI4T 1FMWA 3LK3B 4IDOA 4XAXB 3LK2B 4IE5A 4A98A 4H9PC 3RH3A 4YJ2E 1BR4A 4HFHA 2WWUA 2E8IA 2UUBT 2V8SV 1M62A 3FXEB 3UT5E 2KINB 3ANWA 4EV6A 4DR3T 3L09A 2XSBA 3B13A 2E2AA 4ERRA 4WW0A 3V5UA 2LSYA 3O4XE 3WI3A 1AJ3A 4HTEA 1N32T 3FZLB 2EHOB 3PUZF 4HKAA 3RHWA 1EZ3A 1JNZA 3AE2A 4QX7B 4JI7T 1IZNB 3H3AA 3QOFA 3N9MA 4BJNA 2IIUA 2OV9A 1D0XA 2VL0A 2XUEA 4JI5T 2WDQA 1WFDA 4CXXA 1E7PA 3AEBA 1N33T 1MNDA 3LDQB 2XASB 2Z6EA 3ZKRA 4BAYB 4CI1B 5JDNA 5J2TE 3T8OA 4KHPT 3AE6A 3UULA 4PK6A 3RYIE 2CEAA 4G2AA 2NOXA 5IHYA 2FJBA 5AFUL 3HL6A 3JAFA 3ZN1B 3EUHA 4QXCB 2WCAA 3TLSA 3UUMA 5HAXA 4YSZA 2M6BA 3PUYF 5LOVE 4ZI7E 3H3MA 4UF0A 5JDMA 1J5WA 1SA0E 4H9RC 3VKHA 3E22E 1W09A 3AE3A 4IREA 1S35A 2ES0A 2XQ7A 3ZMSB 3FZMB 2H88A 5AQQB 3ZJ1A 2G0UA 4O2BE 1I94T 2CWYA 4OX9T 2A9UA 3PUVF 4UELA 2JMHA 3ESLA 1T8BA 1HF8A 3G06A 2N1GA 4TX5A 4YSXA 4U31A 3LBXB 1IJ6A 4OYJA 3ONXA 3I0QA 2PBIA 3RX6A 5C2TA 2MYSA 4JV5T 3K3OA 1KF6A 1QUUA 2CM0A 2KLQA 3L8RA 4H63V 4HFIA 5AQRB 5FYMA 1YQ4A 2V7LA 5JDFA 5LB7B 4E7ZA 1UGOA 2IC9A 2LSGA 2W62A 2W63A 3NRYA 5JVDE 5L3EB 4LF7T 4LFBT 3PE0A 2NW8A 3J9X1 2HHHT 4DV6T 4IDPA 5LBMA 5LGTB 3DJBA 3GN5B 4UR9A 2NW9A 2V7MA 3O9XA 2HN1A 2F4VT 1G73A 2FJEA 4ZHQE 2KXPB 1D1BA 2PFVA 3AE5A 4H9QC 4HFDA 2DWKA 4LMLA 4O4JE 2E9XC 1U5PA 1BR0A 4WZXA 3QC9A 2MAWA 5LP6E 5LA6E 3VRAA 4DIDB 2ODVA 5LHGB 1WYBA 4YHHT 4I50E 4Z90A 4DR5T 4CXYA 3RKOA 3LG7A 4ILCA 4LF5T 2BKPA 2LSIA 3ETVA 3F31A 2BKOA 2D0UA 1ZOYA 4IDQA 2LLYA 4ZI2C 4DV7T 4X65T 4TUYE 2C5KT 5LCYA 4KMCA 1KFYA 3ZSSA 4CN6A 2YDRA 3N9NA 2JMKA 3RC3A 1H7CA 3ANWB 2EHOD 2FUPA 3FBLA 3FXDB 4GK0E 2LEHA 3CX6B 4MHCA 2CBJA 4U3CA 4FJOA 3RI5A 5JRCB 4HFVA 1HNWT 2XAJB 4DR6T 4CI3B 4IE0A 2VQFT 2NWBA 2WQYA 1OEDA 1U4QA 3AVRA 3BQIA 2I6HA 5HYAA 4QXBB 1YKHB 3N9PA 1XDPA 3OBVE 5F8PA 2BG9C 2WY2A 2CBIA 3K3QC 5LMUT 1XDOA 5EK3A 3RPUA 4IE6A 5AQJB 5ETWA 5HEHA 4HWFA 4O8SA 3EVYA 3PUAA 5HXRA 4GKKT 3Q2MA 2A72A 4P1NA 5CB4E 4YLHA 3UU6A 3WAKA 3OYZA 3C98B 4C91A 3KV4A 4PNIA 5JREA 3EAMA 5TAOA 3ZYLA 2WS3A 3LBXA 4QH5A 2WP9A 3ONLC 4JI1T 5LJNA 2BG9A 4DUZT 3RYFE 3HI2A 5CFBA 1D1AA 1MIVA 2E9XB 3PU8A 2WWVA 3PTRB 5IWAT 3QK6A 5AQPB 3RYHE 3N2GE 2WAUA 4EGWA 1HG5A 2XQ6A 3JCFA 3EHZA 2WDRA 1ZKEA 5KXJA 4PJLA 3ETUA 1HTJF 4QX8B 3RIUA 2XQ3A 2J62A 3AEGA 4O4IE 3UFEA 4ZI3C 3EDUA 3NBXX 2VQET 5AQMB 5E0OA 4YHJA 4F8HA 2KZ7B 2XQ9A 2CXFA 4DR4T 3C4WA 2XSAA 3I9WA 4U2ZA 5AQSB 5BR8T 5L3FB 1OXZA 1WCRA 2WM9A 2W61A 4LF4T 2Q9QD 3QNUA 4KI0F 5H6RB 5LHIB 2BDEA 4H63H 4I43B 3ZYMA 3C50A 2KWHA 2BZBA 1CHUA 4HWIB 1HCIA 2KT9A 4UXNB 5ADXL 2M67A 5AQNB 1W0BA 5AQKB 3RLFF 2YOEA 3HKCE 1VCTA 1MMGA 2WZHA 2CLYB 3KFWX 4JUYA 4U7IA 5IYZE 2I59A 2EHOA 4U2YA 5AQLB 4BA9A 3FBZA 5L4EA 3RQWA 4PJJA 4ZS3A 4ZZBA 4IHJE 3FZKB 4QXHB 5LBQB 2XAGB 