4JVSA

Crystal structure of lepb gap domain from legionella drancourtii in complex with rab1-gdp and alf3
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
279
Chain Sequence
ATPPLLQMEQEQPFPELIRTWAGLLGQIGVESVRTEEVNFGQLAKCFNDYLNTVAEHCEQQNIWQHKREENHNFFTAFKPDASKAALHGHAYIAHYKESVILRHLSIVDPKTLGMLRFAPYEAPSTDYCRHFPDSPWAKMQRLATAGQNIILQLRLIQNGQMLEDDLPVLQKALDDFMQYKTEVDALLAHDTPVSTHDSSFFYDIDEQTLNAMSGDQLATICFEELNAPHPSRLIMRILKSDSLWQEVDDSLNGDAFMGRQDDICEKRNKICQWRQLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analyses of Legionella LepB reveal a new GAP fold that catalytically mimics eukaryotic RasGAP
pubmed doi rcsb
source organism Legionella drancourtii
molecule tags Hydrolase activator/protein transport
molecule keywords Putative uncharacterized protein
total genus 88
structure length 279
sequence length 287
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4jvsA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jvsA02
4I1OB 4JVSA 4JW1A 4IRUA 4I1MA
chains in the Genus database with same CATH superfamily
1ELWA 2CFUA 3BRJA 4RG6A 4YDOA 4CGVA 3EG9B 1AVOB 4I1MA 3IKOB 3Q7LA 3MYFA 4DI4A 4I43A 4HVBA 3FVYA 3T4RA 1V54E 4GYTA 4UWGA 5DVWA 1LF8A 3ASFA 1D1AA 2XPIA 3ENEA 4E7ZA 1QLEC 5EGYA 1WGWA 5AENA 4GU5A 4B89A 3LYAA 2VGXB 2NUPA 2XLHA 2Y0BG 2R7WA 2XCCA 3C63A 4YL0A 2ETAA 3X1OA 2PQNA 1KT0A 2V5FA 4UI9C 4TV3A 4HOTA 3LAYA 3EFOA 3PUJA 2LAHA 2KGOA 4I9EA 3B7RL 4PJNA 4DVYP 4YK5A 3HIZA 1N4PA 3JQ1A 4MVUA 3CR3A 1ZU5A 4YT4A 4JEAA 2WXIA 4MVQA 1E84A 1H0AA 3CVXA 3ASOE 2WZGA 3E9VA 2XEHA 3UIPC 5JT4A 2PBEA 4B6IA 3D9PA 1H9TA 4FU3A 4WNDA 4JZYA 1Q2ZA 4URKA 3FU5A 1O87A 2UY1A 4GTPA 4JTCB 2VC9A 1HF8A 5FINA 5ARGA 3U9JA 3SNHA 1ZVZA 4NACA 2HM8A 3Q4AB 3ABLC 4XEVA 2IOSA 2WXLA 2PL2A 1MMGA 1NFOA 2DWZA 3DXMG 3OAWA 5CECB 3CHOA 3AAAC 5KYXB 3EUVA 3ML8A 4FP7A 2GRPB 4G11A 2XHEA 2QUPA 2H6GA 2IXNA 1NSGB 4G78A 5EIBE 4NTBA 4TXQA 5CRVA 3LY9A 3M1CB 4X0RA 1JMWA 2P58C 2LIGA 1H7IA 4UQZA 4CS8A 2MYSA 1SMYF 2HZ8A 1ORJA 3U8VA 2E87A 4CCAA 4Q4ZF 1E96B 1HG2A 3C18A 4L23A 4U8HA 4DX7D 4U5BE 2EPLX 3H2UA 3Q6NA 3RF3A 3HDXA 4BSXA 5FZQA 3EPVA 3B29A 1N1CA 2C0LA 4TRQA 4BTAA 3T5VA 2W4BA 3UMHA 2ZXOA 4DLQA 5L0CA 3R9AB 3PZ3A 1E83A 4BETA 3TXNA 3Q78A 3Q7GA 1INZA 3B0PA 1GM5A 3FTSA 4WAFA 3MYVA 3A9CA 3DSSA 3CK8A 4DXWA 2GWWA 1L5JA 1OWLA 2LSEA 2Y69E 1LI5A 3I3NA 4I3MA 5D2MC 3FH8A 1OWPA 1E7UA 4BJ1A 2WXKA 3APCA 2AXZA 1D0ZA 4HOQA 4U96D 2P6VA 3K33A 4N6HA 4P9TA 4BJ6C 3B7UX 1JWGA 2NPUA 1NI1A 256BA 4U5HA 4XLPF 3MKQB 4N2SA 2J7PA 1GW6A 4NIKA 5TJ5E 2DYSC 2WXRA 1T9KA 1OCCC 3QVZA 2Y3DA 3TWVA 3AU5A 4UWHA 1HE1A 4RLYA 4Q94A 1TFKB 3RYLA 2J45A 3FEYA 3SI5A 3ZHEA 1DCEA 2H7OA 3J06A 2VGEA 2BUGA 3SFYA 3X2QE 3LVQE 1AUEA 2YNQA 3C3OA 1EKYA 3TK0A 2IOQA 4ZLCA 2R7RA 3RVZA 3Q6MA 1U3DA 2DI3A 2OEVA 2P2CP 3PH0C 3W9GA 1YDIA 5AQBA 4A63B 3G2VA 2LXLA 2I6HA 3RK6A 2KATA 4IAOA 3E37A 3QAQA 2LNIA 3D9LA 5T1DB 3Q73A 1H2TC 5HV9A 2YWAA 3BU8A 3L16A 5E76A 4LERA 3SY2A 3URZA 3ZVRA 2LFDA 2A1DD 1H6PA 3FUNA 1RXQA 4DRHB 1IHBA 4WNEA 2QC9A 1Q0KA 1F1MA 3JUEA 3Q5MA 3ZGQA 5C1DA 4DOZA 1YYJA 1CGNA 3AG2E 3B7TA 5KYYB 2FULA 4PUCA 4EECA 4C3EA 1Z3YA 3L34A 5FZSA 4LNBA 2B0JA 4G25A 1PAQA 5E3CA 3UKUG 3S7FA 4A1GA 1VLTA 3EQLF 3LXUX 4N5CA 3TWRA 3UXGA 3RQFA 3U3FA 2J0WA 4HLLA 4J7YA 4XZ4A 1HXIA 1JR8A 3C8GB 3SNXA 4GMRA 2V4HC 3EH2A 3EH1A 1RCPA 3SXKA 1Q0DA 3AG3C 4YN0B 2KBXA 1NFNA 3MGBA 5AC4A 1HMDA 1TNYA 4JEUA 4O6MA 2XGMA 3RIBA 1FFHA 5G04J 1K1AA 3GEEA 4CDRA 4K0DA 2OCCE 1S63A 3V30A 2XRYA 1FT1A 2CHWA 2WMNA 2J7PD 3LS0A 2VTBA 3ULQA 3C98A 4U5FE 5ENNA 2CDQA 1G5ZA 3PMRA 4BJ6A 1QQEA 4ACLA 5A6BD 5FTPA 5LP0A 4I1OB 3HNLA 3WAQA 2C03A 1RKEB 3RVYA 4GYOA 2WXQA 3O39A 2AVKA 2F8YA 4PR9A 4I6EA 5FQ8A 3FH7A 2P9KG 2D4UA 3MYIA 1A7DA 4BX8A 3LUTB 1BLXB 1QQ3A 1MMAA 3HXCA 1OCCE 1L7CA 4GTTA 4ZLDA 1OCZE 1YJGA 3FULA 4BY6A 2WXMA 1ZW2A 3KH2A 1IQUA 1KZOA 1WWPA 1Y6IA 3CKCA 5AARA 5JMND 4AJWA 4LNUD 2I9CA 3CVPA 3NMKA 2EINC 3FHDA 1HS6A 4EZLA 1XWJA 3ESKA 3ZTMA 4HRMB 1QVXA 2P7VA 1V4AA 5KYNA 3FUIA 1N54A 3U64A 4JTAB 2WMOA 4YWQA 4GA0A 4PK4A 2P9NG 3J5PA 1ZU2A 3DWLG 4L2LA 4EBAG 2LFFA 2EPKX 3JXJA 4C7OB 2OJQA 2VB6A 2ZXPA 1VYIA 1O3UA 1M57C 4EZJA 2CNWA 3GYZA 3B71A 2RSEB 2HJ3A 2ZPAA 3ZTZA 4ZHBA 1HMOA 4RG9A 5KYWA 5BT1A 5EN5D 3AU4A 1VB5A 4AL0A 3LY7A 3QJZA 4MTOA 3L1MA 3T8MA 1N4RA 3Q15A 3NF1A 3WG7E 4PS7A 3GWLA 1FFTC 4PS8A 1LE2A 2WXOA 1Y6DA 3FAJA 3DI5A 4XIFA 2X51A 5KYUA 2W4MA 2H7VC 3RW0A 4KT6B 3TXMA 1CGME 2F22A 3R7RA 4M3OA 3V5ZA 5T3TA 5AYWD 1YZAA 3FWVA 5BQHA 3U0CA 1UFBA 3SD5A 1IXVA 2YINA 4UWKA 3DSTA 3EHMA 2VCCA 1U89A 4JE9A 4U04A 2FI7A 4KZCA 4OINF 1YARO 4CDNA 3SP1A 4E0IA 3ZVVA 2A69F 1NLXA 2KZTB 3ML9A 1AEPA 1NFIE 3PS6A 3E34A 3DWWA 5L3QA 1XZQA 3V31A 4GZ6A 3N71A 3AGUA 3FDHA 4K7BA 1E90A 2LO6A 1BI8B 2R2LA 2X0CA 1ZB1A 4C9BB 3DSUA 4JZAA 4FADA 3PDMP 5JRAA 1ST6A 2YLDA 3GANA 1JOGA 4BEMJ 2XZDG 3FUMA 4GA1A 2HSBA 1BR4A 2IFUA 3X2QC 2QNLA 2J9QA 3DPYA 3HRAA 5EX3A 5C2YA 4CSAC 4JTDB 3FY4A 1M2OA 2WZLA 2G3KA 4I2WA 2IXPA 4GZDA 3QWWA 2DIWA 1RJ9B 2OEXA 3JZ0A 4U95D 3DM9B 4Y6WA 3ZN3A 3MLGA 4J8DA 3RRNB 1T6QA 2I1JA 5BNWA 4DRXE 4F7AA 3FTVA 5GPGB 4EUKB 1UN8A 5LCWC 4HE8D 1LVKA 1YYXA 2X6IA 2WVQA 2HYZA 3LCAA 2J9BA 1MX2A 3UT4A 2YKZA 3ZKJA 5EILA 1A41A 3IHUA 3E4BA 4JB8P 4A3TA 3NBNB 1A0BA 4AV7A 4BJ5A 1S05A 2B6CA 3FTWA 4LNGA 5CI9A 2RD0A 3W2VA 5DS4A 3BEHA 3D9KA 3PNTB 4MKTA 4HXIA 2IO2C 3E30A 4E17A 1CPQA 4J8FA 2YL7A 3OTNA 5L0FA 3R7QA 3AOUA 3IQTA 3CVNA 1M6TA 1NBBA 4I2ZA 4UWFA 1JPNA 2WXHA 1EDUA 5J08A 5E75A 2WXGA 5CEAA 5HI7A 3T9OA 2H6HA 4YDYA 3ZYMA 4G0HA 3O55A 2M4EA 3NB2A 2XXAA 2QFCA 3HVEB 4J8SA 4AXHA 5ARFA 2FO1E 1HFAA 2X38A 1OW6A 4O79A 3CGHA 3KKBA 3LPZA 3L54A 2NSFA 1KTMA 2CNWD 2R59A 1NU9C 2XRZA 2ZXRA 2R7SA 3ABKC 5EIDA 2HE0A 3GODA 3FUFA 3IQCA 4C3DA 2GRMA 1W3BA 4OIQF 2WXPA 4GTSA 2P1AA 1FMWA 2DYSE 5E2QA 3G50A 4MVMA 5B1AE 4U0ZA 3U2MA 1IHGA 1RMVA 3CSFA 3F47A 3ASNC 2CFZA 4CS7A 1YMPA 4ONSA 3CQGB 4A3VA 3TQOA 2RFMA 3CSKA 4XWJA 1TNBA 4CYMD 4CGWA 4G7ZF 5KJMA 5T4YA 2L0TB 2CW0F 4F53A 4XPWA 4YJWA 2AXVA 5KNHD 3IPMO 3NG1A 4NQ0A 2X6JA 4XLNF 1LTXA 3EGXB 4C48B 3ABME 4HI8A 4AY6A 4WUYA 5CBOA 2OCCC 2HUJA 4A4AA 3DD7A 2ICWG 3PE4A 3SHFA 4G7OF 3HG0D 5B3IA 3RH3A 3RJVA 2J08A 2YLIA 4GCNA 1TWHA 5B3SC 3SEOA 3CVUA 4AEZC 1NA0A 1QSPA 1Y8MA 2XL4A 4IB4A 2WM9A 4HOSA 1JUQA 2P9SG 4CX9A 2HV6A 3DAFA 3CEQA 3UM0A 2V0PA 4WGZA 3PCVA 2KYHA 2J4BA 4CJGA 3E33A 4DX2A 1DVPA 3SO8A 1MX6A 3D9HA 3U5SA 4DX1A 2EIJE 1IW7F 3S29A 3L08A 1NG1A 1RJ9A 1HW2A 2RFAA 1ZHWA 1S7ZA 4I6GA 4RSYA 2IXMA 4WWOA 3KD7A 5KJLA 3ZXPA 4HBDA 3V79K 4ACKA 1DC2A 4ULWA 1LD7A 2H6IA 5EKQD 3JYHA 5G55A 2OOEA 2O9XA 4AL1A 4JURI 4XI9A 4EIYA 3JTLO 1XNFA 3DRAA 1OWOA 3QARA 2WB2A 3IHVA 3O48A 5G04C 3OWTA 1OR3A 4D4NA 1U2VG 3B0VC 1WG0A 3D3MA 3MA5A 3ZIMA 2I2OA 3GZ2A 3C72A 4KNVA 3HNKA 4APFA 5JSLA 1MQVA 4PJLA 1TN8A 3ZYQA 1D8EA 4ABNA 3VTXA 4CSAA 2KZTA 4H4KC 4F4BA 1ZHYA 4AOFA 3UKRG 3DJUB 5A6KA 3IV0A 4K1OA 4KBQA 4R7LA 2Y3HA 4C0EA 3L8IA 4A1SA 2MHRA 4K5CA 4OD4A 3RFYA 5EYLA 3T9KA 2JPUA 5A6JA 5ENSD 3K9IA 3FU0A 2P9LG 1Q0GA 1YAUO 4IJJA 1UW4B 2NG1A 4FHJA 4YVQC 3CVVA 4JKVA 3KS2A 5FJYA 2WXNA 4M63A 2XLMA 4EPZA 4E85A 4BESA 4L6RA 3CAXA 3DAGA 5KJKA 4CT4A 4CT0A 3TWQA 3MBGA 4DBQA 3P1UA 2HMQA 3FHEA 4CS9A 3FEXA 4JIOA 3UUXA 2C0MA 2IM8A 2EINE 4EQFA 3C8ZA 2MWQA 3Q49B 4IRUA 5KYWB 2FGYA 1OWMA 3O4ZA 4GYYA 5KNGA 5BV1A 5DIZA 1BBHA 4E7SA 1UG7A 4J7TA 4RQIA 4XKCA 4KBLA 4XEFA 5BV0A 1WAO1 2DVWA 4PDXA 3FUKA 5BPPA 2HFIA 3C3RA 2XEVA 2PX0A 3TOLA 4MVSA 2WVIA 5DS6A 5IY5E 3LVRE 4U07A 2BEDA 1FPPA 4CS8C 5BUOA 3FU6A 5CRUA 2B0HA 3AS5A 2DB4A 1JAFA 4D10C 2KC7A 3PEUB 3Q79A 1VLSA 5B1BE 4N3CA 4RVBA 4BFRA 1I4YA 2VJ8A 4KZ0A 5G2NA 3HTKC 2JD3A 4UQYA 3SBSA 1MQSA 3QW1A 2KCKA 2AP3A 2A4ZA 3V2XA 4IGGA 4JCZA 3TJ6A 2VSOE 5A6CA 3CKBA 3E70C 3TULA 3S27A 1UJJA 4ZFHA 3UX4A 1Z7Qc 5D0QD 4YL3A 1H6KA 2PQRA 4R32A 3KAEA 2J9WA 3DZAA 2EILE 3NAWA 4MVZA 1WOLA 5EHHA 1EF1C 4MVRA 1QBQA 2L0IA 2PM6A 4J8YA 3L13A 5AJDA 4PFPA 1OR2A 2OV8A 2Y69C 3ONKA 1GQAA 4B93B 4UQXA 2W9YA 5CMWA 2Q00A 1M56C 3LEVA 3GZ1A 2B0OE 1PV3A 4E6HA 3PZ2A 3DPDA 1SA5A 3V2OA 4WJ0A 3UM3A 2KC3A 3LLKA 4I44A 4NCQA 5E33A 1LD8A 3NRHA 2XENA 3C5RA 1ZW3A 1Z6TA 1YA7O 2JX0A 2YL1A 4UI9K 3AS8A 4ATGA 2R7UA 