4JVSA

Crystal structure of lepb gap domain from legionella drancourtii in complex with rab1-gdp and alf3
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
279
Chain Sequence
ATPPLLQMEQEQPFPELIRTWAGLLGQIGVESVRTEEVNFGQLAKCFNDYLNTVAEHCEQQNIWQHKREENHNFFTAFKPDASKAALHGHAYIAHYKESVILRHLSIVDPKTLGMLRFAPYEAPSTDYCRHFPDSPWAKMQRLATAGQNIILQLRLIQNGQMLEDDLPVLQKALDDFMQYKTEVDALLAHDTPVSTHDSSFFYDIDEQTLNAMSGDQLATICFEELNAPHPSRLIMRILKSDSLWQEVDDSLNGDAFMGRQDDICEKRNKICQWRQLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analyses of Legionella LepB reveal a new GAP fold that catalytically mimics eukaryotic RasGAP
pubmed doi rcsb
source organism Legionella drancourtii
molecule tags Hydrolase activator/protein transport
molecule keywords Putative uncharacterized protein
total genus 88
structure length 279
sequence length 287
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4jvsA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jvsA02
4JW1A 4I1MA 4JVSA 4IRUA 4I1OB
chains in the Genus database with same CATH superfamily
3DAGA 4I1MA 3CQZA 3DSVA 2R7SA 4XWJA 1OWLA 3MGBA 4IAQA 1U0BB 4KYOB 3L1MA 2OOEA 1CGOA 3N71A 3U9JA 3CIAA 3UR3C 1KT1A 5BQHA 4J0UA 1NSGB 2HFIA 3B7SA 3FUKA 2LO6A 3V5ZA 3RH3A 3CVPA 4MLPA 2VCAA 3NBNB 4PUCA 4JD2G 5KNHD 3LEOA 4WNDA 3D9PA 2WXOA 3MA5A 4LEUA 4N39A 3X1OA 2NPUA 5KYXB 3ZPJA 3KS2A 2NXPA 4AY6A 2IQCA 3CHMA 5EDSA 4C3DA 3CVXA 4GZ5A 4D10C 2IXOA 2M4EA 1BDJB 4Q7CA 3AQBA 3ZQYA 3ZHEB 3CSKA 5EIDA 4G8LA 1TYQG 1TQGA 3BG1B 4G1TA 4A1SA 4IRUA 5A6BA 3F47A 3NMKA 4MTOA 3ZG1A 1HU3A 4GTRA 4DX5D 3Q7LA 3K9IA 3TXMA 4UWGA 1TJCA 3CSTA 2I15A 1OKKA 2DB4A 1KZOA 3FUEA 3PREA 2PFDA 5F5FA 3PDMP 5DVWA 4TUUA 2Q9AA 3WHNA 1OCOC 3Q4AB 2EILE 2A68F 2OJQA 3A11A 1EF1C 4YDWA 4O7GA 5E33A 3ISMC 2LAHA 2WXIA 4I6EA 2XLEA 5JJ6A 1LI5A 1VOMA 4V3IA 2HJMA 4N06A 1LVKA 3LY9A 3JSZA 3LCAA 2WXJA 1V55E 3FWVA 5HV9A 2EIKE 3DM5A 4F7AA 4N2QA 1TNUA 4L9PA 3QNKA 4DRIB 2YLDA 4GCOA 1XZPA 2AU5A 4PS7A 4JVSA 4J30B 3U5SA 4CZ2D 3HKKA 3IHUA 3VYWA 3TWXA 2OOCA 1IZMA 5B1BE 3SHFA 3EDTB 3R2PA 5EKQD 3RF3A 2KC3A 4URKA 2CYDA 2YINA 4FP7A 3HYMB 4HB5A 5HKPA 5AYWD 3BUAA 4G24A 3S9OA 2YHSA 3TAXA 3UMKA 1H6GA 4OINF 3SQVA 3TWSA 2EIKC 4K0RA 2WM9A 1L5JA 5JSLA 3ZSUA 1V54E 4KMOA 1LKXA 3TOLA 4MVRA 1IQUA 2CNWD 4G2VA 2XXAB 3HXCA 2Q9CA 3APFA 3CV0A 4WNGA 3RRMB 3FUDA 4HRMB 3EPVA 1TJFA 1YARO 3RQEA 3ML8A 3MV2B 3KEAA 3C72A 2DYRC 4B6IA 3U64A 4NQ0A 1N0RA 5JJ7A 4EPZA 3ZYMA 3AGUA 1WATA 4IULA 4D4XA 4BJ6A 2R2LA 4U5DE 5B3IA 1JOGA 4J8DA 3PZ2A 5CCMA 1D9SA 5COMA 1DOWA 3ESKA 5ENQD 3UMVA 1QZXA 1Z6TA 3EH2A 3TWUA 4E7SA 1OQCA 1D1AA 3D9MA 3SD5A 3S7BA 4A2NB 5KYUA 1HF8A 3HHMA 2X0CA 5L3QA 2L9JA 1ELWA 1QLEC 3FEXA 3NOCD 2ETSA 1SZ9A 3FDHA 2QFCA 5ENSD 2XCBA 3Q15A 1HMDA 1UOHA 1ZHXA 1HFAA 5LP0A 2CG3A 3W8IA 1VTMP 5A6JA 2Q7FA 1E7VA 4XPYA 3U4TA 2FO1E 3CKBA 4AJWA 4K5BA 4LG6A 1UN8A 4GZ6A 3EHMA 1B89A 1QYMA 1HW1A 3K1HA 2WXKA 3HG0D 1HH8A 3FU3A 4I43A 4XLNF 4BJ5A 4U5GA 3ZIMA 4APFA 4FU3A 5AQ9A 3ML9A 4HLEA 4ULWA 5K0IA 4NACA 3ZKJA 2MHKA 3FOPA 3MJWA 3GM2A 5B3SC 4GMRA 2NUTA 2LD6A 2RSEB 4B8AA 1ZU5A 3PZDA 2B0HA 5L0JA 2PF4E 1OUVA 2H8AA 2WXFA 4H4KC 2L0IA 1ST6A 4LUNU 2VGEA 1K40A 4BESA 3JSEO 2MYSA 1OW7A 1HXIA 1C02A 4QI2A 4FESA 1KTMA 3C8GA 4O6YA 2P6VA 4YDOA 2CHWA 5D91A 3CHQA 4APOA 4K7BA 3DXJF 1MMAA 4HQDA 1TN7A 4TXRA 5TJ5E 3QMKA 4F3VA 3FUIA 1FAPB 2BE5F 1OT8A 3DPDA 4BT8A 1E7UA 4JXTA 3J06A 3R7QA 256BA 4O6FA 2PNNA 3EG9A 5AENA 1KPSB 2KK1A 1NP7A 3VM6A 1MMDA 2R02A 3JRTA 3DEPA 3RSEG 4JTAB 4ANWA 3I4RB 4EBBA 4YL1A 3SO8A 3URZA 4FC8A 3TJ6A 3HXEA 4CS8A 4GPMA 5G05C 4XI0A 1O87A 2HSBA 3X2QC 1QQ3A 1LD8A 1OWMA 3GORA 3PCVA 1WAO1 1Q2ZA 3ZQVA 2CHZA 1T01A 3AJIA 5HRYA 5HS0A 1QBQA 1X81A 4JCZA 4DRXE 4OIPF 2KSFA 1TR4A 4FLBA 4F6RD 3V79K 3AS4A 4KVMA 3C5RA 1TWCA 4OD5A 3CR3A 3V2OA 4PACA 2OV8A 4TXQA 2KCKA 3NQPA 2Q3TA 4F4BA 4NIKA 4GTVA 1QPUA 2V4LA 4J8YA 4YN0B 2HR2A 5EX3A 5G55A 3U2MA 3B0UX 4NTBA 2GA0A 4AEZC 3LXUX 2EINE 2MOWA 2XXAA 4WGZA 3ABKC 4YT4A 3ONLA 1VDYA 1SF8A 3G2TA 2L6FA 2HJ3A 3K7DA 4H7YA 1LIHA 4YL3A 3CK7A 1E83A 1F1MA 5FQ7A 3LLIA 2XGMA 2IF4A 1IYGA 4JKVA 3FTVA 1M6TA 4CEMA 4IARA 4UQYA 1TN8A 1VYKA 1OWNA 3RIPA 4BPMA 2I6HA 3DSSA 5BT1A 4DRHB 2HYZA 3LUTB 3M1CB 2CCYA 4N2SA 1RMVA 3EZHA 3U8PA 3PE4A 3EGDA 1N0QA 4CS9A 2GRRB 4J6IA 3O6XA 2IONA 3CVNA 2WXQA 4QDLA 3DRAA 4G23A 4BWRA 4QI0A 2ZISA 2J0XA 3JRMO 4GTPA 4BEPA 2XEEA 2WVOA 1E8ZA 3CQGB 4JHKA 4Y6CA 1O3UA 1O1TA 1FCHA 2EIME 3Q73A 3JQ1A 4GYYA 3IQ6A 2L6BA 3Q7GA 3JTLO 1M56C 4C7OA 5ENOD 3E32A 4B0ZA 1D0YA 3QARA 4U95D 3B7RL 2DCPA 3NZUA 2OCCE 4PJMA 3H65A 4UWLA 1Q0KA 3ABLE 4P29A 1QQEA 2RKKA 5L0HA 3PHF2 1YAUO 4MKTA 1B68A 4I6GA 1OXKA 1Y4CA 3KL4A 4LDQA 4F53A 1CGME 3Q49B 4YNDA 4WNFA 5EK0A 3GWNA 4MVZA 5FIOA 2KATA 3PDNA 2YVKA 3MKQA 4DX7D 2A0BA 3KYJA 2Q7RA 4XZ4A 4JC8A 3FTWA 4LDRA 2VJ8A 1G4WR 1Z5ZA 3BRJA 2ASRA 2KYHA 2KCLA 4FJZA 3TWVA 3FHEA 3ASOE 2XM0A 4BY6A 1ORSC 3JCKC 2HM8A 3HLZA 1CPQA 5FCLA 3DSWA 3T9KA 5E3CA 3IBEA 4E0HA 4AK9A 5FWQA 4KC9A 1V4AA 3C3OA 3RU0A 5AIJA 3FTSA 3RVYA 2FFHA 4YT2A 5LCWJ 2DZNA 2C03A 3C3QA 2P0NA 4C3EA 1YYJA 5E2QA 3CAXA 3SXMA 4RBNA 1FMWA 2PQRA 3ZXSA 3PNTB 4F1PA 4Z9JA 3AG2C 2XQ0A 3EU5A 4ANVA 2P7VA 1HE1A 1Z7Qc 3TQOA 3EGDB 2UY1B 5FZRA 3B71A 1UN9A 3SYNA 3ZEFA 2W45A 1XZQA 5FZTA 2H6GA 4G7HF 1M2OA 5A7DB 1H2UA 3IHVA 2F8XK 3E33A 2EPMX 4EBKA 3IEEA 2WQ6A 3QWVA 1Z3YA 1DCQA 3VLEA 1H7IA 3QOUA 4MBGA 3TWWA 4O1OA 4G7OF 4KNVA 4CGWA 3UIOC 3LKUA 2QY9A 4A63B 1JMWA 4LRZA 3KEZA 5D0OD 5BUZA 4JTCB 4RVBA 3EQLF 2L7AA 4BEJA 4UQXA 4CT0A 3QW0A 4MRUA 2DWZA 1NA0A 2LIGA 3LJ3A 3RFYA 4C0MA 2IBFA 3PEUB 1E90A 2QY7A 2L9BA 3UT8A 4YDYA 5DS6A 3DXKG 3D9NA 4GMJA 1TKNA 3CZ6A 4CS7A 3KSQA 5CIVA 4GTSA 3EGXB 4MS2A 1OWPA 2YKZA 3ULYA 5KNGA 2G3KA 1RKCA 3G2SA 2F37A 3I3NA 1O1SA 3ASOC 5CI8A 4I6JA 3UM3A 1N95A 4XKCA 3IQ5A 2KGOA 3K6BA 2IOSA 4LACB 4LLEA 3L8JA 5ANLA 3NMJA 4XLPF 3CEQA 4MVSA 4U9DA 3BG0B 4CS9C 2LSUA 2EPLX 1CPRA 4AOFA 4NRHB 1WY6A 2EIJC 2R7TA 3PEVB 3CVLA 1ZYRF 2FO7A 5JS5A 4NC3A 1WASA 2P2CP 3OXLA 3RKVA 4HRNA 2AWYA 3LAYA 3AG2E 3AGTA 4U63A 4WAFA 1JWGA 2UY1A 1NBBA 2X6JA 3UQ3A 2AVKA 3CK8A 3FTYA 3NF1A 2ZPAA 1SMYF 2YLIA 3GEIA 2RD0A 1TEZA 2GW1A 4G0HA 3FEYA 2ONDA 2VTBB 2XZTG 5IY5C 1N94A 5CBOA 5ARGA 3CHSA 1H6KA 4E7ZA 1KZPA 2PQNA 3DPYA 1AP7A 3L22A 3C63A 4KZ0A 2CG2A 4W8KA 3RAUA 3O39A 2EPNA 1R4TA 4OYSA 4IN3B 4MNDA 2HMZA 3U3WA 1T6QA 3WG7C 4CIPA 4D4NA 2YL0A 3SXKA 3DWLG 5D2MC 3E70C 5EILA 2A1DD 2OU6A 3DKAA 5BXUA 3KSLA 5KYNA 3B9QA 4XPXA 1UG3A 4JEAA 5F5HA 2YL3A 1MNEA 1LE4A 4JL0A 3Q6MA 4FX5A 1A0BA 1UJJA 5LCWC 4IB4A 1PD0A 3ASNE 1N4SA 3ZYKA 2EILC 2JD3A 4OVVA 1SW6A 2R59A 2ZXPA 1HS6A 1NG1A 2WZFA 2IO3C 4RLYA 1JRAA 5D0QD 4YT8A 1WTYA 1GM5A 3PZ4A 1YA9A 5EYPF 2WMOA 3X2QE 4JIOA 4G7ZF 2L0TB 1YVIA 2PM7A 3ZRHA 1OCCC 2JABA 5CHEE 1UG7A 1LS1A 4PK4A 5AQBA 3L13A 2WB7A 4K1OA 5JA4D 3ECSA 1YYXA 4KBLA 1RJ9B 2ILRA 2AP3A 3EIQC 3PRZA 2EIMC 3I4UA 4L7TA 4WWOA 4FWVA 3ZWIA 1EYHA 2KQ9A 4U5CE 4LNGA 3CVQA 5G2NA 5AARA 3VLDA 3FUFA 2CDQA 3PH0C 3C8GD 4JA9A 1N4PA 5FQ8A 2QYJA 2RD9A 4C7OB 2J08A 3UXGA 5M72A 2P58C 4DBRA 1H9TA 1TNOA 4FHJA 1OCOE 2AVPA 3FMSA 4EBJA 1WWPA 2LXMA 4YVOA 1Y6DA 4UI9C 3HVEA 3O4ZA 1U3CA 4Q96A 3V7OA 3FDQA 2CW0F 3KD7A 3VRCA 2NYJA 3AG1E 2XEHA 2D4UA 4FJYA 4NURA 3FULA 2WZLA 4ONSA 2F8YA 4GAAA 4DJAA 4AE4A 1BI7B 3JUIA 1DNPA 2LK4A 1NFIE 2EINC 4ULVA 3TGOA 3B29A 3RK6A 3C62A 4B8CB 3T9OA 2ETAA 2L6GA 3T4RA 2VSXE 3HDXA 3UT4A 3N24A 5B1AE 2UUIA 4PS3A 4BX9A 3ENEA 3O10A 3FH7A 1OCRE 2VGXA 3Q6NA 3E30A 1YZCA 3Q5MA 1YZAA 5KBAA 1XGWA 2R17C 1BU9A 4PJLA 3S90A 4W9RA 2IJGX 1V74B 4TV3A 2YHCA 1YA0A 3FUMA 3ZGQA 3V2XA 2R7WA 3CHPA 3CHOA 2A4ZA 4NQFA 3G2VA 5DBKA 1BZ4A 1NZEA 1DCEA 3EGXA 1GQAA 1MZCA 3T6GB 5HI7A 3PS6A 5JT4A 1M57C 3AS8A 5LOZA 3LNRA 3HRAA 3MKRA 2KZTB 2R7XA 3PZ3A 5L0IA 4N6CA 3EFOB 2QTVA 2BF0X 3NYJA 4U5HA 2VTBA 4EUKB 4JZYA 4NY3A 1LS4A 4ATZD 3AOUA 3IV0A 2GFHA 1ZVZA 4ANJA 2E0IA 4UDVA 4CDYA 2JLBA 4R7LA 2X6IA 3FUHA 1PCXA 3BU8A 2OEWA 1MX6A 3QWWA 5FQ6A 5BV1A 3J5QB 4DK5A 5DIZA 2A6HF 4FULA 1V54C 3V30A 5COFA 4HORA 1GGQA 1OCZE 2Y4TA 2YNQA 4LNBA 1A17A 1D1CA 2PM6A 2Y1LE 4J8SA 2OKUA 2R03A 2Y3DA 5B1AC 4YL0A 3TG5A 1E8WA 4UQZA 3Q75A 4P9FA 4GMLA 1APCA 4FAPB 2WZGA 3L17A 3CK9A 