2BS3A 2DLRA 5HEGA 5L3GB 2Q9QB 3DP7A 3LFMA 4K0UA 2UXNB 2L9QA 3FZFB 2E9XA 3UTKA 5IUXA 1WYCA 1HX1B 1ZV4X 3AA6B 3TKLB 2V5CA 2MBGA 3SWHA 1NWMX 2E9XD 4MALA 5JR9A 4H9NC 1T7SA 5LGNB 2LM2A 4ILAA 4P0BA 2BVMA 2LSJA 2NW7A 4NUVA 4QKNA 5H6QB 2NP9A 5AQOB 5J1GA 3R6NA 1XWMA 1BR2A 3KV6A 2LRKA 2IMLA 3LSVA 4J2CA 1QLBA 4CI2B 3ZMTB 1FMVA 4BJMA 4JI6T 2IHR1 3AAIA 4OHFA 3S4UA 4EOZB 4NUUA 3Q5WA 4OFZA 5AQFB 2YU2A 1QSDA 3QB5A 5LGUB 4IGUA 1NAFA 3CIRA 2A2FX 2CE7A 2XJ7A 4YFSA 4LFAT 2JQKA 3AXJA 3B57A 1X79A 2XQ4A 5CA1E 5LXTE 2E5LT 2VWAA 5JH7E 2YEVC 3MK7C 2UXBT 3CKDA 4DV0T 2NR4A 1S94A 2JQHA 5FY0A 5L4HA 3VR9A 3CX8B 3ABVA 3UU4A 5L47A 1KNPA 4JI8T 4K0KT 2Y6XA 4KP3C 5JTGA 3C4XA 3MXZA 3AE7A 2H7OA 3TLTA 2DHRA 2LM9A 5HXCA 4L9IA 4LF9T 2WU5A 5KX5E 4H9OC 2VKDA 4JEHB 1HS7A 2UUCT 4I0UA 4DVDA 5HXHA 5LG4A 3JC6C 1E1HB 1W9RA 4M1PA 4ZS2A 3KVBA 3Q5EA 5DJQC 5FKYA 4DBQA 2UXCT 3EDVA 4TWDA 5HEJA 3RC8A 3TLUA 2KMFA 1VRBA 3UUNA 4KX6A 3HKEE 4GYSA 4B6XA 4YY3T 4WBOA 1CUNA 5AQVB 2D2SA 2K5BB 4YJ3E 1X9BA 2YU1A 5ABFB 3P8CD 3ZMUB 2X9HA 1OEDE 4EB6E 2W4XA 3AE1A 3PUGA 2YK0A 4JEUB 3FHNA 5LYJE 4HGAA 3ZMVB 1MIWA 5FXXA 2LHRA 2MTQA 3N5LA 4AKLA 3AA1B 1XMOT 5KDMC 2UXDT 4B3MT 4UVBB 5A1LA 1UCUA 2UUAT 2FJAA 4YTMA 5FXZA 2X9YA 4PK4A 3GMIA 2V6XA 3SFDA 1XNRT 2LRLA 2JRKA 2X51A 3P4SA 5LMNT 1XMQT 3IEEA 4UVAB 2N9DA 2VVNA 3SS1A 3CPZA 2W00A 5HXSA 5BMVE 2BVLA 2VL8A 4PFPA 4U72A 4UF0B 3AEEA 2ZM6T 4DR7T 3AXJB 4HE8A 1UURA 2DCFA 3C64A 3KBUA 3ZLIA 4A97A 5L2LA 1HNXT 3MZKB 5FVLA 3ZC0A 1YW0A 1MNEA 1WRDA 2CMRA 2LKHA 4EEDA 2V7IA 3ZJ2A 2XPKA 3X1DA 5FL0A 4ZOLE 2DNXA 1HFAA 2K3WA 3RRCA 4YT0A 2BS2A 1G8XA 1Y64B 3PUXF 4GOUA 4WYVA 4ZZCA 4X66T 1J5ET 1KEYA 3K8PC 3E0ZA 5LG3A 1HNZT 1WLXA 5HEUA 4U7YA 3RF1A 3ZCIA 5FP3A 3L39A 4L5GA 4GK5E 4EZHA 3KDSE 1D1CA 2IDOB 1OWAA 2BS4A 1UX4A 2XHEB 2YINA 3LJCA 2W2UA 3ONJA 4DUYT 1HX8A 5JDGA 4AI6A 3PDYA 2XAHB 2P9BA 2X9WA 2VKHA 3AAAB 1KNRA 2N2NA 2W0GA 3C51A 5AQTB 5HCJA 3OKQA 5J2UE 4JI0T 3U78A 4DV1T 2LHNA 3VU7H 3T1HT 1FJGT 5CJ5A 3CK6A 2BG9B 2NTYA 3PJAJ 4OK0A 3SFEA 4ASKA 5HEOA 5LNKA 4OYKA 3ZC1A 4LFCT 2J1DG 4PJMA 3MACA 5ABGA 3A5XA 4HWDA 3NRXA 3PUQA 3F2EA 3PJAA 1MMDA 1VCSA 2BBJA 1MIYA 3O1HA 1WR6A 3HKBE 3RRWA 2V1DB 2WU2A 2ACXA 2OA5A 2Y48B 3Q5DA 4TV8E 2CWOA 3L3PA 2CRBA 3Q9DA 4TZ4C 4UVCB 2NTXA 3UUXB 4DBRA 3T1YT 3A7MA 2B1EA 4QH4A 4HWCA 3AECA 3QUJA 2UU9T 2L8KA 3E08A 5C8YE 1ZEEA 4MFRA 1HG2A 5EK2A 2LOSA 1O3XA 2KWIB 3UU3A 1D0ZA 4IL9A 3IF8B 2RPAA 4X1KE 3V5SA 4AXPA 4UIGA 4EIWA 4EYYR 3N2KE 4QH1A 5FY1A 3NWIA 2BKNA 3DTOA 5JDQA 2LE8A 3SRZA 5EK4A 3EI0A 2XQYA 3UQ4A 4HFBA 3ZPOA 2CPTA 4IDNA 4GYRA 5DABA 4DMWA 1FEWA 1IAPA 1M7KA 2YN6A 2QYWA 2MPKA 2X0YA 5FXVA 5L3CB 3IA3A 4EYUA 3AA0B 4DV2T 4JLEA 1ZHCA 4L0RA 2XQ8A 4HFCA 4ILBA 