4JVSA

Crystal structure of lepb gap domain from legionella drancourtii in complex with rab1-gdp and alf3
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
279
Chain Sequence
ATPPLLQMEQEQPFPELIRTWAGLLGQIGVESVRTEEVNFGQLAKCFNDYLNTVAEHCEQQNIWQHKREENHNFFTAFKPDASKAALHGHAYIAHYKESVILRHLSIVDPKTLGMLRFAPYEAPSTDYCRHFPDSPWAKMQRLATAGQNIILQLRLIQNGQMLEDDLPVLQKALDDFMQYKTEVDALLAHDTPVSTHDSSFFYDIDEQTLNAMSGDQLATICFEELNAPHPSRLIMRILKSDSLWQEVDDSLNGDAFMGRQDDICEKRNKICQWRQLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein
publication title Structural analyses of Legionella LepB reveal a new GAP fold that catalytically mimics eukaryotic RasGAP
pubmed doi rcsb
source organism Legionella drancourtii
molecule tags Hydrolase activator/protein transport
total genus 88
structure length 279
sequence length 287
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4jvsA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jvsA02
4I1OB 4IRUA 4JVSA 4I1MA 4JW1A
chains in the Genus database with same CATH superfamily
1D0XA 2OJED 3LS0A 5BT1A 4AL1A 2JABA 4I43A 4BSXA 1OR3A 2WZFA 3T4RA 2V5FA 2XGSA 3VLDA 2W45A 4PUCA 1M2VA 4U8VD 2UUIA 4M7CA 2IOLA 3U2MA 1YLMA 1ZB1A 5DBKA 3DXKG 3QARA 3NRHA 2HZ8A 4QI2A 2P9PG 1MMAA 4FA6A 1PAQA 4U5CE 1FR0A 3O4ZA 5LP0A 3GEHA 4GZDA 3ULYA 4UI9J 3T5VA 2KXPC 3GODA 4KYOB 1S7ZA 3NMIA 1O1RA 4CYMD 4BEJA 1NI1A 4FHKA 3RW0A 1YYHA 4EZLA 1YA7O 1SYQA 4O60A 3CHRA 3RAUA 3U3BA 3HNJA 4O7GA 3Q5MA 2FGYA 1X81A 3RKVA 4C0MA 2C0MA 4OVUA 1NSGB 1QSPA 4YT5A 1QNFA 4I9EA 4PFPA 2VASA 4N2SA 3QNKA 3ABMC 2XRHA 1S70B 4HVBA 3SFXA 5DS4A 2HFIA 3ZPJA 1DOVA 2P2CP 3K1IC 4XIFA 3CQGB 4ZHBA 4JC8A 2R7RA 4JJGA 4C3BA 3FTVA 4N3BA 2V3CC 4ATZD 3NYJA 3T9OA 2I2OA 5K0IA 3TWRA 1NU7D 3UI2A 4DX2A 3FMSA 4B93B 2HS5A 4PR9A 1ORSC 3D9PA 3HVEA 4D4XA 1SMYF 4KNVA 3WAQA 5EX3A 1WG0A 2J8WA 1QVXA 3R2PA 4MTFA 3Q75A 1Z3YA 1WTYA 3DMDA 2OCCE 3MJWA 3RH3A 2OG2A 3IQ5A 3AGUA 2NSZA 4HS2A 2XLMA 2WL8A 5COMA 4NY3A 4BFRA 4G0HA 1OWPA 3ABLE 4Z68A 2IEJA 3FDQA 1O1SA 1LPEA 3AAAC 4NIKA 1SA5A 4B94A 1DCQA 3PNLB 3ABKE 5AQ9A 3SD5A 2DCPA 2MWQA 5DS6A 2AWCA 3QK0A 2KCLA 1VB5A 1ORYA 4ANUA 4Q96A 5DVWA 4ZLCA 1RXQA 4LERA 3GZSA 3CVWA 3GM3A 1IQUA 4CS9A 3B95A 5EYLA 4O6FA 2WXGA 3DWWA 3JSZA 2EPMX 2YL3A 5T8IA 3JQ0A 3TULA 3E32A 4WABA 3UGPA 2PM7A 3ZVVA 4GQHA 4XPXA 1H19A 3NKEA 4APFA 2EIJE 3FUNA 3FUFA 2X38A 5L0GA 5C2YA 4UWHA 1HE8A 3O10A 2LQGA 3MV2B 2J9UA 3ZRHA 2LSEA 1RZ4A 5EIDA 4H4KC 1INZA 4W8KA 4DOZA 4ANXA 4KBQA 1ZYRF 5BV1A 3OXFA 2B0OE 4JW1A 5DQZA 2NUPA 3VRCA 2YHSA 2UUHA 3FU0A 1IZMA 3IHVA 2O9XA 3LNRA 3JUEA 2VH3A 1A5EA 4KI2A 1TN7A 4Q94A 4C7OA 4FJZA 3BEHA 1HG2A 4DRHB 4G8LA 3SXYA 3T6GB 2R7SA 1VLSA 3KMIA 5KBAA 2AJAA 3I5PA 2PQNA 1YZCA 2L6BA 3PH0C 3B29A 4QQIA 3TOLA 1H0AA 1K1BA 2WMNA 1KZPA 2X3MA 4CSAA 4AEZC 3FUJA 3Q7AA 3VLFA 2VC9A 3PZ1A 2RFAA 5HI7A 4L23A 3HKKA 2XLOA 4EWCA 3FUMA 5D91A 5L0HA 1W2WA 4I17A 1TR4A 4GTTA 4XKBA 3S0XA 4FADA 1OCOC 4MQ9F 1APCA 3EHMA 2LXMA 3OWTA 2J9QA 1HE9A 4A1SA 3FTSA 2XLWA 1GQAA 1MQVA 1O1TA 3UT4A 4RG9A 1LS1A 3ZWIA 5JJ7A 4F53A 4NTAA 2PBEA 4YDYA 3EHQA 2ZXWC 4C7OB 3MKRA 3NMJA 2BF0X 3D9LA 4FULA 4GPKA 4WJ0A 3GWLA 4DXWA 3SBTB 2DVWA 4EPZA 2LAHA 1V74B 3U3FA 4U5HA 5T1DB 3OXGA 4IN3B 4LEUA 4I1OB 4A2NB 3ZN3A 4R32A 4K0RA 1QYMA 3LCAA 1G4WR 1QLEC 1TJCA 3QW0A 2J08A 3L16A 2LO6A 4UQZA 3QTHA 3EIQC 1SZAA 4CS8C 5E33A 2ILRA 2WXOA 4RDAA 3BU8A 1H7IA 2DYSC 2OJQA 3AU4A 1KTMA 1VOMA 4Z9IA 2IF4A 4XZ4A 2KQ9A 2KATA 5CMYA 1S05A 3JTLO 2WXJA 4DVZA 3V5ZA 3UR3C 5CHEE 3ULEG 2NSFA 3ZTZA 3IQCA 2Z15A 1MMDA 2H6HA 3RQGA 4LDRA 5EIBE 2HMQA 3L8JA 3U8VA 3AS8A 3CVNA 2XLHA 4LRZA 5FWQA 2PF4E 3ML8A 3PNTB 4TRQA 2XL8A 3G2SA 5D0QD 5AYWD 4B6IA 3B71A 1K05A 2FEZA 3FTYA 1LS4A 2GRLA 4L2YA 3EGDA 1MHQA 3D9KA 3FOOA 3FWVA 3LAYA 1MQSA 2WM9A 3GANA 5M72A 3NYMA 2QTVA 1NA3A 3DJNB 2FO7A 4G24A 1BPOA 2BTDA 2Y69E 2R59A 3X1OA 1SF8A 1K04A 2KJGA 2LSUA 3RF3A 1SW6A 4BEPA 4G1TA 2EINC 3OEOA 1OCZC 2LUHA 3AS4A 3S7BA 5FJYA 5JSLA 4IWBA 3M4BA 3W9FA 3TWQA 2YINA 1JOGA 3AG1E 3QWPA 1OXJA 2VCAA 5JT4A 4GYTA 4HNAD 1E7UA 4H54A 5IY5C 3X2QC 3FULA 4HFKB 3MZLB 3TD7A 2L9BA 4NTFA 4C9BB 2DGJA 1R5ID 4NC3A 1SZ9A 1BLXB 5EX0A 2P9KG 3ZYMA 4KMOA 5HQ8A 3RFYA 4BJ6A 2XHEA 2R7OA 4E0HA 1ZHXA 4TXRA 2WZGA 2A69F 1Z6AA 4MVOA 5F5FA 3V5YA 4U5BE 1IYGA 1WASA 3R9MA 5J08A 4BX9A 4XI9A 3ASFA 2R7UA 4LSZE 2J8SD 4MVUA 4JEHA 1T6QA 2IONA 1ZHYA 2P9IG 1V55C 1RKEA 1OKKD 2WXHA 3AG2C 5A6AA 4MVRA 3URZA 5ANRA 4TXQA 1H2VC 2XRZA 3VF0A 2DYRC 3DSTA 3PRZA 1FVHA 2FAPB 1KT1A 2XEHA 4CDRA 4HE8D 1XWJA 