3MV3B 2IOLA 1HO8A 4Z68A 4I1OB 1OKKD 2J9BA 3PMRA 5KYYA 3SFYA 3NMIA 3ZNGA 4UI9K 3ZYQA 1PD1A 4U07A 4GTOA 1D0XA 3GEHA 3DZAA 4ACLA 1YJGA 3M79A 1G3NB 1NLXA 5JHAA 1YMPA 2V0PA 1VK5A 4IJJA 3DM9B 4X0RA 2IFUA 5KJLA 2TMVP 4K0DA 4EBAA 2XPZA 3D9JA 1O1RA 2XLDA 4RD9A 3DSTA 2LFFA 3U9MA 1SZAA 4OD4A 1FVFA 2WXRA 2AW6A 5CEAA 5ENTD 2GRMA 3M4CA 3K66A 3RRUA 2P9SG 3RQGA 2V8SE 1T6UA 3C18A 1ZW2A 5A6AA 3T8MA 2GRQB 3ZHEA 1Q0GA 3DEOA 2AXUA 1AUEA 5KCMA 2C0MA 4DOZA 1XWJA 3ABLC 1JAFA 1FFTC 2J49A 4YWQA 2XZDG 4ZLCA 2X6FA 4E85A 2R7UA 4AE4B 5DQTA 4MQ9F 1D8EA 2HSQA 4K5AB 4HXIA 3TWQA 5JP7A 3SI5A 2HV6A 3NKEA 2IO2C 2D5RB 3EJNA 4CJGA 5AJLA 4JURI 4DUIA 3QK0A 3HVEB 3T5XA 2B0JA 3UM1A 2RG8A 5CBNA 4I44A 3L34A 3JT1A 4CIHA 5GPGB 2WXNA 3QDNA 3LS0A 3LESA 2UWJG 4FA6A 4Q4ZF 4JTDB 4ILGA 4MVOA 1E8YA 2P9IG 5BPPA 2PZIA 4BTAA 4EECA 2J07A 2X51A 5IY5E 2J45A 1HG2A 3QAQA 3ESLA 5ARFA 4DI3A 3C8ZA 4BJ1A 4XPWA 5CECB 2HMQA 4HOTA 4IYPA 4X8QA 4KVOA 2W4MA 2OCCC 3E9VA 2IXNA 3EH1A 3AG4C 3HNJA 3RKOF 2KW3C 1FNTc 1YDIA 1OY3D 2WXGA 1O5HA 3HTKC 3HXFA 1SQMA 3AAAC 4HOSA 3S7FA 2VGYA 3DJNB 1H6OA 3AS5A 4ACKA 1TFKB 2PL2A 1IW7F 1LTXA 2I2OA 1WG0A 3DJUB 4AVXA 2AJAA 3U3BA 4Y6WA 2WVQA 1RXQA 2H7BA 3EFOA 4GA1A 5ENNA 1BR2A 1TNBA 2P9LG 3JYHA 3T8KA 4HEAJ 1BD8A 4A3VA 4PR9A 1ORJA 1Z6AA 4JE9A 2LSEA 4DX2A 2KZTA 5L0CA 2CGEA 1K05A 3ZC4A 3G2WA 1S70B 3FU6A 1QKRA 3WXXA 1K04A 3R7RA 2XS8A 3B95A 3Q78A 1DC2A 5EX0A 2WQ7A 3FAPB 3ZDLA 4CT4A 2EQXA 3JCUQ 2VASA 3HJCA 2XPYA 5B3SE 2RFAA 1TWGA 2C04A 5KYWB 3JYYA 4L2LA 4A1GA 3E34A 1SA4A 2G3VA 3NAWA 3ABKE 2CFZA 4CBEA 4GZCA 2LNIA 3FAJA 4N6HA 4UWHA 3CVUA 3K1IC 4C48B 4HLLA 3GODA 1NA3A 1YYHA 4PJNA 1ELKA 4XI9A 1VB5A 3LJNA 4WUYA 5KYUB 4N5CA 2Y39A 3ZU7B 2A0UA 3D9KA 4OVUA 4G26A 3QWPA 2P61A 2J46A 3OEOA 3R9AB 4BX8A 5JLIA 5F28E 4JC7A 1WGWA 4CDMA 4LNUD 1ZHWA 1M2VB 3LS8A 3VAYA 1OW6A 3LY7A 2H6HA 3U3FA 2GWWA 3FTXA 1BLXB 3JQ0A 1L7CA 4XX5A 4FLHA 1KNYA 1NZNA 1ZB1A 5E76A 3OAWA 2NSFA 4AX2A 1JWFA 1AVOB 3IHYA 1H6PA 2BUGA 3W9FA 4DPRA 1W3BA 3ZVVA 1T5OA 2MWQA 2M64A 2E2EA 4MTGA 2KC7A 1U89A 1QSPA 3SFXA 3KMIA 4U5BE 2GGFA 2R5SA 4XTKA 3FUNA 3CVYA 3ASHA 2Y3BA 2NSZA 3FOOA 3PVLA 5A6KA 5FJYA 4C0EA 3T6BA 3RYLA 1LD7A 3DE8A 3RO2A 1VYIA 2HO1A 1JCSA 2HKVA 2KNHA 4G78A 3T5VA 3NYLA 4PFOA 1TNZA 2YQ8A 3JYSA 2J0WA 3TWTA 1OCCE 4U7EB 2FULA 3D9OA 4ANXA 5J08A 2BKGA 2HZ8A 2W4BA 3SXZA 3CHRA 4BERA 2DZOA 1RKEA 1HMOA 1O5MA 1A41A 2LCHA 5KJNA 1LM3B 3TJ5A 2ZD9A 3ZVRA 2BC5A 3IQTA 3ITFA 3DSXA 4YT5A 3LEVA 2XL8A 5BQIA 3LNMB 3D3MA 3UPVA 1NU9C 1MMNA 3S7DA 1NFOA 2MHRA 5FZSA 4DLQA 2CHXA 3MLGA 2XSEA 4HFFB 2DI3A 2J8WA 5A69A 3E4BA 2F0YA 1E86A 3LDZA 2R05A 1SYQA 3L8IA 2R7VA 1H2TC 1MX4A 5A23A 4YK5A 2PP4A 5D92A 4DX1A 3U0CA 3N2ZB 3WAQA 5CCLA 2I1KA 1Z5SC 2J7PA 4JEHA 3UM2A 4M63A 1MHQA 4NTAA 4J8FA 4CS8C 2ZU6B 2V5FA 5BW8C 5AC5A 2XLVA 1Y8MA 2P1AA 5A6CA 3QKYA 3KYIA 3OWTA 1VLTA 5AC4A 3GZSA 3W8HA 3EHQA 1FMVA 3AG1C 3M4BA 3SFZA 4U0ZA 3OXFA 5CMWA 3GM3A 2DBAA 3CEXA 5KYWA 2W9YA 3S84A 3OTNA 4JJFA 2YHEA 4J8EA 4Q5SF 2P9NG 4A55A 1IQRA 1A5EA 3SF4A 1FT1A 5LX8A 1HE9A 4HOQA 4I1AA 5C2YA 4L1BA 3VTXA 2L6HA 1JPLA 1T6IA 4LCTA 2P9UG 1OXJA 3NZSA 3GZ2A 3LYAA 3W4YA 2WXHA 2XS1A 3QW1A 3K1IA 1JPJA 1PY1A 3B7TA 4HI9A 4HVBA 4U04A 4I9EA 3CQCB 3QJZA 1WDYA 4F1SA 1W2WA 2IXPA 3IXEA 1OR2A 4E17A 1WM5A 2NUTB 2LSVA 1JPNA 3TL5A 4AM9A 3FH8A 2KBXA 2XLHA 4BFRA 3RQFA 3L9TA 3UINC 3DWWA 3DD7A 5EIBE 3LY8A 3PNLB 1K3ZD 2B6CA 3D9LA 2VB6A 4U9EA 1S7ZA 5AGFA 3I4GA 3IEGA 5ENRD 2XHEA 4O79A 5JHBA 3QVZA 3CGHA 1Z3IX 2OVFA 2QZAA 3DXMG 3NOGD 2BEDA 3O55A 4MW3A 4KBQA 1OCZC 3K33A 2WB2A 2QNLA 2FBNA 3I5PA 2MRIA 4BTBA 1ZW3A 2Y4UA 3EZIA 3ZTMA 2IY0C 3H2UA 2UUHA 2AXZA 2P9PG 1IHGA 4EBAG 4LERA 3C98A 2DYSC 4TUMA 1VLSA 2A5UA 3Q9UC 2G62A 2CNWA 1LE2A 1DVPA 1S63A 3DAFA 2ZGDA 5J90A 3ASFA 3ZXPA 4UWKA 5E3AA 4HOUA 4CDVA 1T9KA 5EGYA 3O48A 4KI2A 4LLCA 1NI1A 4YJWA 4G8KA 2L6JA 2ETBA 3ZFWA 2HE0A 1D0ZA 2H7VC 2P9KG 4GA0A 2XRYA 5KYXA 3QB2A 5EYLA 1SVXA 3APCA 3E37A 3B0VC 2X6KA 3RVZA 4G11A 3HIZA 3MYFA 3APDA 4J32B 1K1BA 1MJ0A 2AWCA 5KJMA 1RKEB 3I5QA 2DVWA 4KXKB 1I4YA 1ZBPA 3C7JA 2PBEA 3IPMO 3ATPA 5EN5D 2XEVA 3V5XA 4DVYP 2GRNB 1ZHTA 3UM0A 4EZKA 3MBGA 5COGA 3QC1A 1N4RA 3B7BA 4CYMD 1EI7A 1A7EA 3HXDA 4R32A 1QZ2A 4HBDA 4AV7A 2XRZA 3ASDA 4EQFA 2FI7A 1YLMA 4U5EE 4W8PA 3TJPA 1YA7O 5C1DA 5L0FA 4XIFA 1HW2A 1N11A 2YEVA 4CSAC 2KCVA 2J9UA 2LP4A 3S27A 3P1UA 3TWRA 3T6JA 3GZ1A 3NRHA 4GQHA 4GA2A 3ZUVB 2R9RB 2LXLA 1MYOA 4L6RA 4ZHBA 3LJBA 3SGHA 3TOMA 1UJKA 4BETA 3UT7A 1IKND 3NYMA 1E85A 3EG9B 2EPKX 1E2XA 2V26A 4PFPA 4JJGA 4H54A 4UUCA 4CRWA 2I1JA 1OR3A 3H2VA 5AQAA 1N52A 2Y3HA 2V5QC 1EA8A 4I3MA 5D66A 4RSYA 2L81A 2H7OA 3IQCA 3LPZA 3EHRA 5CRUA 3RO3A 1HZ4A 3S28A 3HNLA 2VSYA 3SNHA 3ZYLA 3L54A 2GRPB 4AIFA 1X5BA 2BTDA 4OIQF 1WOLA 2ZXOA 3FFLA 4YDEA 2WVIA 5ENPD 3AG4E 2OEXA 4ABNA 5G04J 4HFKB 5DLJA 2NUPB 2KM4A 2XLOA 4CJOA 1INZA 2X6HA 4GYOA 2XCCA 3FY4A 1YCSB 4AL1A 2ETCA 3JXJA 3UIPC 3RIBA 4XEVA 4WWNA 3JZ0A 4K5CA 1HY5A 4NCQA 3L82A 3A9CA 1JUQA 4RQIA 3LLKA 4ZFHA 2IOQA 4ME2A 2HV7A 3R7CA 4ER9A 4A4AA 1JCQA 4U0SA 1H9GA 3EHNA 3UGOA 3OA1A 3ZN3A 5ANRA 4KNWA 4I9CA 1V55C 3AU5A 1K8KG 4QFVA 4PJJA 3GEEA 3DMDA 1OXBA 4CCAA 3U8VA 2JEKA 2DYSE 2Z15A 1IXVA 3GANA 2XENA 4NTFA 2WXMA 1S64A 4IAOA 4B89A 4CSAA 5KJKA 3G2UA 3ULQA 3R9MA 4BJTA 2IXMA 4BJ6C 2WQHA 4GEHA 4HFGA 2J4BA 2R25A 4U0UA 3FTUA 3L6AA 1NFNA 4ZLDA 3AU4A 2VCBA 2VYIA 1J8MF 1S0PA 4EIYA 1Q0DA 1ELRA 1BR1A 3V5YA 1E84A 3EU9A 4C9BB 4HE8D 1FTSA 3ASNC 4JEUA 4DI4A 4GPKA 3G4XA 4DLOA 3B0PA 4MTFA 2QUPA 3UGPA 5CRVA 1FVHA 3JUEA 1EDUA 2NSGA 1RW2A 4GTQA 4IWBA 4U8YD 4N4WA 1U3DA 2Y0BG 3KKBA 1KLXA 1U2VG 2XRHA 1TFOB 1NL4A 4OAVB 4DJ9A 1HE8A 3US6A 3UX4A 2A69F 1KU2A 1RCPA 1LPEA 3L16A 2X3MA 3GWLA 1R5ID 1I5NA 2C2LA 4ILIA 3UUXA 3C8GB 4G25A 4ATGA 4J7TA 3P2BA 2YRFA 3SEOA 5T3WA 1AWCB 4U5FE 1Y6IA 1G4US 3W9GA 4BEMJ 3BQOA 3F46A 2BKKB 1H0AA 4MVQA 3NKDA 4XKBA 5FT9A 2VCCA 5EHHA 1FPPA 5KYYB 3S0XA 4DBQA 5AN8A 2GRLA 2YL1A 2YQYA 2WXLA 4I2WA 4BSXA 2OVBA 1KT0A 5E75A 2BL2A 1PV3A 5T3TA 2OQMA 3DBSA 1HX8A 2M63A 4H7XA 3U9WA 4Z9HA 3DE9A 2MYOA 4JA7A 1CGNA 3G4ZA 2OEVA 3SZ7A 4GU5A 4CDRA 2YWAA 1JCRA 3ABME 3TG4A 3ZW3A 3L08A 4AY5A 3CVWA 4DVZA 4O6MA 1E8XA 4ANUA 5T8IA 1ZU4A 3U66A 2NC9A 5AJDA 3CVVA 1OWOA 2HUJA 5T4YA 3NDBB 1MNDA 3J5PA 4GZ3A 5JJTA 2JPUA 2R7QA 2ZGGA 4KT6B 2E87A 3FTZA 1BI8B 3CSFA 1D8DA 2XGOA 4OAUC 3WODF 3IKOB 3KPHA 1C17M 3EIJA 2Q9BA 2QE9A 3Q7FA 4IGGA 2NUPA 5BV0A 4O1PA 1FFHA 4U8HA 1D1BA 3Q9NC 4HI8A 3AJMA 3D9HA 2WMNA 1N54A 1ZHYA 4UWFA 2XLWA 1Q0MA 2PNOA 3MYVA 1Q0FA 1S05A 2XLMA 1RJ9A 4I17A 5BXOA 1EPUA 3UKRG 4WJ0A 3SXYA 4EHMA 2V4HC 2WL8A 2F22A 5G04C 1TR2A 3RJVA 3RRNB 2R7OA 2J9QA 1PAQA 4PDXA 4B94A 4Q69A 1Z63A 3Q7AA 2I8BA 4MVMA 3UNGC 4K03A 1UFBA 4JCHA 1FR0A 4JW1A 2PX0A 4JB8P 5DS4A 1G8XA 1EKYA 4MW8A 4RDAA 1P5QA 2DIWA 3V31A 2XL4A 1TN6A 1RZ4A 2OG2A 1JR8A 2IU1A 1DOVA 2CFUA 3QTHA 4HS2A 1A7DA 2XL6A 4KZCA 2GAQA 2FF4A 2Y69E 4EZLA 3MX3A 3NG1A 4OIOF 4XE0A 2DYRE 3WG7E 1XNFA 1BR4A 5CERB 3SBSA 4E6HA 5L3VA 2I9CA 2XGSA 5JMND 5CEDB 4M7CA 3MZLB 4CX9A 4I2ZA 4N3CA 5FQ4A 2IYLD 5L0DA 3MKQB 2YZSA 5DQZA 1G5ZA 2J09A 2VGXB 3LS1A 3JXIA 4FHKA 5CMYA 5FTPA 4J7YA 1HG5A 1BBHA 4JEBA 2XPIA 2FEZA 3TULA 2GROB 1MQSA 2RFMA 4A3TA 4CDAA 2QYUA 2AXVA 1N4QA 3CLJA 5KWDA 4J7WA 1EQ1A 3QZCA 1ZHZA 3MCXA 3HNIA 2H6FA 5T3RA 3VLFA 1ZZPA 3QVYA 1U6HA 3TXNA 4MS6A 3FH5A 4MVUA 4CDNA 3W2VA 1K1AA 4DX6D 4GCNA 3S29A 4CGVA 2PX3A 4Z9IA 2J9VA 2YL7A 2KXPC 4Q94A 3S2AA 5JVEA 4QQIA 2WVNA 4WNEA 5LFAA 3Q47B 3RW0A 4GYWA 3FUJA 3Q79A 3ABMC 5A6BD 3PUJA 5T1DB 3DSUA 2O9XA 5FZQA 1FT2A 4YVQC 1MQVA 2EPOA 1VMAA 4DRJB 1N9AA 1L3PA 5BNWA 2J9WA 4L2YA 5CI9A 1A7VA 4N5QA 1MMGA 1BPOA 4XQ1A 2NG1A 5B1BC 3POVA 1OW8A 4E0IA 2R7RA 1SZIA 3ZTZA 4TXPA 1TWAA 4XEKA 4UI9J 4L23A 3G50A 4PS8A 3S7JA 2Q4FA 3KAEA 5AQ7A 4JRZA 4GTMA 4RG9A 4ILHB 4B93B 3TK0A 5ITZF 1ZU2A 1Z3XA 4OIRF 2Y3AA 3GW4A 2LFDA 2WXPA 3FXHA 2J8SD 4N3AA 1UW4B 3TD7A 3C3RA 3UTMA 3FU0A 3HXBA 5H7PA 2JX0A 2VSOE 2VSNA 4HRLA 1H2VC 4DXWA 3PUKA 2VC9A 3VF0A 3PZ1A 4U8VD 3SY2A 4GB9A 4JHJA 4P6IC 2LUHA 1C03A 3OXGA 4JHRA 1QVXA 3ULEG 4GZDA 1H19A 4XEFA 5BUOA 3FU5A 4N3BA 4M3OA 2X38A 2QLAA 1N1CA 4WGYA 3AQCA 3MFNA 3SBTB 2WPVA 3U2LA 4FADA 2FAPB 4BG0A 3D9IA 1J8YF 5HSWA 4RG6A 3UMHA 3GYZA 1LI7A 2KJGA 2LQGA 3EUVA 2V3CC 3AG3E 5DS5A 3LVRE 1MX2A 2A6EF 5FINA 3SNXA 4AXHA 2QC9A 1AEPA 3HNKA 4AL0A 4LSZE 4BT9A 3MYIA 2DGJA 2A5EA 4GTTA 2H6IA 4C3BA 2ICWG 3FHDA 3MEKA 1TWHA 4EKWA 2Y69C 5BQGA 3SZRA 3UMIA 3B7UX 3F6QA 2B0OE 2ZXWE 2XM4A 3N0TA 1SA5A 4EZJA 2ZXRA 1QNFA 1OCRC 4PH4B 3VTYA 3GM1A 3CKCA 3UI2A 1Z23A 2GDCA 2ZXWC 3B13A 1E96B 3FP3A 4AP2A 3PE3A 3BEHA 2C0LA 5G05J 1SR2A 3FVYA 1PC2A 5AAOA 2HS5A 4E18A 4U96D 3LVQE 1NU7D 1ORYA 2Q00A 3ASGA 4WABA 3SP1A 4P9TA 2IEJA 3ONKA 4BJ5C 2FGYA 4EHPA 2LAIA 3AG3C 2VQ2A 2AWIA 4O6NA 1GW6A 2J4DA 4JZAA 3BEEA 1WN0A 1LF8A 1M2VA 4BSZB 3LEWA 4WWPA 5JUAA 1TNYA 3NB2A 2Y3GA 4TRQA 3DI5A 3KH2A 2EIJE 2OJED 1IHBA 2YLGA 2J7PD 4GYTA 4JPSA 3UKUG 3M15A 1GS9A 4EWCA 3L0IA 4LDKA 1I4ZA 5HQ8A 4XEIG 4O60A 2IM8A 3ZIBA 2ZIRA 2VH3A 5JRAA 3W2WA 5L0GA 4HNAD