4TN7B 1SHZC 4TNWA 4UV9B 3RIAA 2X9XA 3PU3A 5HCMA 2C0SA 2DWGA 3P4PA 4EAHA 3MKDA 4AQYT 1US7B 1J1JA 3BK9A 3IHRA 4P0AA 3OVUA 4JBWF 2IUBA 2VKOA 1T98A 2QVAA 2JQ9A 3P4RA 4COFA 4AIUA 4AQFC 3U3IA 4JI3T 2XQ5A 2K24A 4DR1T 4ANJA 4ISTA 1OEDB 2I0MA 2ODUA 1D0YA 4AKHA 1WR0A 2D5UA 5J0ZA 1NENA 2LJLA 2CHOA 4C90A 3KV5A 1IBMT 4PAGA 5F3JA 2DL1A 2IC6A 3BQLA 3R84B 3PURA 2XTLA 4A5XA 3AEAA 4CZZB 4X64T 3OPCA 2K48A 4GKJT 3AE9A 2LOPA 3RKGA 2CA5A 2CHNA 1MMAA 1MMNA 2WMNA 2ZM8A 2J47A 3M3ZB 4IDZA 4NIQA 1IJ5A 3ZN0B 1ZP0A 5M4YA 1BR1A 2D9DA 2JIWA 3TLVA 3VKGA 1OEDC 2OLTA 2IAKA 3FB2A 3B5MA 4AKIA 4CXWA 3N2OA 1XZYA 3CVRA 4ZI2D 1Y01A 2VK9A 2ZM0A 2M6IA 3RIFA 4AKRB 1HR0T 3KBTA 1YKEB 4UEMA 3IBPA 2Q9QC 4DV5T 4O2AE 2KSRA 2PJQA 3A8YC 3ZT5A 2XQAA 3KINB 5L3DB 4YSYA 4DO0A 5FY7A 4CN4A 1W0AA 5CA0E 2D0TA 5EZYE 2W67A 1UX5A 5FNVE 4B3TT 1LVKA 2EHOC 1KNZA 2CCQA 2VASA 2YDQA 4ISSA 3BQKA 2HPLA 5HWYA 4TV9E 3KV9A 2IW5B 2PTFA 2YKSA 2AXDS 2L3LA 2WB5A 2XAQB 3N9OA 1V9DA 4TWHA 4F6RC 1YQ3A 2MOZA 1L0VA 5JR9C 4B3RT 5KMGP 2BG9E 5C3JA 4GIWA 3P4QA 4NPPA 4O4LE 5F5WA 1R8IA 4NXMT 4Z91A 5AQHB 3ZCJA 2R6GF 4DV3T 3M65A 2SPCA 4HN9A 5JR9B 3RIUC 3ZT7A 1YD8G 2CXLA 5JRCA 3RYCE 3UU8A 3TLWA
chains in the Genus database with same CATH topology
1HNZT 4JI7T 4LF4T 4JI5T 4X62T 4JI2T 1N33T 4DUYT 1N36T 4LF6T 4KHPT 4JI0T 4DV1T 3T1HT 4DV4T 4LFCT 4NXNT 1I94T 4OX9T 4LF8T 3T1YT 2UU9T 1HNXT 4JI6T 4JV5T 4LF7T 4LFBT 4LFAT 2HHHT 4DV6T 2E5LT 2UXBT 4DV0T 4JI8T 2F4VT 4JYAT 4K0KT 4DV2T 4YHHT 4LF9T 4AQYT 4DR5T 2UUCT 4LF5T 4DV7T 2UXCT 1XNQT 4JI3T 4X65T 4DR1T 4YY3T 4B3ST 2VQET 1IBMT 1HNWT 4X64T 1IBKT 4DR6T 4GKJT 2VQFT 1N34T 1IBLT 1XMOT 2UXDT 4B3MT 5LMUT 2UUAT 1XNRT 4GKKT 4DR2T 1HR0T 4DV5T 5LMNT 1XMQT 4JI4T 2ZM6T 4JI1T 4B3TT 4DUZT 4DR7T 3OTOT 1FJGT 5IWAT 2UUBT 4B3RT 4NXMT 4DR3T 4DV3T 4DR4T 4X66T 1N32T 1J5ET 5BR8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ T;  4JI7 T;  4LF4 T;  4JI5 T;  4X62 T;  4JI2 T;  1N33 T;  4DUY T;  1N36 T;  4LF6 T;  4KHP T;  4JI0 T;  4DV1 T;  3T1H T;  4DV4 T;  4LFC T;  4NXN T;  1I94 T;  4OX9 T;  4LF8 T;  3T1Y T;  2UU9 T;  1HNX T;  4JI6 T;  4JV5 T;  4LF7 T;  4LFB T;  4LFA T;  2HHH T;  4DV6 T;  2E5L T;  2UXB T;  4DV0 T;  4JI8 T;  2F4V T;  4JYA T;  4K0K T;  4DV2 T;  4YHH T;  4LF9 T;  4AQY T;  4DR5 T;  2UUC T;  4LF5 T;  4DV7 T;  2UXC T;  1XNQ T;  4JI3 T;  4X65 T;  4DR1 T;  4YY3 T;  4B3S T;  2VQE T;  1IBM T;  1HNW T;  4X64 T;  1IBK T;  4DR6 T;  4GKJ T;  2VQF T;  1N34 T;  1IBL T;  1XMO T;  2UXD T;  4B3M T;  5LMU T;  2UUA T;  1XNR T;  4GKK T;  4DR2 T;  1HR0 T;  4DV5 T;  5LMN T;  1XMQ T;  4JI4 T;  2ZM6 T;  4JI1 T;  4B3T T;  4DUZ T;  4DR7 T;  3OTO T;  1FJG T;  5IWA T;  2UUB T;  4B3R T;  4NXM T;  4DR3 T;  4DV3 T;  4DR4 T;  4X66 T;  1N32 T;  1J5E T;  5BR8 T; 