1H9TA 3GYZA 1JWFA 3RRNB 2XS8A 4M63A 1E86A 3RO3A 3SF4A 3NF1A 2CFZA 3ZC4A 2Q9CA 3AU5A 3T6BA 2L0TB 5JP7A 1KZOA 1HS6A 2Y1LE 3DSUA 3C7JA 2R5SA 3QJZA 5FQ4A 4DX7D 2PNOA 3C18A 2ZISA 3KS2A 5FINA 2QLAA 2WVOA 2Y3BA 4DVYP 2PNNA 4FJYA 4ABNA 1BBHA 2VGXB 2C03A 1Y4CA 3U9JA 2EIKE 4HI9A 4AE4A 3EGXA 2X6JA 3L9TA 1WGWA 5ENPD 3C3QA 3ESLA 4RD9A 3MA5A 2QYUA 2XPIA 2WXQA 2H6FA 4PS3A 3EH1A 1YJGA 2EPNA 1OQCA 4JEBA 2I1KA 4N5QA 3Q78A 2Q9AA 5L3QA 4BSZB 3EFOA 4EBBA 1BR1A 1ZBPA 4YL0A 4UWLA 3MV3B 1QBQA 4LDQA 1N11A 5JA4D 2QC9A 2NC9A 1ZHZA 4IGGA 1G4US 1YDIA 1Q0MA 1UN8A 1IKND 3ONKA 2H8AA 1PCXA 5G04C 4Y6CA 5D0OD 4WWNA 5L0FA 4N5CA 1AVOB 5JMND 3C63A 2P61A 3GM1A 2JPUA 2J9VA 4X8QA 5B3SE 4WWPA 4OIRF 3U3WA 2LP4A 4F3VA 2E87A 5JHBA 1RCPA 1J8MF 2KCVA 3FP3A 1NZEA 1E96B 2J7PD 2Q7FA 5KYYA 2EQXA 4BJTA 2C2LA 3SQVA 2LAIA 4EZKA 1DCEA 2J0WA 3L54A 4HRLA 3OXLA 3ZGQA 3R7QA 2YRFA 3Q7GA 1UG7A 2G3VA 3HIZA 2R7WA 2YHCA 2XLDA 5COGA 4KBLA 1QQ3A 3DSWA 2GFHA 4K7BA 3EDTB 5A6CA 3TXMA 2NG1A 1OW7A 5KYXA 4J6IA 3C72A 5ANLA 5FQ6A 2AVPA 4ILIA 2B0HA 3ZFWA 3TJ6A 3F46A 4JL0A 5AIJA 4WAFA 3O55A 4HXIA 1MZCA 3TAXA 4CDAA 2GW1A 2ONDA 2WB2A 3QVZA 4HLEA 4P9TA 4TV3A 1ST6A 3HXCA 3SZ7A 5FZTA 3CK7A 3UMKA 3TGOA 5KYUA 1NFNA 3JYHA 3L0IA 4DI3A 3MGBA 3R9AB 3S27A 4GTSA 2F22A 4A4AA 2OCCC 4H7YA 4P6IC 4TUMA 2WXKA 1LM3B 2A4ZA 1BD8A 3NOCD 4GA2A 3FXHA 4ANWA 3IBEA 3UT8A 2QNLA 3U66A 2QUPA 3FFLA 3JRTA 3UX4A 2C04A 2LD6A 3ABLC 4YT4A 5L0JA 4QFVA 3I4UA 4HEAJ 3ABKC 3CEQA 4HI8A 4JA7A 3LS8A 4O1OA 2J07A 1YYJA 3DKAA 4B89A 4Q5SF 4I1AA 1SR2A 2XCCA 3NBNB 4HLLA 2FI7A 4D4NA 1RMVA 4D10C 4XEIG 5EKQD 1DC2A 1TWAA 1YA9A 2HMZA 3ENEA 3U8PA 4I6EA 2YL7A 3S84A 1N54A 4BG0A 1E83A 3IEEA 3LDZA 2HV7A 5KCMA 3CVPA 3ZXSA 3PEUB 2GROB 5CRVA 4U9DA 1MJ0A 4U95D 5T4YA 2EIJC 3MYIA 1EA8A 1G8XA 2XXAA 3GW4A 3MKQB 2W4BA 2G3KA 1E84A 3DSVA 1J8YF 3QZCA 1LF8A 3KEZA 2A5UA 3HLZA 3W2WA 1Q0KA 1KU2A 3EZHA 3GZ2A 3HXFA 1ZU5A 3NAWA 3NG1A 3M1CB 2OQMA 5LX8A 1YCSB 4APOA 3LY8A 1D0ZA 2OVFA 4PJMA 3I4GA 3N0TA 4L1BA 1NP7A 5FZRA 3V30A 1E2XA 4DX5D 4J7WA 2P9LG 4FWVA 4FLHA 5LFAA 2GWWA 1CPRA 3PREA 5A7DB 1Y6IA 2KSFA 3CHOA 2NYJA 2X6FA 4GTRA 3CHSA 1H9GA 4CEMA 2RG8A 3A11A 1N4QA 4YJWA 4GPMA 4FX5A 3HXEA 5CIVA 1Y6DA 1N95A 4GB9A 4C48B 3C3OA 4EHMA 5AGFA 2KC7A 1E7VA 3JXIA 2RD9A 2Y3HA 3HXDA 1OY3D 3B7UX 3ZHEB 3GWNA 4PFOA 4JZAA 2KZTB 4ILGA 2IYLD 4KZ0A 3UM1A 3DZAA 2GRNB 2P0NA 4BJ5C 1VDYA 3SGHA 4PS7A 1CGME 1ELKA 2UY1A 1M2VB 1N52A 2F0YA 5BV0A 2ZPAA 1H6OA 1K3ZD 1KT0A 1NLXA 4U9EA 3E37A 4OIPF 5E75A 2J49A 4XEVA 1TNOA 3AG4E 1T5OA 3N24A 4WUYA 3DEPA 2MYSA 4BERA 2YNQA 1OCCE 4G7HF 4F6RD 4JURI 2PQRA 4WNEA 1A7DA 4U5GA 3V2XA 3VTYA 4DLQA 3GEIA 4BESA 4HOUA 4MNDA 3G4XA 4I6GA 4KXKB 3PHF2 4JTAB 4BY6A 4AIFA 2L6GA 4JTCB 2IXMA 4Z9JA 1TJFA 3FUEA 4E18A 3LVQE 5ENQD 2Y4TA 2OKUA 4HOTA 3ZG1A 3AS5A 2A5EA 3EPVA 2OVBA 3S29A 3B0VC 3JCKC 4N6CA 3UIOC 4EBKA 2OEXA 5JHAA 2J9WA 3DJUB 1MX6A 3LYAA 1A7EA 1O5MA 1M56C 1SQMA 2XGMA 2IXNA 4XEKA 4GYWA 3O39A 3RRMB 3JSEO 3K33A 4DJ9A 5A69A 1T01A 5G05C 1JCQA 2OOCA 1QZXA 4AL0A 4BTAA 1L7CA 3BRJA 2XM0A 4EECA 2XLVA 4G7OF 2FULA 4E6HA 3I5QA 2YL1A 3NOGD 4JHRA 3R7CA 4GZ3A 4G2VA 4ER9A 3SBSA 1VK5A 4PK4A 5ENOD 3PE4A 4CRWA 5EHHA 3DSSA 2H6GA 3HVEB 2AXUA 1Q0DA 3PZ4A 2P7VA 1HH8A 2J09A 3D9IA 4CIHA 3TK0A 1GGQA 4E85A 2B0JA 2DI3A 2AWYA 4J0UA 3DWLG 4YDEA 4ACLA 1VMAA 1TNUA 4HFFB 2Y69C 1M57C 1ELWA 3WXXA 5LOZA 3LNMB 2D4UA 3MFNA 3UKRG 3HNLA 4ME2A 4ANVA 1UJJA 2Y3DA 4KVMA 3KL4A 4BWRA 2XCBA 3MEKA 1PY1A 3NQPA 4L9PA 3B7TA 1IW7F 3AG1C 3RIBA 4C3DA 5L3VA 4NURA 3EIJA 3ZVRA 1D1CA 3ASHA 2FF4A 3U9WA 3QW1A 2L9JA 4HRMB 4GAAA 2L6JA 4YDWA 3G2TA 1JPNA 1H6GA 3G4ZA 3DM5A 3L8IA 2J46A 2V0PA 3DBSA 2LNIA 1C03A 2XZTG 3KKBA 2Y39A 3OA1A 3JT1A 3W4YA 3FEYA 3F6QA 3T5XA 3H65A 5DQTA 2IFUA 3ABME 3FU5A 4GA0A 4JA9A 3CHMA 5G04J 3DXJF 2KCKA 1HY5A 4JXTA 2X6HA 1KPSB 1A0BA 3B9QA 1Z3IX 1I4YA 2WXNA 4HB5A 3L13A 1JRAA 2NUPB 3O48A 2Y3AA 1LE4A 2XL4A 3Q15A 3HNKA 5B1BE 2ZGGA 3UGOA 2ASRA 1D1BA 1WAO1 1OXBA 2VJ8A 3LXUX 1WN0A 3UNGC 1BDJB 4HRNA 4CIPA 4O6NA 3FH8A 3D9NA 4GYYA 3CVQA 2DZOA 2WXPA 2NUTA 3E30A 3SO8A 4LG6A 5BQIA 4JD2G 1TNZA 1JMWA 2ZXRA 3B7SA 4MLPA 3RJVA 2EIKC 3EJNA 3RU0A 2PP4A 1U3DA 3FUKA 4DJAA 1D9SA 3Q47B 4AY5A 5DS5A 5L0DA 1EPUA 4R7LA 4MRUA 1JCRA 3L6AA 3LVRE 4JKVA 4AXHA 4CS9C 1WM5A 4BPMA 2X6IA 4J7TA 5JS5A 1AEPA 3LEWA 2P9SG 3CGHA 3SEOA 3WODF 2MHRA 4IB4A 1OUVA 1WDYA 4J32B 1YA0A 4PS8A 5B1AE 2QZAA 1ZW2A 4XTKA 3KD7A 2WZLA 1OCRE 4G11A 4YWQA 4B8AA 3Q73A 3CIAA 3CSTA 3B7BA 2A1DD 4I44A 3PZDA 1MMGA 2J9BA 3TWWA 1G5ZA 5BXOA 