chains in the Genus database with same CATH topology
3DAGA 4I1MA 3CQZA 2R7SA 4XWJA 1OWLA 3MGBA 4KYOB 2OOEA 3N71A 3CIAA 3UR3C 1KT1A 4J0UA 3B7SA 3FUKA 2LO6A 3RH3A 3CVPA 4MLPA 4PUCA 4WNDA 3D9PA 2WXOA 3MA5A 4LEUA 4N39A 3X1OA 5KYXB 3ZPJA 3KS2A 2NXPA 4AY6A 2IQCA 3CHMA 5EDSA 4C3DA 3CVXA 4GZ5A 4D10C 2IXOA 2M4EA 4Q7CA 3AQBA 3ZHEB 3CSKA 3BG1B 4G1TA 4A1SA 4IRUA 3F47A 3ZG1A 1HU3A 3Q7LA 3K9IA 3TXMA 4UWGA 1TJCA 3CSTA 1OKKA 3FUEA 3PREA 2PFDA 5F5FA 4TUUA 5DVWA 2Q9AA 1OCOC 3Q4AB 2A68F 1EF1C 4O7GA 5E33A 2LAHA 2WXIA 4I6EA 5JJ6A 1VOMA 4V3IA 4N06A 1LVKA 3LY9A 3JSZA 3LCAA 2WXJA 3FWVA 3DM5A 4F7AA 4N2QA 3QNKA 4GCOA 4PS7A 4JVSA 4J30B 3VYWA 1IZMA 3SHFA 3EDTB 5EKQD 4URKA 2YINA 4FP7A 3HYMB 5AYWD 4G24A 2YHSA 3TAXA 3UMKA 4OINF 2EIKC 4K0RA 2WM9A 1L5JA 3ZSUA 4KMOA 1LKXA 1IQUA 2CNWD 4G2VA 2XXAB 2Q9CA 3APFA 3CV0A 4WNGA 3RRMB 3FUDA 3EPVA 1TJFA 3ML8A 3MV2B 2DYRC 4B6IA 3U64A 4NQ0A 5JJ7A 4EPZA 3ZYMA 4IULA 4BJ6A 4U5DE 4J8DA 5CCMA 3ESKA 3UMVA 1QZXA 1Z6TA 3EH2A 4E7SA 1D1AA 3D9MA 3SD5A 3S7BA 4A2NB 5KYUA 1HF8A 3HHMA 5L3QA 2L9JA 1ELWA 1QLEC 3FEXA 3FDHA 1SZ9A 2QFCA 2XCBA 3Q15A 1ZHXA 1HFAA 5LP0A 2CG3A 3W8IA 2Q7FA 1E7VA 3U4TA 3CKBA 4AJWA 1UN8A 4GZ6A 3EHMA 1B89A 3K1HA 2WXKA 1HH8A 3FU3A 4I43A 4XLNF 4BJ5A 4U5GA 3ZIMA 4APFA 4FU3A 3ML9A 4HLEA 4ULWA 4NACA 2MHKA 3MJWA 5B3SC 2NUTA 4B8AA 1ZU5A 3PZDA 2PF4E 1OUVA 2WXFA 4H4KC 2L0IA 1ST6A 4LUNU 2MYSA 1HXIA 4QI2A 4FESA 4O6YA 2P6VA 2CHWA 5D91A 3CHQA 4APOA 4K7BA 3DXJF 1MMAA 3QMKA 4F3VA 3FUIA 2BE5F 3DPDA 4BT8A 1E7UA 4JXTA 3R7QA 4O6FA 3EG9A 5AENA 1NP7A 1MMDA 3JRTA 4ANWA 3I4RB 4EBBA 3URZA 4FC8A 4CS8A 5G05C 4XI0A 1O87A 3X2QC 1OWMA 1WAO1 2CHZA 4OIPF 4FLBA 3AS4A 4KVMA 1TWCA 4OD5A 3CR3A 2OV8A 2KCKA 3NQPA 2Q3TA 4F4BA 2V4LA 4YN0B 2HR2A 5EX3A 5G55A 3B0UX 4AEZC 3LXUX 2MOWA 2XXAA 3ABKC 4YT4A 3ONLA 1VDYA 1SF8A 3G2TA 3K7DA 4H7YA 3CK7A 5FQ7A 3LLIA 2XGMA 2IF4A 1IYGA 3FTVA 4CEMA 4UQYA 2I6HA 1VYKA 1OWNA 3RIPA 5BT1A 2HYZA 3M1CB 4N2SA 3EZHA 3PE4A 3EGDA 4CS9A 4J6IA 3O6XA 2IONA 3CVNA 2WXQA 4QDLA 4G23A 4BWRA 4QI0A 2J0XA 4JHKA 2WVOA 1E8ZA 3CQGB 4Y6CA 1FCHA 3JQ1A 4GYYA 3Q7GA 1M56C 4C7OA 4B0ZA 1D0YA 3QARA 3B7RL 2DCPA 3NZUA 4PJMA 3H65A 4UWLA 4P29A 1QQEA 3PHF2 4MKTA 4I6GA 3KL4A 4F53A 3Q49B 4YNDA 4WNFA 3PDNA 2KATA 3MKQA 4XZ4A 4JC8A 3FTWA 2VJ8A 1Z5ZA 2KCLA 4FJZA 3FHEA 4BY6A 3JCKC 2HM8A 3HLZA 5FCLA 5E3CA 3IBEA 4AK9A 5FWQA 4KC9A 3RU0A 5AIJA 3FTSA 2FFHA 4YT2A 5LCWJ 2C03A 4C3EA 5E2QA 4RBNA 1FMWA 2PQRA 3ZXSA 3PNTB 2XQ0A 3AG2C 4ANVA 2P7VA 3EGDB 2UY1B 5FZRA 1UN9A 3SYNA 3ZEFA 2W45A 4G7HF 1M2OA 5A7DB 1H2UA 3IHVA 3IEEA 2WQ6A 3QWVA 1Z3YA 3VLEA 3QOUA 4G7OF 4KNVA 4CGWA 3LKUA 2QY9A 4LRZA 3KEZA 5D0OD 5BUZA 4RVBA 3EQLF 4BEJA 4UQXA 4CT0A 4MRUA 1NA0A 3LJ3A 3RFYA 4C0MA 3PEUB 1E90A 2QY7A 2L9BA 3UT8A 5DS6A 3D9NA 4GMJA 1TKNA 3CZ6A 4CS7A 3EGXB 1OWPA 2G3KA 3G2SA 3I3NA 3ASOC 5CI8A 4I6JA 4XKCA 2KGOA 3K6BA 2IOSA 4LACB 4LLEA 5ANLA 4XLPF 3CEQA 3BG0B 4CS9C 2LSUA 4AOFA 4NRHB 1WY6A 2EIJC 2R7TA 3PEVB 3CVLA 1ZYRF 2FO7A 3OXLA 3RKVA 3LAYA 4U63A 4WAFA 1JWGA 2UY1A 2X6JA 3UQ3A 3CK8A 3FTYA 3NF1A 2ZPAA 1SMYF 2RD0A 1TEZA 2GW1A 4G0HA 3FEYA 2ONDA 2VTBB 5IY5C 5ARGA 3CHSA 1H6KA 4E7ZA 2PQNA 3L22A 4KZ0A 2CG2A 4W8KA 3O39A 4OYSA 4IN3B 4MNDA 3U3WA 3WG7C 3E70C 2A1DD 5KYNA 3B9QA 1UG3A 5F5HA 1MNEA 4JL0A 3Q6MA 4FX5A 1UJJA 5LCWC 1PD0A 3ZYKA 2EILC 2JD3A 4OVVA 2R59A 2ZXPA 1HS6A 1NG1A 2WZFA 5D0QD 4YT8A 2WMOA 4G7ZF 2L0TB 2PM7A 3ZRHA 1OCCC 5CHEE 1LS1A 4PK4A 3L13A 2WB7A 3ECSA 4KBLA 2ILRA 1RJ9B 3EIQC 3PRZA 2EIMC 3I4UA 4L7TA 4WWOA 4FWVA 1EYHA 2KQ9A 4U5CE 3CVQA 5G2NA 3VLDA 3FUFA 2CDQA 3PH0C 4JA9A 5FQ8A 4C7OB 2J08A 5M72A 2P58C 4DBRA 4FHJA 2AVPA 4YVOA 4UI9C 3HVEA 3O4ZA 1U3CA 4Q96A 3V7OA 3FDQA 2CW0F 3KD7A 4FJYA 4NURA 3FULA 2WZLA 4GAAA 4DJAA 4AE4A 3JUIA 1DNPA 2EINC 3TGOA 3RK6A 4B8CB 3T4RA 2VSXE 3HDXA 3UT4A 3N24A 4PS3A 4BX9A 3ENEA 3FH7A 2VGXA 3Q6NA 3Q5MA 1XGWA 2R17C 4PJLA 4W9RA 2IJGX 4TV3A 2YHCA 1YA0A 3FUMA 3ZGQA 2R7WA 3CHPA 3CHOA 2A4ZA 3G2VA 5DBKA 1NZEA 3EGXA 5HI7A 3PS6A 1M57C 3AS8A 5LOZA 3LNRA 3MKRA 2KZTB 2R7XA 3EFOB 2QTVA 2BF0X 3NYJA 4U5HA 2VTBA 4JZYA 4NY3A 3IV0A 2GFHA 4ANJA 2E0IA 4R7LA 2JLBA 2X6IA 3FUHA 1PCXA 3QWWA 5FQ6A 5BV1A 4DK5A 5DIZA 2A6HF 4FULA 1V54C 4HORA 2Y4TA 2YNQA 1A17A 4J8SA 1D1CA 2PM6A 2Y3DA 5B1AC 3TG5A 1E8WA 4UQZA 4GMLA 2WZGA 3L17A 3CK9A 3MV3B 2IOLA 1HO8A 4I1OB 1OKKD 3PMRA 5KYYA 4UI9K 3ZYQA 1PD1A 4U07A 1D0XA 3DZAA 4ACLA 5JHAA 2V0PA 1VK5A 4IJJA 3DM9B 4X0RA 2IFUA 5KJLA 4K0DA 4EBAA 2XPZA 3D9JA 4RD9A 1SZAA 4OD4A 1FVFA 2WXRA 2AW6A 2GRMA 3K66A 3RRUA 2V8SE 3T8MA 3ZHEA 2AXUA 5KCMA 2C0MA 4DOZA 3ABLC 1FFTC 2J49A 4YWQA 4ZLCA 2X6FA 4E85A 2R7UA 4AE4B 5DQTA 4MQ9F 4HXIA 3SI5A 2HV6A 3NKEA 2D5RB 3EJNA 5AJLA 4JURI 3QK0A 3HVEB 3T5XA 2B0JA 2RG8A 4I44A 3L34A 3JT1A 4CIHA 2WXNA 3QDNA 3LS0A 3LESA 2UWJG 4FA6A 4Q4ZF 4ILGA 1E8YA 5BPPA 2PZIA 4BTAA 4EECA 2J07A 2X51A 2J45A 1HG2A 3QAQA 3ESLA 5ARFA 4DI3A 4BJ1A 4HOTA 4IYPA 4KVOA 2W4MA 2OCCC 3E9VA 2IXNA 3EH1A 3AG4C 3RKOF 2KW3C 2WXGA 1O5HA 3HTKC 1SQMA 4HOSA 3S7FA 2VGYA 3DJNB 3AS5A 4ACKA 2PL2A 1IW7F 2I2OA 3DJUB 4AVXA 4Y6WA 2WVQA 3EFOA 2H7BA 4GA1A 5ENNA 1BR2A 3JYHA 4HEAJ 4A3VA 1Z6AA 2LSEA 2KZTA 2CGEA 3ZC4A 3G2WA 3FU6A 3WXXA 3R7RA 5EX0A 2WQ7A 4CT4A 2EQXA 3JCUQ 2VASA 3HJCA 2XPYA 1TWGA 2C04A 5KYWB 4A1GA 4L2LA 2G3VA 2CFZA 4CBEA 4GZCA 2LNIA 3FAJA 4UWHA 3CVUA 3K1IC 3GODA 1NA3A 4PJNA 1ELKA 4XI9A 4WUYA 5KYUB 4N5CA 2Y39A 3D9KA 4OVUA 4G26A 3QWPA 2J46A 3OEOA 3R9AB 4BX8A 1WGWA 4CDMA 1ZHWA 1M2VB 3LS8A 3VAYA 3LY7A 3FTXA 3JQ0A 4XX5A 4FLHA 1NZNA 5E76A 3OAWA 4AX2A 1JWFA 3IHYA 2BUGA 4DPRA 1W3BA 3ZVVA 2MWQA 2E2EA 2KC7A 3KMIA 4U5BE 2GGFA 2R5SA 4XTKA 3FUNA 3CVYA 3ASHA 2Y3BA 2NSZA 3PVLA 5FJYA 4C0EA 3T6BA 3RYLA 3RO2A 1VYIA 2HO1A 2KNHA 3T5VA 3NYLA 4PFOA 2YQ8A 3JYSA 2J0WA 2FULA 3D9OA 4ANXA 5J08A 2W4BA 3CHRA 5KJNA 3ZVRA 3ITFA 4YT5A 3LEVA 3D3MA 3UPVA 1NU9C 1MMNA 3S7DA 5FZSA 4DLQA 2CHXA 3MLGA 2XSEA 4HFFB 3E4BA 3LDZA 2R7VA 1H2TC 5A23A 2PP4A 5D92A 3N2ZB 5CCLA 2I1KA 2J7PA 4JEHA 4M63A 1MHQA 4J8FA 4CS8C 2ZU6B 2V5FA 5BW8C 1Y8MA 5A6CA 3QKYA 3OWTA 3GZSA 3W8HA 1FMVA 3AG1C 3SFZA 4U0ZA 3OXFA 5CMWA 2DBAA 5KYWA 2W9YA 3OTNA 4JJFA 2YHEA 4J8EA 4Q5SF 4A55A 1IQRA 3SF4A 5LX8A 4HOQA 4I1AA 3VTXA 4L1BA 5C2YA 1JPLA 4LCTA 3NZSA 3GZ2A 3LYAA 2WXHA 1JPJA 1PY1A 3B7TA 4HVBA 4U04A 4I9EA 3CQCB 3QJZA 4F1SA 1W2WA 2IXPA 4AM9A 1WM5A 3TL5A 2NUTB 2LSVA 1JPNA 3FH8A 4BFRA 3DD7A 3LY8A 3PNLB 3D9LA 2VB6A 1S7ZA 3I4GA 3IEGA 2XHEA 4O79A 5JHBA 3CGHA 1Z3IX 2OVFA 4KBQA 1OCZC 3K33A 2WB2A 2FBNA 3I5PA 2MRIA 4BTBA 2Y4UA 3EZIA 4EBAG 2AXZA 1IHGA 4LERA 3C98A 2DYSC 2A5UA 2G62A 2CNWA 1DVPA 3DAFA 5J90A 3ASFA 4UWKA 5E3AA 4HOUA 5EGYA 3O48A 4KI2A 4LLCA 4YJWA 2L6JA 3ZFWA 1D0ZA 2H7VC 4GA0A 2XRYA 5KYXA 3QB2A 3APCA 3B0VC 2X6KA 4G11A 3HIZA 3APDA 4J32B 5KJMA 3I5QA 4KXKB 1ZBPA 2XEVA 4DVYP 1ZHTA 4EZKA 3QC1A 1QZ2A 4AV7A 2XRZA 3ASDA 4EQFA 2FI7A 4U5EE 3TJPA 5C1DA 4XIFA 2YEVA 4CSAC 2KCVA 2J9UA 3S27A 3P1UA 3T6JA 3GZ1A 3NRHA 4GA2A 3LJBA 3SGHA 1UJKA 3UT7A 3NYMA 3EG9B 2V26A 4PFPA 4JJGA 4CRWA 2I1JA 1N52A 2Y3HA 4I3MA 4RSYA 2L81A 2H7OA 3LPZA 3RO3A 1HZ4A 3S28A 2VSYA 3SNHA 3ZYLA 3L54A 4AIFA 1X5BA 2BTDA 4OIQF 2ZXOA 3FFLA 2WVIA 4ABNA 5G04J 4HFKB 5DLJA 2NUPB 2KM4A 1INZA 2X6HA 4GYOA 2XCCA 3FY4A 3RIBA 4WWNA 1JUQA 3LLKA 2IOQA 4ME2A 2HV7A 4U0SA 3OA1A 3EHNA 3UGOA 3ZN3A 5ANRA 4KNWA 4I9CA 3AU5A 1V55C 4QFVA 4PJJA 3DMDA 4CCAA 2JEKA 2Z15A 3GANA 