#chains in the Genus database with same CATH topology
 2CXD A;  3P50 A;  2XZE A;  4PFO A;  3HA4 A;  3ZYK A;  5ABH A;  2V5D A;  3HKD E;  4X62 T;  4JI2 T;  4G63 A;  2PG8 A;  2VVS A;  1Z8U A;  2AE9 A;  2JJ9 A;  2WDV A;  4IIJ E;  4X1Y E;  3CWZ B;  4EZ4 A;  2H89 A;  2C5I T;  1LKX A;  1N36 T;  4LF6 T;  4XBF B;  3HR0 A;  2VKJ A;  3K1S A;  3OYX A;  4KBM B;  3I1A A;  2WZI A;  5AQG B;  3NZP A;  1GQE A;  1UK5 A;  2B76 A;  2ZM2 A;  3AED A;  3C4Z A;  3NZQ A;  4I55 E;  3J7Y q;  1SUM B;  4WNK A;  3EAB A;  3QB5 K;  4DV4 T;  3P4W A;  3D0T A;  3GN5 A;  4FI5 A;  2HPJ A;  3H37 A;  4MLK A;  2ZLY A;  3Q5X A;  2UXX B;  3UFG A;  4ILU A;  2VB6 A;  3GWH A;  5ABF A;  4NXN T;  5AQU B;  4H9S E;  2A3D A;  2KND A;  4HFE A;  4ADZ A;  4UV8 B;  3ZMZ B;  2JQQ A;  2C5J A;  3WAJ A;  2X67 A;  3CQC B;  2ACZ A;  5FVK A;  4DMV A;  2CLY C;  3ZT6 A;  4X5T A;  3NVO A;  3N9L A;  4LF8 T;  3VHL A;  2QRX A;  2V6Y A;  2Y8D A;  5LHH B;  4QHO A;  2XM2 A;  4LMK A;  2J4G A;  3MA9 A;  3RGL A;  2Q9Q A;  3I0O A;  3O1I A;  3KVA A;  3I9Y A;  3MJX A;  5FMN A;  3SOL A;  3LK4 2;  3P7I A;  3RQU A;  4AQF A;  5JDH A;  5JQG E;  1NEK A;  2WMO A;  2X0H A;  3JAD A;  2K9A A;  3JAE A;  3UU5 A;  3CQG B;  1JNR A;  3VR8 A;  4AKG A;  1Z0P A;  4IE7 A;  4IT4 A;  4TWF A;  4CQI A;  3ZEF B;  4IE4 A;  5LJM A;  2V7J A;  2RP4 A;  2QA7 A;  4PW8 A;  5L3B B;  4YTP A;  3OTO T;  3UUB A;  1SE7 A;  2YDS A;  2WBL A;  2V7K A;  4QWN B;  2JPF A;  3VRB A;  1E2A A;  5AQI B;  2X66 A;  3GA8 A;  4PK5 A;  2WSS V;  5HXE A;  1T72 A;  4P09 A;  4HWH A;  2FJD A;  2X68 A;  4Q25 A;  4ZXL A;  4V1A v;  2VUR A;  4EXT A;  4YTN A;  5HWX A;  4JYA T;  2V26 A;  4MBQ A;  3AEF A;  4AIS A;  4WBN E;  4U33 A;  2XAF B;  3AE4 A;  2H7V C;  3O1J A;  2LKG A;  4O4H E;  2HN2 A;  3CX7 B;  3K3N A;  4U74 A;  4X1I E;  2BBH A;  3N9Q A;  4I4T E;  4Z8X A;  3F57 A;  5JDL A;  2QGS A;  1XNQ T;  3AAE B;  2LSK A;  3CQX C;  4A56 A;  4N78 D;  4IL4 A;  5DQV A;  5FXW A;  1VOM A;  3ZST A;  4YXD A;  2LT3 A;  1UUS A;  2GK9 A;  3AB3 B;  3AE8 A;  2E5V A;  4KUM B;  5CGM A;  5FL1 A;  4B3S T;  4DND A;  2HH7 A;  4HEA A;  3PUS A;  3UQ7 A;  2XM1 A;  3PUW F;  1YXR A;  2FBW A;  5GON E;  4AQG A;  1IBK T;  4CN1 A;  2RA1 A;  3AA7 B;  3JC6 D;  1N34 T;  1FIO A;  4LMJ A;  1IBL T;  3W15 B;  3AVS A;  2V6Y B;  2DI4 A;  4ZEY A;  4TNV A;  4KHZ F;  5ABE A;  2W66 A;  3CML A;  4E7S A;  2X0L B;  4PJN A;  1DU2 A;  1LRZ A;  2ZMA A;  3FZH B;  1I6Z A;  1KK7 A;  1LVF A;  1B7T A;  3OJA A;  2XY8 B;  4XZC A;  4DR2 T;  4X20 E;  4EEB A;  3NKZ A;  3PV0 F;  5DQW A;  4ZI3 D;  2H3R A;  4JI4 T;  1FMW A;  3LK3 B;  4IDO A;  4XAX B;  3LK2 B;  4IE5 A;  