3C8GA 4G26A 2QLAA 4Q7CA 4DVZA 4IYPA 4XX5A 2OKUA 3QW0A 2P0NA 2L6FA 5EYPF 5JJTA 3M4CA 2MYOA 5B1BC 4DJ9A 3DEPA 3ECSA 4K03A 4WWNA 3EGXA 2Y3AA 4XPYA 1N0RA 3W9FA 4MW8A 5F28E 3E32A 3L17A 2R7XA 3ZG1A 4GTOA 4ANUA 2YRFA 2ZIRA 2I15A 4EBKA 1O1TA 3ULYA 2IJGX 3O10A 3NZSA 3NZUA 4MS2A 3K66A 2UUIA 1LS4A 2WQHA 4N2QA 2IY0C 4PJMA 5FIOA 3AJMA 4NQFA 3AG4E 1SZAA 3MV2B 2R7QA 3DKAA 1N9AA 1ZHXA 2J46A 2KQ9A 1N0QA 3S7JA 3B13A 5A6AA 1HE9A 1BD8A 2J4DA 4NURA 3JUIA 1DOVA 3EJNA 2VSXE 3N2ZB 3JCKC 4HFKB 2XPZA 1X5BA 3ABMC 3ZFWA 3ZYLA 2C04A 1H6OA 2WVNA 2J0XA 1O5HA 1O5MA 2EIME 3BUAA 2Y4UA 4QDLA 3ULEG 1WATA 2ILRA 4JA7A 2P61A 1ZYRF 2XLDA 1G4US 3EHRA 2NSZA 4OIPF 3ZHEB 3HVEA 2OJED 4FESA 4FJZA 1HO8A 2Y39A 1T01A 3JYSA 3FU3A 2XXAB 1YA0A 1UG3A 2HS5A 2IXOA 3DXKG 4FULA 5FQ4A 1B68A 3DXJF 4NY3A 2XGSA 5FWQA 2WVOA 1Z5SC 3U2LA 4BJ5C 5BXUA 4DX6D 3AG4C 3TJPA 2WQ7A 2JLBA 2VASA 3MCXA 2WPVA 3L8JA 3UMKA 3UR3C 3WXXA 3D9NA 4K5BA 1J8YF 1VTMP 4EBAA 4N3BA 3V5XA 3SZRA 3US6A 3LLIA 3SGHA 2BE5F 3G2UA 4CDMA 3TG5A 2GA0A 4JHRA 2XLOA 3U3WA 2F37A 2EPOA 1TYQG 2OEWA 3SF4A 2R17C 4O6NA 3SZ7A 4U5CE 3FMSA 2YQ8A 4CBEA 4GEHA 1Q0FA 3VAYA 1YYHA 2KSFA 1OW7A 4IN3B 2Q9CA 2FF4A 2V5QC 2Q3TA 1I5NA 2WZFA 3S7BA 2OQMA 2AWYA 4O1PA 5FQ7A 2V4LA 3TWUA 3CVLA 1EPUA 4E0HA 3R2PA 3L6AA 3VM6A 4YT2A 3D9OA 1G8XA 3TG4A 5DBKA 4JPSA 2V3CC 2KCLA 2TMVP 2RKKA 1BPOA 4AM9A 2MOWA 2I1KA 4G7HF 3V5YA 2Y3BA 2QYJA 3V7OA 4CDYA 1QZXA 4IWBA 4JXTA 1Q0MA 2IQCA 2HJMA 1U0BB 4FLBA 1LIHA 1U3CA 4JD2G 3UNGC 1OY3D 4HI9A 4KXKB 3G4ZA 4LLCA 2IEJA 2R05A 2ZGGA 1H2UA 3ASGA 4DPRA 1X81A 3DE8A 4N39A 3OXFA 4O60A 1PC2A 1Z5ZA 1ZHZA 2A0BA 4UDVA 1O1RA 5BUZA 2EIMC 2P9IG 2L7AA 2HMZA 4LUNU 1BZ4A 3EDTB 3VYWA 1LE4A 2KNHA 2UY1B 3R7CA 3K1HA 4ILGA 2EQXA 2L6GA 3UQ3A 4Q69A 4UUCA 2GRLA 5G05J 5HKPA 2DGJA 2MRIA 1S0PA 2ZXWE 1LI7A 3M4BA 4I6JA 4B0ZA 4U9EA 1PD1A 2GAQA 1E8ZA 3DM5A 3CHRA 4FLHA 3IQ6A 2L6HA 3HKKA 2X3MA 4KNWA 2XZTG 3NOCD 5KBAA 1NU7D 2YQYA 3U9WA 2ZISA 3DMDA 3EFOB 2EIKC 2WL8A 5FZTA 3KSLA 1L3PA 2QE9A 4XE0A 3VTYA 4ANXA 3PDNA 1TWAA 3TWSA 4MQ9F 4NTFA 3TD7A 2ETCA 1HX8A 2DZNA 5KYUB 1D0XA 2NUPB 5AQ9A 1TEZA 1QYMA 4A55A 5FZRA 3CZ6A 2BKGA 3LS8A 3F6QA 4FA6A 3SXMA 1MJ0A 3HXEA 1ZZPA 3ABKE 4LDRA 2WQ6A 1VMAA 3CHPA 2LK4A 3EG9A 4DRJB 3TWTA 4BJTA 3AG1C 1OXKA 1HG5A 1Z3IX 2A5UA 2A6EF 3ASNE 4V3IA 3FOPA 2A6HF 1O1SA 3CSTA 4QI2A 3UINC 4U5EE 3GEIA 5ITZF 4N6CA 4JHKA 5JA4D 4GPKA 1SF8A 1JCSA 2WXJA 4C7OA 4LG6A 5AQ7A 1G4WR 4CRWA 3LJNA 3KEAA 2J09A 1C17M 4GZ3A 4LEUA 1N52A 1KT1A 5KJNA 1VYKA 3HNIA 3F46A 2A5EA 1PY1A 3I4RB 3UMIA 4TXPA 2XM0A 3U9MA 4XEKA 4ILIA 1TJFA 4Q96A 4BT8A 1QPUA 5ENOD 3VRCA 2RG8A 1UN9A 4I9CA 1FAPB 3PZDA 2EPNA 3QTHA 5FQ6A 4LSZE 3UMVA 1JPLA 5BQGA 4WNFA 2L81A 4B94A 3RU0A 2BL2A 1V74B 3GZSA 5G05C 3UM2A 2IBFA 4O6YA 1V55C 2XPYA 3ZXSA 3FTXA 4ANWA 5JJ7A 1A7VA 4HFGA 2HV7A 2X6FA 1RKEA 1B89A 3VF0A 1FMVA 5KCMA 4G24A 5T8IA 2XQ0A 1ZHTA 3ASDA 1TWCA 1ORYA 4XTKA 4J8EA 2R5SA 2EIJC 4H7XA 3TL5A 2Y4TA 4TXRA 3AG3E 1MMDA 2VTBB 1JPJA 3NYLA 2UWJG 2XL6A 3TJ5A 3RRMB 3S2AA 1ZU4A 4A2NB 2R7OA 1BDJB 1ZBPA 4PH4B 3B95A 3MX3A 3BEEA 4TUUA 2PNNA 4GPMA 5ENRD 4EHPA 5FCLA 3VLEA 4HQDA 4U7EB 2DYRE 4F3VA 4J30B 2L9JA 4QQIA 3NKDA 3UI2A 3MJWA 2PF4E 3AG2C 5B3SE 3IEEA 3DSVA 2L9BA 2ASRA 2AWIA 5A7DB 2WB7A 4B8AA 3GM2A 3ZW3A 4FAPB 3GORA 3SFZA 3TAXA 2OG2A 1CGOA 4N5QA 2IONA 3S84A 3JCUQ 3W8HA 1R4TA 2LQGA 4W8PA 3UGOA 1R5ID 4LLEA 1IQRA 4J32B 3G2TA 5KYYA 1YA9A 2PFDA 4Y6CA 3FUEA 4M7CA 2QYUA 1BI7B 1S70B 4G8KA 3I5QA 1SQMA 3APFA 1OCOE 5JVEA 3POVA 3LEWA 1TNUA 4BEPA 4WGYA 2HSQA 2LP4A 3CVWA 2KJGA 2J9VA 1N95A 3S9OA 4HOUA 5B1AC 2PNOA 4LACB 3P2BA 3ZC4A 2AVPA 2Y3GA 3D9IA 3RO3A 2XLEA 1D8DA 2GW1A 4OD5A 3ZDLA 1DCQA 3TOMA 3S7DA 4BWRA 3GEHA 2R03A 5L0JA 1HH8A 3NQPA 4GCOA 1ELRA 3FAPB 5LOZA 1NP7A 3ITFA 2DCPA 4HFFB 4H54A 1D0YA 4FX5A 2ZGDA 1FVFA 2BF0X 3GW4A 3FDQA 3AS4A 4YT8A 4B8CB 3ZNGA 3EIQC 3N0TA 3NMIA 1SZIA 1WTYA 2OOCA 4CEMA 1D1BA 1T5OA 1OKKA 1MZCA 1LPEA 2L6BA 4JW1A 3T5XA 2QZAA 3PZ1A 3MKQA 4YVOA 5T3RA 2NUTB 4GTRA 2XGOA 4PACA 2OVFA 5DS5A 5CMYA 3HLZA 3EHNA 2EIKE 4J7WA 2AU5A 2KW3C 3JSZA 4O1OA 4HRNA 1OCOC 2L6JA 4L7TA 3GM3A 1IZMA 1QZ2A 1H2VC 1TNOA 5M72A 4Q5SF 1UJKA 2W45A 2YHCA 1Z23A 2FAPB 5J90A 2V26A 3GWNA 1YCSB 4HRLA 4GQHA 1HE8A 3ZUVB 3IBEA 4PJJA 4APOA 4NTAA 5ANRA 2Q4FA 4ATZD 4U63A 4Z68A 1MX4A 2PP4A 4C0MA 4Z9IA 2BKKB 2VSYA 4W9RA 4HORA 1U6HA 4DI3A 4OYSA 1E8YA 2I8BA 3JRTA 4G1TA 3ATPA 1RW2A 3CK7A 3FTUA 1K8KG 3CVYA 2F0YA 3WHNA 3FH5A 2CCYA 3OEOA 3Q75A 1QNFA 3LY8A 3ZYKA 1MHQA 2ZXWC 3R9MA 1EQ1A 3UTMA 3EIJA 1SVXA 2GROB 4RD9A 5DLJA 1JRAA 3ZU7B 2KM4A 3PHF2 3K1IA 3G4XA 3QKYA 4HLEA 3MV3B 4CDAA 1P5QA 4HEAJ 4P29A 3NOGD 3LJ3A 3JQ0A 2YHEA 5KYXA 4F6RD 3M79A 3LNRA 5A6BA 4ANJA 3U8PA 3O6XA 3NDBB 1H6GA 5JJ6A 3D9JA 2BTDA 3FUDA 4XI0A 2GRRB 1H9GA 2Y1LE 3Q7AA 1FTSA 4JC8A 1TN7A 2HKVA 4L1BA 2AXUA 3APDA 1N11A 3NMJA 5T3WA 2AWCA 3L0IA 2IOLA 4UI9J 2ETSA 1TR4A 2KCVA 3DSWA 4CIPA 4FHKA 4JC7A 3OXGA 1EI7A 3LKUA 4MTFA 3RSEG 2G62A 2X6HA 4MS6A 3QMKA 4Z9HA 4JCHA 4U8VD 1YZCA 2Q9AA 1Z6AA 2V8SE 2Q7FA 2LXMA 5H7PA 3C3QA 3T6JA 1NZNA 2VYIA 3ZQVA 2VGXA 4H7YA 2LD6A 1XGWA 3HXDA 3WODF 3L82A 5LCWJ 3ZRHA 3AG1E 3K6BA 3W2WA 4CS9C 2EILC 2FBNA 4DBRA 3S28A 2R9RB 2M64A 3ZIBA 3IHYA 3GM1A 4E18A 3B7SA 3HNJA 2H8AA 5FT9A 4JJFA 1EA8A 1KPSB 3KPHA 2QTVA 4KI2A 1DNPA 4F1SA 1BR1A 5LFAA 1N4SA 2GFHA 3JXIA 2CHXA 5D92A 1M2VB 4U5GA 4QFVA 3NYMA 4MW3A 4FJYA 3IQ5A 4GMJA 2XLVA 4YL1A 5L3VA 1MYOA 3UPVA 1T6UA 4U0UA 5CBNA 3BQOA 2LSUA 3ISMC 4LCTA 5ENQD 1VK5A 1TNZA 5BQIA 1K1BA 3C7JA 4OAUC 4LDKA 5AJLA 3UT8A 1WDYA 3W8IA 1T6IA 2LCHA 4CDVA 4MTGA 5F5HA 5E3AA 1OW8A 2VCBA 5DQTA 3G2WA 5CERB 5CHEE 2Z15A 1SA4A 2A68F 1IKND 1WM5A 1RKCA 4XKBA 4P6IC 3C8GD 2E2EA 4EBJA 1UOHA 4QI0A 3A11A 2XS1A 3CQZA 2PZIA 3HYMB 5EDSA 4XPXA 2IU1A 4DX5D 3ZSUA 2ZU6B 2VGYA 5HSWA 3SXZA 2NYJA 2YL0A 2RD9A 3QB2A 2J8SD 2YVKA 4WABA 2AJAA 3QWVA 3QWPA 4W8KA 1OCZC 1K3ZD 2GDCA 3QZCA 3DEOA 5D66A 2Q7RA 2LAIA 4PS3A 2J9UA 4MVOA 3H65A 2MHKA 3HXBA 1YLMA 3JRMO 4EBBA 5L0HA 1E7VA 3EZHA 4DRIB 2VQ2A 1KZPA 3BG1B 2DZOA 3EZIA 3I4UA 1TWGA 1TR2A 2C2LA 2HR2A 3IXEA 3PEVB 4YDEA 4G8LA 2A0UA 3S90A 3M15A 4BSZB 3WG7C 3RO2A 3UGPA 4XEIG 3LEOA 4ANVA 3KYIA 4PFOA 3ZQYA 3CQCB 4DJAA 5AGFA 4ME2A 1AWCB 3DJNB 5CI8A 1NZEA 1GGQA 4CJOA 4FWVA 4CIHA 1J8MF 4IARA 1E8XA 4GZCA 4KMOA 3MZLB 5CEDB 3FUJA 1SYQA 3AJIA 2CYDA 3TWWA 3BG0B 1TJCA 3LS1A 5JHAA 1JWFA 5JS5A 1LS1A 1JCQA 4MLPA 1ORSC 4N3AA 4YNDA 3EU5A 3FP3A 4YDWA 4KVOA 1E85A 2CG2A 4L2YA 4C3BA 3QNKA 1HW1A 2UUHA 2XEEA 4JHJA 4AK9A 3IEGA 3PVLA 4GAAA 2ONDA 4F1PA 5HS0A 1EYHA 2FO7A 3N24A 1ELKA 3ABLE 4GTMA 4L9PA 4BT9A 3L22A 4DLOA 3T8KA 4AY5A 2R7VA 4I1AA 3QK0A 3ASOC 3AQCA 2H7BA 1OXJA 2ZD9A 4LRZA 1NL4A 1KLXA 3MEKA 2KK1A 1G3NB 2CGEA 2J49A 2XSEA 1V55E 3ONLA 1FVHA 5CCLA 3C62A 1SZ9A 1Y4CA 2QY7A 5L0GA 2YLGA 4AE4B 2XCBA 3EGDA 3CHQA 1PCXA 3I4GA 4UWLA 4OIRF 2X6KA 4GMLA 2IF4A 5ENPD 1MNDA 3CK9A 3PNLB 1WASA 1E86A 4EZKA 4WWPA 5JP7A 1MNEA 5COMA 4IULA 1GS9A 3H2VA 4OAVB 2WXFA 5D0OD 2FEZA 1KNYA 1DOWA 4GYWA 2P9PG 4RBNA 1Z63A 3CV0A 4FC8A 2F8XK 1E8WA 2CHZA 5AIJA 5LX8A 1XZPA 3UIOC 3Q9UC 3SFXA 1W2WA 4JRZA 1OCRE 3RRUA 2CG3A 1MMNA 1OT8A 3K1IC 4AP2A 2OU6A 3CVQA 4OIOF 4ER9A 3JYYA 1SR2A 4NRHB 2NSGA 4BX9A 2J8WA 4EHMA 2XL8A 3U4TA 3JT1A 4MRUA 3SBTB 5EK0A 3UM1A 3T6GB 3TWXA 3W4YA 4EKWA 5COGA 4I17A 4KYOB 5ANLA 3ZPJA 4G23A 4HB5A 2ETBA 3FFLA 1TQGA 3LJBA 4DK5A 5L0IA 2EPMX 1APCA 3CHSA 5HRYA 2NUTA 1FCHA 5JLIA 3K7DA 4BEJA 3OXLA 4JL0A 3EU9A 3DSXA 3VLDA 2XLWA 3EGDB 3G2SA 2KXPC 4ULVA 2R7TA 4AE4A 3RAUA 3PE3A 1TFOB 1FT2A 5AN8A 3FXHA 5BXOA 4XQ1A 2VSNA 1D1CA 1OWNA 2XM4A 1A17A 1HU3A 4JVSA 2IO3C 4P9FA 4OVUA 2GRNB 4DUIA 4AIFA 4NC3A 4G2VA 2E0IA 3SYNA 3Q7FA 3FTZA 1E2XA 3OA1A 4AVXA 3DBSA 1OUVA 4JEHA 1TN6A 3PZ4A 2QY9A 3SXYA 4GB9A 4YT5A 1TKNA 3HXFA 4JJGA 2YHSA 3QVYA 5DQZA 1LM3B 4BTBA 4K0RA 2YEVA 1VDYA 3CEXA 5ENTD 1JCRA 3RKOF 3HHMA 5AC5A 1N94A 3KSQA 1A5EA 3PREA 2R25A 2P9UG 3DE9A 4K5AB 2JEKA 2IYLD 4BG0A 3D9MA 2YL3A 3QOUA 5F5FA 2GRQB 1OXBA 4EWCA 2VH3A 1D9SA 4Z9JA 3S0XA 2HO1A 4N4WA 4BPMA 3QDNA 4ILHB 2XRHA 3JSEO 3RQEA 3U3BA 3ASHA 5K0IA 4N06A 3RIPA 1NA3A 1WY6A 4D4XA 2D5RB 1PD0A 3KMIA 2H6FA 3Q9NC 1Z3XA 4TUMA 2Q9BA 1BR2A 4MNDA 4O6FA 3T6BA 3L9TA 4RDAA 4HNAD 3ESLA 2BC5A 3Q47B 3ZEFA 2OVBA 1SW6A 1CPRA 4CZ2D 3UT7A 3KYJA 3FTYA 3SQVA 3CIAA 3CHMA 5L0DA 4GTVA 3VLFA 2R02A 5A69A 5CIVA 1OCRC 3KEZA 1BU9A 2VCAA 4HS2A 5JHBA 1FNTc 2YZSA 4O7GA 1V54C 4JEBA 4X8QA 3MKRA 1AP7A 4OVVA 1C02A 5EX0A 4KVMA 1OKKD 5AQAA 2PM7A 3NKEA 4U0SA 1RZ4A 2AW6A 3EHQA 5AAOA 3PRZA 3MFNA 1N4QA 4AX2A 1C03A 1FR0A 1A7EA 3B0UX 2NC9A 3J5QB 4LDQA 1KU2A 2LSVA 4KC9A 2FFHA 1H19A 1K40A 1HZ4A 3AGTA 3LDZA 1IYGA 5D91A 3RQGA 4WNGA 2GGFA 2DYRC 3I5PA 4U5DE 1QKRA 3QC1A 5CCMA 3CLJA 2LUHA 4GZ5A 5KWDA 4IAQA 3FOOA 3PUKA 3LNMB 3RKVA 3ZWIA 3HJCA 2PX3A 2XS8A 4MBGA 4BERA 3TGOA 2G3VA 3LESA 2M63A 2JABA 3U66A 2DBAA 4U9DA 1VOMA 1HY5A 5COFA 1YVIA 1K04A 5IY5C 2J07A 1WN0A 5A23A 5BW8C 3B9QA 3KL4A 1OQCA 4JA9A 3AQBA 1K05A 1LKXA 1M2VA 4U8YD 4J6IA 5HQ8A 1I4ZA 4GA2A 1S64A 5JUAA 4J0UA 2NXPA 3B7BA 3NYJA 4GTQA 3FUHA