2WXMA 4IAOA 4B89A 4CSAA 5KJKA 3G2UA 3ULQA 4BJTA 2IXMA 4BJ6C 2WQHA 4GEHA 4HFGA 2J4BA 4U0UA 3FTUA 3L6AA 4ZLDA 3AU4A 2VYIA 1J8MF 1S0PA 1ELRA 1BR1A 4C9BB 4HE8D 1FTSA 3ASNC 4JEUA 4DI4A 4GPKA 4DLOA 3B0PA 3UGPA 1FVHA 1EDUA 4IWBA 1U3DA 3KKBA 1KLXA 2XRHA 1HE8A 3UX4A 2A69F 1KU2A 3L16A 2X3MA 2C2LA 4ILIA 3UUXA 4G25A 4ATGA 3P2BA 3SEOA 5T3WA 4U5FE 1Y6IA 3F46A 1H0AA 3NKDA 4XKBA 5FT9A 5EHHA 5KYYB 3S0XA 4DBQA 2GRLA 2WXLA 4I2WA 4BSXA 2OVBA 1KT0A 5E75A 5T3TA 3DBSA 1HX8A 2M63A 4H7XA 3U9WA 4JA7A 3SZ7A 4GU5A 4CDRA 3TG4A 3ZW3A 3L08A 4AY5A 3CVWA 4DVZA 4O6MA 1E8XA 4ANUA 5T8IA 1ZU4A 3U66A 2NC9A 5AJDA 3CVVA 1OWOA 5T4YA 3NDBB 1MNDA 4GZ3A 5JJTA 2R7QA 4KT6B 2E87A 3FTZA 3CSFA 2XGOA 3WODF 3IKOB 3EIJA 2Q9BA 2NUPA 5BV0A 1FFHA 4U8HA 1D1BA 2WMNA 1N54A 1ZHYA 4UWFA 3MYVA 1RJ9A 4I17A 1EPUA 4WJ0A 5G04C 2WL8A 1TR2A 3RJVA 3RRNB 2R7OA 2J9QA 1PAQA 4PDXA 4B94A 4Q69A 1Z63A 2I8BA 3UNGC 4K03A 4JCHA 4JW1A 2PX0A 5DS4A 1G8XA 4RDAA 1P5QA 2DIWA 2XL4A 2OG2A 2IU1A 2CFUA 4HS2A 4KZCA 2FF4A 4EZLA 3MX3A 3NG1A 4OIOF 4XE0A 1XNFA 1BR4A 3SBSA 4E6HA 5L3VA 2I9CA 2XGSA 3MZLB 4I2ZA 4N3CA 5FQ4A 2IYLD 3MKQB 2YZSA 5DQZA 2J09A 2VGXB 4FHKA 5CMYA 3LS1A 5FTPA 1HG5A 2XPIA 2FEZA 1MQSA 4A3TA 2AXVA 3CLJA 3QZCA 1ZHZA 3MCXA 5T3RA 3VLFA 3TXNA 4MS6A 3FH5A 4CDNA 3W2VA 4CGVA 4GCNA 3S29A 2PX3A 2J9VA 4Q94A 3S2AA 2WVNA 4WNEA 5LFAA 3Q47B 4GYWA 3FUJA 3ABMC 3PUJA 5T1DB 2O9XA 5FZQA 4YVQC 1VMAA 5BNWA 2J9WA 4L2YA 5CI9A 1MMGA 1BPOA 2NG1A 5B1BC 3POVA 2R7RA 1SZIA 1TWAA 4UI9J 4L23A 4PS8A 3S7JA 3KAEA 4RG9A 4ILHB 1ZU2A 1Z3XA 4OIRF 2Y3AA 3GW4A 2WXPA 4N3AA 1UW4B 3TD7A 3FU0A 2VSOE 2VSNA 1H2VC 3PUKA 4GB9A 4JHJA 4P6IC 3OXGA 4JHRA 4GZDA 1H19A 3FU5A 5BUOA 4N3BA 4M3OA 2X38A 1N1CA 3AQCA 3SBTB 2WPVA 4FADA 4BG0A 3D9IA 1J8YF 5HSWA 4RG6A 3UMHA 3GYZA 2KJGA 2V3CC 5DS5A 3LVRE 2A6EF 3SNXA 4AXHA 4BT9A 2DGJA 4C3BA 3FHDA 3MEKA 1TWHA 2Y69C 3SZRA 3UMIA 3B7UX 3N0TA 4EZJA 2ZXRA 1QNFA 4PH4B 1OCRC 3VTYA 3CKCA 1Z23A 2ZXWC 3B13A 1E96B 3FP3A 4AP2A 3PE3A 2C0LA 5G05J 3FVYA 1PC2A 3LVQE 1NU7D 3ASGA 3SP1A 3ONKA 4BJ5C 2FGYA 2LAIA 3AG3C 2VQ2A 2AWIA 4O6NA 1GW6A 2J4DA 4JZAA 3BEEA 1LF8A 1M2VA 3LEWA 4WWPA 2Y3GA 4TRQA 3KH2A 2J7PD 4GYTA 4JPSA 4EWCA 3L0IA 5HQ8A 3ZIBA 2VH3A 3W2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JW1 A;  4I1M A;  4JVS A;  4IRU A;  4I1O B; 
#chains in the Genus database with same CATH topology
 3DAG A;  4I1M A;  3CQZ A;  3DSV A;  2R7S A;  4XWJ A;  1OWL A;  3MGB A;  4IAQ A;  1U0B B;  4KYO B;  3L1M A;  2OOE A;  1CGO A;  3N71 A;  3U9J A;  3CIA A;  3UR3 C;  1KT1 A;  5BQH A;  4J0U A;  1NSG B;  2HFI A;  3B7S A;  3FUK A;  2LO6 A;  3V5Z A;  3RH3 A;  3CVP A;  4MLP A;  2VCA A;  3NBN B;  4PUC A;  4JD2 G;  5KNH D;  3LEO A;  4WND A;  3D9P A;  2WXO A;  3MA5 A;  4LEU A;  4N39 A;  3X1O A;  2NPU A;  5KYX B;  3ZPJ A;  3KS2 A;  2NXP A;  4AY6 A;  2IQC A;  3CHM A;  5EDS A;  4C3D A;  3CVX A;  4GZ5 A;  4D10 C;  2IXO A;  2M4E A;  1BDJ B;  4Q7C A;  3AQB A;  3ZQY A;  3ZHE B;  3CSK A;  5EID A;  4G8L A;  1TYQ G;  1TQG A;  3BG1 B;  4G1T A;  4A1S A;  4IRU A;  5A6B A;  3F47 A;  3NMK A;  4MTO A;  3ZG1 A;  1HU3 A;  4GTR A;  4DX5 D;  3Q7L A;  3K9I A;  3TXM A;  4UWG A;  1TJC A;  3CST A;  2I15 A;  1OKK A;  2DB4 A;  1KZO A;  3FUE A;  3PRE A;  2PFD A;  5F5F A;  3PDM P;  5DVW A;  4TUU A;  2Q9A A;  3WHN A;  1OCO C;  3Q4A B;  2EIL E;  2A68 F;  2OJQ A;  3A11 A;  1EF1 C;  4YDW A;  4O7G A;  5E33 A;  3ISM C;  2LAH A;  2WXI A;  4I6E A;  2XLE A;  5JJ6 A;  1LI5 A;  1VOM A;  4V3I A;  2HJM A;  4N06 A;  1LVK A;  3LY9 A;  3JSZ A;  3LCA A;  2WXJ A;  1V55 E;  3FWV A;  5HV9 A;  2EIK E;  3DM5 A;  4F7A A;  4N2Q A;  1TNU A;  4L9P A;  3QNK A;  4DRI B;  2YLD A;  4GCO A;  1XZP A;  2AU5 A;  4PS7 A;  4JVS A;  4J30 B;  3U5S A;  4CZ2 D;  3HKK A;  3IHU A;  3VYW A;  3TWX A;  2OOC A;  1IZM A;  5B1B E;  3SHF A;  3EDT B;  3R2P A;  5EKQ D;  3RF3 A;  2KC3 A;  4URK A;  2CYD A;  2YIN A;  4FP7 A;  3HYM B;  4HB5 A;  5HKP A;  5AYW D;  3BUA A;  4G24 A;  3S9O A;  2YHS A;  3TAX A;  3UMK A;  1H6G A;  4OIN F;  3SQV A;  3TWS A;  2EIK C;  4K0R A;  2WM9 A;  1L5J A;  5JSL A;  3ZSU A;  1V54 E;  4KMO A;  1LKX A;  3TOL A;  4MVR A;  1IQU A;  2CNW D;  4G2V A;  2XXA B;  3HXC A;  2Q9C A;  3APF A;  3CV0 A;  4WNG A;  3RRM B;  3FUD A;  4HRM B;  3EPV A;  1TJF A;  1YAR O;  3RQE A;  3ML8 A;  3MV2 B;  3KEA A;  3C72 A;  2DYR C;  4B6I A;  3U64 A;  4NQ0 A;  1N0R A;  5JJ7 A;  4EPZ A;  3ZYM A;  3AGU A;  1WAT A;  4IUL A;  4D4X A;  4BJ6 A;  2R2L A;  4U5D E;  5B3I A;  1JOG A;  4J8D A;  3PZ2 A;  5CCM A;  1D9S A;  5COM A;  1DOW A;  3ESK A;  5ENQ D;  3UMV A;  1QZX A;  1Z6T A;  3EH2 A;  3TWU A;  4E7S A;  1OQC A;  1D1A A;  3D9M A;  3SD5 A;  3S7B A;  4A2N B;  5KYU A;  1HF8 A;  3HHM A;  2X0C A;  5L3Q A;  2L9J A;  1ELW A;  1QLE C;  3FEX A;  3NOC D;  2ETS A;  1SZ9 A;  3FDH A;  2QFC A;  5ENS D;  2XCB A;  3Q15 A;  1HMD A;  1UOH A;  1ZHX A;  1HFA A;  5LP0 A;  2CG3 A;  3W8I A;  1VTM P;  5A6J A;  2Q7F A;  1E7V A;  4XPY A;  3U4T A;  2FO1 E;  3CKB A;  4AJW A;  4K5B A;  4LG6 A;  1UN8 A;  4GZ6 A;  3EHM A;  1B89 A;  1QYM A;  1HW1 A;  3K1H A;  2WXK A;  3HG0 D;  1HH8 A;  3FU3 A;  4I43 A;  4XLN F;  4BJ5 A;  4U5G A;  3ZIM A;  4APF A;  4FU3 A;  5AQ9 A;  3ML9 A;  4HLE A;  4ULW A;  5K0I A;  4NAC A;  3ZKJ A;  2MHK A;  3FOP A;  3MJW A;  3GM2 A;  5B3S C;  4GMR A;  2NUT A;  2LD6 A;  2RSE B;  4B8A A;  1ZU5 A;  3PZD A;  2B0H A;  5L0J A;  2PF4 E;  1OUV A;  2H8A A;  2WXF A;  4H4K C;  2L0I A;  1ST6 A;  4LUN U;  2VGE A;  1K40 A;  4BES A;  3JSE O;  2MYS A;  1OW7 A;  1HXI A;  1C02 A;  4QI2 A;  4FES A;  1KTM A;  3C8G A;  4O6Y A;  2P6V A;  4YDO A;  2CHW A;  5D91 A;  3CHQ A;  4APO A;  4K7B A;  3DXJ F;  1MMA A;  4HQD A;  1TN7 A;  4TXR A;  5TJ5 E;  3QMK A;  4F3V A;  3FUI A;  1FAP B;  2BE5 F;  1OT8 A;  3DPD A;  4BT8 A;  1E7U A;  4JXT A;  3J06 A;  3R7Q A;  256B A;  4O6F A;  2PNN A;  3EG9 A;  5AEN A;  1KPS B;  2KK1 A;  1NP7 A;  3VM6 A;  1MMD A;  2R02 A;  3JRT A;  3DEP A;  3RSE G;  4JTA B;  4ANW A;  3I4R B;  4EBB A;  4YL1 A;  3SO8 A;  3URZ A;  4FC8 A;  3TJ6 A;  3HXE A;  4CS8 A;  4GPM A;  5G05 C;  4XI0 A;  1O87 A;  2HSB A;  3X2Q C;  1QQ3 A;  1LD8 A;  1OWM A;  3GOR A;  3PCV A;  1WAO 1;  1Q2Z A;  3ZQV A;  2CHZ A;  1T01 A;  3AJI A;  5HRY A;  5HS0 A;  1QBQ A;  1X81 A;  4JCZ A;  4DRX E;  4OIP F;  2KSF A;  1TR4 A;  4FLB A;  4F6R D;  3V79 K;  3AS4 A;  4KVM A;  3C5R A;  1TWC A;  4OD5 A;  3CR3 A;  3V2O A;  4PAC A;  2OV8 A;  4TXQ A;  2KCK A;  3NQP A;  2Q3T A;  4F4B A;  4NIK A;  4GTV A;  1QPU A;  2V4L A;  4J8Y A;  4YN0 B;  2HR2 A;  5EX3 A;  5G55 A;  3U2M A;  3B0U X;  4NTB A;  2GA0 A;  4AEZ C;  3LXU X;  2EIN E;  2MOW A;  2XXA A;  4WGZ A;  3ABK C;  4YT4 A;  3ONL A;  1VDY A;  1SF8 A;  3G2T A;  2L6F A;  2HJ3 A;  3K7D A;  4H7Y A;  1LIH A;  4YL3 A;  3CK7 A;  1E83 A;  1F1M A;  5FQ7 A;  3LLI A;  2XGM A;  2IF4 A;  1IYG A;  4JKV A;  3FTV A;  1M6T A;  4CEM A;  4IAR A;  4UQY A;  1TN8 A;  1VYK A;  1OWN A;  3RIP A;  4BPM A;  2I6H A;  3DSS A;  5BT1 A;  4DRH B;  2HYZ A;  3LUT B;  3M1C B;  2CCY A;  4N2S A;  1RMV A;  3EZH A;  3U8P A;  3PE4 A;  3EGD A;  1N0Q A;  4CS9 A;  2GRR B;  4J6I A;  3O6X A;  2ION A;  3CVN A;  2WXQ A;  4QDL A;  3DRA A;  4G23 A;  4BWR A;  4QI0 A;  2ZIS A;  2J0X A;  3JRM O;  4GTP A;  4BEP A;  2XEE A;  2WVO A;  1E8Z A;  3CQG B;  4JHK A;  4Y6C A;  1O3U A;  1O1T A;  1FCH A;  2EIM E;  3Q73 A;  3JQ1 A;  4GYY A;  3IQ6 A;  2L6B A;  3Q7G A;  3JTL O;  1M56 C;  4C7O A;  5ENO D;  3E32 A;  4B0Z A;  1D0Y A;  3QAR A;  4U95 D;  3B7R L;  2DCP A;  3NZU A;  2OCC E;  4PJM A;  3H65 A;  4UWL A;  1Q0K A;  3ABL E;  4P29 A;  1QQE A;  2RKK A;  5L0H A;  3PHF 2;  1YAU O;  4MKT A;  1B68 A;  4I6G A;  1OXK A;  1Y4C A;  3KL4 A;  4LDQ A;  4F53 A;  1CGM E;  3Q49 B;  4YND A;  4WNF A;  5EK0 A;  3GWN A;  4MVZ A;  5FIO A;  2KAT A;  3PDN A;  2YVK A;  3MKQ A;  4DX7 D;  2A0B A;  3KYJ A;  2Q7R A;  4XZ4 A;  4JC8 A;  3FTW A;  4LDR A;  2VJ8 A;  1G4W R;  1Z5Z A;  3BRJ A;  2ASR A;  2KYH A;  2KCL A;  4FJZ A;  3TWV A;  3FHE A;  3ASO E;  2XM0 A;  4BY6 A;  1ORS C;  3JCK C;  2HM8 A;  3HLZ A;  1CPQ A;  5FCL A;  3DSW A;  3T9K A;  5E3C A;  3IBE