4A98 A;  4H9P C;  3RH3 A;  4YJ2 E;  1BR4 A;  4HFH A;  2WWU A;  2E8I A;  2UUB T;  2V8S V;  1M62 A;  3FXE B;  3UT5 E;  2KIN B;  3ANW A;  4EV6 A;  4DR3 T;  3L09 A;  2XSB A;  3B13 A;  2E2A A;  4ERR A;  4WW0 A;  3V5U A;  2LSY A;  3O4X E;  3WI3 A;  1AJ3 A;  4HTE A;  1N32 T;  3FZL B;  2EHO B;  3PUZ F;  4HKA A;  3RHW A;  1EZ3 A;  1JNZ A;  3AE2 A;  4QX7 B;  4JI7 T;  1IZN B;  3H3A A;  3QOF A;  3N9M A;  4BJN A;  2IIU A;  2OV9 A;  1D0X A;  2VL0 A;  2XUE A;  4JI5 T;  2WDQ A;  1WFD A;  4CXX A;  1E7P A;  3AEB A;  1N33 T;  1MND A;  3LDQ B;  2XAS B;  2Z6E A;  3ZKR A;  4BAY B;  4CI1 B;  5JDN A;  5J2T E;  3T8O A;  4KHP T;  3AE6 A;  3UUL A;  4PK6 A;  3RYI E;  2CEA A;  4G2A A;  2NOX A;  5IHY A;  2FJB A;  5AFU L;  3HL6 A;  3JAF A;  3ZN1 B;  3EUH A;  4QXC B;  2WCA A;  3TLS A;  3UUM A;  5HAX A;  4YSZ A;  2M6B A;  3PUY F;  5LOV E;  4ZI7 E;  3H3M A;  4UF0 A;  5JDM A;  1J5W A;  1SA0 E;  4H9R C;  3VKH A;  3E22 E;  1W09 A;  3AE3 A;  4IRE A;  1S35 A;  2ES0 A;  2XQ7 A;  3ZMS B;  3FZM B;  2H88 A;  5AQQ B;  3ZJ1 A;  2G0U A;  4O2B E;  1I94 T;  2CWY A;  4OX9 T;  2A9U A;  3PUV F;  4UEL A;  2JMH A;  3ESL A;  1T8B A;  1HF8 A;  3G06 A;  2N1G A;  4TX5 A;  4YSX A;  4U31 A;  3LBX B;  1IJ6 A;  4OYJ A;  3ONX A;  3I0Q A;  2PBI A;  3RX6 A;  5C2T A;  2MYS A;  4JV5 T;  3K3O A;  1KF6 A;  1QUU A;  2CM0 A;  2KLQ A;  3L8R A;  4H63 V;  4HFI A;  5AQR B;  5FYM A;  1YQ4 A;  2V7L A;  5JDF A;  5LB7 B;  4E7Z A;  1UGO A;  2IC9 A;  2LSG A;  2W62 A;  2W63 A;  3NRY A;  5JVD E;  5L3E B;  4LF7 T;  4LFB T;  3PE0 A;  2NW8 A;  3J9X 1;  2HHH T;  4DV6 T;  4IDP A;  5LBM A;  5LGT B;  3DJB A;  3GN5 B;  4UR9 A;  2NW9 A;  2V7M A;  3O9X A;  2HN1 A;  2F4V T;  1G73 A;  2FJE A;  4ZHQ E;  2KXP B;  1D1B A;  2PFV A;  3AE5 A;  4H9Q C;  4HFD A;  2DWK A;  4LML A;  4O4J E;  2E9X C;  1U5P A;  1BR0 A;  4WZX A;  3QC9 A;  2MAW A;  5LP6 E;  5LA6 E;  3VRA A;  4DID B;  2ODV A;  5LHG B;  1WYB A;  4YHH T;  4I50 E;  4Z90 A;  4DR5 T;  4CXY A;  3RKO A;  3LG7 A;  4ILC A;  4LF5 T;  2BKP A;  2LSI A;  3ETV A;  3F31 A;  2BKO A;  2D0U A;  1ZOY A;  4IDQ A;  2LLY A;  4ZI2 C;  4DV7 T;  4X65 T;  4TUY E;  2C5K T;  5LCY A;  4KMC A;  1KFY A;  3ZSS A;  4CN6 A;  2YDR A;  3N9N A;  2JMK A;  3RC3 A;  1H7C A;  3ANW B;  2EHO D;  2FUP A;  3FBL A;  3FXD B;  4GK0 E;  2LEH A;  3CX6 B;  4MHC A;  2CBJ A;  4U3C A;  4FJO A;  3RI5 A;  5JRC B;  4HFV A;  1HNW T;  2XAJ B;  4DR6 T;  4CI3 B;  4IE0 A;  2VQF T;  2NWB A;  2WQY A;  1OED A;  1U4Q A;  3AVR A;  3BQI A;  2I6H A;  5HYA A;  4QXB B;  1YKH B;  3N9P A;  1XDP A;  3OBV E;  5F8P A;  2BG9 C;  2WY2 A;  2CBI A;  3K3Q C;  5LMU T;  1XDO A;  5EK3 A;  3RPU A;  4IE6 A;  5AQJ B;  5ETW A;  5HEH A;  4HWF A;  