3UMVA 4CCAA 1E8YA 1FT2A 4MVSA 3CK9A 1OW6A 3DE9A 2TMVP 3S7DA 1TWCA 2ICWG 3ZDLA 5B3SC 3ZEFA 1FPPA 1HXIA 2R02A 1Q2ZA 4K5BA 1EKYA 4HQDA 5CEDB 4HOQA 1AUEA 2VGEA 3ASDA 4X0RA 1MX4A 2EPOA 5AQAA 1H6KA 3NDBB 2V4LA 1VTMP 1D8EA 1UW4B 1WY6A 4Q69A 3LKUA 1TYQG 1FMVA 1CGOA 4XQ1A 4OD4A 4DRXE 4EHPA 1K8KG 2DBAA 1A17A 4CSAC 4J8EA 1N0QA 1HF8A 3CV0A 2J0XA 2VSXE 4FHJA 1RJ9A 2YHEA 2L6HA 1Z3XA 3FHDA 3DXMG 4DX6D 1UG3A 3LEOA 3DPYA 2WVIA 3FAJA 3WG7E 4AVXA 4E7SA 1MNDA 2XLEA 3CEXA 1S64A 3IV0A 3EUVA 3CZ6A 1ORJA 2ZXPA 3CKCA 5KJLA 3S28A 2XPYA 4GA1A 4L7TA 2KW3C 3C8GA 5BUOA 3EGDB 3Q79A 2DB4A 5GPGB 3MX3A 2IJGX 3EHRA 1Z5SC 3IEGA 4I2WA 3HXBA 3HDXA 2J4BA 1ELRA 4DUIA 5FQ7A 1O87A 2J4DA 1FTSA 2ETBA 4F1SA 1A7VA 2WXMA 4RQIA 1UFBA 4XLNF 3EU5A 3R7RA 3KH2A 1N4PA 2L0IA 2X6KA 3UMHA 4F1PA 1TWHA 2EPLX 3AQBA 2VSYA 1V54E 2P6VA 2ZXOA 1FT1A 4A55A 4L2LA 1ZZPA 4N6HA 5AARA 4LLCA 4CDMA 4GTQA 4OVVA 3FOPA 2R2LA 1ZU4A 4J8DA 2GDCA 2HR2A 2IBFA 2J45A 2W9YA 3LLKA 4N06A 4W9RA 2OEVA 2CYDA 3DE8A 3TWUA 1BR4A 3SXMA 4ANJA 3EZIA 4J30B 4MW8A 5E3CA 3RRUA 3BEEA 3QWWA 3CR3A 4CS7A 3E33A 4GZ5A 3DD7A 3UM0A 3OTNA 5ITZF 2OEWA 3BG0B 4CT0A 1LTXA 2V26A 4KVOA 1UJKA 1XGWA 1N9AA 2R03A 3B0UX 3Q9NC 4OAUC 2R7TA 1TNYA 1BI8B 2PX3A 5CI8A 3J5PA 1RKEB 3IHUA 3CHPA 3ESKA 5FT9A 1JWGA 2ETCA 3UM3A 4WNGA 3EHNA 4MTGA 1N4RA 3QC1A 1NU9C 3RIPA 3S90A 1TN8A 4LCTA 3ZQYA 2MOWA 4IYPA 4G25A 2BUGA 4MVMA 2HJMA 2V5QC 2M4EA 2Q4FA 3E9VA 3SP1A 5JJTA 4EIYA 3RKOF 3IQ6A 2R17C 2I15A 4ILHB 1NG1A 3E34A 4J8SA 4URKA 1EI7A 4GZ6A 2P1AA 5ENNA 1LKXA 3EG9A 2A0UA 1WWPA 4XWJA 3C3RA 2XS1A 3PS6A 3FHEA 2WMOA 2R05A 4U07A 3KYIA 3MLGA 2EPKX 4J8FA 5LCWJ 4U0ZA 2F8XK 1ZU2A 1N1CA 1HFAA 4I2ZA 4AE4B 4GMLA 3EGXB 2Y4UA 2CNWD 2I8BA 4NCQA 1JUQA 4H7XA 5BW8C 4GTVA 4K1OA 2GRQB 1TN6A 5KYNA 3W8HA 3DEOA 2PX0A 5G05J 2RD0A 3JZ0A 5AN8A 3ULQA 3CVLA 4UQXA 3TXNA 3EFOB 3PE3A 4BJ6C 4OIOF 2CG2A 3SNXA 3N71A 4CJOA 2C0LA 1NZNA 3NKDA 3DSXA 5CRUA 3CVXA 1WOLA 3J06A 5KYWA 5ARGA 1LD8A 1B89A 1N0RA 3BUAA 5F5HA 4JB8P 5T3TA 1JPJA 4DRIB 5F28E 3UIPC 2BEDA 3ZYQA 1VYIA 3FTZA 4LNBA 1HMDA 2XL6A 1GM5A 2CHXA 5G2NA 3AG4C 3CVUA 3K1IA 2Q00A 1Z5ZA 5A6BD 2FFHA 4I1MA 1OCCC 4ULWA 2VTBA 4LACB 1DOWA 2RFMA 1E8XA 3ASNE 4LUNU 5KYYB 4TXPA 3IHYA 5L0CA 2P9UG 4JZYA 4UDVA 1JR8A 5AAOA 4I3MA 3ATPA 2KM4A 2VSOE 3APCA 5EDSA 5ENTD 3JRMO 1U3CA 5BQGA 1VYKA 3P1UA 2H7VC 4Y6WA 1N94A 4DI4A 1K1AA 1BR2A 5KYXB 4IAOA 1OT8A 3QMKA 4DRJB 4YN0B 3IQTA 3W9GA 5CCLA 2HJ3A 1I4ZA 5E76A 4Q4ZF 3UMIA 1AWCB 3BG1B 2LCHA 3M4CA 3KAEA 5ENRD 2GRPB 3CLJA 2WXFA 3Q7FA 1DNPA 4Q7CA 4A3VA 3RSEG 1IQRA 1FCHA 3ASOE 3UUXA 1Q0FA 4G23A 3PZ3A 2NXPA 3LS1A 2YVKA 4BETA 1BZ4A 5KYUB 1KNYA 1E8WA 3GM2A 4AY6A 4P9FA 2JLBA 2I1JA 1S63A 5L0IA 4GMJA 4U5EE 2BKKB 2XENA 3QKYA 1JPLA 2IXPA 2YQ8A 2HM8A 3LPZA 4DLOA 2M64A 1IXVA 4WWOA 2VCBA 3PZ2A 2AXZA 2LIGA 3ZTMA 2ETSA 2WB7A 2YLIA 2GRMA 2AWIA 4GEHA 3ZSUA 3I4RB 3L82A 3KYJA 3PEVB 3C62A 2QYJA 1F1MA 5KNHD 5DIZA 1V4AA 4LDKA 1A41A 3L34A 3ZU7B 4U96D 4K5AB 2XEVA 4XPWA 2LK4A 1FFTC 5FZSA 3K6BA 2PFDA 4EUKB 4IARA 2GAQA 3JCUQ 1EDUA 4EZJA 1TWGA 3CQZA 4B8CB 4NTBA 2V4HC 2JX0A 1SVXA 5EILA 3TWSA 2F8YA 3D9MA 2EIME 4J7YA 1ZHTA 1MX2A 4XEFA 4ZLDA 2AW6A 4HBDA 5KJNA 3AG3E 3HRAA 4OIQF 4JIOA 2F37A 2XXAB 3L17A 4PH4B 2GA0A 1UOHA 5CEAA 1CGNA 1I5NA 1TFKB 4YDOA 1Z6TA 2EILE 3QAQA 5HKPA 1TNBA 3LEVA 4GCOA 1ZVZA 4CDVA 3FTUA 4WNDA 4WNFA 3O6XA 2B6CA 5JJ6A 2WXLA 5B1BC 3GZ1A 5BUZA 2KBXA 5AJDA 3TWXA 4K5CA 2LFDA 1G3NB 5E2QA 2GGFA 1JAFA 4XI0A 4QDLA 5D2MC 4QI0A 4N3AA 2ZD9A 5JLIA 5JUAA 5B3IA 4MTOA 4B0ZA 3L22A 4FESA 1OWLA 3I3NA 3T9KA 2VGYA 3K9IA 4EBAA 3PCVA 3VM6A 4UI9K 3QVYA 1O5HA 3RO2A 4F7AA 5TJ5E 4E17A 1MYOA 1Z7Qc 4O6MA 1X5BA 3S7JA 4IJJA 5C1DA 3FU3A 3U5SA 2AU5A 4JCZA 5LCWC 3J5QB 4HORA 2AP3A 2D5RB 2IQCA 4G78A 3FH5A 2LSVA 1HO8A 2R7VA 4FLBA 3NZSA 4NACA 4OAVB 3ZYKA 4GTPA 4AK9A 3V2OA 2CW0F 4C3EA 3HTKC 2UY1B 3P2BA 2JEKA 4PJLA 4U63A 1S0PA 4DPRA 1CPQA 2YKZA 4XKCA 1Q0GA 2JD3A 3M79A 3BQOA 4CS8A 2V8SE 1XZPA 1PC2A 5B1AC 3T6JA 2QE9A 3VYWA 5AC4A 1OCRC 1HX8A 3UINC 1OXKA 4I6JA 2XM4A 4DK5A 3PUJA 3QOUA 3GEEA 5A23A 3H2UA 3LESA 4CX9A 5AQ7A 1W3BA 4L6RA 3CSFA 4N39A 3AJIA 4A3TA 1YVIA 3HYMB 2P9NG 2UWJG 3CHQA 4FAPB 1HW1A 4P29A 4UWGA 3NMKA 1EQ1A 3NB2A 3ZNGA 5COFA 2H7BA 3RQEA 3W8IA 2BL2A 2YZSA 2QY7A 5BNWA 5BPPA 1UN9A 4GYOA 3K7DA 4JVSA 2BC5A 5AQBA 2OOEA 4XPYA 5E3AA 2IM8A 3NYLA 1FNTc 1TKNA 5J90A 2ZGDA 1NFIE 1T6UA 3DPDA 4GTMA 3ECSA 2L6FA 5CI9A 3JUIA 3V79K 1OR2A 2I9CA 4WGYA 1OWNA 1PV3A 3F47A 3HJCA 3ZYLA 4CJGA 4NRHB 3APDA 3EQLF 3CK8A 4JEAA 3UXGA 1BU9A 