chains in the Genus database with same CATH topology
1ELWA 2CFUA 4RG6A 4CGVA 3EG9B 4I1MA 3IKOB 3Q7LA 4DI4A 4HVBA 4I43A 3FVYA 3T4RA 4GYTA 4UWGA 5DVWA 1LF8A 3ASFA 1D1AA 2XPIA 3ENEA 4E7ZA 1QLEC 5EGYA 1WGWA 5AENA 4GU5A 4B89A 3LYAA 2VGXB 2NUPA 2R7WA 2XCCA 3X1OA 2PQNA 1KT0A 2V5FA 4UI9C 4TV3A 4HOTA 3LAYA 3EFOA 3PUJA 2LAHA 2KGOA 4I9EA 3B7RL 4PJNA 4DVYP 3HIZA 3JQ1A 3CR3A 1ZU5A 4YT4A 2WXIA 1H0AA 3CVXA 2WZGA 3E9VA 3D9PA 4B6IA 4FU3A 4WNDA 4JZYA 4URKA 3FU5A 1O87A 2UY1A 1HF8A 5ARGA 3SNHA 4NACA 2HM8A 3Q4AB 3ABLC 2IOSA 2WXLA 2PL2A 1MMGA 3OAWA 3CHOA 5KYXB 3ML8A 4FP7A 4G11A 2XHEA 2IXNA 3LY9A 3M1CB 4X0RA 2P58C 4UQZA 4CS8A 2MYSA 1SMYF 2E87A 4CCAA 4Q4ZF 1E96B 1HG2A 4L23A 4U8HA 4U5BE 3HDXA 4BSXA 3Q6NA 5FZQA 3EPVA 2C0LA 1N1CA 4TRQA 4BTAA 3T5VA 2W4BA 3UMHA 2ZXOA 4DLQA 3R9AB 3TXNA 3Q7GA 1INZA 3B0PA 3FTSA 4WAFA 3MYVA 3CK8A 1L5JA 1OWLA 2LSEA 3I3NA 4I3MA 3FH8A 1OWPA 1E7UA 4BJ1A 2WXKA 3APCA 2AXZA 1D0ZA 4HOQA 2P6VA 3K33A 4BJ6C 3B7UX 1JWGA 4U5HA 4XLPF 3MKQB 4N2SA 2J7PA 1GW6A 2DYSC 2WXRA 1OCCC 2Y3DA 3AU5A 4UWHA 4Q94A 3RYLA 2J45A 3FEYA 3SI5A 3ZHEA 2H7OA 2BUGA 3LVQE 2YNQA 4ZLCA 2IOQA 2R7RA 3Q6MA 1U3DA 3PH0C 3G2VA 2I6HA 3RK6A 2KATA 4IAOA 3QAQA 2LNIA 3D9LA 5T1DB 1H2TC 3L16A 5E76A 4LERA 3URZA 3ZVRA 2A1DD 3FUNA 4WNEA 5C1DA 3ZGQA 3Q5MA 4DOZA 3B7TA 5KYYB 2FULA 4PUCA 4EECA 4C3EA 1Z3YA 3L34A 5FZSA 2B0JA 4G25A 1PAQA 5E3CA 4A1GA 3S7FA 3EQLF 3LXUX 4N5CA 2J0WA 4XZ4A 1HXIA 3SNXA 3EH2A 3EH1A 3AG3C 4YN0B 3MGBA 4JEUA 4O6MA 2XGMA 3RIBA 1FFHA 5G04J 4CDRA 4K0DA 2XRYA 2CHWA 2WMNA 2J7PD 3LS0A 2VTBA 3ULQA 3C98A 4U5FE 5ENNA 2CDQA 3PMRA 4BJ6A 1QQEA 4ACLA 5FTPA 5LP0A 4I1OB 2C03A 4GYOA 2WXQA 3O39A 4I6EA 5FQ8A 3FH7A 4BX8A 1MMAA 4ZLDA 3FULA 4BY6A 2WXMA 3KH2A 1IQUA 1Y6IA 3CKCA 4AJWA 2I9CA 3CVPA 2EINC 3FHDA 1HS6A 4EZLA 3ESKA 2P7VA 5KYNA 3FUIA 1N54A 3U64A 2WMOA 4YWQA 4GA0A 4PK4A 1ZU2A 4L2LA 4EBAG 4C7OB 2VB6A 2ZXPA 1VYIA 1M57C 4EZJA 2CNWA 3GYZA 2ZPAA 4RG9A 5KYWA 5BT1A 3AU4A 3LY7A 3QJZA 3T8MA 3Q15A 3NF1A 4PS7A 1FFTC 4PS8A 2WXOA 3FAJA 4XIFA 2X51A 5KYUA 2W4MA 2H7VC 4KT6B 3TXMA 3R7RA 4M3OA 5T3TA 5AYWD 3FWVA 3SD5A 2YINA 4UWKA 3EHMA 4U04A 2FI7A 4KZCA 4OINF 4CDNA 3SP1A 3ZVVA 2A69F 2KZTB 3ML9A 3PS6A 5L3QA 4GZ6A 3N71A 3FDHA 4K7BA 1E90A 2LO6A 4C9BB 4JZAA 4FADA 1ST6A 3GANA 3FUMA 4GA1A 1BR4A 2IFUA 3X2QC 2J9QA 5EX3A 5C2YA 4CSAC 3FY4A 1M2OA 2WZLA 2G3KA 4I2WA 2IXPA 4GZDA 3QWWA 2DIWA 1RJ9B 3DM9B 4Y6WA 3ZN3A 3MLGA 4J8DA 3RRNB 2I1JA 5BNWA 4F7AA 3FTVA 1UN8A 5LCWC 4HE8D 1LVKA 2X6IA 2WVQA 2HYZA 3LCAA 3UT4A 3E4BA 4A3TA 4AV7A 4BJ5A 3FTWA 5CI9A 2RD0A 3W2VA 5DS4A 3D9KA 3PNTB 4MKTA 4HXIA 4J8FA 3OTNA 3R7QA 3CVNA 4I2ZA 4UWFA 1JPNA 2WXHA 1EDUA 5J08A 5E75A 2WXGA 5HI7A 3ZYMA 4G0HA 2M4EA 2XXAA 2QFCA 3HVEB 4J8SA 4AXHA 5ARFA 1HFAA 2X38A 4O79A 3CGHA 3KKBA 3LPZA 3L54A 2CNWD 2R59A 1NU9C 2XRZA 2ZXRA 2R7SA 3ABKC 3FUFA 3GODA 4C3DA 2GRMA 1W3BA 4OIQF 2WXPA 1FMWA 5E2QA 4U0ZA 1IHGA 3CSFA 3F47A 3ASNC 2CFZA 4CS7A 3CQGB 4A3VA 3CSKA 4XWJA 4CGWA 4G7ZF 5KJMA 5T4YA 2L0TB 2CW0F 4F53A 4YJWA 2AXVA 3NG1A 4NQ0A 2X6JA 4XLNF 3EGXB 4AY6A 4WUYA 2OCCC 3DD7A 3PE4A 3SHFA 4G7OF 3RH3A 3RJVA 2J08A 4GCNA 1TWHA 5B3SC 3SEOA 3CVUA 4AEZC 1NA0A 1Y8MA 2XL4A 2WM9A 4HOSA 1JUQA 2HV6A 3DAFA 3CEQA 2V0PA 2J4BA 1DVPA 1IW7F 3S29A 3L08A 1NG1A 1RJ9A 1ZHWA 1S7ZA 4I6GA 4RSYA 2IXMA 4WWOA 3KD7A 5KJLA 4ACKA 4ULWA 5EKQD 3JYHA 5G55A 2OOEA 2O9XA 4JURI 4XI9A 1XNFA 3QARA 1OWOA 2WB2A 3IHVA 3O48A 5G04C 3OWTA 3D3MA 3B0VC 3MA5A 3ZIMA 2I2OA 3GZ2A 4KNVA 4APFA 4PJLA 3ZYQA 4ABNA 3VTXA 4CSAA 2KZTA 4H4KC 4F4BA 1ZHYA 4AOFA 3DJUB 3IV0A 4KBQA 4R7LA 2Y3HA 4C0EA 4A1SA 4OD4A 3RFYA 3K9IA 3FU0A 4IJJA 1UW4B 4FHJA 4YVQC 2NG1A 3CVVA 3KS2A 5FJYA 2WXNA 4M63A 4EPZA 4E85A 3DAGA 5KJKA 4CT4A 4CT0A 4DBQA 3P1UA 3FHEA 3FEXA 3UUXA 4CS9A 2C0MA 4EQFA 2MWQA 3Q49B 4IRUA 5KYWB 2FGYA 1OWMA 3O4ZA 4GYYA 5BV1A 5DIZA 4E7SA 4XKCA 4KBLA 5BV0A 1WAO1 4PDXA 3FUKA 5BPPA 2XEVA 2PX0A 2WVIA 5DS6A 3LVRE 4U07A 4CS8C 5BUOA 3FU6A 3AS5A 4D10C 2KC7A 3PEUB 4N3CA 4RVBA 4BFRA 2VJ8A 4KZ0A 5G2NA 3HTKC 2JD3A 4UQYA 3SBSA 1MQSA 2KCKA 2A4ZA 2VSOE 5A6CA 3CKBA 3E70C 3S27A 1UJJA 3UX4A 5D0QD 1H6KA 2PQRA 3KAEA 2J9WA 3DZAA 5EHHA 1EF1C 2L0IA 2PM6A 3L13A 5AJDA 4PFPA 2OV8A 2Y69C 3ONKA 4UQXA 2W9YA 5CMWA 3LEVA 3GZ1A 1M56C 4E6HA 3DPDA 4WJ0A 4I44A 3LLKA 5E33A 3NRHA 1Z6TA 4UI9K 3AS8A 4ATGA 2R7UA 4G26A 4Q7CA 4DVZA 4IYPA 4XX5A 5JJTA 5B1BC 3ECSA 4K03A 4WWNA 3EGXA 2Y3AA 3L17A 2R7XA 3ZG1A 4ANUA 2IJGX 3NZSA 3NZUA 3K66A 2WQHA 4N2QA 4PJMA 1SZAA 3MV2B 2R7QA 1ZHXA 2J46A 2KQ9A 3S7JA 3B13A 2J4DA 4NURA 3JUIA 3EJNA 2VSXE 3N2ZB 3JCKC 4HFKB 2XPZA 1X5BA 3ABMC 3ZFWA 3ZYLA 2C04A 2WVNA 2J0XA 1O5HA 2Y4UA 4QDLA 2ILRA 4JA7A 1ZYRF 2NSZA 4OIPF 3ZHEB 3HVEA 4FESA 4FJZA 1HO8A 2Y39A 3JYSA 3FU3A 2XXAB 1YA0A 1UG3A 2IXOA 4FULA 5FQ4A 3DXJF 4NY3A 2XGSA 5FWQA 2WVOA 4BJ5C 3AG4C 3TJPA 2WQ7A 2JLBA 2VASA 3MCXA 2WPVA 3UMKA 3WXXA 3UR3C 3D9NA 1J8YF 4EBAA 4N3BA 3SZRA 3LLIA 3SGHA 2BE5F 3G2UA 4CDMA 3TG5A 4JHRA 3U3WA 3SF4A 2R17C 4O6NA 3SZ7A 4U5CE 2YQ8A 4CBEA 4GEHA 3VAYA 4IN3B 2Q9CA 2FF4A 2Q3TA 2WZFA 3S7BA 5FQ7A 2V4LA 3CVLA 1EPUA 3L6AA 4YT2A 3D9OA 1G8XA 3TG4A 5DBKA 4JPSA 2V3CC 2KCLA 1BPOA 4AM9A 2MOWA 2I1KA 4G7HF 2Y3BA 3V7OA 1QZXA 4IWBA 4JXTA 2IQCA 4FLBA 1U3CA 3UNGC 4KXKB 4LLCA 1H2UA 3ASGA 4DPRA 4N39A 3OXFA 1PC2A 1Z5ZA 1ZHZA 5BUZA 2EIMC 4LUNU 3EDTB 3VYWA 2KNHA 2UY1B 3K1HA 4ILGA 2EQXA 3UQ3A 4Q69A 2GRLA 5G05J 2DGJA 2MRIA 1S0PA 4I6JA 4B0ZA 1PD1A 1E8ZA 3DM5A 3CHRA 4FLHA 2X3MA 4KNWA 1NU7D 3U9WA 3DMDA 3EFOB 2EIKC 2WL8A 4XE0A 3VTYA 4ANXA 3PDNA 1TWAA 4MQ9F 3TD7A 1HX8A 5KYUB 1D0XA 2NUPB 1TEZA 4A55A 5FZRA 3CZ6A 3LS8A 4FA6A 2WQ6A 1VMAA 3CHPA 3EG9A 4BJTA 3AG1C 1HG5A 1Z3IX 2A5UA 2A6EF 4V3IA 2A6HF 3CSTA 4QI2A 4U5EE 4JHKA 4GPKA 1SF8A 2WXJA 4C7OA 4CRWA 2J09A 4GZ3A 4LEUA 1N52A 1KT1A 5KJNA 1VYKA 3F46A 1PY1A 3I4RB 3UMIA 4ILIA 1TJFA 4Q96A 4BT8A 2RG8A 1UN9A 4I9CA 3PZDA 5FQ6A 3UMVA 1JPLA 4WNFA 2L81A 4B94A 3RU0A 5G05C 3GZSA 4O6YA 1V55C 2XPYA 3ZXSA 3FTXA 4ANWA 5JJ7A 4HFGA 2HV7A 2X6FA 1B89A 5KCMA 1FMVA 5T8IA 4G24A 2XQ0A 1ZHTA 3ASDA 1TWCA 4XTKA 4J8EA 2R5SA 2EIJC 4H7XA 3TL5A 2Y4TA 1MMDA 2VTBB 1JPJA 3NYLA 2UWJG 3RRMB 3S2AA 1ZU4A 4A2NB 2R7OA 1ZBPA 4PH4B 3MX3A 3BEEA 4TUUA 5FCLA 3VLEA 4F3VA 4J30B 2L9JA 3NKDA 3MJWA 2PF4E 3AG2C 3IEEA 2L9BA 2AWIA 5A7DB 4B8AA 2WB7A 3ZW3A 3SFZA 3TAXA 2OG2A 2IONA 3JCUQ 3W8HA 3UGOA 4LLEA 1IQRA 4J32B 3G2TA 5KYYA 2PFDA 4Y6CA 3FUEA 3I5QA 1SQMA 3APFA 3POVA 3LEWA 3CVWA 2KJGA 2J9VA 4HOUA 5B1AC 4LACB 3P2BA 3ZC4A 2AVPA 2Y3GA 3D9IA 3RO3A 2GW1A 4OD5A 3S7DA 4BWRA 1HH8A 3NQPA 4GCOA 1ELRA 5LOZA 3ITFA 1NP7A 2DCPA 4HFFB 1D0YA 4FX5A 1FVFA 2BF0X 3GW4A 3FDQA 3AS4A 4YT8A 4B8CB 3EIQC 3N0TA 1SZIA 4CEMA 1D1BA 1OKKA 4JW1A 3T5XA 3MKQA 4YVOA 5T3RA 2NUTB 2XGOA 2OVFA 5DS5A 5CMYA 3HLZA 3EHNA 2KW3C 3JSZA 1OCOC 2L6JA 4L7TA 1IZMA 1QZ2A 1H2VC 5M72A 4Q5SF 1UJKA 2W45A 2YHCA 1Z23A 5J90A 2V26A 1HE8A 3IBEA 4PJJA 4APOA 5ANRA 4U63A 2PP4A 4C0MA 2VSYA 4W9RA 4HORA 4DI3A 4OYSA 1E8YA 2I8BA 3JRTA 4G1TA 3CK7A 3FTUA 3CVYA 3FH5A 3OEOA 1QNFA 3LY8A 3ZYKA 1MHQA 2ZXWC 3EIJA 4RD9A 5DLJA 2KM4A 3PHF2 3QKYA 4HLEA 3MV3B 1P5QA 4P29A 4HEAJ 3LJ3A 3JQ0A 2YHEA 5KYXA 3LNRA 4ANJA 3O6XA 3NDBB 5JJ6A 3D9JA 2BTDA 3FUDA 4XI0A 1FTSA 4JC8A 4L1BA 2AXUA 3APDA 5T3WA 3L0IA 2IOLA 4UI9J 2KCVA 4FHKA 3OXGA 3LKUA 2G62A 2X6HA 4MS6A 3QMKA 4JCHA 2Q9AA 1Z6AA 2V8SE 2Q7FA 3T6JA 1NZNA 2VYIA 2VGXA 4H7YA 1XGWA 3WODF 