A;  4E0H A;  4AK9 A;  5FWQ A;  4KC9 A;  1V4A A;  3C3O A;  3RU0 A;  5AIJ A;  3FTS A;  3RVY A;  2FFH A;  4YT2 A;  5LCW J;  2DZN A;  2C03 A;  3C3Q A;  2P0N A;  4C3E A;  1YYJ A;  5E2Q A;  3CAX A;  3SXM A;  4RBN A;  1FMW A;  2PQR A;  3ZXS A;  3PNT B;  4F1P A;  4Z9J A;  3AG2 C;  2XQ0 A;  3EU5 A;  4ANV A;  2P7V A;  1HE1 A;  1Z7Q c;  3TQO A;  3EGD B;  2UY1 B;  5FZR A;  3B71 A;  1UN9 A;  3SYN A;  3ZEF A;  2W45 A;  1XZQ A;  5FZT A;  2H6G A;  4G7H F;  1M2O A;  5A7D B;  1H2U A;  3IHV A;  2F8X K;  3E33 A;  2EPM X;  4EBK A;  3IEE A;  2WQ6 A;  3QWV A;  1Z3Y A;  1DCQ A;  3VLE A;  1H7I A;  3QOU A;  4MBG A;  3TWW A;  4O1O A;  4G7O F;  4KNV A;  4CGW A;  3UIO C;  3LKU A;  2QY9 A;  4A63 B;  1JMW A;  4LRZ A;  3KEZ A;  5D0O D;  5BUZ A;  4JTC B;  4RVB A;  3EQL F;  2L7A A;  4BEJ A;  4UQX A;  4CT0 A;  3QW0 A;  4MRU A;  2DWZ A;  1NA0 A;  2LIG A;  3LJ3 A;  3RFY A;  4C0M A;  2IBF A;  3PEU B;  1E90 A;  2QY7 A;  2L9B A;  3UT8 A;  4YDY A;  5DS6 A;  3DXK G;  3D9N A;  4GMJ A;  1TKN A;  3CZ6 A;  4CS7 A;  3KSQ A;  5CIV A;  4GTS A;  3EGX B;  4MS2 A;  1OWP A;  2YKZ A;  3ULY A;  5KNG A;  2G3K A;  1RKC A;  3G2S A;  2F37 A;  3I3N A;  1O1S A;  3ASO C;  5CI8 A;  4I6J A;  3UM3 A;  1N95 A;  4XKC A;  3IQ5 A;  2KGO A;  3K6B A;  2IOS A;  4LAC B;  4LLE A;  3L8J A;  5ANL A;  3NMJ A;  4XLP F;  3CEQ A;  4MVS A;  4U9D A;  3BG0 B;  4CS9 C;  2LSU A;  2EPL X;  1CPR A;  4AOF A;  4NRH B;  1WY6 A;  2EIJ C;  2R7T A;  3PEV B;  3CVL A;  1ZYR F;  2FO7 A;  5JS5 A;  4NC3 A;  1WAS A;  2P2C P;  3OXL A;  3RKV A;  4HRN A;  2AWY A;  3LAY A;  3AG2 E;  3AGT A;  4U63 A;  4WAF A;  1JWG A;  2UY1 A;  1NBB A;  2X6J A;  3UQ3 A;  2AVK A;  3CK8 A;  3FTY A;  3NF1 A;  2ZPA A;  1SMY F;  2YLI A;  3GEI A;  2RD0 A;  1TEZ A;  2GW1 A;  4G0H A;  3FEY A;  2OND A;  2VTB B;  2XZT G;  5IY5 C;  1N94 A;  5CBO A;  5ARG A;  3CHS A;  1H6K A;  4E7Z A;  1KZP A;  2PQN A;  3DPY A;  1AP7 A;  3L22 A;  3C63 A;  4KZ0 A;  2CG2 A;  4W8K A;  3RAU A;  3O39 A;  2EPN A;  1R4T A;  4OYS A;  4IN3 B;  4MND A;  2HMZ A;  3U3W A;  1T6Q A;  3WG7 C;  4CIP A;  4D4N A;  2YL0 A;  3SXK A;  3DWL G;  5D2M C;  3E70 C;  5EIL A;  2A1D D;  2OU6 A;  3DKA A;  5BXU A;  3KSL A;  5KYN A;  3B9Q A;  4XPX A;  1UG3 A;  4JEA A;  5F5H A;  2YL3 A;  1MNE A;  1LE4 A;  4JL0 A;  3Q6M A;  4FX5 A;  1A0B A;  1UJJ A;  5LCW C;  4IB4 A;  1PD0 A;  3ASN E;  1N4S A;  3ZYK A;  2EIL C;  2JD3 A;  4OVV A;  1SW6 A;  2R59 A;  2ZXP A;  1HS6 A;  1NG1 A;  2WZF A;  2IO3 C;  4RLY A;  1JRA A;  5D0Q D;  4YT8 A;  1WTY A;  1GM5 A;  3PZ4 A;  1YA9 A;  5EYP F;  2WMO A;  3X2Q E;  4JIO A;  4G7Z F;  2L0T B;  1YVI A;  2PM7 A;  3ZRH A;  1OCC C;  2JAB A;  5CHE E;  1UG7 A;  1LS1 A;  4PK4 A;  5AQB A;  3L13 A;  2WB7 A;  4K1O A;  5JA4 D;  3ECS A;  1YYX A;  4KBL A;  1RJ9 B;  2ILR A;  2AP3 A;  3EIQ C;  3PRZ A;  2EIM C;  3I4U A;  4L7T A;  4WWO A;  4FWV A;  3ZWI A;  1EYH A;  2KQ9 A;  4U5C E;  4LNG A;  3CVQ A;  5G2N A;  5AAR A;  3VLD A;  3FUF A;  2CDQ A;  3PH0 C;  3C8G D;  4JA9 A;  1N4P A;  5FQ8 A;  2QYJ A;  2RD9 A;  4C7O B;  2J08 A;  3UXG A;  5M72 A;  2P58 C;  4DBR A;  1H9T A;  1TNO A;  4FHJ A;  1OCO E;  2AVP A;  3FMS A;  4EBJ A;  1WWP A;  2LXM A;  4YVO A;  1Y6D A;  4UI9 C;  3HVE A;  3O4Z A;  1U3C A;  4Q96 A;  3V7O A;  3FDQ A;  2CW0 F;  3KD7 A;  3VRC A;  2NYJ A;  3AG1 E;  2XEH A;  2D4U A;  4FJY A;  4NUR A;  3FUL A;  2WZL A;  4ONS A;  2F8Y A;  4GAA A;  4DJA A;  4AE4 A;  1BI7 B;  3JUI A;  1DNP A;  2LK4 A;  1NFI E;  2EIN C;  4ULV A;  3TGO A;  3B29 A;  3RK6 A;  3C62 A;  4B8C B;  3T9O A;  2ETA A;  2L6G A;  3T4R A;  2VSX E;  3HDX A;  3UT4 A;  3N24 A;  5B1A E;  2UUI A;  4PS3 A;  4BX9 A;  3ENE A;  3O10 A;  3FH7 A;  1OCR E;  2VGX A;  3Q6N A;  3E30 A;  1YZC A;  3Q5M A;  1YZA A;  5KBA A;  1XGW A;  2R17 C;  1BU9 A;  4PJL A;  3S90 A;  4W9R A;  2IJG X;  1V74 B;  4TV3 A;  2YHC A;  1YA0 A;  3FUM A;  3ZGQ A;  3V2X A;  2R7W A;  3CHP A;  3CHO A;  2A4Z A;  4NQF A;  3G2V A;  5DBK A;  1BZ4 A;  1NZE A;  1DCE A;  3EGX A;  1GQA A;  1MZC A;  3T6G B;  5HI7 A;  3PS6 A;  5JT4 A;  1M57 C;  3AS8 A;  5LOZ A;  3LNR A;  3HRA A;  3MKR A;  2KZT B;  2R7X A;  3PZ3 A;  5L0I A;  4N6C A;  3EFO B;  2QTV A;  2BF0 X;  3NYJ A;  4U5H A;  2VTB A;  4EUK B;  4JZY A;  4NY3 A;  1LS4 A;  4ATZ D;  3AOU A;  3IV0 A;  2GFH A;  1ZVZ A;  4ANJ A;  2E0I A;  4UDV A;  4CDY A;  2JLB A;  4R7L A;  2X6I A;  3FUH A;  1PCX A;  3BU8 A;  2OEW A;  1MX6 A;  3QWW A;  5FQ6 A;  5BV1 A;  3J5Q B;  4DK5 A;  5DIZ A;  2A6H F;  4FUL A;  1V54 C;  3V30 A;  5COF A;  4HOR A;  1GGQ A;  1OCZ E;  2Y4T A;  2YNQ A;  4LNB A;  1A17 A;  1D1C A;  2PM6 A;  2Y1L E;  4J8S A;  2OKU A;  2R03 A;  2Y3D A;  5B1A C;  4YL0 A;  3TG5 A;  1E8W A;  4UQZ A;  3Q75 A;  4P9F A;  4GML A;  1APC A;  4FAP B;  2WZG A;  3L17 A;  3CK9 A;  3MV3 B;  2IOL A;  1HO8 A;  4Z68 A;  4I1O B;  1OKK D;  2J9B A;  3PMR A;  5KYY A;  3SFY A;  3NMI A;  3ZNG A;  4UI9 K;  3ZYQ A;  1PD1 A;  4U07 A;  4GTO A;  1D0X A;  3GEH A;  3DZA A;  4ACL A;  1YJG A;  3M79 A;  1G3N B;  1NLX A;  5JHA A;  1YMP A;  2V0P A;  1VK5 A;  4IJJ A;  3DM9 B;  4X0R A;  2IFU A;  5KJL A;  2TMV P;  4K0D A;  4EBA A;  2XPZ A;  3D9J A;  1O1R A;  2XLD A;  4RD9 A;  3DST A;  2LFF A;  3U9M A;  1SZA A;  4OD4 A;  1FVF A;  2WXR A;  2AW6 A;  5CEA A;  5ENT D;  2GRM A;  3M4C A;  3K66 A;  3RRU A;  2P9S G;  3RQG A;  2V8S E;  1T6U A;  3C18 A;  1ZW2 A;  5A6A A;  3T8M A;  2GRQ B;  3ZHE A;  1Q0G A;  3DEO A;  2AXU A;  1AUE A;  5KCM A;  2C0M A;  4DOZ A;  1XWJ A;  3ABL C;  1JAF A;  1FFT C;  2J49 A;  4YWQ A;  2XZD G;  4ZLC A;  2X6F A;  4E85 A;  2R7U A;  4AE4 B;  5DQT A;  4MQ9 F;  1D8E A;  2HSQ A;  4K5A B;  4HXI A;  3TWQ A;  5JP7 A;  3SI5 A;  2HV6 A;  3NKE A;  2IO2 C;  2D5R B;  3EJN A;  4CJG A;  5AJL A;  4JUR I;  4DUI A;  3QK0 A;  3HVE B;  3T5X A;  2B0J A;  3UM1 A;  2RG8 A;  5CBN A;  4I44 A;  3L34 A;  3JT1 A;  4CIH A;  5GPG B;  2WXN A;  3QDN A;  3LS0 A;  3LES A;  2UWJ G;  4FA6 A;  4Q4Z F;  4JTD B;  4ILG A;  4MVO A;  1E8Y A;  2P9I G;  5BPP A;  2PZI A;  4BTA A;  4EEC A;  2J07 A;  2X51 A;  5IY5 E;  2J45 A;  1HG2 A;  3QAQ A;  3ESL A;  5ARF A;  4DI3 A;  3C8Z A;  4BJ1 A;  4XPW A;  5CEC B;  2HMQ A;  4HOT A;  4IYP A;  4X8Q A;  4KVO A;  2W4M A;  2OCC C;  3E9V A;  2IXN A;  3EH1 A;  3AG4 C;  3HNJ A;  3RKO F;  2KW3 C;  1FNT c;  1YDI A;  1OY3 D;  2WXG A;  1O5H A;  3HTK C;  3HXF A;  1SQM A;  3AAA C;  4HOS A;  3S7F A;  2VGY A;  3DJN B;  1H6O A;  3AS5 A;  4ACK A;  1TFK B;  2PL2 A;  1IW7 F;  1LTX A;  2I2O A;  1WG0 A;  3DJU B;  4AVX A;  2AJA A;  3U3B A;  4Y6W A;  2WVQ A;  1RXQ A;  2H7B A;  3EFO A;  4GA1 A;  5ENN A;  1BR2 A;  1TNB A;  2P9L G;  3JYH A;  3T8K A;  4HEA J;  1BD8 A;  4A3V A;  4PR9 A;  1ORJ A;  1Z6A A;  4JE9 A;  2LSE A;  4DX2 A;  2KZT A;  5L0C A;  2CGE A;  1K05 A;  3ZC4 A;  3G2W A;  1S70 B;  3FU6 A;  1QKR A;  3WXX A;  1K04 A;  3R7R A;  2XS8 A;  3B95 A;  3Q78 A;  1DC2 A;  5EX0 A;  2WQ7 A;  3FAP B;  3ZDL A;  4CT4 A;  2EQX A;  3JCU Q;  2VAS A;  3HJC A;  2XPY A;  5B3S E;  2RFA A;  1TWG A;  2C04 A;  5KYW B;  3JYY A;  4L2L A;  4A1G A;  3E34 A;  1SA4 A;  2G3V A;  3NAW A;  3ABK E;  2CFZ A;  4CBE A;  4GZC A;  2LNI A;  3FAJ A;  4N6H A;  4UWH A;  3CVU A;  3K1I C;  4C48 B;  4HLL A;  3GOD A;  1NA3 A;  1YYH A;  4PJN A;  1ELK A;  4XI9 A;  1VB5 A;  3LJN A;  4WUY A;  5KYU B;  4N5C A;  2Y39 A;  3ZU7 B;  2A0U A;  3D9K A;  4OVU A;  4G26 A;  3QWP A;  2P61 A;  2J46 A;  3OEO A;  3R9A B;  4BX8 A;  5JLI A;  5F28 E;  4JC7 A;  1WGW A;  4CDM A;  4LNU D;  1ZHW A;  1M2V B;  3LS8 A;  3VAY A;  1OW6 A;  3LY7 A;  2H6H A;  3U3F A;  2GWW A;  3FTX A;  1BLX B;  3JQ0 A;  1L7C A;  4XX5 A;  4FLH A;  1KNY A;  1NZN A;  1ZB1 A;  5E76 A;  3OAW A;  2NSF A;  4AX2 A;  1JWF A;  1AVO B;  3IHY A;  1H6P A;  2BUG A;  3W9F A;  4DPR A;  1W3B A;  3ZVV A;  1T5O A;  2MWQ A;  2M64 A;  2E2E A;  4MTG A;  2KC7 A;  1U89 A;  1QSP A;  3SFX A;  3KMI A;  4U5B E;  2GGF A;  2R5S A;  4XTK A;  3FUN A;  3CVY A;  3ASH A;  2Y3B A;  2NSZ A;  3FOO A;  3PVL A;  5A6K A;  5FJY A;  4C0E A;  3T6B A;  3RYL A;  1LD7 A;  3DE8 A;  3RO2 A;  1VYI A;  2HO1 A;  1JCS A;  2HKV A;  2KNH A;  4G78 