3WG7C 2XGOA 5CMWA 1B68A 4CGVA 4YK5A 2VSNA 5A6JA 3LJNA 4U04A 2CHZA 1TEZA 4PJNA 3FU6A 256BA 3ZUVB 5EGYA 4BT8A 5KNGA 1OKKA 3FEXA 3FUDA 1Y8MA 2H7OA 4WGZA 2KYHA 3V5XA 4N2QA 4M3OA 2HUJA 1V54C 4KC9A 3UTMA 4CDNA 4JCHA 3ISMC 3V7OA 3FVYA 3N2ZB 1M2OA 3ZIMA 3U64A 4CGWA 1MMNA 3DAGA 2E0IA 5ARFA 5EK0A 2BE5F 5FCLA 4G26A 3TWTA 3D9HA 3S7FA 3TL5A 1H2UA 4DX1A 1FFHA 4V3IA 1NA0A 4DBQA 3SXKA 3B0PA 4JC7A 3DI5A 3V31A 4GTOA 3Q4AB 3C5RA 4UI9C 1H2TC 2Q7RA 2I6HA 3FDHA 2VCCA 3IXEA 2CG3A 4PDXA 2W4MA 2WQHA 4YVOA 5KWDA 4XLPF 4Z9HA 2Y3GA 4K03A 4JHJA 3Q7LA 3AGTA 1NFOA 4YL1A 2OV8A 3ZKJA 2WQ7A 3S2AA 4HOSA 5HRYA 4K0DA 3HHMA 4DBRA 3MYFA 3G2VA 3K1HA 4LNGA 1LE2A 2BKGA 2MYOA 5KJMA 1M6TA 5CECB 1YARO 2DZNA 3LY7A 3PVLA 2LFFA 5BXUA 3JYYA 3IPMO 2ETAA 3UPVA 1U6HA 2WPVA 3ZXPA 2NUTB 4MBGA 1C17M 3US6A 2IY0C 1FMWA 5FTPA 3PMRA 4AM9A 4CDYA 1E85A 3JXJA 4NQ0A 4XX5A 2HYZA 2IXOA 4FP7A 4GMRA 3ZW3A 3SXZA 2IO2C 3B13A 1N4SA 4U8YD 4A1GA 1TFOB 2RSEB 5HSWA 1D0YA 2VB6A 3E70C 4HFGA 2CFUA 2PZIA 5CBNA 2NSGA 4RLYA 1FAPB 1LI5A 4U8HA 4JEUA 3ZIBA 3MBGA 2HSQA 2J7PA 2WVNA 3VLEA 3CQCB 2L7AA 3LLIA 3ONLA 4GU5A 5EYPF 2IOSA 1RW2A 3DM9B 1NBBA 2KC3A 2Q3TA 1YZAA 3Q6NA 3NZUA 2CNWA 4RG6A 3UKUG 4JE9A 2AXVA 2WQ6A 2YQYA 4CBEA 1XZQA 1E8ZA 2P58C 2XZDG 2HE0A 3POVA 5HS0A 3IKOB 2RKKA 4AP2A 3ZQVA 4U0UA 1LIHA 4PJJA 5DLJA 4UWFA 2VGXA 1WATA 1EYHA 1U0BB 2XSEA 3DAFA 4ULVA 3UM2A 2WXRA 3SFYA 2XEEA 4PACA 3FY4A 2Q9BA 2R25A 4CT4A 4AV7A 3FH7A 2MHKA 1PD0A 2OU6A 1OW8A 2NPUA 1T6IA 1R4TA 4OYSA 3UQ3A 1OCOE 2CHWA 5BQHA 3LJBA 3JQ1A 3AQCA 1LI7A 2XPZA 2WVQA 2YEVA 3ASNC 1VLTA 2YLGA 1YAUO 4UQYA 2PM6A 1DVPA 3FTWA 2ZU6B 1SZIA 5A6BA 5AJLA 4MS6A 1JCSA 3G2WA 2QY9A 4JRZA 2KNHA 1FVFA 2ZXWE 3B7RL 3S9OA 3SHFA 1GW6A 3KSQA 1RJ9B 2HO1A 5G55A 3H2VA 3MCXA 1T9KA 2H6IA 3KEAA 3LJ3A 4KNWA 1L3PA 1OWOA 2M63A 4JJFA 3W2VA 3APFA 4GCNA 3ML9A 4AJWA 2A6HF 3LY9A 2R7QA 2AVKA 2A0BA 3C8GB 4RBNA 1KLXA 3C98A 4ACKA 2DYSE 3U0CA 4N3CA 3ASOC 1GS9A 3K66A 2G62A 1HMOA 4UWKA 5AENA 3T8KA 2YLDA 5H7PA 4TUUA 2Y0BG 2FO1E 1RKCA 3PDNA 4BJ1A 1E90A 5T3WA 1U2VG 3DRAA 2CCYA 3M15A 3WHNA 4KT6B 5CCMA 3TQOA 2VQ2A 1XNFA 3PDMP 3TG4A 5FQ8A 3SI5A 3CSKA 1OWMA 4ATGA 4IAQA 4U7EB 5FZQA 3SY2A 3RVZA 4MS2A 4IULA 3L1MA 2YL0A 3KPHA 3SYNA 1O3UA 5JVEA 5AC5A 3U2LA 3QB2A 4YNDA 3CAXA 3PUKA 3MYVA 3AJMA 2MRIA 2X51A 1YYXA 3RQFA 4GZCA 4MVZA 2IU1A 4BEMJ 3SZRA 3UT7A 2LXLA 5KJKA 4YT2A 2ZIRA 3A9CA 1HE1A 4W8PA 1HG5A 5FIOA 4LNUD 2EINE 2DIWA 1K40A 4YT8A 1QKRA 1OCZE 1QZ2A 4OD5A 1LVKA 4CZ2D 3QWVA 3E4BA 5EN5D 4O1PA 5CBOA 2A6EF 4JPSA 1SA4A 2GRRB 3TOMA 2EIMC 3VTXA 1IHBA 2A68F 4UUCA 2KGOA 2HSBA 3RYLA 1HZ4A 4U5FE 4N4WA 2KK1A 3FUHA 5IY5E 3FUIA 4C0EA 3AG3C 3X2QE 4MVQA 4G8KA 2FBNA 5A6KA 1LD7A 4BX8A 1YMPA 3RVYA 4O6YA 3C8GD 2EILC 3EH2A 3G2UA 1NL4A 1TR2A 4A63B 3Q49B 1H6PA 2QFCA 3D9OA 3TWVA 1TQGA 4YVQC 1Z23A 4JTDB 5JRAA 2HV6A 1BI7B 4BJ5A 2YWAA 3FAPB 5ENSD 3CVYA 4YL3A 4J8YA 4U5DE 1C02A 3EG9B 1Z63A 1MNEA 1PD1A 3OAWA 2IO3C 4I9CA 3G50A 1V55E 3U4TA 5HV9A 3AG2E 3GORA 4AOFA 3SNHA 3TJ5A 2IOQA 3CVVA 2X0CA 2VYIA 4G7ZF 4U0SA 2DYRE 2XQ0A 3T8MA 3MKQA 1L5JA 3ITFA 2L81A 4O79A 1U89A 3U9MA 3RK6A 4EBAG 4BTBA 4FC8A 1QPUA 2DWZA 3EU9A 2CGEA 3JYSA 3Q9UC 4KZCA 2WXIA 4RVBA 4JHKA 3KSLA 4FU3A 3LUTB 5T3RA 2R7XA 4BT9A 2CDQA 4EKWA 3VAYA 1P5QA 3CKBA 1EF1C 1D1AA 1HU3A 5CERB 5KYWB 4MKTA 3Q6MA 1IHGA 4MW3A 4E7ZA 3TJPA 3ASGA 1ZW3A 3TG5A 4IRUA 2E2EA 3L08A 3D3MA 3SFZA 4EBJA 1QQEA 3D9JA 4XE0A 2HKVA 4ZFHA 3FTXA 2R9RB 4AX2A 4OINF 4ONSA 4F4BA 1AP7A 3AOUA 4LLEA 3QDNA 1HW2A 5D92A 3C8ZA 2XRYA 1ZHWA 1D8DA 4NQFA 3HNIA 2VTBB 4E0IA 4EQFA 3HG0D 3ZHEA 5D66A 2PL2A 4RSYA 2KZTA
chains in the Genus database with same CATH topology
1D0XA 3LS0A 5BT1A 4I43A 4BSXA 2WZFA 3T4RA 2V5FA 2XGSA 3VLDA 2W45A 4PUCA 1M2VA 2IOLA 5DBKA 3QARA 3NRHA 4QI2A 1MMAA 4FA6A 1PAQA 4U5CE 3O4ZA 5LP0A 4GZDA 4UI9J 3T5VA 3GODA 4KYOB 1S7ZA 4BEJA 4FHKA 4EZLA 3CHRA 4O7GA 3Q5MA 2FGYA 3RKVA 4C0MA 2C0MA 4OVUA 4YT5A 1QNFA 4I9EA 4PFPA 2VASA 4N2SA 3QNKA 3ABMC 2XRHA 4HVBA 5DS4A 3ZPJA 3K1IC 4XIFA 3CQGB 4JC8A 2R7RA 4JJGA 4C3BA 3FTVA 4N3BA 2V3CC 3NYJA 2I2OA 1NU7D 3D9PA 3HVEA 1SMYF 4KNVA 5EX3A 1Z3YA 3DMDA 3MJWA 3RH3A 2OG2A 2NSZA 4HS2A 2WL8A 4NY3A 4BFRA 4G0HA 1OWPA 3FDQA 4B94A 3PNLB 3SD5A 2DCPA 2MWQA 5DS6A 3QK0A 2KCLA 4ANUA 4Q96A 5DVWA 4ZLCA 4LERA 3GZSA 3CVWA 1IQUA 4CS9A 4O6FA 2WXGA 3JSZA 5T8IA 3JQ0A 3UGPA 2PM7A 3ZVVA 1H19A 3NKEA 4APFA 3FUNA 3FUFA 2X38A 5C2YA 4UWHA 1HE8A 3MV2B 2J9UA 3ZRHA 2LSEA 4H4KC 1INZA 4W8KA 4DOZA 4ANXA 4KBQA 1ZYRF 5BV1A 3OXFA 4JW1A 5DQZA 2NUPA 2YHSA 