5LCWJ 3ZRHA 3K6BA 3W2WA 4CS9C 2EILC 2FBNA 4DBRA 3S28A 3ZIBA 3IHYA 3B7SA 5FT9A 4JJFA 2QTVA 4KI2A 1DNPA 4F1SA 1BR1A 5LFAA 2GFHA 2CHXA 5D92A 1M2VB 4U5GA 4QFVA 3NYMA 4FJYA 4GMJA 5L3VA 3UPVA 4U0UA 2LSUA 4LCTA 1VK5A 3UT8A 5AJLA 3W8IA 5F5HA 5E3AA 5DQTA 3G2WA 5CHEE 2Z15A 2A68F 1WM5A 4XKBA 4P6IC 2E2EA 4QI0A 3CQZA 2PZIA 3HYMB 5EDSA 2IU1A 3ZSUA 2ZU6B 2VGYA 5HSWA 3QB2A 3QWVA 3QWPA 4W8KA 1OCZC 3QZCA 2LAIA 4PS3A 2J9UA 2MHKA 3H65A 4EBBA 1E7VA 3EZHA 2VQ2A 3BG1B 3EZIA 3I4UA 1TWGA 1TR2A 2C2LA 2HR2A 3PEVB 3WG7C 3RO2A 3UGPA 4ANVA 4PFOA 3CQCB 4DJAA 4ME2A 3DJNB 5CI8A 1NZEA 4FWVA 4CIHA 1J8MF 1E8XA 4GZCA 4KMOA 3MZLB 3FUJA 3BG0B 1TJCA 3LS1A 5JHAA 1JWFA 1LS1A 4MLPA 4N3AA 4YNDA 3FP3A 4KVOA 2CG2A 4L2YA 4C3BA 3QNKA 4JHJA 4AK9A 3IEGA 3PVLA 4GAAA 2ONDA 1EYHA 2FO7A 3N24A 1ELKA 4BT9A 3L22A 4DLOA 4AY5A 2R7VA 4I1AA 3QK0A 3ASOC 3AQCA 2H7BA 4LRZA 1KLXA 3MEKA 2CGEA 2J49A 2XSEA 3ONLA 1FVHA 5CCLA 1SZ9A 2QY7A 4AE4B 2XCBA 3EGDA 3CHQA 1PCXA 4UWLA 3I4GA 4OIRF 2X6KA 4GMLA 2IF4A 1MNDA 3CK9A 3PNLB 4EZKA 4WWPA 1MNEA 4IULA 2WXFA 5D0OD 2FEZA 4GYWA 4RBNA 1Z63A 3CV0A 4FC8A 1E8WA 2CHZA 5AIJA 5LX8A 1W2WA 3RRUA 2CG3A 1MMNA 3K1IC 4AP2A 3CVQA 4OIOF 4NRHB 4BX9A 3U4TA 3JT1A 4MRUA 3SBTB 4I17A 4KYOB 5ANLA 3ZPJA 4G23A 3FFLA 3LJBA 4DK5A 3CHSA 2NUTA 1FCHA 3K7DA 4BEJA 3OXLA 4JL0A 3VLDA 3EGDB 3G2SA 2R7TA 4AE4A 3PE3A 2VSNA 1D1CA 1OWNA 1A17A 1HU3A 4JVSA 4OVUA 4AIFA 4G2VA 2E0IA 3SYNA 3FTZA 3OA1A 4AVXA 3DBSA 1OUVA 4JEHA 2QY9A 4GB9A 4YT5A 1TKNA 4JJGA 2YHSA 5DQZA 4BTBA 4K0RA 2YEVA 1VDYA 3RKOF 3HHMA 3PREA 2JEKA 2IYLD 4BG0A 3D9MA 3QOUA 5F5FA 2VH3A 4EWCA 3S0XA 2HO1A 3QDNA 4ILHB 2XRHA 3ASHA 4N06A 3RIPA 1NA3A 1WY6A 2D5RB 1PD0A 3KMIA 1Z3XA 2Q9BA 1BR2A 4MNDA 4O6FA 3T6BA 4RDAA 3ESLA 3Q47B 3ZEFA 2OVBA 3UT7A 3FTYA 3CIAA 3CHMA 3VLFA 1OCRC 3KEZA 4HS2A 5JHBA 2YZSA 4O7GA 1V54C 3MKRA 4OVVA 5EX0A 4KVMA 1OKKD 2PM7A 3NKEA 4U0SA 2AW6A 3PRZA 4AX2A 3B0UX 2NC9A 1KU2A 2LSVA 4KC9A 2FFHA 1H19A 1HZ4A 3LDZA 1IYGA 5D91A 4WNGA 2GGFA 2DYRC 3I5PA 4U5DE 3QC1A 5CCMA 3CLJA 4GZ5A 3PUKA 3RKVA 3TGOA 3HJCA 2PX3A 2G3VA 3LESA 2M63A 3U66A 2DBAA 1VOMA 5IY5C 2J07A 5A23A 5BW8C 3B9QA 3KL4A 4JA9A 3AQBA 1LKXA 1M2VA 4J6IA 5HQ8A 4GA2A 4J0UA 2NXPA 3NYJA 3FUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1O B;  4JVS A;  4JW1 A;  4IRU A;  4I1M A; 
#chains in the Genus database with same CATH topology
 1ELW A;  2CFU A;  3BRJ A;  4RG6 A;  4YDO A;  4CGV A;  3EG9 B;  1AVO B;  4I1M A;  3IKO B;  3Q7L A;  3MYF A;  4DI4 A;  4I43 A;  4HVB A;  3FVY A;  3T4R A;  1V54 E;  4GYT A;  4UWG A;  5DVW A;  1LF8 A;  3ASF A;  1D1A A;  2XPI A;  3ENE A;  4E7Z A;  1QLE C;  5EGY A;  1WGW A;  5AEN A;  4GU5 A;  4B89 A;  3LYA A;  2VGX B;  2NUP A;  2XLH A;  2Y0B G;  2R7W A;  2XCC A;  3C63 A;  4YL0 A;  2ETA A;  3X1O A;  2PQN A;  1KT0 A;  2V5F A;  4UI9 C;  4TV3 A;  4HOT A;  3LAY A;  3EFO A;  3PUJ A;  2LAH A;  2KGO A;  4I9E A;  3B7R L;  4PJN A;  4DVY P;  4YK5 A;  3HIZ A;  1N4P A;  3JQ1 A;  4MVU A;  3CR3 A;  1ZU5 A;  4YT4 A;  4JEA A;  2WXI A;  4MVQ A;  1E84 A;  1H0A A;  3CVX A;  3ASO E;  2WZG A;  3E9V A;  2XEH A;  3UIP C;  5JT4 A;  2PBE A;  4B6I A;  3D9P A;  1H9T A;  4FU3 A;  4WND A;  4JZY A;  1Q2Z A;  4URK A;  3FU5 A;  1O87 A;  2UY1 A;  4GTP A;  4JTC B;  2VC9 A;  1HF8 A;  5FIN A;  5ARG A;  3U9J A;  3SNH A;  1ZVZ A;  4NAC A;  2HM8 A;  3Q4A B;  3ABL C;  4XEV A;  2IOS A;  2WXL A;  2PL2 A;  1MMG A;  1NFO A;  2DWZ A;  3DXM G;  3OAW A;  5CEC B;  3CHO A;  3AAA C;  5KYX B;  3EUV A;  3ML8 A;  4FP7 A;  2GRP B;  4G11 A;  2XHE A;  2QUP A;  2H6G A;  2IXN A;  1NSG B;  4G78 A;  5EIB E;  4NTB A;  4TXQ A;  5CRV A;  3LY9 A;  3M1C B;  4X0R A;  1JMW A;  2P58 C;  2LIG A;  1H7I A;  4UQZ A;  4CS8 A;  2MYS A;  1SMY F;  2HZ8 A;  1ORJ A;  3U8V A;  2E87 A;  4CCA A;  4Q4Z F;  1E96 B;  1HG2 A;  3C18 A;  4L23 A;  4U8H A;  4DX7 D;  4U5B E;  2EPL X;  3H2U A;  3Q6N A;  3RF3 A;  3HDX A;  4BSX A;  5FZQ A;  3EPV A;  3B29 A;  1N1C A;  2C0L A;  4TRQ A;  4BTA A;  3T5V A;  2W4B A;  3UMH A;  2ZXO A;  4DLQ A;  5L0C A;  3R9A B;  3PZ3 A;  1E83 A;  4BET A;  3TXN A;  3Q78 A;  3Q7G A;  1INZ A;  3B0P A;  1GM5 A;  3FTS A;  4WAF A;  3MYV A;  3A9C A;  3DSS A;  3CK8 A;  4DXW A;  2GWW A;  1L5J A;  1OWL A;  2LSE A;  2Y69 E;  1LI5 A;  3I3N A;  4I3M A;  5D2M C;  3FH8 A;  1OWP A;  1E7U A;  4BJ1 A;  2WXK A;  3APC A;  2AXZ A;  1D0Z A;  4HOQ A;  4U96 D;  2P6V A;  3K33 A;  4N6H A;  4P9T A;  4BJ6 C;  3B7U X;  1JWG A;  2NPU A;  1NI1 A;  256B A;  4U5H A;  4XLP F;  3MKQ B;  4N2S A;  2J7P A;  1GW6 A;  4NIK A;  5TJ5 E;  2DYS C;  2WXR A;  1T9K A;  1OCC C;  3QVZ A;  2Y3D A;  3TWV A;  3AU5 A;  4UWH A;  1HE1 A;  4RLY A;  4Q94 A;  1TFK B;  3RYL A;  2J45 A;  3FEY A;  3SI5 A;  3ZHE A;  1DCE A;  2H7O A;  3J06 A;  2VGE A;  2BUG A;  3SFY A;  3X2Q E;  3LVQ E;  1AUE A;  2YNQ A;  3C3O A;  1EKY A;  3TK0 A;  2IOQ A;  4ZLC A;  2R7R A;  3RVZ A;  3Q6M A;  1U3D A;  2DI3 A;  2OEV A;  2P2C P;  3PH0 C;  3W9G A;  1YDI A;  5AQB A;  4A63 B;  3G2V A;  2LXL A;  2I6H A;  3RK6 A;  2KAT A;  4IAO A;  3E37 A;  3QAQ A;  2LNI A;  3D9L A;  5T1D B;  3Q73 A;  1H2T C;  5HV9 A;  2YWA A;  3BU8 A;  3L16 A;  5E76 A;  4LER A;  3SY2 A;  3URZ A;  3ZVR A;  2LFD A;  2A1D D;  1H6P A;  3FUN A;  1RXQ A;  4DRH B;  1IHB A;  4WNE A;  2QC9 A;  1Q0K A;  1F1M A;  3JUE A;  3Q5M A;  3ZGQ A;  5C1D A;  4DOZ A;  1YYJ A;  1CGN A;  3AG2 E;  3B7T A;  5KYY B;  2FUL A;  4PUC A;  4EEC A;  4C3E A;  1Z3Y A;  3L34 A;  5FZS A;  4LNB A;  2B0J A;  4G25 A;  1PAQ A;  5E3C A;  3UKU G;  3S7F A;  4A1G A;  1VLT A;  3EQL F;  3LXU X;  4N5C A;  3TWR A;  3UXG A;  3RQF A;  3U3F A;  2J0W A;  4HLL A;  4J7Y A;  4XZ4 A;  1HXI A;  1JR8 A;  3C8G B;  3SNX A;  4GMR A;  2V4H C;  3EH2 A;  3EH1 A;  1RCP A;  3SXK A;  1Q0D A;  3AG3 C;  4YN0 B;  2KBX A;  1NFN A;  3MGB A;  5AC4 A;  1HMD A;  1TNY A;  4JEU A;  4O6M A;  2XGM A;  3RIB A;  1FFH A;  5G04 J;  1K1A A;  3GEE A;  4CDR A;  4K0D A;  2OCC E;  1S63 A;  3V30 A;  2XRY A;  1FT1 A;  2CHW A;  2WMN A;  2J7P D;  3LS0 A;  2VTB A;  3ULQ A;  3C98 A;  4U5F E;  5ENN A;  2CDQ A;  1G5Z A;  3PMR A;  4BJ6 A;  1QQE A;  4ACL A;  5A6B D;  5FTP A;  5LP0 A;  4I1O B;  3HNL A;  3WAQ A;  2C03 A;  1RKE B;  3RVY A;  4GYO A;  2WXQ A;  3O39 A;  2AVK A;  2F8Y A;  4PR9 A;  4I6E A;  5FQ8 A;  3FH7 A;  2P9K G;  2D4U A;  3MYI A;  1A7D A;  4BX8 A;  3LUT B;  1BLX B;  1QQ3 A;  1MMA A;  3HXC A;  1OCC E;  1L7C A;  4GTT A;  4ZLD A;  1OCZ E;  1YJG A;  3FUL A;  4BY6 A;  2WXM A;  1ZW2 A;  3KH2 A;  1IQU A;  1KZO A;  1WWP A;  1Y6I A;  3CKC A;  5AAR A;  5JMN D;  4AJW A;  4LNU D;  2I9C A;  3CVP A;  3NMK A;  2EIN C;  3FHD A;  1HS6 A;  4EZL A;  1XWJ A;  3ESK A;  3ZTM A;  4HRM B;  1QVX A;  2P7V A;  1V4A A;  5KYN A;  3FUI A;  1N54 A;  3U64 A;  4JTA B;  2WMO A;  4YWQ A;  4GA0 A;  4PK4 A;  2P9N G;  3J5P A;  1ZU2 A;  3DWL G;  4L2L A;  4EBA G;  2LFF A;  2EPK X;  3JXJ A;  4C7O B;  2OJQ A;  2VB6 A;  2ZXP A;  1VYI A;  1O3U A;  1M57 C;  4EZJ A;  2CNW A;  3GYZ A;  3B71 A;  2RSE B;  2HJ3 A;  2ZPA A;  3ZTZ A;  4ZHB A;  1HMO A;  4RG9 A;  5KYW A;  5BT1 A;  5EN5 D;  3AU4 A;  1VB5 A;  4AL0 A;  3LY7 A;  3QJZ A;  4MTO A;  3L1M A;  3T8M A;  1N4R A;  3Q15 A;  3NF1 A;  3WG7 E;  4PS7 A;  3GWL A;  1FFT C;  4PS8 A;  1LE2 A;  2WXO A;  1Y6D A;  3FAJ A;  3DI5 A;  4XIF A;  2X51 A;  5KYU A;  2W4M A;  2H7V C;  3RW0 A;  4KT6 B;  3TXM A;  1CGM E;  2F22 A;  3R7R A;  4M3O A;  3V5Z A;  5T3T A;  5AYW D;  1YZA A;  3FWV A;  5BQH A;  3U0C A;  1UFB A;  3SD5 A;  1IXV A;  2YIN A;  4UWK A;  3DST A;  3EHM A;  2VCC A;  1U89 A;  4JE9 A;  4U04 A;  2FI7 A;  4KZC A;  4OIN F;  1YAR O;  4CDN A;  3SP1 A;  4E0I A;  3ZVV A;  2A69 F;  1NLX A;  2KZT B;  3ML9 A;  1AEP A;  1NFI E;  3PS6 A;  3E34 A;  3DWW A;  5L3Q A;  1XZQ A;  3V31 A;  4GZ6 A;  3N71 A;  3AGU A;  3FDH A;  4K7B A;  1E90 A;  2LO6 A;  1BI8 B;  2R2L A;  2X0C A;  1ZB1 A;  4C9B B;  3DSU A;  4JZA A;  4FAD A;  3PDM P;  5JRA A;  1ST6 A;  2YLD A;  3GAN A;  1JOG A;  4BEM J;  2XZD G;  3FUM A;  4GA1 A;  2HSB A;  1BR4 A;  2IFU A;  3X2Q C;  2QNL A;  2J9Q A;  3DPY A;  3HRA A;  5EX3 A;  5C2Y A;  4CSA C;  4JTD B;  3FY4 A;  1M2O A;  2WZL