A;  3T5V A;  3NYL A;  4PFO A;  1TNZ A;  2YQ8 A;  3JYS A;  2J0W A;  3TWT A;  1OCC E;  4U7E B;  2FUL A;  3D9O A;  4ANX A;  5J08 A;  2BKG A;  2HZ8 A;  2W4B A;  3SXZ A;  3CHR A;  4BER A;  2DZO A;  1RKE A;  1HMO A;  1O5M A;  1A41 A;  2LCH A;  5KJN A;  1LM3 B;  3TJ5 A;  2ZD9 A;  3ZVR A;  2BC5 A;  3IQT A;  3ITF A;  3DSX A;  4YT5 A;  3LEV A;  2XL8 A;  5BQI A;  3LNM B;  3D3M A;  3UPV A;  1NU9 C;  1MMN A;  3S7D A;  1NFO A;  2MHR A;  5FZS A;  4DLQ A;  2CHX A;  3MLG A;  2XSE A;  4HFF B;  2DI3 A;  2J8W A;  5A69 A;  3E4B A;  2F0Y A;  1E86 A;  3LDZ A;  2R05 A;  1SYQ A;  3L8I A;  2R7V A;  1H2T C;  1MX4 A;  5A23 A;  4YK5 A;  2PP4 A;  5D92 A;  4DX1 A;  3U0C A;  3N2Z B;  3WAQ A;  5CCL A;  2I1K A;  1Z5S C;  2J7P A;  4JEH A;  3UM2 A;  4M63 A;  1MHQ A;  4NTA A;  4J8F A;  4CS8 C;  2ZU6 B;  2V5F A;  5BW8 C;  5AC5 A;  2XLV A;  1Y8M A;  2P1A A;  5A6C A;  3QKY A;  3KYI A;  3OWT A;  1VLT A;  5AC4 A;  3GZS A;  3W8H A;  3EHQ A;  1FMV A;  3AG1 C;  3M4B A;  3SFZ A;  4U0Z A;  3OXF A;  5CMW A;  3GM3 A;  2DBA A;  3CEX A;  5KYW A;  2W9Y A;  3S84 A;  3OTN A;  4JJF A;  2YHE A;  4J8E A;  4Q5S F;  2P9N G;  4A55 A;  1IQR A;  1A5E A;  3SF4 A;  1FT1 A;  5LX8 A;  1HE9 A;  4HOQ A;  4I1A A;  5C2Y A;  4L1B A;  3VTX A;  2L6H A;  1JPL A;  1T6I A;  4LCT A;  2P9U G;  1OXJ A;  3NZS A;  3GZ2 A;  3LYA A;  3W4Y A;  2WXH A;  2XS1 A;  3QW1 A;  3K1I A;  1JPJ A;  1PY1 A;  3B7T A;  4HI9 A;  4HVB A;  4U04 A;  4I9E A;  3CQC B;  3QJZ A;  1WDY A;  4F1S A;  1W2W A;  2IXP A;  3IXE A;  1OR2 A;  4E17 A;  1WM5 A;  2NUT B;  2LSV A;  1JPN A;  3TL5 A;  4AM9 A;  3FH8 A;  2KBX A;  2XLH A;  4BFR A;  3RQF A;  3L9T A;  3UIN C;  3DWW A;  3DD7 A;  5EIB E;  3LY8 A;  3PNL B;  1K3Z D;  2B6C A;  3D9L A;  2VB6 A;  4U9E A;  1S7Z A;  5AGF A;  3I4G A;  3IEG A;  5ENR D;  2XHE A;  4O79 A;  5JHB A;  3QVZ A;  3CGH A;  1Z3I X;  2OVF A;  2QZA A;  3DXM G;  3NOG D;  2BED A;  3O55 A;  4MW3 A;  4KBQ A;  1OCZ C;  3K33 A;  2WB2 A;  2QNL A;  2FBN A;  3I5P A;  2MRI A;  4BTB A;  1ZW3 A;  2Y4U A;  3EZI A;  3ZTM A;  2IY0 C;  3H2U A;  2UUH A;  2AXZ A;  2P9P G;  1IHG A;  4EBA G;  4LER A;  3C98 A;  2DYS C;  4TUM A;  1VLS A;  2A5U A;  3Q9U C;  2G62 A;  2CNW A;  1LE2 A;  1DVP A;  1S63 A;  3DAF A;  2ZGD A;  5J90 A;  3ASF A;  3ZXP A;  4UWK A;  5E3A A;  4HOU A;  4CDV A;  1T9K A;  5EGY A;  3O48 A;  4KI2 A;  4LLC A;  1NI1 A;  4YJW A;  4G8K A;  2L6J A;  2ETB A;  3ZFW A;  2HE0 A;  1D0Z A;  2H7V C;  2P9K G;  4GA0 A;  2XRY A;  5KYX A;  3QB2 A;  5EYL A;  1SVX A;  3APC A;  3E37 A;  3B0V C;  2X6K A;  3RVZ A;  4G11 A;  3HIZ A;  3MYF A;  3APD A;  4J32 B;  1K1B A;  1MJ0 A;  2AWC A;  5KJM A;  1RKE B;  3I5Q A;  2DVW A;  4KXK B;  1I4Y A;  1ZBP A;  3C7J A;  2PBE A;  3IPM O;  3ATP A;  5EN5 D;  2XEV A;  3V5X A;  4DVY P;  2GRN B;  1ZHT A;  3UM0 A;  4EZK A;  3MBG A;  5COG A;  3QC1 A;  1N4R A;  3B7B A;  4CYM D;  1EI7 A;  1A7E A;  3HXD A;  4R32 A;  1QZ2 A;  4HBD A;  4AV7 A;  2XRZ A;  3ASD A;  4EQF A;  2FI7 A;  1YLM A;  4U5E E;  4W8P A;  3TJP A;  1YA7 O;  5C1D A;  5L0F A;  4XIF A;  1HW2 A;  1N11 A;  2YEV A;  4CSA C;  2KCV A;  2J9U A;  2LP4 A;  3S27 A;  3P1U A;  3TWR A;  3T6J A;  3GZ1 A;  3NRH A;  4GQH A;  4GA2 A;  3ZUV B;  2R9R B;  2LXL A;  1MYO A;  4L6R A;  4ZHB A;  3LJB A;  3SGH A;  3TOM A;  1UJK A;  4BET A;  3UT7 A;  1IKN D;  3NYM A;  1E85 A;  3EG9 B;  2EPK X;  1E2X A;  2V26 A;  4PFP A;  4JJG A;  4H54 A;  4UUC A;  4CRW A;  2I1J A;  1OR3 A;  3H2V A;  5AQA A;  1N52 A;  2Y3H A;  2V5Q C;  1EA8 A;  4I3M A;  5D66 A;  4RSY A;  2L81 A;  2H7O A;  3IQC A;  3LPZ A;  3EHR A;  5CRU A;  3RO3 A;  1HZ4 A;  3S28 A;  3HNL A;  2VSY A;  3SNH A;  3ZYL A;  3L54 A;  2GRP B;  4AIF A;  1X5B A;  2BTD A;  4OIQ F;  1WOL A;  2ZXO A;  3FFL A;  4YDE A;  2WVI A;  5ENP D;  3AG4 E;  2OEX A;  4ABN A;  5G04 J;  4HFK B;  5DLJ A;  2NUP B;  2KM4 A;  2XLO A;  4CJO A;  1INZ A;  2X6H A;  4GYO A;  2XCC A;  3FY4 A;  1YCS B;  4AL1 A;  2ETC A;  3JXJ A;  3UIP C;  3RIB A;  4XEV A;  4WWN A;  3JZ0 A;  4K5C A;  1HY5 A;  4NCQ A;  3L82 A;  3A9C A;  1JUQ A;  4RQI A;  3LLK A;  4ZFH A;  2IOQ A;  4ME2 A;  2HV7 A;  3R7C A;  4ER9 A;  4A4A A;  1JCQ A;  4U0S A;  1H9G A;  3EHN A;  3UGO A;  3OA1 A;  3ZN3 A;  5ANR A;  4KNW A;  4I9C A;  1V55 C;  3AU5 A;  1K8K G;  4QFV A;  4PJJ A;  3GEE A;  3DMD A;  1OXB A;  4CCA A;  3U8V A;  2JEK A;  2DYS E;  2Z15 A;  1IXV A;  3GAN A;  2XEN A;  4NTF A;  2WXM A;  1S64 A;  4IAO A;  4B89 A;  4CSA A;  5KJK A;  3G2U A;  3ULQ A;  3R9M A;  4BJT A;  2IXM A;  4BJ6 C;  2WQH A;  4GEH A;  4HFG A;  2J4B A;  2R25 A;  4U0U A;  3FTU A;  3L6A A;  1NFN A;  4ZLD A;  3AU4 A;  2VCB A;  2VYI A;  1J8M F;  1S0P A;  4EIY A;  1Q0D A;  1ELR A;  1BR1 A;  3V5Y A;  1E84 A;  3EU9 A;  4C9B B;  4HE8 D;  1FTS A;  3ASN C;  4JEU A;  4DI4 A;  4GPK A;  3G4X A;  4DLO A;  3B0P A;  4MTF A;  2QUP A;  3UGP A;  5CRV A;  1FVH A;  3JUE A;  1EDU A;  2NSG A;  1RW2 A;  4GTQ A;  4IWB A;  4U8Y D;  4N4W A;  1U3D A;  2Y0B G;  3KKB A;  1KLX A;  1U2V G;  2XRH A;  1TFO B;  1NL4 A;  4OAV B;  4DJ9 A;  1HE8 A;  3US6 A;  3UX4 A;  2A69 F;  1KU2 A;  1RCP A;  1LPE A;  3L16 A;  2X3M A;  3GWL A;  1R5I D;  1I5N A;  2C2L A;  4ILI A;  3UUX A;  3C8G B;  4G25 A;  4ATG A;  4J7T A;  3P2B A;  2YRF A;  3SEO A;  5T3W A;  1AWC B;  4U5F E;  1Y6I A;  1G4U S;  3W9G A;  4BEM J;  3BQO A;  3F46 A;  2BKK B;  1H0A A;  4MVQ A;  3NKD A;  4XKB A;  5FT9 A;  2VCC A;  5EHH A;  1FPP A;  5KYY B;  3S0X A;  4DBQ A;  5AN8 A;  2GRL A;  2YL1 A;  2YQY A;  2WXL A;  4I2W A;  4BSX A;  2OVB A;  1KT0 A;  5E75 A;  2BL2 A;  1PV3 A;  5T3T A;  2OQM A;  3DBS A;  1HX8 A;  2M63 A;  4H7X A;  3U9W A;  4Z9H A;  3DE9 A;  2MYO A;  4JA7 A;  1CGN A;  3G4Z A;  2OEV A;  3SZ7 A;  4GU5 A;  4CDR A;  2YWA A;  1JCR A;  3ABM E;  3TG4 A;  3ZW3 A;  3L08 A;  4AY5 A;  3CVW A;  4DVZ A;  4O6M A;  1E8X A;  4ANU A;  5T8I A;  1ZU4 A;  3U66 A;  2NC9 A;  5AJD A;  3CVV A;  1OWO A;  2HUJ A;  5T4Y A;  3NDB B;  1MND A;  3J5P A;  4GZ3 A;  5JJT A;  2JPU A;  2R7Q A;  2ZGG A;  4KT6 B;  2E87 A;  3FTZ A;  1BI8 B;  3CSF A;  1D8D A;  2XGO A;  4OAU C;  3WOD F;  3IKO B;  3KPH A;  1C17 M;  3EIJ A;  2Q9B A;  2QE9 A;  3Q7F A;  4IGG A;  2NUP A;  5BV0 A;  4O1P A;  1FFH A;  4U8H A;  1D1B A;  3Q9N C;  4HI8 A;  3AJM A;  3D9H A;  2WMN A;  1N54 A;  1ZHY A;  4UWF A;  2XLW A;  1Q0M A;  2PNO A;  3MYV A;  1Q0F A;  1S05 A;  2XLM A;  1RJ9 A;  4I17 A;  5BXO A;  1EPU A;  3UKR G;  4WJ0 A;  3SXY A;  4EHM A;  2V4H C;  2WL8 A;  2F22 A;  5G04 C;  1TR2 A;  3RJV A;  3RRN B;  2R7O A;  2J9Q A;  1PAQ A;  4PDX A;  4B94 A;  4Q69 A;  1Z63 A;  3Q7A A;  2I8B A;  4MVM A;  3UNG C;  4K03 A;  1UFB A;  4JCH A;  1FR0 A;  4JW1 A;  2PX0 A;  4JB8 P;  5DS4 A;  1G8X A;  1EKY A;  4MW8 A;  4RDA A;  1P5Q A;  2DIW A;  3V31 A;  2XL4 A;  1TN6 A;  1RZ4 A;  2OG2 A;  1JR8 A;  2IU1 A;  1DOV A;  2CFU A;  3QTH A;  4HS2 A;  1A7D A;  2XL6 A;  4KZC A;  2GAQ A;  2FF4 A;  2Y69 E;  4EZL A;  3MX3 A;  3NG1 A;  4OIO F;  4XE0 A;  2DYR E;  3WG7 E;  1XNF A;  1BR4 A;  5CER B;  3SBS A;  4E6H A;  5L3V A;  2I9C A;  2XGS A;  5JMN D;  5CED B;  4M7C A;  3MZL B;  4CX9 A;  4I2Z A;  4N3C A;  5FQ4 A;  2IYL D;  5L0D A;  3MKQ B;  2YZS A;  5DQZ A;  1G5Z A;  2J09 A;  2VGX B;  3LS1 A;  3JXI A;  4FHK A;  5CMY A;  5FTP A;  4J7Y A;  1HG5 A;  1BBH A;  4JEB A;  2XPI A;  2FEZ A;  3TUL A;  2GRO B;  1MQS A;  2RFM A;  4A3T A;  4CDA A;  2QYU A;  2AXV A;  1N4Q A;  3CLJ A;  5KWD A;  4J7W A;  1EQ1 A;  3QZC A;  1ZHZ A;  3MCX A;  3HNI A;  2H6F A;  5T3R A;  3VLF A;  1ZZP A;  3QVY A;  1U6H A;  3TXN A;  4MS6 A;  3FH5 A;  4MVU A;  4CDN A;  3W2V A;  1K1A A;  4DX6 D;  4GCN A;  3S29 A;  4CGV A;  2PX3 A;  4Z9I A;  2J9V A;  2YL7 A;  2KXP C;  4Q94 A;  3S2A A;  5JVE A;  4QQI A;  2WVN A;  4WNE A;  5LFA A;  3Q47 B;  3RW0 A;  4GYW A;  3FUJ A;  3Q79 A;  3ABM C;  5A6B D;  3PUJ A;  5T1D B;  3DSU A;  2O9X A;  5FZQ A;  1FT2 A;  4YVQ C;  1MQV A;  2EPO A;  1VMA A;  4DRJ B;  1N9A A;  1L3P A;  5BNW A;  2J9W A;  4L2Y A;  5CI9 A;  1A7V A;  4N5Q A;  1MMG A;  1BPO A;  4XQ1 A;  2NG1 A;  5B1B C;  3POV A;  1OW8 A;  4E0I A;  2R7R A;  1SZI A;  3ZTZ A;  