4O8S A;  3EVY A;  3PUA A;  5HXR A;  4GKK T;  3Q2M A;  2A72 A;  4P1N A;  5CB4 E;  4YLH A;  3UU6 A;  3WAK A;  3OYZ A;  3C98 B;  4C91 A;  3KV4 A;  4PNI A;  5JRE A;  3EAM A;  5TAO A;  3ZYL A;  2WS3 A;  3LBX A;  4QH5 A;  2WP9 A;  3ONL C;  4JI1 T;  5LJN A;  2BG9 A;  4DUZ T;  3RYF E;  3HI2 A;  5CFB A;  1D1A A;  1MIV A;  2E9X B;  3PU8 A;  2WWV A;  3PTR B;  5IWA T;  3QK6 A;  5AQP B;  3RYH E;  3N2G E;  2WAU A;  4EGW A;  1HG5 A;  2XQ6 A;  3JCF A;  3EHZ A;  2WDR A;  1ZKE A;  5KXJ A;  4PJL A;  3ETU A;  1HTJ F;  4QX8 B;  3RIU A;  2XQ3 A;  2J62 A;  3AEG A;  4O4I E;  3UFE A;  4ZI3 C;  3EDU A;  3NBX X;  2VQE T;  5AQM B;  5E0O A;  4YHJ A;  4F8H A;  2KZ7 B;  2XQ9 A;  2CXF A;  4DR4 T;  3C4W A;  2XSA A;  3I9W A;  4U2Z A;  5AQS B;  5BR8 T;  5L3F B;  1OXZ A;  1WCR A;  2WM9 A;  2W61 A;  4LF4 T;  2Q9Q D;  3QNU A;  4KI0 F;  5H6R B;  5LHI B;  2BDE A;  4H63 H;  4I43 B;  3ZYM A;  3C50 A;  2KWH A;  2BZB A;  1CHU A;  4HWI B;  1HCI A;  2KT9 A;  4UXN B;  5ADX L;  2M67 A;  5AQN B;  1W0B A;  5AQK B;  3RLF F;  2YOE A;  3HKC E;  1VCT A;  1MMG A;  2WZH A;  2CLY B;  3KFW X;  4JUY A;  4U7I A;  5IYZ E;  2I59 A;  2EHO A;  4U2Y A;  5AQL B;  4BA9 A;  3FBZ A;  5L4E A;  3RQW A;  4PJJ A;  4ZS3 A;  4ZZB A;  4IHJ E;  3FZK B;  4QXH B;  5LBQ B;  2XAG B;  2BS3 A;  2DLR A;  5HEG A;  5L3G B;  2Q9Q B;  3DP7 A;  3LFM A;  4K0U A;  2UXN B;  2L9Q A;  3FZF B;  2E9X A;  3UTK A;  5IUX A;  1WYC A;  1HX1 B;  1ZV4 X;  3AA6 B;  3TKL B;  2V5C A;  2MBG A;  3SWH A;  1NWM X;  2E9X D;  4MAL A;  5JR9 A;  4H9N C;  1T7S A;  5LGN B;  2LM2 A;  4ILA A;  4P0B A;  2BVM A;  2LSJ A;  2NW7 A;  4NUV A;  4QKN A;  5H6Q B;  2NP9 A;  5AQO B;  5J1G A;  3R6N A;  1XWM A;  1BR2 A;  3KV6 A;  2LRK A;  2IML A;  3LSV A;  4J2C A;  1QLB A;  4CI2 B;  3ZMT B;  1FMV A;  4BJM A;  4JI6 T;  2IHR 1;  3AAI A;  4OHF A;  3S4U A;  4EOZ B;  4NUU A;  3Q5W A;  4OFZ A;  5AQF B;  2YU2 A;  1QSD A;  3QB5 A;  5LGU B;  4IGU A;  1NAF A;  3CIR A;  2A2F X;  2CE7 A;  2XJ7 A;  4YFS A;  4LFA T;  2JQK A;  3AXJ A;  3B57 A;  1X79 A;  2XQ4 A;  5CA1 E;  5LXT E;  2E5L T;  2VWA A;  5JH7 E;  2YEV C;  3MK7 C;  2UXB T;  3CKD A;  4DV0 T;  2NR4 A;  1S94 A;  2JQH A;  5FY0 A;  5L4H A;  3VR9 A;  3CX8 B;  3ABV A;  3UU4 A;  5L47 A;  1KNP A;  4JI8 T;  4K0K T;  2Y6X A;  4KP3 C;  5JTG A;  3C4X A;  3MXZ A;  3AE7 A;  2H7O A;  3TLT A;  2DHR A;  2LM9 A;  5HXC A;  4L9I A;  4LF9 T;  2WU5 A;  5KX5 E;  4H9O C;  2VKD A;  4JEH B;  1HS7 A;  2UUC T;  4I0U A;  4DVD A;  5HXH A;  5LG4 A;  3JC6 C;  1E1H B;  1W9R A;  4M1P A;  4ZS2 A;  3KVB A;  3Q5E A;  5DJQ C;  5FKY A;  4DBQ A;  2UXC T;  3EDV A;  4TWD A;  5HEJ A;  3RC8 A;  3TLU A;  2KMF A;  1VRB A;  3UUN A;  4KX6 A;  3HKE E;  