3FU0A 1IZMA 3IHVA 2O9XA 3LNRA 2VH3A 4KI2A 4Q94A 4C7OA 4FJZA 1HG2A 2R7SA 3KMIA 3I5PA 2PQNA 3PH0C 1H0AA 2WMNA 2X3MA 4CSAA 4AEZC 3FUJA 3VLFA 5HI7A 4L23A 4EWCA 3FUMA 5D91A 1W2WA 4I17A 4XKBA 3S0XA 4FADA 1OCOC 4MQ9F 3EHMA 3OWTA 2J9QA 4A1SA 3FTSA 3UT4A 4RG9A 1LS1A 5JJ7A 4F53A 2ZXWC 4C7OB 3MKRA 4FULA 2BF0X 3D9LA 4GPKA 4WJ0A 3SBTB 4EPZA 2LAHA 4U5HA 5T1DB 3OXGA 4IN3B 4LEUA 4I1OB 4A2NB 3ZN3A 4K0RA 3LCAA 1QLEC 1TJCA 2J08A 3L16A 2LO6A 4UQZA 3EIQC 1SZAA 4CS8C 5E33A 2ILRA 2WXOA 4RDAA 2DYSC 3AU4A 2IF4A 1VOMA 4XZ4A 2KQ9A 2KATA 5CMYA 2WXJA 4DVZA 5CHEE 3UR3C 2Z15A 1MMDA 3AS8A 3CVNA 5FWQA 4LRZA 2PF4E 3ML8A 3PNTB 4TRQA 3G2SA 5D0QD 5AYWD 4B6IA 2FEZA 3FTYA 2GRLA 4L2YA 3EGDA 1MHQA 3D9KA 3FWVA 3LAYA 1MQSA 2WM9A 3GANA 5M72A 3NYMA 2QTVA 1NA3A 3DJNB 2FO7A 4G24A 1BPOA 2BTDA 2R59A 3X1OA 1SF8A 2KJGA 2LSUA 4G1TA 2EINC 3OEOA 1OCZC 3AS4A 3S7BA 5FJYA 4IWBA 2YINA 3QWPA 4GYTA 1E7UA 5IY5C 3X2QC 3FULA 4HFKB 3MZLB 3TD7A 2L9BA 4C9BB 2DGJA 1SZ9A 5EX0A 3ZYMA 5HQ8A 4KMOA 3RFYA 4BJ6A 2XHEA 2R7OA 1ZHXA 2WZGA 2A69F 1Z6AA 5F5FA 4U5BE 1IYGA 5J08A 4BX9A 4XI9A 3ASFA 2R7UA 4JEHA 2IONA 1ZHYA 1V55C 2WXHA 1OKKD 3AG2C 3URZA 5ANRA 1H2VC 2XRZA 2DYRC 3PRZA 1FVHA 4CDRA 1KT1A 4HE8D 3GYZA 3RRNB 1JWFA 4M63A 3RO3A 3SF4A 3NF1A 2CFZA 3ZC4A 2Q9CA 3AU5A 3T6BA 2L0TB 1HS6A 2R5SA 3QJZA 5FQ4A 3KS2A 2WVOA 2Y3BA 4FJYA 4DVYP 4ABNA 2VGXB 2C03A 4AE4A 3EGXA 2X6JA 1WGWA 3ESLA 4RD9A 3MA5A 2XPIA 2WXQA 4PS3A 3EH1A 2I1KA 2Q9AA 5L3QA 3EFOA 4EBBA 1BR1A 1ZBPA 4UWLA 3MV3B 2NC9A 1ZHZA 1UN8A 3ONKA 1PCXA 5G04C 4Y6CA 5D0OD 4WWNA 4N5CA 2J9VA 4WWPA 4OIRF 3U3WA 4F3VA 2E87A 5JHBA 1J8MF 2KCVA 3FP3A 1NZEA 1E96B 2J7PD 2Q7FA 5KYYA 2EQXA 4BJTA 2C2LA 2LAIA 4EZKA 2J0WA 3L54A 3OXLA 3ZGQA 3R7QA 3Q7GA 2G3VA 3HIZA 2R7WA 2YHCA 4KBLA 2GFHA 4K7BA 3EDTB 5A6CA 3TXMA 2NG1A 5ANLA 5KYXA 4J6IA 5FQ6A 3ZFWA 2AVPA 4ILIA 3F46A 4JL0A 5AIJA 4WAFA 4HXIA 3TAXA 2GW1A 2ONDA 2WB2A 4HLEA 4TV3A 1ST6A 3SZ7A 3CK7A 3UMKA 3TGOA 5KYUA 3JYHA 3L0IA 4DI3A 3MGBA 3R9AB 3S27A 2OCCC 4H7YA 4P6IC 2WXKA 2A4ZA 4GA2A 4ANWA 3IBEA 3UT8A 3U66A 3FFLA 3JRTA 3UX4A 2C04A 3ABLC 4YT4A 4QFVA 3I4UA 4HEAJ 3ABKC 3CEQA 4JA7A 3LS8A 2J07A 4B89A 4Q5SF 4I1AA 2XCCA 2FI7A 4D10C 5EKQD 1TWAA 4I6EA 3ENEA 1N54A 4BG0A 3IEEA 3LDZA 2HV7A 5KCMA 3CVPA 3ZXSA 3PEUB 5T4YA 2EIJC 1G8XA 2XXAA 3GW4A 3MKQB 2W4BA 2G3KA 1J8YF 3QZCA 1LF8A 3KEZA 2A5UA 3HLZA 3W2WA 3GZ2A 1KU2A 3EZHA 1ZU5A 3NG1A 3M1CB 5LX8A 4APOA 3LY8A 1D0ZA 2OVFA 4PJMA 3I4GA 3N0TA 4L1BA 1NP7A 5FZRA 4FWVA 4FLHA 5LFAA 3PREA 5A7DB 1Y6IA 3CHOA 2X6FA 3CHSA 4CEMA 2RG8A 4YJWA 4FX5A 4GB9A 2KC7A 1E7VA 2Y3HA 3B7UX 3ZHEB 4PFOA 4JZAA 2KZTB 4ILGA 2IYLD 4KZ0A 3DZAA 4BJ5C 1VDYA 3SGHA 4PS7A 1ELKA 2UY1A 1M2VB 1N52A 5BV0A 2ZPAA 1KT0A 4OIPF 5E75A 2J49A 3N24A 4WUYA 2MYSA 2YNQA 4G7HF 4JURI 2PQRA 4WNEA 3VTYA 4U5GA 4DLQA 4HOUA 4MNDA 4I6GA 4KXKB 3PHF2 4BY6A 4AIFA 2IXMA 1TJFA 3FUEA 3LVQE 2Y4TA 4HOTA 3ZG1A 3AS5A 3EPVA 2OVBA 3S29A 3B0VC 3JCKC 5JHAA 2J9WA 3DJUB 3LYAA 1M56C 1SQMA 2XGMA 2IXNA 4GYWA 3O39A 3RRMB 3K33A 5G05C 1QZXA 4BTAA 4EECA 4G7OF 2FULA 4E6HA 3I5QA 4JHRA 4GZ3A 4G2VA 3SBSA 1VK5A 4PK4A 3PE4A 4CRWA 5EHHA 3HVEB 2AXUA 2P7VA 1HH8A 2J09A 3D9IA 4CIHA 4E85A 2B0JA 4J0UA 4ACLA 1VMAA 4HFFB 2Y69C 1M57C 1ELWA 3WXXA 5LOZA 4ME2A 4ANVA 1UJJA 2Y3DA 4KVMA 3KL4A 4BWRA 2XCBA 3MEKA 1PY1A 3NQPA 3B7TA 1IW7F 3AG1C 3RIBA 4C3DA 5L3VA 4NURA 3EIJA 3ZVRA 1D1CA 3ASHA 2FF4A 3U9WA 2L9JA 4GAAA 2L6JA 3G2TA 1JPNA 3DM5A 2J46A 2V0PA 3DBSA 2LNIA 3KKBA 2Y39A 3OA1A 3JT1A 3FEYA 3T5XA 3H65A 5DQTA 2IFUA 3FU5A 4GA0A 4JA9A 3CHMA 5G04J 3DXJF 2KCKA 4JXTA 2X6HA 3B9QA 1Z3IX 2WXNA 3L13A 2NUPB 3O48A 2Y3AA 2XL4A 3Q15A 3UGOA 1D1BA 1WAO1 2VJ8A 3LXUX 3UNGC 4O6NA 3FH8A 3D9NA 4GYYA 3CVQA 2WXPA 2NUTA 2ZXRA 3B7SA 4MLPA 3RJVA 2EIKC 3EJNA 3RU0A 2PP4A 1U3DA 3FUKA 4DJAA 3Q47B 4AY5A 5DS5A 1EPUA 4R7LA 4MRUA 3L6AA 3LVRE 4AXHA 4CS9C 1WM5A 2X6IA 3LEWA 3CGHA 3SEOA 3WODF 1OUVA 4J32B 1YA0A 4PS8A 4XTKA 3KD7A 2WZLA 4G11A 4YWQA 4B8AA 3CIAA 3CSTA 2A1DD 4I44A 3PZDA 1MMGA 3UMVA 4CCAA 1E8YA 3CK9A 3S7DA 1TWCA 5B3SC 3ZEFA 1HXIA 4HOQA 3ASDA 4X0RA 1H6KA 3NDBB 2V4LA 1UW4B 1WY6A 4Q69A 3LKUA 1FMVA 4OD4A 2DBAA 1A17A 4CSAC 4J8EA 1HF8A 3CV0A 2J0XA 2VSXE 4FHJA 1RJ9A 2YHEA 1Z3XA 3FHDA 1UG3A 2WVIA 3FAJA 4AVXA 4E7SA 1MNDA 3IV0A 3CZ6A 2ZXPA 3CKCA 5KJLA 3S28A 2XPYA 4GA1A 4L7TA 2KW3C 5BUOA 3EGDB 3MX3A 2IJGX 3IEGA 4I2WA 3HDXA 2J4BA 1ELRA 5FQ7A 1O87A 2J4DA 1FTSA 4F1SA 2WXMA 4XLNF 3R7RA 3KH2A 2L0IA 2X6KA 3UMHA 1TWHA 3AQBA 2VSYA 2P6VA 2ZXOA 4A55A 4L2LA 4LLCA 4CDMA 4OVVA 1ZU4A 4J8DA 2HR2A 2J45A 