4TXP A;  1TWA A;  4XEK A;  4UI9 J;  4L23 A;  3G50 A;  4PS8 A;  3S7J A;  2Q4F A;  3KAE A;  5AQ7 A;  4JRZ A;  4GTM A;  4RG9 A;  4ILH B;  4B93 B;  3TK0 A;  5ITZ F;  1ZU2 A;  1Z3X A;  4OIR F;  2Y3A A;  3GW4 A;  2LFD A;  2WXP A;  3FXH A;  2J8S D;  4N3A A;  1UW4 B;  3TD7 A;  3C3R A;  3UTM A;  3FU0 A;  3HXB A;  5H7P A;  2JX0 A;  2VSO E;  2VSN A;  4HRL A;  1H2V C;  4DXW A;  3PUK A;  2VC9 A;  3VF0 A;  3PZ1 A;  4U8V D;  3SY2 A;  4GB9 A;  4JHJ A;  4P6I C;  2LUH A;  1C03 A;  3OXG A;  4JHR A;  1QVX A;  3ULE G;  4GZD A;  1H19 A;  4XEF A;  5BUO A;  3FU5 A;  4N3B A;  4M3O A;  2X38 A;  2QLA A;  1N1C A;  4WGY A;  3AQC A;  3MFN A;  3SBT B;  2WPV A;  3U2L A;  4FAD A;  2FAP B;  4BG0 A;  3D9I A;  1J8Y F;  5HSW A;  4RG6 A;  3UMH A;  3GYZ A;  1LI7 A;  2KJG A;  2LQG A;  3EUV A;  2V3C C;  3AG3 E;  5DS5 A;  3LVR E;  1MX2 A;  2A6E F;  5FIN A;  3SNX A;  4AXH A;  2QC9 A;  1AEP A;  3HNK A;  4AL0 A;  4LSZ E;  4BT9 A;  3MYI A;  2DGJ A;  2A5E A;  4GTT A;  2H6I A;  4C3B A;  2ICW G;  3FHD A;  3MEK A;  1TWH A;  4EKW A;  2Y69 C;  5BQG A;  3SZR A;  3UMI A;  3B7U X;  3F6Q A;  2B0O E;  2ZXW E;  2XM4 A;  3N0T A;  1SA5 A;  4EZJ A;  2ZXR A;  1QNF A;  1OCR C;  4PH4 B;  3VTY A;  3GM1 A;  3CKC A;  3UI2 A;  1Z23 A;  2GDC A;  2ZXW C;  3B13 A;  1E96 B;  3FP3 A;  4AP2 A;  3PE3 A;  3BEH A;  2C0L A;  5G05 J;  1SR2 A;  3FVY A;  1PC2 A;  5AAO A;  2HS5 A;  4E18 A;  4U96 D;  3LVQ E;  1NU7 D;  1ORY A;  2Q00 A;  3ASG A;  4WAB A;  3SP1 A;  4P9T A;  2IEJ A;  3ONK A;  4BJ5 C;  2FGY A;  4EHP A;  2LAI A;  3AG3 C;  2VQ2 A;  2AWI A;  4O6N A;  1GW6 A;  2J4D A;  4JZA A;  3BEE A;  1WN0 A;  1LF8 A;  1M2V A;  4BSZ B;  3LEW A;  4WWP A;  5JUA A;  1TNY A;  3NB2 A;  2Y3G A;  4TRQ A;  3DI5 A;  3KH2 A;  2EIJ E;  2OJE D;  1IHB A;  2YLG A;  2J7P D;  4GYT A;  4JPS A;  3UKU G;  3M15 A;  1GS9 A;  4EWC A;  3L0I A;  4LDK A;  1I4Z A;  5HQ8 A;  4XEI G;  4O60 A;  2IM8 A;  3ZIB A;  2ZIR A;  2VH3 A;  5JRA A;  3W2W A;  5L0G A;  4HNA D; 
#chains in the Genus database with same CATH homology
 3DAG A;  4I1M A;  3CQZ A;  2R7S A;  4XWJ A;  1OWL A;  3MGB A;  4KYO B;  2OOE A;  3N71 A;  3CIA A;  3UR3 C;  1KT1 A;  4J0U A;  3B7S A;  3FUK A;  2LO6 A;  3RH3 A;  3CVP A;  4MLP A;  4PUC A;  4WND A;  3D9P A;  2WXO A;  3MA5 A;  4LEU A;  4N39 A;  3X1O A;  5KYX B;  3ZPJ A;  3KS2 A;  2NXP A;  4AY6 A;  2IQC A;  3CHM A;  5EDS A;  4C3D A;  3CVX A;  4GZ5 A;  4D10 C;  2IXO A;  2M4E A;  4Q7C A;  3AQB A;  3ZHE B;  3CSK A;  3BG1 B;  4G1T A;  4A1S A;  4IRU A;  3F47 A;  3ZG1 A;  1HU3 A;  3Q7L A;  3K9I A;  3TXM A;  4UWG A;  1TJC A;  3CST A;  1OKK A;  3FUE A;  3PRE A;  2PFD A;  5F5F A;  4TUU A;  5DVW A;  2Q9A A;  1OCO C;  3Q4A B;  2A68 F;  1EF1 C;  4O7G A;  5E33 A;  2LAH A;  2WXI A;  4I6E A;  5JJ6 A;  1VOM A;  4V3I A;  4N06 A;  1LVK A;  3LY9 A;  3JSZ A;  3LCA A;  2WXJ A;  3FWV A;  3DM5 A;  4F7A A;  4N2Q A;  3QNK A;  4GCO A;  4PS7 A;  4JVS A;  4J30 B;  3VYW A;  1IZM A;  3SHF A;  3EDT B;  5EKQ D;  4URK A;  2YIN A;  4FP7 A;  3HYM B;  5AYW D;  4G24 A;  2YHS A;  3TAX A;  3UMK A;  4OIN F;  2EIK C;  4K0R A;  2WM9 A;  1L5J A;  3ZSU A;  4KMO A;  1LKX A;  1IQU A;  2CNW D;  4G2V A;  2XXA B;  2Q9C A;  3APF A;  3CV0 A;  4WNG A;  3RRM B;  3FUD A;  3EPV A;  1TJF A;  3ML8 A;  3MV2 B;  2DYR C;  4B6I A;  3U64 A;  4NQ0 A;  5JJ7 A;  4EPZ A;  3ZYM A;  4IUL A;  4BJ6 A;  4U5D E;  4J8D A;  5CCM A;  3ESK A;  3UMV A;  1QZX A;  1Z6T A;  3EH2 A;  4E7S A;  1D1A A;  3D9M A;  3SD5 A;  3S7B A;  4A2N B;  5KYU A;  1HF8 A;  3HHM A;  5L3Q A;  2L9J A;  1ELW A;  1QLE C;  3FEX A;  3FDH A;  1SZ9 A;  2QFC A;  2XCB A;  3Q15 A;  1ZHX A;  1HFA A;  5LP0 A;  2CG3 A;  3W8I A;  2Q7F A;  1E7V A;  3U4T A;  3CKB A;  4AJW A;  1UN8 A;  4GZ6 A;  3EHM A;  1B89 A;  3K1H A;  2WXK A;  1HH8 A;  3FU3 A;  4I43 A;  4XLN F;  4BJ5 A;  4U5G A;  3ZIM A;  4APF A;  4FU3 A;  3ML9 A;  4HLE A;  4ULW A;  4NAC A;  2MHK A;  3MJW A;  5B3S C;  2NUT A;  4B8A A;  1ZU5 A;  3PZD A;  2PF4 E;  1OUV A;  2WXF A;  4H4K C;  2L0I A;  1ST6 A;  4LUN U;  2MYS A;  1HXI A;  4QI2 A;  4FES A;  4O6Y A;  2P6V A;  2CHW A;  5D91 A;  3CHQ A;  4APO A;  4K7B A;  3DXJ F;  1MMA A;  3QMK A;  4F3V A;  3FUI A;  2BE5 F;  3DPD A;  4BT8 A;  1E7U A;  4JXT A;  3R7Q A;  4O6F A;  3EG9 A;  5AEN A;  1NP7 A;  1MMD A;  3JRT A;  4ANW A;  3I4R B;  4EBB A;  3URZ A;  4FC8 A;  4CS8 A;  5G05 C;  4XI0 A;  1O87 A;  3X2Q C;  1OWM A;  1WAO 1;  2CHZ A;  4OIP F;  4FLB A;  3AS4 A;  4KVM A;  1TWC A;  4OD5 A;  3CR3 A;  2OV8 A;  2KCK A;  3NQP A;  2Q3T A;  4F4B A;  2V4L A;  4YN0 B;  2HR2 A;  5EX3 A;  5G55 A;  3B0U X;  4AEZ C;  3LXU X;  2MOW A;  2XXA A;  3ABK C;  4YT4 A;  3ONL A;  1VDY A;  1SF8 A;  3G2T A;  3K7D A;  4H7Y A;  3CK7 A;  5FQ7 A;  3LLI A;  2XGM A;  2IF4 A;  1IYG A;  3FTV A;  4CEM A;  4UQY A;  2I6H A;  1VYK A;  1OWN A;  3RIP A;  5BT1 A;  2HYZ A;  3M1C B;  4N2S A;  3EZH A;  3PE4 A;  3EGD A;  4CS9 A;  4J6I A;  3O6X A;  2ION A;  3CVN A;  2WXQ A;  4QDL A;  4G23 A;  4BWR A;  4QI0 A;  2J0X A;  4JHK A;  2WVO A;  1E8Z A;  3CQG B;  4Y6C A;  1FCH A;  3JQ1 A;  4GYY A;  3Q7G A;  1M56 C;  4C7O A;  4B0Z A;  1D0Y A;  3QAR A;  3B7R L;  2DCP A;  3NZU A;  4PJM A;  3H65 A;  4UWL A;  4P29 A;  1QQE A;  3PHF 2;  4MKT A;  4I6G A;  3KL4 A;  4F53 A;  3Q49 B;  4YND A;  4WNF A;  3PDN A;  2KAT A;  3MKQ A;  4XZ4 A;  4JC8 A;  3FTW A;  2VJ8 A;  1Z5Z A;  2KCL A;  4FJZ A;  3FHE A;  4BY6 A;  3JCK C;  2HM8 A;  3HLZ A;  5FCL A;  5E3C A;  3IBE A;  4AK9 A;  5FWQ A;  4KC9 A;  3RU0 A;  5AIJ A;  3FTS A;  2FFH A;  4YT2 A;  5LCW J;  2C03 A;  4C3E A;  5E2Q A;  4RBN A;  1FMW A;  2PQR A;  3ZXS A;  3PNT B;  2XQ0 A;  3AG2 C;  4ANV A;  2P7V A;  3EGD B;  2UY1 B;  5FZR A;  1UN9 A;  3SYN A;  3ZEF A;  2W45 A;  4G7H F;  1M2O A;  5A7D B;  1H2U A;  3IHV A;  3IEE A;  2WQ6 A;  3QWV A;  1Z3Y A;  3VLE A;  3QOU A;  4G7O F;  4KNV A;  4CGW A;  3LKU A;  2QY9 A;  4LRZ A;  3KEZ A;  5D0O D;  5BUZ A;  4RVB A;  3EQL F;  4BEJ A;  4UQX A;  4CT0 A;  4MRU A;  1NA0 A;  3LJ3 A;  3RFY A;  4C0M A;  3PEU B;  1E90 A;  2QY7 A;  2L9B A;  3UT8 A;  5DS6 A;  3D9N A;  4GMJ A;  1TKN A;  3CZ6 A;  4CS7 A;  3EGX B;  1OWP A;  2G3K A;  3G2S A;  3I3N A;  3ASO C;  5CI8 A;  4I6J A;  4XKC A;  2KGO A;  3K6B A;  2IOS A;  4LAC B;  4LLE A;  5ANL A;  4XLP F;  3CEQ A;  3BG0 B;  4CS9 C;  2LSU A;  4AOF A;  4NRH B;  1WY6 A;  2EIJ C;  2R7T A;  3PEV B;  3CVL A;  1ZYR F;  2FO7 A;  3OXL A;  3RKV A;  3LAY A;  4U63 A;  4WAF A;  1JWG A;  2UY1 A;  2X6J A;  3UQ3 A;  3CK8 A;  3FTY A;  3NF1 A;  2ZPA A;  1SMY F;  2RD0 A;  1TEZ A;  2GW1 A;  4G0H A;  3FEY A;  2OND A;  2VTB B;  5IY5 C;  5ARG A;  3CHS A;  1H6K A;  4E7Z A;  2PQN A;  3L22 A;  4KZ0 A;  2CG2 A;  4W8K A;  3O39 A;  4OYS A;  4IN3 B;  4MND A;  3U3W A;  3WG7 C;  3E70 C;  2A1D D;  5KYN A;  3B9Q A;  1UG3 A;  5F5H A;  1MNE A;  4JL0 A;  3Q6M A;  4FX5 A;  1UJJ A;  5LCW C;  1PD0 A;  3ZYK A;  2EIL C;  2JD3 A;  4OVV A;  2R59 A;  2ZXP A;  1HS6 A;  1NG1 A;  2WZF A;  5D0Q D;  4YT8 A;  2WMO A;  4G7Z F;  2L0T B;  2PM7 A;  3ZRH A;  1OCC C;  5CHE E;  1LS1 A;  4PK4 A;  3L13 A;  2WB7 A;  3ECS A;  4KBL A;  2ILR A;  1RJ9 B;  3EIQ C;  3PRZ A;  2EIM C;  3I4U A;  4L7T A;  4WWO A;  4FWV A;  1EYH A;  2KQ9 A;  4U5C E;  3CVQ A;  5G2N A;  3VLD A;  3FUF A;  2CDQ A;  3PH0 C;  4JA9 A;  5FQ8 A;  4C7O B;  2J08 A;  5M72 A;  2P58 C;  4DBR A;  4FHJ A;  2AVP A;  4YVO A;  4UI9 C;  3HVE A;  3O4Z A;  1U3C A;  4Q96 A;  3V7O A;  3FDQ A;  2CW0 F;  3KD7 A;  4FJY A;  4NUR A;  3FUL A;  2WZL A;  4GAA A;  4DJA A;  4AE4 A;  3JUI A;  1DNP A;  2EIN C;  3TGO A;  3RK6 A;  4B8C B;  3T4R A;  2VSX E;  3HDX A;  3UT4 A;  3N24 A;  4PS3 A;  4BX9 A;  3ENE A;  3FH7 A;  2VGX A;  3Q6N A;  3Q5M A;  1XGW A;  2R17 C;  4PJL A;  4W9R A;  2IJG X;  4TV3 A;  2YHC A;  1YA0 A;  3FUM A;  3ZGQ A;  2R7W A;  3CHP A;  3CHO A;  2A4Z A;  3G2V A;  5DBK A;  1NZE A;  3EGX A;  5HI7 A;  3PS6 A;  1M57 C;  3AS8 A;  5LOZ A;  3LNR A;  3MKR A;  2KZT B;  2R7X A;  3EFO B;  2QTV A;  2BF0 X;  3NYJ A;  4U5H A;  2VTB A;  4JZY A;  4NY3 A;  3IV0 A;  2GFH A;  4ANJ A;  2E0I A;  4R7L A;  2JLB A;  2X6I A;  3FUH A;  1PCX