4GYS A;  4B6X A;  4YY3 T;  4WBO A;  1CUN A;  5AQV B;  2D2S A;  2K5B B;  4YJ3 E;  1X9B A;  2YU1 A;  5ABF B;  3P8C D;  3ZMU B;  2X9H A;  1OED E;  4EB6 E;  2W4X A;  3AE1 A;  3PUG A;  2YK0 A;  4JEU B;  3FHN A;  5LYJ E;  4HGA A;  3ZMV B;  1MIW A;  5FXX A;  2LHR A;  2MTQ A;  3N5L A;  4AKL A;  3AA1 B;  1XMO T;  5KDM C;  2UXD T;  4B3M T;  4UVB B;  5A1L A;  1UCU A;  2UUA T;  2FJA A;  4YTM A;  5FXZ A;  2X9Y A;  4PK4 A;  3GMI A;  2V6X A;  3SFD A;  1XNR T;  2LRL A;  2JRK A;  2X51 A;  3P4S A;  5LMN T;  1XMQ T;  3IEE A;  4UVA B;  2N9D A;  2VVN A;  3SS1 A;  3CPZ A;  2W00 A;  5HXS A;  5BMV E;  2BVL A;  2VL8 A;  4PFP A;  4U72 A;  4UF0 B;  3AEE A;  2ZM6 T;  4DR7 T;  3AXJ B;  4HE8 A;  1UUR A;  2DCF A;  3C64 A;  3KBU A;  3ZLI A;  4A97 A;  5L2L A;  1HNX T;  3MZK B;  5FVL A;  3ZC0 A;  1YW0 A;  1MNE A;  1WRD A;  2CMR A;  2LKH A;  4EED A;  2V7I A;  3ZJ2 A;  2XPK A;  3X1D A;  5FL0 A;  4ZOL E;  2DNX A;  1HFA A;  2K3W A;  3RRC A;  4YT0 A;  2BS2 A;  1G8X A;  1Y64 B;  3PUX F;  4GOU A;  4WYV A;  4ZZC A;  4X66 T;  1J5E T;  1KEY A;  3K8P C;  3E0Z A;  5LG3 A;  1HNZ T;  1WLX A;  5HEU A;  4U7Y A;  3RF1 A;  3ZCI A;  5FP3 A;  3L39 A;  4L5G A;  4GK5 E;  4EZH A;  3KDS E;  1D1C A;  2IDO B;  1OWA A;  2BS4 A;  1UX4 A;  2XHE B;  2YIN A;  3LJC A;  2W2U A;  3ONJ A;  4DUY T;  1HX8 A;  5JDG A;  4AI6 A;  3PDY A;  2XAH B;  2P9B A;  2X9W A;  2VKH A;  3AAA B;  1KNR A;  2N2N A;  2W0G A;  3C51 A;  5AQT B;  5HCJ A;  3OKQ A;  5J2U E;  4JI0 T;  3U78 A;  4DV1 T;  2LHN A;  3VU7 H;  3T1H T;  1FJG T;  5CJ5 A;  3CK6 A;  2BG9 B;  2NTY A;  3PJA J;  4OK0 A;  3SFE A;  4ASK A;  5HEO A;  5LNK A;  4OYK A;  3ZC1 A;  4LFC T;  2J1D G;  4PJM A;  3MAC A;  5ABG A;  3A5X A;  4HWD A;  3NRX A;  3PUQ A;  3F2E A;  3PJA A;  1MMD A;  1VCS A;  2BBJ A;  1MIY A;  3O1H A;  1WR6 A;  3HKB E;  3RRW A;  2V1D B;  2WU2 A;  2ACX A;  2OA5 A;  2Y48 B;  3Q5D A;  4TV8 E;  2CWO A;  3L3P A;  2CRB A;  3Q9D A;  4TZ4 C;  4UVC B;  2NTX A;  3UUX B;  4DBR A;  3T1Y T;  3A7M A;  2B1E A;  4QH4 A;  4HWC A;  3AEC A;  3QUJ A;  2UU9 T;  2L8K A;  3E08 A;  5C8Y E;  1ZEE A;  4MFR A;  1HG2 A;  5EK2 A;  2LOS A;  1O3X A;  2KWI B;  3UU3 A;  1D0Z A;  4IL9 A;  3IF8 B;  2RPA A;  4X1K E;  3V5S A;  4AXP A;  4UIG A;  4EIW A;  4EYY R;  3N2K E;  4QH1 A;  5FY1 A;  3NWI A;  2BKN A;  3DTO A;  5JDQ A;  2LE8 A;  3SRZ A;  5EK4 A;  3EI0 A;  2XQY A;  3UQ4 A;  4HFB A;  3ZPO A;  2CPT A;  4IDN A;  4GYR A;  5DAB A;  4DMW A;  1FEW A;  1IAP A;  1M7K A;  2YN6 A;  2QYW A;  2MPK A;  2X0Y A;  5FXV A;  5L3C B;  3IA3 A;  4EYU A;  3AA0 B;  4DV2 T;  4JLE A;  1ZHC A;  4L0R A;  2XQ8 A;  4HFC A;  4ILB A;  4TN7 B;  1SHZ C;  4TNW A;  4UV9 B;  3RIA A;  2X9X A;  3PU3 A;  