2W9YA 3LLKA 4N06A 4W9RA 1BR4A 4ANJA 3EZIA 4J30B 5E3CA 3RRUA 3BEEA 3QWWA 3CR3A 4CS7A 4GZ5A 3DD7A 3OTNA 3BG0B 4CT0A 2V26A 4KVOA 1UJKA 1XGWA 3B0UX 2R7TA 2PX3A 5CI8A 3CHPA 3ESKA 5FT9A 1JWGA 4WNGA 3EHNA 4LCTA 3QC1A 1NU9C 3RIPA 2MOWA 4IYPA 4G25A 2BUGA 2M4EA 3E9VA 3SP1A 5JJTA 3RKOF 2R17C 4ILHB 1NG1A 4J8SA 4URKA 4GZ6A 5ENNA 1LKXA 3EG9A 4XWJA 3PS6A 3FHEA 2WMOA 4U07A 3MLGA 4J8FA 5LCWJ 4U0ZA 1ZU2A 1N1CA 1HFAA 4I2ZA 4AE4B 4GMLA 3EGXB 2Y4UA 2CNWD 2I8BA 1JUQA 4H7XA 5BW8C 5KYNA 3W8HA 2PX0A 5G05J 2RD0A 3ULQA 3CVLA 4UQXA 3TXNA 3EFOB 3PE3A 4BJ6C 4OIOF 2CG2A 3SNXA 3N71A 2C0LA 1NZNA 3NKDA 3CVXA 5KYWA 5ARGA 1B89A 5F5HA 5T3TA 1JPJA 3ZYQA 1VYIA 3FTZA 2CHXA 5G2NA 3AG4C 3CVUA 1Z5ZA 2FFHA 4I1MA 1OCCC 4ULWA 2VTBA 4LACB 1E8XA 4LUNU 5KYYB 3IHYA 4JZYA 4I3MA 2KM4A 2VSOE 3APCA 5EDSA 1U3CA 1VYKA 3P1UA 2H7VC 4Y6WA 4DI4A 1BR2A 5KYXB 4IAOA 3QMKA 4YN0B 5CCLA 5E76A 4Q4ZF 3UMIA 3BG1B 3KAEA 3CLJA 2WXFA 1DNPA 4Q7CA 4A3VA 1IQRA 1FCHA 3UUXA 4G23A 2NXPA 3LS1A 5KYUB 1E8WA 4AY6A 2JLBA 2I1JA 4GMJA 4U5EE 3QKYA 1JPLA 2IXPA 2YQ8A 2HM8A 3LPZA 4DLOA 4WWOA 2AXZA 2WB7A 2GRMA 2AWIA 4GEHA 3ZSUA 3I4RB 3PEVB 5DIZA 3L34A 2XEVA 1FFTC 5FZSA 3K6BA 2PFDA 3JCUQ 1EDUA 4EZJA 1TWGA 3CQZA 4B8CB 3D9MA 1ZHTA 4ZLDA 2AW6A 5KJNA 4OIQF 2XXAB 3L17A 4PH4B 1Z6TA 3QAQA 3LEVA 4GCOA 3FTUA 4WNDA 4WNFA 3O6XA 5JJ6A 2WXLA 5B1BC 3GZ1A 5BUZA 5AJDA 5E2QA 2GGFA 4XI0A 4QDLA 4QI0A 4N3AA 4B0ZA 3L22A 4FESA 1OWLA 3I3NA 2VGYA 3K9IA 4EBAA 4UI9K 1O5HA 3RO2A 4F7AA 4O6MA 1X5BA 3S7JA 4IJJA 5C1DA 3FU3A 5LCWC 4HORA 2D5RB 2IQCA 3FH5A 2LSVA 1HO8A 2R7VA 4FLBA 3NZSA 4NACA 3ZYKA 4AK9A 2CW0F 4C3EA 3HTKC 2UY1B 3P2BA 2JEKA 4PJLA 4U63A 1S0PA 4DPRA 4XKCA 2JD3A 4CS8A 2V8SE 1PC2A 5B1AC 3T6JA 3VYWA 1OCRC 1HX8A 4I6JA 4DK5A 3PUJA 3QOUA 5A23A 3LESA 1W3BA 3CSFA 4N39A 4A3TA 3HYMB 2UWJG 3CHQA 4P29A 4UWGA 2H7BA 3W8IA 2YZSA 2QY7A 5BNWA 5BPPA 1UN9A 4GYOA 3K7DA 4JVSA 2OOEA 5E3AA 3NYLA 1TKNA 5J90A 3DPDA 3ECSA 5CI9A 3JUIA 2I9CA 1OWNA 3F47A 3HJCA 3ZYLA 4NRHB 3APDA 3EQLF 3CK8A 3WG7C 2XGOA 5CMWA 4CGVA 2VSNA 4U04A 2CHZA 1TEZA 4PJNA 3FU6A 5EGYA 4BT8A 1OKKA 3FEXA 3FUDA 1Y8MA 2H7OA 4N2QA 4M3OA 1V54C 4KC9A 4CDNA 4JCHA 3V7OA 3FVYA 3N2ZB 1M2OA 3ZIMA 3U64A 4CGWA 1MMNA 3DAGA 2E0IA 5ARFA 2BE5F 5FCLA 4G26A 3S7FA 3TL5A 1H2UA 1FFHA 4V3IA 1NA0A 4DBQA 3B0PA 3Q4AB 4UI9C 1H2TC 3FDHA 2I6HA 4PDXA 2CG3A 4YVOA 2W4MA 2WQHA 4XLPF 2Y3GA 4K03A 4JHJA 3Q7LA 2OV8A 2WQ7A 3S2AA 4HOSA 4K0DA 3HHMA 4DBRA 3G2VA 3K1HA 5KJMA 3LY7A 3PVLA 3UPVA 2WPVA 2NUTB 1FMWA 5FTPA 3PMRA 4AM9A 4XX5A 4NQ0A 2HYZA 2IXOA 4FP7A 3ZW3A 3B13A 4A1GA 5HSWA 1D0YA 2VB6A 3E70C 4HFGA 2CFUA 2PZIA 4U8HA 4JEUA 3ZIBA 3VLEA 2J7PA 2WVNA 3CQCB 3ONLA 3LLIA 4GU5A 2IOSA 3DM9B 4RG6A 2Q3TA 3Q6NA 3NZUA 2CNWA 2AXVA 2WQ6A 4CBEA 1E8ZA 2P58C 3POVA 3IKOB 4AP2A 4U0UA 4PJJA 4UWFA 5DLJA 2VGXA 1EYHA 2XSEA 3DAFA 2WXRA 3FY4A 2Q9BA 4CT4A 4AV7A 3FH7A 2MHKA 1PD0A 4OYSA 3UQ3A 2CHWA 3LJBA 3JQ1A 3AQCA 2XPZA 2WVQA 2YEVA 3ASNC 4UQYA 2PM6A 1DVPA 3FTWA 2ZU6B 1SZIA 5AJLA 4MS6A 3G2WA 2QY9A 2KNHA 1FVFA 3B7RL 3SHFA 1GW6A 1RJ9B 2HO1A 5G55A 3MCXA 3LJ3A 4KNWA 1OWOA 2M63A 4JJFA 3W2VA 3APFA 4GCNA 3ML9A 4AJWA 2A6HF 3LY9A 2R7QA 4RBNA 1KLXA 3C98A 4ACKA 4N3CA 3ASOC 3K66A 2G62A 4UWKA 5AENA 4TUUA 3PDNA 4BJ1A 1E90A 5T3WA 4KT6B 5CCMA 2VQ2A 1XNFA 3TG4A 5FQ8A 3SI5A 3CSKA 1OWMA 4ATGA 5FZQA 4IULA 3SYNA 3QB2A 4YNDA 3PUKA 3MYVA 2MRIA 2X51A 4GZCA 2IU1A 3SZRA 3UT7A 5KJKA 4YT2A 1HG5A 2DIWA 4YT8A 1QZ2A 4OD5A 1LVKA 3QWVA 3E4BA 2A6EF 4JPSA 3VTXA 2EIMC 2A68F 2KGOA 3RYLA 1HZ4A 4U5FE 3FUHA 3FUIA 4C0EA 3AG3C 2FBNA 4BX8A 4O6YA 2EILC 3EH2A 3G2UA 1TR2A 3Q49B 2QFCA 3D9OA 4YVQC 1Z23A 2HV6A 4BJ5A 3CVYA 4U5DE 3EG9B 1Z63A 1MNEA 1PD1A 3OAWA 4I9CA 3U4TA 4AOFA 3SNHA 2IOQA 3CVVA 2VYIA 4G7ZF 4U0SA 2XQ0A 3T8MA 3MKQA 1L5JA 3ITFA 2L81A 4O79A 3RK6A 4EBAG 4BTBA 4FC8A 2CGEA 3JYSA 4KZCA 2WXIA 4RVBA 4JHKA 4FU3A 5T3RA 2R7XA 4BT9A 2CDQA 1P5QA 3VAYA 3CKBA 1EF1C 1D1AA 1HU3A 5KYWB 4MKTA 3Q6MA 1IHGA 4E7ZA 3TJPA 3ASGA 3TG5A 4IRUA 3L08A 2E2EA 3D3MA 3SFZA 1QQEA 3D9JA 4XE0A 3FTXA 4AX2A 4OINF 4F4BA 4LLEA 3QDNA 5D92A 2XRYA 1ZHWA 2VTBB 4EQFA 3ZHEA 2PL2A 4RSYA 2KZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1O B;  4IRU A;  4JVS A;  4I1M A;  4JW1 A; 
#chains in the Genus database with same CATH topology