A;  3QWW A;  5FQ6 A;  5BV1 A;  4DK5 A;  5DIZ A;  2A6H F;  4FUL A;  1V54 C;  4HOR A;  2Y4T A;  2YNQ A;  1A17 A;  4J8S A;  1D1C A;  2PM6 A;  2Y3D A;  5B1A C;  3TG5 A;  1E8W A;  4UQZ A;  4GML A;  2WZG A;  3L17 A;  3CK9 A;  3MV3 B;  2IOL A;  1HO8 A;  4I1O B;  1OKK D;  3PMR A;  5KYY A;  4UI9 K;  3ZYQ A;  1PD1 A;  4U07 A;  1D0X A;  3DZA A;  4ACL A;  5JHA A;  2V0P A;  1VK5 A;  4IJJ A;  3DM9 B;  4X0R A;  2IFU A;  5KJL A;  4K0D A;  4EBA A;  2XPZ A;  3D9J A;  4RD9 A;  1SZA A;  4OD4 A;  1FVF A;  2WXR A;  2AW6 A;  2GRM A;  3K66 A;  3RRU A;  2V8S E;  3T8M A;  3ZHE A;  2AXU A;  5KCM A;  2C0M A;  4DOZ A;  3ABL C;  1FFT C;  2J49 A;  4YWQ A;  4ZLC A;  2X6F A;  4E85 A;  2R7U A;  4AE4 B;  5DQT A;  4MQ9 F;  4HXI A;  3SI5 A;  2HV6 A;  3NKE A;  2D5R B;  3EJN A;  5AJL A;  4JUR I;  3QK0 A;  3HVE B;  3T5X A;  2B0J A;  2RG8 A;  4I44 A;  3L34 A;  3JT1 A;  4CIH A;  2WXN A;  3QDN A;  3LS0 A;  3LES A;  2UWJ G;  4FA6 A;  4Q4Z F;  4ILG A;  1E8Y A;  5BPP A;  2PZI A;  4BTA A;  4EEC A;  2J07 A;  2X51 A;  2J45 A;  1HG2 A;  3QAQ A;  3ESL A;  5ARF A;  4DI3 A;  4BJ1 A;  4HOT A;  4IYP A;  4KVO A;  2W4M A;  2OCC C;  3E9V A;  2IXN A;  3EH1 A;  3AG4 C;  3RKO F;  2KW3 C;  2WXG A;  1O5H A;  3HTK C;  1SQM A;  4HOS A;  3S7F A;  2VGY A;  3DJN B;  3AS5 A;  4ACK A;  2PL2 A;  1IW7 F;  2I2O A;  3DJU B;  4AVX A;  4Y6W A;  2WVQ A;  3EFO A;  2H7B A;  4GA1 A;  5ENN A;  1BR2 A;  3JYH A;  4HEA J;  4A3V A;  1Z6A A;  2LSE A;  2KZT A;  2CGE A;  3ZC4 A;  3G2W A;  3FU6 A;  3WXX A;  3R7R A;  5EX0 A;  2WQ7 A;  4CT4 A;  2EQX A;  3JCU Q;  2VAS A;  3HJC A;  2XPY A;  1TWG A;  2C04 A;  5KYW B;  4A1G A;  4L2L A;  2G3V A;  2CFZ A;  4CBE A;  4GZC A;  2LNI A;  3FAJ A;  4UWH A;  3CVU A;  3K1I C;  3GOD A;  1NA3 A;  4PJN A;  1ELK A;  4XI9 A;  4WUY A;  5KYU B;  4N5C A;  2Y39 A;  3D9K A;  4OVU A;  4G26 A;  3QWP A;  2J46 A;  3OEO A;  3R9A B;  4BX8 A;  1WGW A;  4CDM A;  1ZHW A;  1M2V B;  3LS8 A;  3VAY A;  3LY7 A;  3FTX A;  3JQ0 A;  4XX5 A;  4FLH A;  1NZN A;  5E76 A;  3OAW A;  4AX2 A;  1JWF A;  3IHY A;  2BUG A;  4DPR A;  1W3B A;  3ZVV A;  2MWQ A;  2E2E A;  2KC7 A;  3KMI A;  4U5B E;  2GGF A;  2R5S A;  4XTK A;  3FUN A;  3CVY A;  3ASH A;  2Y3B A;  2NSZ A;  3PVL A;  5FJY A;  4C0E A;  3T6B A;  3RYL A;  3RO2 A;  1VYI A;  2HO1 A;  2KNH A;  3T5V A;  3NYL A;  4PFO A;  2YQ8 A;  3JYS A;  2J0W A;  2FUL A;  3D9O A;  4ANX A;  5J08 A;  2W4B A;  3CHR A;  5KJN A;  3ZVR A;  3ITF A;  4YT5 A;  3LEV A;  3D3M A;  3UPV A;  1NU9 C;  1MMN A;  3S7D A;  5FZS A;  4DLQ A;  2CHX A;  3MLG A;  2XSE A;  4HFF B;  3E4B A;  3LDZ A;  2R7V A;  1H2T C;  5A23 A;  2PP4 A;  5D92 A;  3N2Z B;  5CCL A;  2I1K A;  2J7P A;  4JEH A;  4M63 A;  1MHQ A;  4J8F A;  4CS8 C;  2ZU6 B;  2V5F A;  5BW8 C;  1Y8M A;  5A6C A;  3QKY A;  3OWT A;  3GZS A;  3W8H A;  1FMV A;  3AG1 C;  3SFZ A;  4U0Z A;  3OXF A;  5CMW A;  2DBA A;  5KYW A;  2W9Y A;  3OTN A;  4JJF A;  2YHE A;  4J8E A;  4Q5S F;  4A55 A;  1IQR A;  3SF4 A;  5LX8 A;  4HOQ A;  4I1A A;  3VTX A;  4L1B A;  5C2Y A;  1JPL A;  4LCT A;  3NZS A;  3GZ2 A;  3LYA A;  2WXH A;  1JPJ A;  1PY1 A;  3B7T A;  4HVB A;  4U04 A;  4I9E A;  3CQC B;  3QJZ A;  4F1S A;  1W2W A;  2IXP A;  4AM9 A;  1WM5 A;  3TL5 A;  2NUT B;  2LSV A;  1JPN A;  3FH8 A;  4BFR A;  3DD7 A;  3LY8 A;  3PNL B;  3D9L A;  2VB6 A;  1S7Z A;  3I4G A;  3IEG A;  2XHE A;  4O79 A;  5JHB A;  3CGH A;  1Z3I X;  2OVF A;  4KBQ A;  1OCZ C;  3K33 A;  2WB2 A;  2FBN A;  3I5P A;  2MRI A;  4BTB A;  2Y4U A;  3EZI A;  4EBA G;  2AXZ A;  1IHG A;  4LER A;  3C98 A;  2DYS C;  2A5U A;  2G62 A;  2CNW A;  1DVP A;  3DAF A;  5J90 A;  3ASF A;  4UWK A;  5E3A A;  4HOU A;  5EGY A;  3O48 A;  4KI2 A;  4LLC A;  4YJW A;  2L6J A;  3ZFW A;  1D0Z A;  2H7V C;  4GA0 A;  2XRY A;  5KYX A;  3QB2 A;  3APC A;  3B0V C;  2X6K A;  4G11 A;  3HIZ A;  3APD A;  4J32 B;  5KJM A;  3I5Q A;  4KXK B;  1ZBP A;  2XEV A;  4DVY P;  1ZHT A;  4EZK A;  3QC1 A;  1QZ2 A;  4AV7 A;  2XRZ A;  3ASD A;  4EQF A;  2FI7 A;  4U5E E;  3TJP A;  5C1D A;  4XIF A;  2YEV A;  4CSA C;  2KCV A;  2J9U A;  3S27 A;  3P1U A;  3T6J A;  3GZ1 A;  3NRH A;  4GA2 A;  3LJB A;  3SGH A;  1UJK A;  3UT7 A;  3NYM A;  3EG9 B;  2V26 A;  4PFP A;  4JJG A;  4CRW A;  2I1J A;  1N52 A;  2Y3H A;  4I3M A;  4RSY A;  2L81 A;  2H7O A;  3LPZ A;  3RO3 A;  1HZ4 A;  3S28 A;  2VSY A;  3SNH A;  3ZYL A;  3L54 A;  4AIF A;  1X5B A;  2BTD A;  4OIQ F;  2ZXO A;  3FFL A;  2WVI A;  4ABN A;  5G04 J;  4HFK B;  5DLJ A;  2NUP B;  2KM4 A;  1INZ A;  2X6H A;  4GYO A;  2XCC A;  3FY4 A;  3RIB A;  4WWN A;  1JUQ A;  3LLK A;  2IOQ A;  4ME2 A;  2HV7 A;  4U0S A;  3OA1 A;  3EHN A;  3UGO A;  3ZN3 A;  5ANR A;  4KNW A;  4I9C A;  3AU5 A;  1V55 C;  4QFV A;  4PJJ A;  3DMD A;  4CCA A;  2JEK A;  2Z15 A;  3GAN A;  2WXM A;  4IAO A;  4B89 A;  4CSA A;  5KJK A;  3G2U A;  3ULQ A;  4BJT A;  2IXM A;  4BJ6 C;  2WQH A;  4GEH A;  4HFG A;  2J4B A;  4U0U A;  3FTU A;  3L6A A;  4ZLD A;  3AU4 A;  2VYI A;  1J8M F;  1S0P A;  1ELR A;  1BR1 A;  4C9B B;  4HE8 D;  1FTS A;  3ASN C;  4JEU A;  4DI4 A;  4GPK A;  4DLO A;  3B0P A;  3UGP A;  1FVH A;  1EDU A;  4IWB A;  1U3D A;  3KKB A;  1KLX A;  2XRH A;  1HE8 A;  3UX4 A;  2A69 F;  1KU2 A;  3L16 A;  2X3M A;  2C2L A;  4ILI A;  3UUX A;  4G25 A;  4ATG A;  3P2B A;  3SEO A;  5T3W A;  4U5F E;  1Y6I A;  3F46 A;  1H0A A;  3NKD A;  4XKB A;  5FT9 A;  5EHH A;  5KYY B;  3S0X A;  4DBQ A;  2GRL A;  2WXL A;  4I2W A;  4BSX A;  2OVB A;  1KT0 A;  5E75 A;  5T3T A;  3DBS A;  1HX8 A;  2M63 A;  4H7X A;  3U9W A;  4JA7 A;  3SZ7 A;  4GU5 A;  4CDR A;  3TG4 A;  3ZW3 A;  3L08 A;  4AY5 A;  3CVW A;  4DVZ A;  4O6M A;  1E8X A;  4ANU A;  5T8I A;  1ZU4 A;  3U66 A;  2NC9 A;  5AJD A;  3CVV A;  1OWO A;  5T4Y A;  3NDB B;  1MND A;  4GZ3 A;  5JJT A;  2R7Q A;  4KT6 B;  2E87 A;  3FTZ A;  3CSF A;  2XGO A;  3WOD F;  3IKO B;  3EIJ A;  2Q9B A;  2NUP A;  5BV0 A;  1FFH A;  4U8H A;  1D1B A;  2WMN A;  1N54 A;  1ZHY A;  4UWF A;  3MYV A;  1RJ9 A;  4I17 A;  1EPU A;  4WJ0 A;  5G04 C;  2WL8 A;  1TR2 A;  3RJV A;  3RRN B;  2R7O A;  2J9Q A;  1PAQ A;  4PDX A;  4B94 A;  4Q69 A;  1Z63 A;  2I8B A;  3UNG C;  4K03 A;  4JCH A;  4JW1 A;  2PX0 A;  5DS4 A;  1G8X A;  4RDA A;  1P5Q A;  2DIW A;  2XL4 A;  2OG2 A;  2IU1 A;  2CFU A;  4HS2 A;  4KZC A;  2FF4 A;  4EZL A;  3MX3 A;  3NG1 A;  4OIO F;  4XE0 A;  1XNF A;  1BR4 A;  3SBS A;  4E6H A;  5L3V A;  2I9C A;  2XGS A;  3MZL B;  4I2Z A;  4N3C A;  5FQ4 A;  2IYL D;  3MKQ B;  2YZS A;  5DQZ A;  2J09 A;  2VGX B;  4FHK A;  5CMY A;  3LS1 A;  5FTP A;  1HG5 A;  2XPI A;  2FEZ A;  1MQS A;  4A3T A;  2AXV A;  3CLJ A;  3QZC A;  1ZHZ A;  3MCX A;  5T3R A;  3VLF A;  3TXN A;  4MS6 A;  3FH5 A;  4CDN A;  3W2V A;  4CGV A;  4GCN A;  3S29 A;  2PX3 A;  2J9V A;  4Q94 A;  3S2A A;  2WVN A;  4WNE A;  5LFA A;  3Q47 B;  4GYW A;  3FUJ A;  3ABM C;  3PUJ A;  5T1D B;  2O9X A;  5FZQ A;  4YVQ C;  1VMA A;  5BNW A;  2J9W A;  4L2Y A;  5CI9 A;  1MMG A;  1BPO A;  2NG1 A;  5B1B C;  3POV A;  2R7R A;  1SZI A;  1TWA A;  4UI9 J;  4L23 A;  4PS8 A;  3S7J A;  3KAE A;  4RG9 A;  4ILH B;  1ZU2 A;  1Z3X A;  4OIR F;  2Y3A A;  3GW4 A;  2WXP A;  4N3A A;  1UW4 B;  3TD7 A;  3FU0 A;  2VSO E;  2VSN A;  1H2V C;  3PUK A;  4GB9 A;  4JHJ A;  4P6I C;  3OXG A;  4JHR A;  4GZD A;  1H19 A;  3FU5 A;  5BUO A;  4N3B A;  4M3O A;  2X38 A;  1N1C A;  3AQC A;  3SBT B;  2WPV A;  4FAD A;  4BG0 A;  3D9I A;  1J8Y F;  5HSW A;  4RG6 A;  3UMH A;  3GYZ A;  2KJG A;  2V3C C;  5DS5 A;  3LVR E;  2A6E F;  3SNX A;  4AXH A;  4BT9 A;  2DGJ A;  4C3B A;  3FHD A;  3MEK A;  1TWH A;  2Y69 C;  3SZR A;  3UMI A;  3B7U X;  3N0T A;  4EZJ A;  2ZXR A;  1QNF A;  4PH4 B;  1OCR C;  3VTY A;  3CKC A;  1Z23 A;  2ZXW C;  3B13 A;  1E96 B;  3FP3 A;  4AP2 A;  3PE3 A;  2C0L A;  5G05 J;  3FVY A;  1PC2 A;  3LVQ E;  1NU7 D;  3ASG A;  3SP1 A;  3ONK A;  4BJ5 C;  2FGY A;  2LAI A;  3AG3 C;  2VQ2 A;  2AWI A;  4O6N A;  1GW6 A;  2J4D A;  4JZA A;  3BEE A;  1LF8 A;  1M2V A;  3LEW A;  4WWP A;  2Y3G A;  4TRQ A;  3KH2 A;  2J7P D;  4GYT A;  4JPS A;  4EWC A;  3L0I A;  5HQ8 A;  3ZIB A;  2VH3 A;  3W2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...