A;  2G3K A;  4I2W A;  2IXP A;  4GZD A;  3QWW A;  2DIW A;  1RJ9 B;  2OEX A;  3JZ0 A;  4U95 D;  3DM9 B;  4Y6W A;  3ZN3 A;  3MLG A;  4J8D A;  3RRN B;  1T6Q A;  2I1J A;  5BNW A;  4DRX E;  4F7A A;  3FTV A;  5GPG B;  4EUK B;  1UN8 A;  5LCW C;  4HE8 D;  1LVK A;  1YYX A;  2X6I A;  2WVQ A;  2HYZ A;  3LCA A;  2J9B A;  1MX2 A;  3UT4 A;  2YKZ A;  3ZKJ A;  5EIL A;  1A41 A;  3IHU A;  3E4B A;  4JB8 P;  4A3T A;  3NBN B;  1A0B A;  4AV7 A;  4BJ5 A;  1S05 A;  2B6C A;  3FTW A;  4LNG A;  5CI9 A;  2RD0 A;  3W2V A;  5DS4 A;  3BEH A;  3D9K A;  3PNT B;  4MKT A;  4HXI A;  2IO2 C;  3E30 A;  4E17 A;  1CPQ A;  4J8F A;  2YL7 A;  3OTN A;  5L0F A;  3R7Q A;  3AOU A;  3IQT A;  3CVN A;  1M6T A;  1NBB A;  4I2Z A;  4UWF A;  1JPN A;  2WXH A;  1EDU A;  5J08 A;  5E75 A;  2WXG A;  5CEA A;  5HI7 A;  3T9O A;  2H6H A;  4YDY A;  3ZYM A;  4G0H A;  3O55 A;  2M4E A;  3NB2 A;  2XXA A;  2QFC A;  3HVE B;  4J8S A;  4AXH A;  5ARF A;  2FO1 E;  1HFA A;  2X38 A;  1OW6 A;  4O79 A;  3CGH A;  3KKB A;  3LPZ A;  3L54 A;  2NSF A;  1KTM A;  2CNW D;  2R59 A;  1NU9 C;  2XRZ A;  2ZXR A;  2R7S A;  3ABK C;  5EID A;  2HE0 A;  3GOD A;  3FUF A;  3IQC A;  4C3D A;  2GRM A;  1W3B A;  4OIQ F;  2WXP A;  4GTS A;  2P1A A;  1FMW A;  2DYS E;  5E2Q A;  3G50 A;  4MVM A;  5B1A E;  4U0Z A;  3U2M A;  1IHG A;  1RMV A;  3CSF A;  3F47 A;  3ASN C;  2CFZ A;  4CS7 A;  1YMP A;  4ONS A;  3CQG B;  4A3V A;  3TQO A;  2RFM A;  3CSK A;  4XWJ A;  1TNB A;  4CYM D;  4CGW A;  4G7Z F;  5KJM A;  5T4Y A;  2L0T B;  2CW0 F;  4F53 A;  4XPW A;  4YJW A;  2AXV A;  5KNH D;  3IPM O;  3NG1 A;  4NQ0 A;  2X6J A;  4XLN F;  1LTX A;  3EGX B;  4C48 B;  3ABM E;  4HI8 A;  4AY6 A;  4WUY A;  5CBO A;  2OCC C;  2HUJ A;  4A4A A;  3DD7 A;  2ICW G;  3PE4 A;  3SHF A;  4G7O F;  3HG0 D;  5B3I A;  3RH3 A;  3RJV A;  2J08 A;  2YLI A;  4GCN A;  1TWH A;  5B3S C;  3SEO A;  3CVU A;  4AEZ C;  1NA0 A;  1QSP A;  1Y8M A;  2XL4 A;  4IB4 A;  2WM9 A;  4HOS A;  1JUQ A;  2P9S G;  4CX9 A;  2HV6 A;  3DAF A;  3CEQ A;  3UM0 A;  2V0P A;  4WGZ A;  3PCV A;  2KYH A;  2J4B A;  4CJG A;  3E33 A;  4DX2 A;  1DVP A;  3SO8 A;  1MX6 A;  3D9H A;  3U5S A;  4DX1 A;  2EIJ E;  1IW7 F;  3S29 A;  3L08 A;  1NG1 A;  1RJ9 A;  1HW2 A;  2RFA A;  1ZHW A;  1S7Z A;  4I6G A;  4RSY A;  2IXM A;  4WWO A;  3KD7 A;  5KJL A;  3ZXP A;  4HBD A;  3V79 K;  4ACK A;  1DC2 A;  4ULW A;  1LD7 A;  2H6I A;  5EKQ D;  3JYH A;  5G55 A;  2OOE A;  2O9X A;  4AL1 A;  4JUR I;  4XI9 A;  4EIY A;  3JTL O;  1XNF A;  3DRA A;  1OWO A;  3QAR A;  2WB2 A;  3IHV A;  3O48 A;  5G04 C;  3OWT A;  1OR3 A;  4D4N A;  1U2V G;  3B0V C;  1WG0 A;  3D3M A;  3MA5 A;  3ZIM A;  2I2O A;  3GZ2 A;  3C72 A;  4KNV A;  3HNK A;  4APF A;  5JSL A;  1MQV A;  4PJL A;  1TN8 A;  3ZYQ A;  1D8E A;  4ABN A;  3VTX A;  4CSA A;  2KZT A;  4H4K C;  4F4B A;  1ZHY A;  4AOF A;  3UKR G;  3DJU B;  5A6K A;  3IV0 A;  4K1O A;  4KBQ A;  4R7L A;  2Y3H A;  4C0E A;  3L8I A;  4A1S A;  2MHR A;  4K5C A;  4OD4 A;  3RFY A;  5EYL A;  3T9K A;  2JPU A;  5A6J A;  5ENS D;  3K9I A;  3FU0 A;  2P9L G;  1Q0G A;  1YAU O;  4IJJ A;  1UW4 B;  2NG1 A;  4FHJ A;  4YVQ C;  3CVV A;  4JKV A;  3KS2 A;  5FJY A;  2WXN A;  4M63 A;  2XLM A;  4EPZ A;  4E85 A;  4BES A;  4L6R A;  3CAX A;  3DAG A;  5KJK A;  4CT4 A;  4CT0 A;  3TWQ A;  3MBG A;  4DBQ A;  3P1U A;  2HMQ A;  3FHE A;  4CS9 A;  3FEX A;  4JIO A;  3UUX A;  2C0M A;  2IM8 A;  2EIN E;  4EQF A;  3C8Z A;  2MWQ A;  3Q49 B;  4IRU A;  5KYW B;  2FGY A;  1OWM A;  3O4Z A;  4GYY A;  5KNG A;  5BV1 A;  5DIZ A;  1BBH A;  4E7S A;  1UG7 A;  4J7T A;  4RQI A;  4XKC A;  4KBL A;  4XEF A;  5BV0 A;  1WAO 1;  2DVW A;  4PDX A;  3FUK A;  5BPP A;  2HFI A;  3C3R A;  2XEV A;  2PX0 A;  3TOL A;  4MVS A;  2WVI A;  5DS6 A;  5IY5 E;  3LVR E;  4U07 A;  2BED A;  1FPP A;  4CS8 C;  5BUO A;  3FU6 A;  5CRU A;  2B0H A;  3AS5 A;  2DB4 A;  1JAF A;  4D10 C;  2KC7 A;  3PEU B;  3Q79 A;  1VLS A;  5B1B E;  4N3C A;  4RVB A;  4BFR A;  1I4Y A;  2VJ8 A;  4KZ0 A;  5G2N A;  3HTK C;  2JD3 A;  4UQY A;  3SBS A;  1MQS A;  3QW1 A;  2KCK A;  2AP3 A;  2A4Z A;  3V2X A;  4IGG A;  4JCZ A;  3TJ6 A;  2VSO E;  5A6C A;  3CKB A;  3E70 C;  3TUL A;  3S27 A;  1UJJ A;  4ZFH A;  3UX4 A;  1Z7Q c;  5D0Q D;  4YL3 A;  1H6K A;  2PQR A;  4R32 A;  3KAE A;  2J9W A;  3DZA A;  2EIL E;  3NAW A;  4MVZ A;  1WOL A;  5EHH A;  1EF1 C;  4MVR A;  1QBQ A;  2L0I A;  2PM6 A;  4J8Y A;  3L13 A;  5AJD A;  4PFP A;  1OR2 A;  2OV8 A;  2Y69 C;  3ONK A;  1GQA A;  4B93 B;  4UQX A;  2W9Y A;  5CMW A;  2Q00 A;  1M56 C;  3LEV A;  3GZ1 A;  2B0O E;  1PV3 A;  4E6H A;  3PZ2 A;  3DPD A;  1SA5 A;  3V2O A;  4WJ0 A;  3UM3 A;  2KC3 A;  3LLK A;  4I44 A;  4NCQ A;  5E33 A;  1LD8 A;  3NRH A;  2XEN A;  3C5R A;  1ZW3 A;  1Z6T A;  1YA7 O;  2JX0 A;  2YL1 A;  4UI9 K;  3AS8 A;  4ATG A;  2R7U A;  3C8G A;  4G26 A;  2QLA A;  4Q7C A;  4DVZ A;  4IYP A;  4XX5 A;  2OKU A;  3QW0 A;  2P0N A;  2L6F A;  5EYP F;  5JJT A;  3M4C A;  2MYO A;  5B1B C;  4DJ9 A;  3DEP A;  3ECS A;  4K03 A;  4WWN A;  3EGX A;  2Y3A A;  4XPY A;  1N0R A;  3W9F A;  4MW8 A;  5F28 E;  3E32 A;  3L17 A;  2R7X A;  3ZG1 A;  4GTO A;  4ANU A;  2YRF A;  2ZIR A;  2I15 A;  4EBK A;  1O1T A;  3ULY A;  2IJG X;  3O10 A;  3NZS A;  3NZU A;  4MS2 A;  3K66 A;  2UUI A;  1LS4 A;  2WQH A;  4N2Q A;  2IY0 C;  4PJM A;  5FIO A;  3AJM A;  4NQF A;  3AG4 E;  1SZA A;  3MV2 B;  2R7Q A;  3DKA A;  1N9A A;  1ZHX A;  2J46 A;  2KQ9 A;  1N0Q A;  3S7J A;  3B13 A;  5A6A A;  1HE9 A;  1BD8 A;  2J4D A;  4NUR A;  3JUI A;  1DOV A;  3EJN A;  2VSX E;  3N2Z B;  3JCK C;  4HFK B;  2XPZ A;  1X5B A;  3ABM C;  3ZFW A;  3ZYL A;  2C04 A;  1H6O A;  2WVN A;  2J0X A;  1O5H A;  1O5M A;  2EIM E;  3BUA A;  2Y4U A;  4QDL A;  3ULE G;  1WAT A;  2ILR A;  4JA7 A;  2P61 A;  1ZYR F;  2XLD A;  1G4U S;  3EHR A;  2NSZ A;  4OIP F;  3ZHE B;  3HVE A;  2OJE D;  4FES A;  4FJZ A;  1HO8 A;  2Y39 A;  1T01 A;  3JYS A;  3FU3 A;  2XXA B;  1YA0 A;  1UG3 A;  2HS5 A;  2IXO A;  3DXK G;  4FUL A;  5FQ4 A;  1B68 A;  3DXJ F;  4NY3 A;  2XGS A;  5FWQ A;  2WVO A;  1Z5S C;  3U2L A;  4BJ5 C;  5BXU A;  4DX6 D;  3AG4 C;  3TJP A;  2WQ7 A;  2JLB A;  2VAS A;  3MCX A;  2WPV A;  3L8J A;  3UMK A;  3UR3 C;  3WXX A;  3D9N A;  4K5B A;  1J8Y F;  1VTM P;  4EBA A;  4N3B A;  3V5X A;  3SZR A;  3US6 A;  3LLI A;  3SGH A;  2BE5 F;  3G2U A;  4CDM A;  3TG5 A;  2GA0 A;  4JHR A;  2XLO A;  3U3W A;  2F37 A;  2EPO A;  1TYQ G;  2OEW A;  3SF4 A;  2R17 C;  4O6N A;  3SZ7 A;  4U5C E;  3FMS A;  2YQ8 A;  4CBE A;  4GEH A;  1Q0F A;  3VAY A;  1YYH A;  2KSF A;  1OW7 A;  4IN3 B;  2Q9C A;  2FF4 A;  2V5Q C;  2Q3T A;  1I5N A;  2WZF A;  3S7B A;  2OQM A;  2AWY A;  4O1P A;  5FQ7 A;  2V4L A;  3TWU A;  3CVL A;  1EPU A;  4E0H A;  3R2P A;  3L6A A;  3VM6 A;  4YT2 A;  3D9O A;  1G8X A;  3TG4 A;  5DBK A;  4JPS A;  2V3C C;  2KCL A;  2TMV P;  2RKK A;  1BPO A;  4AM9 A;  2MOW A;  2I1K A;  4G7H F;  3V5Y A;  2Y3B A;  2QYJ A;  3V7O A;  4CDY A;  1QZX A;  4IWB A;  4JXT A;  1Q0M A;  2IQC A;  2HJM A;  1U0B B;  4FLB A;  1LIH A;  1U3C A;  4JD2 G;  3UNG C;  1OY3 D;  4HI9 A;  4KXK B;  3G4Z A;  4LLC A;  2IEJ A;  2R05 A;  2ZGG A;  1H2U A;  3ASG A;  4DPR A;  1X81 A;  3DE8 A;  4N39 A;  3OXF A;  4O60 A;  1PC2 A;  1Z5Z A;  1ZHZ A;  2A0B A;  4UDV A;  1O1R A;  5BUZ A;  2EIM C;  2P9I G;  2L7A A;  2HMZ A;  4LUN U;  1BZ4 A;  3EDT B;  3VYW A;  1LE4 A;  2KNH A;  2UY1 B;  3R7C A;  3K1H A;  4ILG A;  2EQX A;  2L6G A;  3UQ3 A;  4Q69 A;  4UUC A;  2GRL A;  5G05 J;  5HKP A;  2DGJ A;  2MRI A;  1S0P A;  2ZXW E;  1LI7 A;  3M4B A;  4I6J A;  4B0Z A;  4U9E A;  1PD1 A;  2GAQ A;  1E8Z A;  3DM5 A;  3CHR A;  4FLH A;  3IQ6 A;  2L6H A;  3HKK A;  2X3M A;  4KNW A;  2XZT G;  3NOC D;  5KBA A;  1NU7 D;  2YQY A;  3U9W A;  2ZIS A;  3DMD A;  3EFO B;  2EIK C;  2WL8 A;  5FZT A;  3KSL A;  1L3P A;  2QE9 A;  4XE0 A;  3VTY A;  4ANX A;  3PDN A;  1TWA A;  3TWS A;  4MQ9 F;  4NTF A;  3TD7 A;  2ETC A;  1HX8 A;  2DZN A;  5KYU B;  1D0X A;  2NUP B;  5AQ9 A;  1TEZ A;  1QYM A;  4A55 A;  5FZR A;  3CZ6 A;  2BKG A;  3LS8 A;  3F6Q A;  4FA6 A;  3SXM A;  1MJ0 A;  3HXE A;  1ZZP A;  3ABK E;  4LDR A;  2WQ6 A;  1VMA A;  3CHP A;  2LK4 A;  3EG9 