 1D0X A;  2OJE D;  3LS0 A;  5BT1 A;  4AL1 A;  2JAB A;  4I43 A;  4BSX A;  1OR3 A;  2WZF A;  3T4R A;  2V5F A;  2XGS A;  3VLD A;  2W45 A;  4PUC A;  1M2V A;  4U8V D;  2UUI A;  4M7C A;  2IOL A;  3U2M A;  1YLM A;  1ZB1 A;  5DBK A;  3DXK G;  3QAR A;  3NRH A;  2HZ8 A;  4QI2 A;  2P9P G;  1MMA A;  4FA6 A;  1PAQ A;  4U5C E;  1FR0 A;  3O4Z A;  5LP0 A;  3GEH A;  4GZD A;  3ULY A;  4UI9 J;  3T5V A;  2KXP C;  3GOD A;  4KYO B;  1S7Z A;  3NMI A;  1O1R A;  4CYM D;  4BEJ A;  1NI1 A;  4FHK A;  3RW0 A;  1YYH A;  4EZL A;  1YA7 O;  1SYQ A;  4O60 A;  3CHR A;  3RAU A;  3U3B A;  3HNJ A;  4O7G A;  3Q5M A;  2FGY A;  1X81 A;  3RKV A;  4C0M A;  2C0M A;  4OVU A;  1NSG B;  1QSP A;  4YT5 A;  1QNF A;  4I9E A;  4PFP A;  2VAS A;  4N2S A;  3QNK A;  3ABM C;  2XRH A;  1S70 B;  4HVB A;  3SFX A;  5DS4 A;  2HFI A;  3ZPJ A;  1DOV A;  2P2C P;  3K1I C;  4XIF A;  3CQG B;  4ZHB A;  4JC8 A;  2R7R A;  4JJG A;  4C3B A;  3FTV A;  4N3B A;  2V3C C;  4ATZ D;  3NYJ A;  3T9O A;  2I2O A;  5K0I A;  3TWR A;  1NU7 D;  3UI2 A;  4DX2 A;  3FMS A;  4B93 B;  2HS5 A;  4PR9 A;  1ORS C;  3D9P A;  3HVE A;  4D4X A;  1SMY F;  4KNV A;  3WAQ A;  5EX3 A;  1WG0 A;  2J8W A;  1QVX A;  3R2P A;  4MTF A;  3Q75 A;  1Z3Y A;  1WTY A;  3DMD A;  2OCC E;  3MJW A;  3RH3 A;  2OG2 A;  3IQ5 A;  3AGU A;  2NSZ A;  4HS2 A;  2XLM A;  2WL8 A;  5COM A;  4NY3 A;  4BFR A;  4G0H A;  1OWP A;  3ABL E;  4Z68 A;  2IEJ A;  3FDQ A;  1O1S A;  1LPE A;  3AAA C;  4NIK A;  1SA5 A;  4B94 A;  1DCQ A;  3PNL B;  3ABK E;  5AQ9 A;  3SD5 A;  2DCP A;  2MWQ A;  5DS6 A;  2AWC A;  3QK0 A;  2KCL A;  1VB5 A;  1ORY A;  4ANU A;  4Q96 A;  5DVW A;  4ZLC A;  1RXQ A;  4LER A;  3GZS A;  3CVW A;  3GM3 A;  1IQU A;  4CS9 A;  3B95 A;  5EYL A;  4O6F A;  2WXG A;  3DWW A;  3JSZ A;  2EPM X;  2YL3 A;  5T8I A;  3JQ0 A;  3TUL A;  3E32 A;  4WAB A;  3UGP A;  2PM7 A;  3ZVV A;  4GQH A;  4XPX A;  1H19 A;  3NKE A;  4APF A;  2EIJ E;  3FUN A;  3FUF A;  2X38 A;  5L0G A;  5C2Y A;  4UWH A;  1HE8 A;  3O10 A;  2LQG A;  3MV2 B;  2J9U A;  3ZRH A;  2LSE A;  1RZ4 A;  5EID A;  4H4K C;  1INZ A;  4W8K A;  4DOZ A;  4ANX A;  4KBQ A;  1ZYR F;  5BV1 A;  3OXF A;  2B0O E;  4JW1 A;  5DQZ A;  2NUP A;  3VRC A;  2YHS A;  2UUH A;  3FU0 A;  1IZM A;  3IHV A;  2O9X A;  3LNR A;  3JUE A;  2VH3 A;  1A5E A;  4KI2 A;  1TN7 A;  4Q94 A;  4C7O A;  4FJZ A;  3BEH A;  1HG2 A;  4DRH B;  4G8L A;  3SXY A;  3T6G B;  2R7S A;  1VLS A;  3KMI A;  5KBA A;  2AJA A;  3I5P A;  2PQN A;  1YZC A;  2L6B A;  3PH0 C;  3B29 A;  4QQI A;  3TOL A;  1H0A A;  1K1B A;  2WMN A;  1KZP A;  2X3M A;  4CSA A;  4AEZ C;  3FUJ A;  3Q7A A;  3VLF A;  2VC9 A;  3PZ1 A;  2RFA A;  5HI7 A;  4L23 A;  3HKK A;  2XLO A;  4EWC A;  3FUM A;  5D91 A;  5L0H A;  1W2W A;  4I17 A;  1TR4 A;  4GTT A;  4XKB A;  3S0X A;  4FAD A;  1OCO C;  4MQ9 F;  1APC A;  3EHM A;  2LXM A;  3OWT A;  2J9Q A;  1HE9 A;  4A1S A;  3FTS A;  2XLW A;  1GQA A;  1MQV A;  1O1T A;  3UT4 A;  4RG9 A;  1LS1 A;  3ZWI A;  5JJ7 A;  4F53 A;  4NTA A;  2PBE A;  4YDY A;  3EHQ A;  2ZXW C;  4C7O B;  3MKR A;  3NMJ A;  2BF0 X;  3D9L A;  4FUL A;  4GPK A;  4WJ0 A;  3GWL A;  4DXW A;  3SBT B;  2DVW A;  4EPZ A;  2LAH A;  1V74 B;  3U3F A;  4U5H A;  5T1D B;  3OXG A;  4IN3 B;  4LEU A;  4I1O B;  4A2N B;  3ZN3 A;  4R32 A;  4K0R A;  1QYM A;  3LCA A;  1G4W R;  1QLE C;  1TJC A;  3QW0 A;  2J08 A;  3L16 A;  2LO6 A;  4UQZ A;  3QTH A;  3EIQ C;  1SZA A;  4CS8 C;  5E33 A;  2ILR A;  2WXO A;  4RDA A;  3BU8 A;  1H7I A;  2DYS C;  2OJQ A;  3AU4 A;  1KTM A;  1VOM A;  4Z9I A;  2IF4 A;  4XZ4 A;  2KQ9 A;  2KAT A;  5CMY A;  1S05 A;  3JTL O;  2WXJ A;  4DVZ A;  3V5Z A;  3UR3 C;  5CHE E;  3ULE G;  2NSF A;  3ZTZ A;  3IQC A;  2Z15 A;  1MMD A;  2H6H A;  3RQG A;  4LDR A;  5EIB E;  2HMQ A;  3L8J A;  3U8V A;  3AS8 A;  3CVN A;  2XLH A;  4LRZ A;  5FWQ A;  2PF4 E;  3ML8 A;  3PNT B;  4TRQ A;  2XL8 A;  3G2S A;  5D0Q D;  5AYW D;  4B6I A;  3B71 A;  1K05 A;  2FEZ A;  3FTY A;  1LS4 A;  2GRL A;  4L2Y A;  3EGD A;  1MHQ A;  3D9K A;  3FOO A;  3FWV A;  3LAY A;  1MQS A;  2WM9 A;  3GAN A;  5M72 A;  3NYM A;  2QTV A;  1NA3 A;  3DJN B;  2FO7 A;  4G24 A;  1BPO A;  2BTD A;  2Y69 E;  2R59 A;  3X1O A;  1SF8 A;  1K04 A;  2KJG A;  2LSU A;  3RF3 A;  1SW6 A;  4BEP A;  4G1T A;  2EIN C;  3OEO A;  1OCZ C;  2LUH A;  3AS4 A;  3S7B A;  5FJY A;  5JSL A;  4IWB A;  3M4B A;  3W9F A;  3TWQ A;  2YIN A;  1JOG A;  3AG1 E;  3QWP A;  1OXJ A;  2VCA A;  5JT4 A;  4GYT A;  4HNA D;  1E7U A;  4H54 A;  5IY5 C;  3X2Q C;  3FUL A;  4HFK B;  3MZL B;  3TD7 A;  2L9B A;  4NTF A;  4C9B B;  2DGJ A;  1R5I D;  4NC3 A;  1SZ9 A;  1BLX B;  5EX0 A;  2P9K G;  3ZYM A;  4KMO A;  5HQ8 A;  3RFY A;  4BJ6 A;  2XHE A;  2R7O A;  4E0H A;  1ZHX A;  4TXR A;  2WZG A;  2A69 F;  1Z6A A;  4MVO A;  5F5F A;  