5HCM A;  2C0S A;  2DWG A;  3P4P A;  4EAH A;  3MKD A;  4AQY T;  1US7 B;  1J1J A;  3BK9 A;  3IHR A;  4P0A A;  3OVU A;  4JBW F;  2IUB A;  2VKO A;  1T98 A;  2QVA A;  2JQ9 A;  3P4R A;  4COF A;  4AIU A;  4AQF C;  3U3I A;  4JI3 T;  2XQ5 A;  2K24 A;  4DR1 T;  4ANJ A;  4IST A;  1OED B;  2I0M A;  2ODU A;  1D0Y A;  4AKH A;  1WR0 A;  2D5U A;  5J0Z A;  1NEN A;  2LJL A;  2CHO A;  4C90 A;  3KV5 A;  1IBM T;  4PAG A;  5F3J A;  2DL1 A;  2IC6 A;  3BQL A;  3R84 B;  3PUR A;  2XTL A;  4A5X A;  3AEA A;  4CZZ B;  4X64 T;  3OPC A;  2K48 A;  4GKJ T;  3AE9 A;  2LOP A;  3RKG A;  2CA5 A;  2CHN A;  1MMA A;  1MMN A;  2WMN A;  2ZM8 A;  2J47 A;  3M3Z B;  4IDZ A;  4NIQ A;  1IJ5 A;  3ZN0 B;  1ZP0 A;  5M4Y A;  1BR1 A;  2D9D A;  2JIW A;  3TLV A;  3VKG A;  1OED C;  2OLT A;  2IAK A;  3FB2 A;  3B5M A;  4AKI A;  4CXW A;  3N2O A;  1XZY A;  3CVR A;  4ZI2 D;  1Y01 A;  2VK9 A;  2ZM0 A;  2M6I A;  3RIF A;  4AKR B;  1HR0 T;  3KBT A;  1YKE B;  4UEM A;  3IBP A;  2Q9Q C;  4DV5 T;  4O2A E;  2KSR A;  2PJQ A;  3A8Y C;  3ZT5 A;  2XQA A;  3KIN B;  5L3D B;  4YSY A;  4DO0 A;  5FY7 A;  4CN4 A;  1W0A A;  5CA0 E;  2D0T A;  5EZY E;  2W67 A;  1UX5 A;  5FNV E;  4B3T T;  1LVK A;  2EHO C;  1KNZ A;  2CCQ A;  2VAS A;  2YDQ A;  4ISS A;  3BQK A;  2HPL A;  5HWY A;  4TV9 E;  3KV9 A;  2IW5 B;  2PTF A;  2YKS A;  2AXD S;  2L3L A;  2WB5 A;  2XAQ B;  3N9O A;  1V9D A;  4TWH A;  4F6R C;  1YQ3 A;  2MOZ A;  1L0V A;  5JR9 C;  4B3R T;  5KMG P;  2BG9 E;  5C3J A;  4GIW A;  3P4Q A;  4NPP A;  4O4L E;  5F5W A;  1R8I A;  4NXM T;  4Z91 A;  5AQH B;  3ZCJ A;  2R6G F;  4DV3 T;  3M65 A;  2SPC A;  4HN9 A;  5JR9 B;  3RIU C;  3ZT7 A;  1YD8 G;  2CXL A;  5JRC A;  3RYC E;  3UU8 A;  3TLW A; 
#chains in the Genus database with same CATH homology
 1HNZ T;  4JI7 T;  4LF4 T;  4JI5 T;  4X62 T;  4JI2 T;  1N33 T;  4DUY T;  1N36 T;  4LF6 T;  4KHP T;  4JI0 T;  4DV1 T;  3T1H T;  4DV4 T;  4LFC T;  4NXN T;  1I94 T;  4OX9 T;  4LF8 T;  3T1Y T;  2UU9 T;  1HNX T;  4JI6 T;  4JV5 T;  4LF7 T;  4LFB T;  4LFA T;  2HHH T;  4DV6 T;  2E5L T;  2UXB T;  4DV0 T;  4JI8 T;  2F4V T;  4JYA T;  4K0K T;  4DV2 T;  4YHH T;  4LF9 T;  4AQY T;  4DR5 T;  2UUC T;  4LF5 T;  4DV7 T;  2UXC T;  1XNQ T;  4JI3 T;  4X65 T;  4DR1 T;  4YY3 T;  4B3S T;  2VQE T;  1IBM T;  1HNW T;  4X64 T;  1IBK T;  4DR6 T;  4GKJ T;  2VQF T;  1N34 T;  1IBL T;  1XMO T;  2UXD T;  4B3M T;  5LMU T;  2UUA T;  1XNR T;  4GKK T;  4DR2 T;  1HR0 T;  4DV5 T;  5LMN T;  1XMQ T;  4JI4 T;  2ZM6 T;  4JI1 T;  4B3T T;  4DUZ T;  4DR7 T;  3OTO T;  1FJG T;  5IWA T;  2UUB T;  4B3R T;  4NXM T;  4DR3 T;  4DV3 T;  4DR4 T;  4X66 T;  1N32 T;  1J5E T;  5BR8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...