A;  4DRJ B;  3TWT A;  4BJT A;  3AG1 C;  1OXK A;  1HG5 A;  1Z3I X;  2A5U A;  2A6E F;  3ASN E;  4V3I A;  3FOP A;  2A6H F;  1O1S A;  3CST A;  4QI2 A;  3UIN C;  4U5E E;  3GEI A;  5ITZ F;  4N6C A;  4JHK A;  5JA4 D;  4GPK A;  1SF8 A;  1JCS A;  2WXJ A;  4C7O A;  4LG6 A;  5AQ7 A;  1G4W R;  4CRW A;  3LJN A;  3KEA A;  2J09 A;  1C17 M;  4GZ3 A;  4LEU A;  1N52 A;  1KT1 A;  5KJN A;  1VYK A;  3HNI A;  3F46 A;  2A5E A;  1PY1 A;  3I4R B;  3UMI A;  4TXP A;  2XM0 A;  3U9M A;  4XEK A;  4ILI A;  1TJF A;  4Q96 A;  4BT8 A;  1QPU A;  5ENO D;  3VRC A;  2RG8 A;  1UN9 A;  4I9C A;  1FAP B;  3PZD A;  2EPN A;  3QTH A;  5FQ6 A;  4LSZ E;  3UMV A;  1JPL A;  5BQG A;  4WNF A;  2L81 A;  4B94 A;  3RU0 A;  2BL2 A;  1V74 B;  3GZS A;  5G05 C;  3UM2 A;  2IBF A;  4O6Y A;  1V55 C;  2XPY A;  3ZXS A;  3FTX A;  4ANW A;  5JJ7 A;  1A7V A;  4HFG A;  2HV7 A;  2X6F A;  1RKE A;  1B89 A;  3VF0 A;  1FMV A;  5KCM A;  4G24 A;  5T8I A;  2XQ0 A;  1ZHT A;  3ASD A;  1TWC A;  1ORY A;  4XTK A;  4J8E A;  2R5S A;  2EIJ C;  4H7X A;  3TL5 A;  2Y4T A;  4TXR A;  3AG3 E;  1MMD A;  2VTB B;  1JPJ A;  3NYL A;  2UWJ G;  2XL6 A;  3TJ5 A;  3RRM B;  3S2A A;  1ZU4 A;  4A2N B;  2R7O A;  1BDJ B;  1ZBP A;  4PH4 B;  3B95 A;  3MX3 A;  3BEE A;  4TUU A;  2PNN A;  4GPM A;  5ENR D;  4EHP A;  5FCL A;  3VLE A;  4HQD A;  4U7E B;  2DYR E;  4F3V A;  4J30 B;  2L9J A;  4QQI A;  3NKD A;  3UI2 A;  3MJW A;  2PF4 E;  3AG2 C;  5B3S E;  3IEE A;  3DSV A;  2L9B A;  2ASR A;  2AWI A;  5A7D B;  2WB7 A;  4B8A A;  3GM2 A;  3ZW3 A;  4FAP B;  3GOR A;  3SFZ A;  3TAX A;  2OG2 A;  1CGO A;  4N5Q A;  2ION A;  3S84 A;  3JCU Q;  3W8H A;  1R4T A;  2LQG A;  4W8P A;  3UGO A;  1R5I D;  4LLE A;  1IQR A;  4J32 B;  3G2T A;  5KYY A;  1YA9 A;  2PFD A;  4Y6C A;  3FUE A;  4M7C A;  2QYU A;  1BI7 B;  1S70 B;  4G8K A;  3I5Q A;  1SQM A;  3APF A;  1OCO E;  5JVE A;  3POV A;  3LEW A;  1TNU A;  4BEP A;  4WGY A;  2HSQ A;  2LP4 A;  3CVW A;  2KJG A;  2J9V A;  1N95 A;  3S9O A;  4HOU A;  5B1A C;  2PNO A;  4LAC B;  3P2B A;  3ZC4 A;  2AVP A;  2Y3G A;  3D9I A;  3RO3 A;  2XLE A;  1D8D A;  2GW1 A;  4OD5 A;  3ZDL A;  1DCQ A;  3TOM A;  3S7D A;  4BWR A;  3GEH A;  2R03 A;  5L0J A;  1HH8 A;  3NQP A;  4GCO A;  1ELR A;  3FAP B;  5LOZ A;  1NP7 A;  3ITF A;  2DCP A;  4HFF B;  4H54 A;  1D0Y A;  4FX5 A;  2ZGD A;  1FVF A;  2BF0 X;  3GW4 A;  3FDQ A;  3AS4 A;  4YT8 A;  4B8C B;  3ZNG A;  3EIQ C;  3N0T A;  3NMI A;  1SZI A;  1WTY A;  2OOC A;  4CEM A;  1D1B A;  1T5O A;  1OKK A;  1MZC A;  1LPE A;  2L6B A;  4JW1 A;  3T5X A;  2QZA A;  3PZ1 A;  3MKQ A;  4YVO A;  5T3R A;  2NUT B;  4GTR A;  2XGO A;  4PAC A;  2OVF A;  5DS5 A;  5CMY A;  3HLZ A;  3EHN A;  2EIK E;  4J7W A;  2AU5 A;  2KW3 C;  3JSZ A;  4O1O A;  4HRN A;  1OCO C;  2L6J A;  4L7T A;  3GM3 A;  1IZM A;  1QZ2 A;  1H2V C;  1TNO A;  5M72 A;  4Q5S F;  1UJK A;  2W45 A;  2YHC A;  1Z23 A;  2FAP B;  5J90 A;  2V26 A;  3GWN A;  1YCS B;  4HRL A;  4GQH A;  1HE8 A;  3ZUV B;  3IBE A;  4PJJ A;  4APO A;  4NTA A;  5ANR A;  2Q4F A;  4ATZ D;  4U63 A;  4Z68 A;  1MX4 A;  2PP4 A;  4C0M A;  4Z9I A;  2BKK B;  2VSY A;  4W9R A;  4HOR A;  1U6H A;  4DI3 A;  4OYS A;  1E8Y A;  2I8B A;  3JRT A;  4G1T A;  3ATP A;  1RW2 A;  3CK7 A;  3FTU A;  1K8K G;  3CVY A;  2F0Y A;  3WHN A;  3FH5 A;  2CCY A;  3OEO A;  3Q75 A;  1QNF A;  3LY8 A;  3ZYK A;  1MHQ A;  2ZXW C;  3R9M A;  1EQ1 A;  3UTM A;  3EIJ A;  1SVX A;  2GRO B;  4RD9 A;  5DLJ A;  1JRA A;  3ZU7 B;  2KM4 A;  3PHF 2;  3K1I A;  3G4X A;  3QKY A;  4HLE A;  3MV3 B;  4CDA A;  1P5Q A;  4HEA J;  4P29 A;  3NOG D;  3LJ3 A;  3JQ0 A;  2YHE A;  5KYX A;  4F6R D;  3M79 A;  3LNR A;  5A6B A;  4ANJ A;  3U8P A;  3O6X A;  3NDB B;  1H6G A;  5JJ6 A;  3D9J A;  2BTD A;  3FUD A;  4XI0 A;  2GRR B;  1H9G A;  2Y1L E;  3Q7A A;  1FTS A;  4JC8 A;  1TN7 A;  2HKV A;  4L1B A;  2AXU A;  3APD A;  1N11 A;  3NMJ A;  5T3W A;  2AWC A;  3L0I A;  2IOL A;  4UI9 J;  2ETS A;  1TR4 A;  2KCV A;  3DSW A;  4CIP A;  4FHK A;  4JC7 A;  3OXG A;  1EI7 A;  3LKU A;  4MTF A;  3RSE G;  2G62 A;  2X6H A;  4MS6 A;  3QMK A;  4Z9H A;  4JCH A;  4U8V D;  1YZC A;  2Q9A A;  1Z6A A;  2V8S E;  2Q7F A;  2LXM A;  5H7P A;  3C3Q A;  3T6J A;  1NZN A;  2VYI A;  3ZQV A;  2VGX A;  4H7Y A;  2LD6 A;  1XGW A;  3HXD A;  3WOD F;  3L82 A;  5LCW J;  3ZRH A;  3AG1 E;  3K6B A;  3W2W A;  4CS9 C;  2EIL C;  2FBN A;  4DBR A;  3S28 A;  2R9R B;  2M64 A;  3ZIB A;  3IHY A;  3GM1 A;  4E18 A;  3B7S A;  3HNJ A;  2H8A A;  5FT9 A;  4JJF A;  1EA8 A;  1KPS B;  3KPH A;  2QTV A;  4KI2 A;  1DNP A;  4F1S A;  1BR1 A;  5LFA A;  1N4S A;  2GFH A;  3JXI A;  2CHX A;  5D92 A;  1M2V B;  4U5G A;  4QFV A;  3NYM A;  4MW3 A;  4FJY A;  3IQ5 A;  4GMJ A;  2XLV A;  4YL1 A;  5L3V A;  1MYO A;  3UPV A;  1T6U A;  4U0U A;  5CBN A;  3BQO A;  2LSU A;  3ISM C;  4LCT A;  5ENQ D;  1VK5 A;  1TNZ A;  5BQI A;  1K1B A;  3C7J A;  4OAU C;  4LDK A;  5AJL A;  3UT8 A;  1WDY A;  3W8I A;  1T6I A;  2LCH A;  4CDV A;  4MTG A;  5F5H A;  5E3A A;  1OW8 A;  2VCB A;  5DQT A;  3G2W A;  5CER B;  5CHE E;  2Z15 A;  1SA4 A;  2A68 F;  1IKN D;  1WM5 A;  1RKC A;  4XKB A;  4P6I C;  3C8G D;  2E2E A;  4EBJ A;  1UOH A;  4QI0 A;  3A11 A;  2XS1 A;  3CQZ A;  2PZI A;  3HYM B;  5EDS A;  4XPX A;  2IU1 A;  4DX5 D;  3ZSU A;  2ZU6 B;  2VGY A;  5HSW A;  3SXZ A;  2NYJ A;  2YL0 A;  2RD9 A;  3QB2 A;  2J8S D;  2YVK A;  4WAB A;  2AJA A;  3QWV A;  3QWP A;  4W8K A;  1OCZ C;  1K3Z D;  2GDC A;  3QZC A;  3DEO A;  5D66 A;  2Q7R A;  2LAI A;  4PS3 A;  2J9U A;  4MVO A;  3H65 A;  2MHK A;  3HXB A;  1YLM A;  3JRM O;  4EBB A;  5L0H A;  1E7V A;  3EZH A;  4DRI B;  2VQ2 A;  1KZP A;  3BG1 B;  2DZO A;  3EZI A;  3I4U A;  1TWG A;  1TR2 A;  2C2L A;  2HR2 A;  3IXE A;  3PEV B;  4YDE A;  4G8L A;  2A0U A;  3S90 A;  3M15 A;  4BSZ B;  3WG7 C;  3RO2 A;  3UGP A;  4XEI G;  3LEO A;  4ANV A;  3KYI A;  4PFO A;  3ZQY A;  3CQC B;  4DJA A;  5AGF A;  4ME2 A;  1AWC B;  3DJN B;  5CI8 A;  1NZE A;  1GGQ A;  4CJO A;  4FWV A;  4CIH A;  1J8M F;  4IAR A;  1E8X A;  4GZC A;  4KMO A;  3MZL B;  5CED B;  3FUJ A;  1SYQ A;  3AJI A;  2CYD A;  3TWW A;  3BG0 B;  1TJC A;  3LS1 A;  5JHA A;  1JWF A;  5JS5 A;  1LS1 A;  1JCQ A;  4MLP A;  1ORS C;  4N3A A;  4YND A;  3EU5 A;  3FP3 A;  4YDW A;  4KVO A;  1E85 A;  2CG2 A;  4L2Y A;  4C3B A;  3QNK A;  1HW1 A;  2UUH A;  2XEE A;  4JHJ A;  4AK9 A;  3IEG A;  3PVL A;  4GAA A;  2OND A;  4F1P A;  5HS0 A;  1EYH A;  2FO7 A;  3N24 A;  1ELK A;  3ABL E;  4GTM A;  4L9P A;  4BT9 A;  3L22 A;  4DLO A;  3T8K A;  4AY5 A;  2R7V A;  4I1A A;  3QK0 A;  3ASO C;  3AQC A;  2H7B A;  1OXJ A;  2ZD9 A;  4LRZ A;  1NL4 A;  1KLX A;  3MEK A;  2KK1 A;  1G3N B;  2CGE A;  2J49 A;  2XSE A;  1V55 E;  3ONL A;  1FVH A;  5CCL A;  3C62 A;  1SZ9 A;  1Y4C A;  2QY7 A;  5L0G A;  2YLG A;  4AE4 B;  2XCB A;  3EGD A;  3CHQ A;  1PCX A;  3I4G A;  4UWL A;  4OIR F;  2X6K A;  4GML A;  2IF4 A;  5ENP D;  1MND A;  3CK9 A;  3PNL B;  1WAS A;  1E86 A;  4EZK A;  4WWP A;  5JP7 A;  1MNE A;  5COM A;  4IUL A;  1GS9 A;  3H2V A;  4OAV B;  2WXF A;  5D0O D;  2FEZ A;  1KNY A;  1DOW A;  4GYW A;  2P9P G;  4RBN A;  1Z63 A;  3CV0 A;  4FC8 A;  2F8X K;  1E8W A;  2CHZ A;  5AIJ A;  5LX8 A;  1XZP A;  3UIO C;  3Q9U C;  3SFX A;  1W2W A;  4JRZ A;  1OCR E;  3RRU A;  2CG3 A;  1MMN A;  1OT8 A;  3K1I C;  4AP2 A;  2OU6 A;  3CVQ A;  4OIO F;  4ER9 A;  3JYY A;  1SR2 A;  4NRH B;  2NSG A;  4BX9 A;  2J8W A;  4EHM A;  2XL8 A;  3U4T A;  3JT1 A;  4MRU A;  3SBT B;  5EK0 A;  3UM1 A;  3T6G B;  3TWX A;  3W4Y A;  4EKW A;  5COG A;  4I17 A;  4KYO B;  5ANL A;  3ZPJ A;  4G23 A;  4HB5 A;  2ETB A;  3FFL A;  1TQG A;  3LJB A;  4DK5 A;  5L0I A;  2EPM X;  1APC A;  3CHS A;  5HRY A;  2NUT A;  1FCH A;  5JLI A;  3K7D A;  4BEJ A;  3OXL A;  4JL0 A;  3EU9 A;  3DSX A;  3VLD A;  2XLW A;  3EGD B;  3G2S A;  2KXP C;  4ULV A;  2R7T A;  4AE4 A;  3RAU A;  3PE3 A;  1TFO B;  1FT2 A;  5AN8 A;  3FXH A;  5BXO A;  4XQ1 A;  2VSN A;  1D1C A;  1OWN A;  2XM4 A;  1A17 A;  1HU3 A;  4JVS A;  2IO3 C;  4P9F A;  4OVU A;  2GRN B;  4DUI A;  4AIF A;  4NC3 A;  4G2V A;  2E0I A;  3SYN A;  3Q7F A;  3FTZ A;  1E2X A;  3OA1 A;  4AVX A;  3DBS A;  1OUV A;  4JEH A;  1TN6 A;  3PZ4 A;  2QY9 A;  3SXY A;  4GB9 A;  4YT5 A;  1TKN A;  3HXF A;  4JJG A;  2YHS A;  3QVY A;  5DQZ A;  1LM3 B;  4BTB A;  4K0R A;  2YEV A;  1VDY A;  3CEX A;  5ENT D;  1JCR A;  3RKO F;  3HHM A;  5AC5 A;  1N94 A;  3KSQ A;  1A5E A;  3PRE A;  2R25 A;  2P9U G;  3DE9 A;  4K5A B;  2JEK A;  2IYL D;  4BG0 A;  3D9M A;  2YL3 A;  3QOU A;  5F5F A;  2GRQ B;  1OXB A;  4EWC A;  2VH3 A;  1D9S A;  4Z9J A;  3S0X A;  2HO1 A;  4N4W A;  4BPM A;  3QDN A;  4ILH B;  2XRH A;  3JSE O;  3RQE A;  3U3B A;  3ASH A;  5K0I A;  4N06 A;  3RIP A;  1NA3 A;  1WY6 A;  4D4X A;  2D5R B;  1PD0 A;  3KMI A;  2H6F A;  3Q9N C;  1Z3X A;  4TUM A;  2Q9B A;  1BR2 A;  4MND A;  4O6F A;  3T6B A;  3L9T A;  4RDA A;  4HNA D;  3ESL A;  2BC5 A;  3Q47 B;  3ZEF A;  2OVB A;  1SW6 A;  1CPR A;  4CZ2 D;  3UT7 A;  3KYJ A;  3FTY A;  3SQV A;  3CIA A;  3CHM A;  5L0D A;  4GTV A;  3VLF A;  2R02 A;  5A69 A;  5CIV A;  1OCR C;  3KEZ A;  1BU9 A;  2VCA A;  4HS2 A;  5JHB A;  1FNT c;  2YZS A;  4O7G A;  1V54 C;  4JEB A;  4X8Q A;  3MKR A;  1AP7 A;  4OVV A;  1C02 A;  5EX0 A;  4KVM A;  1OKK D;  5AQA A;  2PM7 A;  3NKE A;  4U0S A;  1RZ4 A;  2AW6 A;  3EHQ A;  5AAO A;  3PRZ A;  3MFN A;  1N4Q A;  4AX2 A;  1C03 A;  1FR0 A;  1A7E A;  3B0U X;  2NC9 A;  3J5Q B;  4LDQ A;  1KU2 A;  2LSV A;  4KC9 A;  2FFH A;  1H19 A;  1K40 A;  1HZ4 A;  3AGT A;  3LDZ A;  1IYG A;  5D91 A;  3RQG A;  4WNG A;  2GGF A;  2DYR C;  3I5P A;  4U5D E;  1QKR A;  3QC1 A;  5CCM A;  3CLJ A;  2LUH A;  4GZ5 A;  5KWD A;  4IAQ A;  3FOO A;  3PUK A;  3LNM B;  3RKV A;  3ZWI A;  3HJC A;  2PX3 A;  2XS8 A;  4MBG A;  4BER A;  3TGO A;  2G3V A;  3LES A;  2M63 A;  2JAB A;  3U66 A;  2DBA A;  4U9D A;  1VOM A;  1HY5 A;  5COF A;  1YVI A;  1K04 A;  5IY5 C;  2J07 A;  1WN0 A;  5A23 A;  5BW8 C;  3B9Q A;  3KL4 A;  1OQC A;  4JA9 A;  3AQB A;  1K05 A;  1LKX A;  1M2V A;  4U8Y D;  4J6I A;  5HQ8 A;  1I4Z A;  4GA2 A;  1S64 A;  5JUA A;  4J0U A;  2NXP A;  3B7B A;  3NYJ A;  4GTQ A;  3FUH A; 
#chains in the Genus database with same CATH homology
 1ELW A;  2CFU A;  4RG6 A;  4CGV A;  3EG9 B;  4I1M A;  3IKO B;  3Q7L A;  4DI4 A;  4HVB A;  4I43 A;  3FVY A;  3T4R A;  4GYT A;  4UWG A;  5DVW A;  1LF8 A;  3ASF A;  1D1A A;  2XPI A;  3ENE A;  4E7Z A;  1QLE C;  5EGY A;  1WGW A;  5AEN A;  4GU5 A;  4B89 A;  3LYA A;  2VGX B;  2NUP A;  2R7W A;  2XCC A;  3X1O A;  2PQN A;  1KT0 A;  2V5F A;  4UI9 C;  4TV3 A;  4HOT A;  3LAY A;  3EFO A;  3PUJ A;  2LAH A;  2KGO A;  4I9E A;  3B7R L;  4PJN A;  4DVY P;  3HIZ A;  3JQ1 A;  3CR3 A;  1ZU5 A;  4YT4 A;  2WXI A;  1H0A A;  3CVX A;  2WZG A;  3E9V A;  3D9P A;  4B6I A;  4FU3 A;  4WND A;  4JZY A;  4URK A;  3FU5 A;  1O87 A;  2UY1 A;  1HF8 A;  5ARG A;  3SNH A;  4NAC A;  2HM8 A;  3Q4A B;  3ABL C;  2IOS A;  2WXL A;  2PL2 A;  1MMG A;  3OAW A;  3CHO A;  5KYX B;  3ML8 A;  4FP7 A;  4G11 A;  2XHE A;  2IXN A;  3LY9 A;  3M1C B;  4X0R A;  2P58 C;  4UQZ A;  4CS8 A;  2MYS A;  1SMY F;  2E87 A;  4CCA A;  4Q4Z F;  1E96 B;  1HG2 A;  4L23 A;  4U8H A;  4U5B E;  3HDX A;  4BSX A;  3Q6N A;  5FZQ A;  3EPV A;  2C0L A;  1N1C A;  4TRQ A;  4BTA A;  3T5V A;  2W4B A;  3UMH A;  2ZXO A;  4DLQ A;  3R9A B;  3TXN A;  3Q7G A;  1INZ A;  3B0P A;  3FTS A;  4WAF A;  3MYV A;  3CK8 A;  1L5J A;  1OWL A;  2LSE A;  3I3N A;  4I3M A;  3FH8 A;  1OWP A;  1E7U A;  4BJ1 A;  2WXK A;  3APC A;  2AXZ A;  1D0Z A;  4HOQ A;  2P6V A;  3K33 A;  4BJ6 C;  3B7U X;  1JWG A;  4U5H A;  4XLP F;  3MKQ B;  4N2S A;  2J7P A;  1GW6 A;  2DYS C;  2WXR A;  1OCC C;  2Y3D A;  3AU5 A;  4UWH A;  4Q94 A;  3RYL A;  2J45 A;  3FEY A;  3SI5 A;  3ZHE A;  2H7O A;  2BUG A;  3LVQ E;  2YNQ A;  4ZLC A;  2IOQ A;  2R7R A;  3Q6M A;  1U3D A;  3PH0 C;  3G2V A;  2I6H A;  3RK6 A;  2KAT A;  4IAO A;  3QAQ A;  2LNI A;  3D9L A;  5T1D B;  1H2T C;  3L16 A;  5E76 A;  4LER A;  3URZ A;  3ZVR A;  2A1D D;  3FUN A;  4WNE A;  5C1D A;  3ZGQ A;  3Q5M A;  4DOZ A;  3B7T A;  5KYY B;  2FUL A;  4PUC A;  4EEC A;  4C3E A;  1Z3Y A;  3L34 A;  5FZS A;  2B0J A;  4G25 A;  1PAQ A;  5E3C A;  4A1G A;  3S7F A;  3EQL F;  3LXU X;  4N5C A;  2J0W A;  4XZ4 A;  1HXI A;  3SNX A;  3EH2 A;  3EH1 A;  3AG3 C;  4YN0 B;  3MGB A;  4JEU A;  4O6M A;  2XGM A;  3RIB A;  1FFH A;  5G04 J;  4CDR A;  4K0D A;  2XRY A;  2CHW A;  2WMN A;  2J7P D;  3LS0 A;  2VTB A;  3ULQ A;  3C98 A;  4U5F E;  5ENN A;  2CDQ A;  3PMR A;  4BJ6 A;  1QQE A;  4ACL A;  5FTP A;  5LP0 A;  4I1O B;  2C03 A;  4GYO A;  2WXQ A;  3O39 A;  4I6E A;  5FQ8 A;  3FH7 A;  4BX8 A;  1MMA A;  4ZLD A;  3FUL A;  4BY6 A;  2WXM A;  3KH2 A;  1IQU A;  1Y6I A;  3CKC A;  4AJW A;  2I9C A;  3CVP A;  2EIN C;  3FHD A;  1HS6 A;  4EZL A;  3ESK A;  2P7V A;  5KYN A;  3FUI A;  1N54 A;  3U64 A;  2WMO A;  4YWQ A;  4GA0 A;  4PK4 A;  1ZU2 A;  4L2L A;  4EBA G;  4C7O B;  2VB6 A;  2ZXP A;  1VYI A;  1M57 C;  4EZJ A;  2CNW A;  3GYZ A;  2ZPA A;  4RG9 A;  5KYW A;  5BT1 A;  3AU4 A;  3LY7 A;  3QJZ A;  3T8M A;  3Q15 A;  3NF1 A;  4PS7 A;  1FFT C;  4PS8 A;  2WXO A;  3FAJ A;  4XIF A;  2X51 A;  5KYU A;  2W4M A;  2H7V C;  4KT6 B;  3TXM A;  3R7R A;  4M3O A;  5T3T A;  5AYW D;  3FWV A;  3SD5 A;  2YIN A;  4UWK A;  3EHM A;  4U04 A;  2FI7 A;  4KZC A;  4OIN F;  4CDN A;  3SP1 A;  3ZVV A;  2A69 F;  2KZT B;  3ML9 A;  3PS6 A;  5L3Q A;  4GZ6 A;  3N71 A;  3FDH A;  4K7B A;  1E90 A;  2LO6 A;  4C9B B;  4JZA A;  4FAD A;  1ST6 A;  3GAN A;  3FUM A;  4GA1 A;  1BR4 A;  2IFU A;  3X2Q C;  2J9Q A;  5EX3 A;  5C2Y A;  4CSA C;  3FY4 A;  1M2O A;  2WZL A;  2G3K A;  4I2W A;  2IXP A;  4GZD A;  3QWW A;  2DIW A;  1RJ9 B;  3DM9 B;  4Y6W A;  3ZN3 A;  3MLG A;  4J8D A;  3RRN B;  2I1J A;  5BNW A;  4F7A A;  3FTV A;  1UN8 A;  5LCW C;  4HE8 D;  1LVK A;  2X6I A;  2WVQ A;  2HYZ A;  3LCA A;  3UT4 A;  3E4B A;  4A3T A;  4AV7 A;  4BJ5 A;  3FTW A;  5CI9 A;  2RD0 A;  3W2V A;  5DS4 A;  3D9K A;  3PNT B;  4MKT A;  4HXI A;  4J8F A;  3OTN A;  3R7Q A;  3CVN A;  4I2Z A;  4UWF A;  1JPN A;  2WXH A;  1EDU A;  5J08 A;  5E75 A;  2WXG A;  5HI7 A;  3ZYM A;  4G0H A;  2M4E A;  2XXA A;  2QFC A;  3HVE B;  4J8S A;  4AXH A;  5ARF A;  1HFA A;  2X38 A;  4O79 A;  3CGH A;  3KKB A;  3LPZ A;  3L54 A;  2CNW D;  2R59 A;  1NU9 C;  2XRZ A;  2ZXR A;  2R7S A;  3ABK C;  3FUF A;  3GOD A;  4C3D A;  2GRM A;  1W3B A;  4OIQ F;  2WXP A;  1FMW A;  5E2Q A;  4U0Z A;  1IHG A;  3CSF A;  3F47 A;  3ASN C;  2CFZ A;  4CS7 A;  3CQG B;  4A3V A;  3CSK A;  4XWJ A;  4CGW A;  4G7Z F;  5KJM A;  5T4Y A;  2L0T B;  2CW0 F;  4F53 A;  4YJW A;  2AXV A;  3NG1 A;  4NQ0 A;  2X6J A;  4XLN F;  3EGX B;  4AY6 A;  4WUY A;  2OCC C;  3DD7 A;  3PE4 A;  3SHF A;  4G7O F;  3RH3 A;  3RJV A;  2J08 A;  4GCN A;  1TWH A;  5B3S C;  3SEO A;  3CVU A;  4AEZ C;  1NA0 A;  1Y8M A;  2XL4 A;  2WM9 A;  4HOS A;  1JUQ A;  2HV6 A;  3DAF A;  3CEQ A;  2V0P A;  2J4B A;  1DVP A;  1IW7 F;  3S29 A;  3L08 A;  1NG1 A;  1RJ9 A;  1ZHW A;  1S7Z A;  4I6G A;  4RSY A;  2IXM A;  4WWO A;  3KD7 A;  5KJL A;  4ACK A;  4ULW A;  5EKQ D;  3JYH A;  5G55 A;  2OOE A;  2O9X A;  4JUR I;  4XI9 A;  1XNF A;  3QAR A;  1OWO A;  2WB2 A;  3IHV A;  3O48 A;  5G04 C;  3OWT A;  3D3M A;  3B0V C;  3MA5 A;  3ZIM A;  2I2O A;  3GZ2 A;  4KNV A;  4APF A;  4PJL A;  3ZYQ A;  4ABN A;  3VTX A;  4CSA A;  2KZT A;  4H4K C;  4F4B A;  1ZHY A;  4AOF A;  3DJU B;  3IV0 A;  4KBQ A;  4R7L A;  2Y3H A;  4C0E A;  4A1S A;  4OD4 A;  3RFY A;  3K9I A;  3FU0 A;  4IJJ A;  1UW4 B;  4FHJ A;  4YVQ C;  2NG1 A;  3CVV A;  3KS2 A;  5FJY A;  2WXN A;  4M63 A;  4EPZ A;  4E85 A;  3DAG A;  5KJK A;  4CT4 A;  4CT0 A;  4DBQ A;  3P1U A;  3FHE A;  3FEX A;  3UUX A;  4CS9 A;  2C0M A;  4EQF A;  2MWQ A;  3Q49 B;  4IRU A;  5KYW B;  2FGY A;  1OWM A;  3O4Z A;  4GYY A;  5BV1 A;  5DIZ A;  4E7S A;  4XKC A;  4KBL A;  5BV0 A;  1WAO 1;  4PDX A;  3FUK A;  5BPP A;  2XEV A;  2PX0 A;  2WVI A;  5DS6 A;  3LVR E;  4U07 A;  4CS8 C;  5BUO A;  3FU6 A;  3AS5 A;  4D10 C;  2KC7 A;  3PEU B;  4N3C A;  4RVB A;  4BFR A;  2VJ8 A;  4KZ0 A;  5G2N A;  3HTK C;  2JD3 A;  4UQY A;  3SBS A;  1MQS A;  2KCK A;  2A4Z A;  2VSO E;  5A6C A;  3CKB A;  3E70 C;  3S27 A;  1UJJ A;  3UX4 A;  5D0Q D;  1H6K A;  2PQR A;  3KAE A;  2J9W A;  3DZA A;  5EHH A;  1EF1 C;  2L0I A;  2PM6 A;  3L13 A;  5AJD A;  4PFP A;  2OV8 A;  2Y69 C;  3ONK A;  4UQX A;  2W9Y A;  5CMW A;  3LEV A;  3GZ1 A;  1M56 C;  4E6H A;  3DPD A;  4WJ0 A;  4I44 A;  3LLK A;  5E33 A;  3NRH A;  1Z6T A;  4UI9 K;  3AS8 A;  4ATG A;  2R7U A;  4G26 A;  4Q7C A;  4DVZ A;  4IYP A;  4XX5 A;  5JJT A;  5B1B C;  3ECS A;  4K03 A;  4WWN A;  3EGX A;  2Y3A A;  3L17 A;  2R7X A;  3ZG1 A;  4ANU A;  2IJG X;  3NZS A;  3NZU A;  3K66 A;  2WQH A;  4N2Q A;  4PJM A;  1SZA A;  3MV2 B;  2R7Q A;  1ZHX A;  2J46 A;  2KQ9 A;  3S7J A;  3B13 A;  2J4D A;  4NUR A;  3JUI A;  3EJN A;  2VSX E;  3N2Z B;  3JCK C;  4HFK B;  2XPZ A;  1X5B A;  3ABM C;  3ZFW A;  3ZYL A;  2C04 A;  2WVN A;  2J0X A;  1O5H A;  2Y4U A;  4QDL A;  2ILR A;  4JA7 A;  1ZYR F;  2NSZ A;  4OIP F;  3ZHE B;  3HVE A;  4FES A;  4FJZ A;  1HO8 A;  2Y39 A;  3JYS A;  3FU3 A;  2XXA B;  1YA0 A;  1UG3 A;  2IXO A;  4FUL A;  5FQ4 A;  3DXJ F;  4NY3 A;  2XGS A;  5FWQ A;  2WVO A;  4BJ5 C;  3AG4 C;  3TJP A;  2WQ7 A;  2JLB A;  2VAS A;  3MCX A;  2WPV A;  3UMK A;  3WXX A;  3UR3 C;  3D9N A;  1J8Y F;  4EBA A;  4N3B A;  3SZR A;  3LLI A;  3SGH A;  2BE5 F;  3G2U A;  4CDM A;  3TG5 A;  4JHR A;  3U3W A;  3SF4 A;  2R17 C;  4O6N A;  3SZ7 A;  4U5C E;  2YQ8 A;  4CBE A;  4GEH A;  3VAY A;  4IN3 B;  2Q9C A;  2FF4 A;  2Q3T A;  2WZF A;  3S7B A;  5FQ7 A;  2V4L A;  3CVL A;  1EPU A;  3L6A A;  4YT2 A;  3D9O A;  1G8X A;  3TG4 A;  5DBK A;  4JPS A;  2V3C C;  2KCL A;  1BPO A;  4AM9 A;  2MOW A;  2I1K A;  4G7H F;  2Y3B A;  3V7O A;  1QZX A;  4IWB A;  4JXT A;  2IQC A;  4FLB A;  1U3C A;  3UNG C;  4KXK B;  4LLC A;  1H2U A;  3ASG A;  4DPR A;  4N39 A;  3OXF A;  1PC2 A;  1Z5Z A;  1ZHZ A;  5BUZ A;  2EIM C;  4LUN U;  3EDT B;  3VYW A;  2KNH A;  2UY1 B;  3K1H A;  4ILG A;  2EQX A;  3UQ3 A;  4Q69 A;  2GRL A;  5G05 J;  2DGJ A;  2MRI A;  1S0P A;  4I6J A;  4B0Z A;  1PD1 A;  1E8Z A;  3DM5 A;  3CHR A;  4FLH A;  2X3M A;  4KNW A;  1NU7 D;  3U9W A;  3DMD A;  3EFO B;  2EIK C;  2WL8 A;  4XE0 A;  3VTY A;  4ANX A;  3PDN A;  1TWA A;  4MQ9 F;  3TD7 A;  1HX8 A;  5KYU B;  1D0X A;  2NUP B;  1TEZ A;  4A55 A;  5FZR A;  3CZ6 A;  3LS8 A;  4FA6 A;  2WQ6 A;  1VMA A;  3CHP A;  3EG9 A;  4BJT A;  3AG1 C;  1HG5 A;  1Z3I X;  2A5U A;  2A6E F;  4V3I A;  2A6H F;  3CST A;  4QI2 A;  4U5E E;  4JHK A;  4GPK A;  1SF8 A;  2WXJ A;  4C7O A;  4CRW A;  2J09 A;  4GZ3 A;  4LEU A;  1N52 A;  1KT1 A;  5KJN A;  1VYK A;  3F46 A;  1PY1 A;  3I4R B;  3UMI A;  4ILI A;  1TJF A;  4Q96 A;  4BT8 A;  2RG8 A;  1UN9 A;  4I9C A;  3PZD A;  5FQ6 A;  3UMV A;  1JPL A;  4WNF A;  2L81 A;  4B94 A;  3RU0 A;  5G05 C;  3GZS A;  4O6Y A;  1V55 C;  2XPY A;  3ZXS A;  3FTX A;  4ANW A;  5JJ7 A;  4HFG A;  2HV7 A;  2X6F A;  1B89 A;  5KCM A;  1FMV A;  5T8I A;  4G24 A;  2XQ0 A;  1ZHT A;  3ASD A;  1TWC A;  4XTK A;  4J8E A;  2R5S A;  2EIJ C;  4H7X A;  3TL5 A;  2Y4T A;  1MMD A;  2VTB B;  1JPJ A;  3NYL A;  2UWJ G;  3RRM B;  3S2A A;  1ZU4 A;  4A2N B;  2R7O A;  1ZBP A;  4PH4 B;  3MX3 A;  3BEE A;  4TUU A;  5FCL A;  3VLE A;  4F3V A;  4J30 B;  2L9J A;  3NKD A;  3MJW A;  2PF4 E;  3AG2 C;  3IEE A;  2L9B A;  2AWI A;  5A7D B;  4B8A A;  2WB7 A;  3ZW3 A;  3SFZ A;  3TAX A;  2OG2 A;  2ION A;  3JCU Q;  3W8H A;  3UGO A;  4LLE A;  1IQR A;  4J32 B;  3G2T A;  5KYY A;  2PFD A;  4Y6C A;  3FUE A;  3I5Q A;  1SQM A;  3APF A;  3POV A;  3LEW A;  3CVW A;  2KJG A;  2J9V A;  4HOU A;  5B1A C;  4LAC B;  3P2B A;  3ZC4 A;  2AVP A;  2Y3G A;  3D9I A;  3RO3 A;  2GW1 A;  4OD5 A;  3S7D A;  4BWR A;  1HH8 A;  3NQP A;  4GCO A;  1ELR A;  5LOZ A;  3ITF A;  1NP7 A;  2DCP A;  4HFF B;  1D0Y A;  4FX5 A;  1FVF A;  2BF0 X;  3GW4 A;  3FDQ A;  3AS4 A;  4YT8 A;  4B8C B;  3EIQ C;  3N0T A;  1SZI A;  4CEM A;  1D1B A;  1OKK A;  4JW1 A;  3T5X A;  3MKQ A;  4YVO A;  5T3R A;  2NUT B;  2XGO A;  2OVF A;  5DS5 A;  5CMY A;  3HLZ A;  3EHN A;  2KW3 C;  3JSZ A;  1OCO C;  2L6J A;  4L7T A;  1IZM A;  1QZ2 A;  1H2V C;  5M72 A;  4Q5S F;  1UJK A;  2W45 A;  2YHC A;  1Z23 A;  5J90 A;  2V26 A;  1HE8 A;  3IBE A;  4PJJ A;  4APO A;  5ANR A;  4U63 A;  2PP4 A;  4C0M A;  2VSY A;  4W9R A;  4HOR A;  4DI3 A;  4OYS A;  1E8Y A;  2I8B A;  3JRT A;  4G1T A;  3CK7 A;  3FTU A;  3CVY A;  3FH5 A;  3OEO A;  1QNF A;  3LY8 A;  3ZYK A;  1MHQ A;  2ZXW C;  3EIJ A;  4RD9 A;  5DLJ A;  2KM4 A;  3PHF 2;  3QKY A;  4HLE A;  3MV3 B;  1P5Q A;  4P29 A;  4HEA J;  3LJ3 A;  3JQ0 A;  2YHE A;  5KYX A;  3LNR A;  4ANJ A;  3O6X A;  3NDB B;  5JJ6 A;  3D9J A;  2BTD A;  3FUD A;  4XI0 A;  1FTS A;  4JC8 A;  4L1B A;  2AXU A;  3APD A;  5T3W A;  3L0I A;  2IOL A;  4UI9 J;  2KCV A;  4FHK A;  3OXG A;  3LKU A;  2G62 A;  2X6H A;  4MS6 A;  3QMK A;  4JCH A;  2Q9A A;  1Z6A A;  2V8S E;  2Q7F A;  3T6J A;  1NZN A;  2VYI A;  2VGX A;  4H7Y A;  1XGW A;  3WOD F;  5LCW J;  3ZRH A;  3K6B A;  3W2W A;  4CS9 C;  2EIL C;  2FBN A;  4DBR A;  3S28 A;  3ZIB A;  3IHY A;  3B7S A;  5FT9 A;  4JJF A;  2QTV A;  4KI2 A;  1DNP A;  4F1S A;  1BR1 A;  5LFA A;  2GFH A;  2CHX A;  5D92 A;  1M2V B;  4U5G A;  4QFV A;  3NYM A;  4FJY A;  4GMJ A;  5L3V A;  3UPV A;  4U0U A;  2LSU A;  4LCT A;  1VK5 A;  3UT8 A;  5AJL A;  3W8I A;  5F5H A;  5E3A A;  5DQT A;  3G2W A;  5CHE E;  2Z15 A;  2A68 F;  1WM5 A;  4XKB A;  4P6I C;  2E2E A;  4QI0 A;  3CQZ A;  2PZI A;  3HYM B;  5EDS A;  2IU1 A;  3ZSU A;  2ZU6 B;  2VGY A;  5HSW A;  3QB2 A;  3QWV A;  3QWP A;  4W8K A;  1OCZ C;  3QZC A;  2LAI A;  4PS3 A;  2J9U A;  2MHK A;  3H65 A;  4EBB A;  1E7V A;  3EZH A;  2VQ2 A;  3BG1 B;  3EZI A;  3I4U A;  1TWG A;  1TR2 A;  2C2L A;  2HR2 A;  3PEV B;  3WG7 C;  3RO2 A;  3UGP A;  4ANV A;  4PFO A;  3CQC B;  4DJA A;  4ME2 A;  3DJN B;  5CI8 A;  1NZE A;  4FWV A;  4CIH A;  1J8M F;  1E8X A;  4GZC A;  4KMO A;  3MZL B;  3FUJ A;  3BG0 B;  1TJC A;  3LS1 A;  5JHA A;  1JWF A;  1LS1 A;  4MLP A;  4N3A A;  4YND A;  3FP3 A;  4KVO A;  2CG2 A;  4L2Y A;  4C3B A;  3QNK A;  4JHJ A;  4AK9 A;  3IEG A;  3PVL A;  4GAA A;  2OND A;  1EYH A;  2FO7 A;  3N24 A;  1ELK A;  4BT9 A;  3L22 A;  4DLO A;  4AY5 A;  2R7V A;  4I1A A;  3QK0 A;  3ASO C;  3AQC A;  2H7B A;  4LRZ A;  1KLX A;  3MEK A;  2CGE A;  2J49 A;  2XSE A;  3ONL A;  1FVH A;  5CCL A;  1SZ9 A;  2QY7 A;  4AE4 B;  2XCB A;  3EGD A;  3CHQ A;  1PCX A;  4UWL A;  3I4G A;  4OIR F;  2X6K A;  4GML A;  2IF4 A;  1MND A;  3CK9 A;  3PNL B;  4EZK A;  4WWP A;  1MNE A;  4IUL A;  2WXF A;  5D0O D;  2FEZ A;  4GYW A;  4RBN A;  1Z63 A;  3CV0 A;  4FC8 A;  1E8W A;  2CHZ A;  5AIJ A;  5LX8 A;  1W2W A;  3RRU A;  2CG3 A;  1MMN A;  3K1I C;  4AP2 A;  3CVQ A;  4OIO F;  4NRH B;  4BX9 A;  3U4T A;  3JT1 A;  4MRU A;  3SBT B;  4I17 A;  4KYO B;  5ANL A;  3ZPJ A;  4G23 A;  3FFL A;  3LJB A;  4DK5 A;  3CHS A;  2NUT A;  1FCH A;  3K7D A;  4BEJ A;  3OXL A;  4JL0 A;  3VLD A;  3EGD B;  3G2S A;  2R7T A;  4AE4 A;  3PE3 A;  2VSN A;  1D1C A;  1OWN A;  1A17 A;  1HU3 A;  4JVS A;  4OVU A;  4AIF A;  4G2V A;  2E0I A;  3SYN A;  3FTZ A;  3OA1 A;  4AVX A;  3DBS A;  1OUV A;  4JEH A;  2QY9 A;  4GB9 A;  4YT5 A;  1TKN A;  4JJG A;  2YHS A;  5DQZ A;  4BTB A;  4K0R A;  2YEV A;  1VDY A;  3RKO F;  3HHM A;  3PRE A;  2JEK A;  2IYL D;  4BG0 A;  3D9M A;  3QOU A;  5F5F A;  2VH3 A;  4EWC A;  3S0X A;  2HO1 A;  3QDN A;  4ILH B;  2XRH A;  3ASH A;  4N06 A;  3RIP A;  1NA3 A;  1WY6 A;  2D5R B;  1PD0 A;  3KMI A;  1Z3X A;  2Q9B A;  1BR2 A;  4MND A;  4O6F A;  3T6B A;  4RDA A;  3ESL A;  3Q47 B;  3ZEF A;  2OVB A;  3UT7 A;  3FTY A;  3CIA A;  3CHM A;  3VLF A;  1OCR C;  3KEZ A;  4HS2 A;  5JHB A;  2YZS A;  4O7G A;  1V54 C;  3MKR A;  4OVV A;  5EX0 A;  4KVM A;  1OKK D;  2PM7 A;  3NKE A;  4U0S A;  2AW6 A;  3PRZ A;  4AX2 A;  3B0U X;  2NC9 A;  1KU2 A;  2LSV A;  4KC9 A;  2FFH A;  1H19 A;  1HZ4 A;  3LDZ A;  1IYG A;  5D91 A;  4WNG A;  2GGF A;  2DYR C;  3I5P A;  4U5D E;  3QC1 A;  5CCM A;  3CLJ A;  4GZ5 A;  3PUK A;  3RKV A;  3TGO A;  3HJC A;  2PX3 A;  2G3V A;  3LES A;  2M63 A;  3U66 A;  2DBA A;  1VOM A;  5IY5 C;  2J07 A;  5A23 A;  5BW8 C;  3B9Q A;  3KL4 A;  4JA9 A;  3AQB A;  1LKX A;  1M2V A;  4J6I A;  5HQ8 A;  4GA2 A;  4J0U A;  2NXP A;  3NYJ A;  3FUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...