3V5Y A;  4U5B E;  1IYG A;  1WAS A;  3R9M A;  5J08 A;  4BX9 A;  4XI9 A;  3ASF A;  2R7U A;  4LSZ E;  2J8S D;  4MVU A;  4JEH A;  1T6Q A;  2ION A;  1ZHY A;  2P9I G;  1V55 C;  1RKE A;  1OKK D;  2WXH A;  3AG2 C;  5A6A A;  4MVR A;  3URZ A;  5ANR A;  4TXQ A;  1H2V C;  2XRZ A;  3VF0 A;  2DYR C;  3DST A;  3PRZ A;  1FVH A;  2FAP B;  1KT1 A;  2XEH A;  4CDR A;  4HE8 D;  1XWJ A;  1H9T A;  3GYZ A;  1JWF A;  3RRN B;  2XS8 A;  4M63 A;  1E86 A;  3RO3 A;  3SF4 A;  3NF1 A;  2CFZ A;  3ZC4 A;  2Q9C A;  3AU5 A;  3T6B A;  2L0T B;  5JP7 A;  1KZO A;  1HS6 A;  2Y1L E;  3DSU A;  3C7J A;  2R5S A;  3QJZ A;  5FQ4 A;  4DX7 D;  2PNO A;  3C18 A;  2ZIS A;  3KS2 A;  5FIN A;  2QLA A;  2WVO A;  2Y3B A;  4DVY P;  2PNN A;  4FJY A;  4ABN A;  1BBH A;  2VGX B;  2C03 A;  1Y4C A;  3U9J A;  2EIK E;  4HI9 A;  4AE4 A;  3EGX A;  2X6J A;  3L9T A;  1WGW A;  5ENP D;  3C3Q A;  3ESL A;  4RD9 A;  3MA5 A;  2QYU A;  2XPI A;  2WXQ A;  2H6F A;  4PS3 A;  3EH1 A;  1YJG A;  2EPN A;  1OQC A;  4JEB A;  2I1K A;  4N5Q A;  3Q78 A;  2Q9A A;  5L3Q A;  4BSZ B;  3EFO A;  4EBB A;  1BR1 A;  1ZBP A;  4YL0 A;  4UWL A;  3MV3 B;  1QBQ A;  4LDQ A;  1N11 A;  5JA4 D;  2QC9 A;  2NC9 A;  1ZHZ A;  4IGG A;  1G4U S;  1YDI A;  1Q0M A;  1UN8 A;  1IKN D;  3ONK A;  2H8A A;  1PCX A;  5G04 C;  4Y6C A;  5D0O D;  4WWN A;  5L0F A;  4N5C A;  1AVO B;  5JMN D;  3C63 A;  2P61 A;  3GM1 A;  2JPU A;  2J9V A;  4X8Q A;  5B3S E;  4WWP A;  4OIR F;  3U3W A;  2LP4 A;  4F3V A;  2E87 A;  5JHB A;  1RCP A;  1J8M F;  2KCV A;  3FP3 A;  1NZE A;  1E96 B;  2J7P D;  2Q7F A;  5KYY A;  2EQX A;  4BJT A;  2C2L A;  3SQV A;  2LAI A;  4EZK A;  1DCE A;  2J0W A;  3L54 A;  4HRL A;  3OXL A;  3ZGQ A;  3R7Q A;  2YRF A;  3Q7G A;  1UG7 A;  2G3V A;  3HIZ A;  2R7W A;  2YHC A;  2XLD A;  5COG A;  4KBL A;  1QQ3 A;  3DSW A;  2GFH A;  4K7B A;  3EDT B;  5A6C A;  3TXM A;  2NG1 A;  1OW7 A;  5KYX A;  4J6I A;  3C72 A;  5ANL A;  5FQ6 A;  2AVP A;  4ILI A;  2B0H A;  3ZFW A;  3TJ6 A;  3F46 A;  4JL0 A;  5AIJ A;  4WAF A;  3O55 A;  4HXI A;  1MZC A;  3TAX A;  4CDA A;  2GW1 A;  2OND A;  2WB2 A;  3QVZ A;  4HLE A;  4P9T A;  4TV3 A;  1ST6 A;  3HXC A;  3SZ7 A;  5FZT A;  3CK7 A;  3UMK A;  3TGO A;  5KYU A;  1NFN A;  3JYH A;  3L0I A;  4DI3 A;  3MGB A;  3R9A B;  3S27 A;  4GTS A;  2F22 A;  4A4A A;  2OCC C;  4H7Y A;  4P6I C;  4TUM A;  2WXK A;  1LM3 B;  2A4Z A;  1BD8 A;  3NOC D;  4GA2 A;  3FXH A;  4ANW A;  3IBE A;  3UT8 A;  2QNL A;  3U66 A;  2QUP A;  3FFL A;  3JRT A;  3UX4 A;  2C04 A;  2LD6 A;  3ABL C;  4YT4 A;  5L0J A;  4QFV A;  3I4U A;  4HEA J;  3ABK C;  3CEQ A;  4HI8 A;  4JA7 A;  3LS8 A;  4O1O A;  2J07 A;  1YYJ A;  3DKA A;  4B89 A;  4Q5S F;  4I1A A;  1SR2 A;  2XCC A;  3NBN B;  4HLL A;  2FI7 A;  4D4N A;  1RMV A;  4D10 C;  4XEI G;  5EKQ D;  1DC2 A;  1TWA A;  1YA9 A;  2HMZ A;  3ENE A;  3U8P A;  4I6E A;  2YL7 A;  3S84 A;  1N54 A;  4BG0 A;  1E83 A;  3IEE A;  3LDZ A;  2HV7 A;  5KCM A;  3CVP A;  3ZXS A;  3PEU B;  2GRO B;  5CRV A;  4U9D A;  1MJ0 A;  4U95 D;  5T4Y A;  2EIJ C;  3MYI A;  1EA8 A;  1G8X A;  2XXA A;  3GW4 A;  3MKQ B;  2W4B A;  2G3K A;  1E84 A;  3DSV A;  1J8Y F;  3QZC A;  1LF8 A;  3KEZ A;  2A5U A;  3HLZ A;  3W2W A;  1Q0K A;  1KU2 A;  3EZH A;  3GZ2 A;  3HXF A;  1ZU5 A;  3NAW A;  3NG1 A;  3M1C B;  2OQM A;  5LX8 A;  1YCS B;  4APO A;  3LY8 A;  1D0Z A;  2OVF A;  4PJM A;  3I4G A;  3N0T A;  4L1B A;  1NP7 A;  5FZR A;  3V30 A;  1E2X A;  4DX5 D;  4J7W A;  2P9L G;  4FWV A;  4FLH A;  5LFA A;  2GWW A;  1CPR A;  3PRE A;  5A7D B;  1Y6I A;  2KSF A;  3CHO A;  2NYJ A;  2X6F A;  4GTR A;  3CHS A;  1H9G A;  4CEM A;  2RG8 A;  3A11 A;  1N4Q A;  4YJW A;  4GPM A;  4FX5 A;  3HXE A;  5CIV A;  1Y6D A;  1N95 A;  4GB9 A;  4C48 B;  3C3O A;  4EHM A;  5AGF A;  2KC7 A;  1E7V A;  3JXI A;  2RD9 A;  2Y3H A;  3HXD A;  1OY3 D;  3B7U X;  3ZHE B;  3GWN A;  4PFO A;  4JZA A;  2KZT B;  4ILG A;  2IYL D;  4KZ0 A;  3UM1 A;  3DZA A;  2GRN B;  2P0N A;  4BJ5 C;  1VDY A;  3SGH A;  4PS7 A;  1CGM E;  1ELK A;  2UY1 A;  1M2V B;  1N52 A;  2F0Y A;  5BV0 A;  2ZPA A;  1H6O A;  1K3Z D;  1KT0 A;  1NLX A;  4U9E A;  3E37 A;  4OIP F;  5E75 A;  2J49 A;  4XEV A;  1TNO A;  3AG4 E;  1T5O A;  3N24 A;  4WUY A;  3DEP A;  2MYS A;  4BER A;  2YNQ A;  1OCC E;  4G7H F;  4F6R D;  4JUR I;  2PQR A;  4WNE A;  1A7D A;  4U5G A;  3V2X A;  3VTY A;  4DLQ A;  3GEI A;  4BES A;  4HOU A;  4MND A;  3G4X A;  4I6G A;  4KXK B;  3PHF 2;  4JTA B;  4BY6 A;  4AIF A;  2L6G A;  4JTC B;  2IXM A;  4Z9J A;  1TJF A;  3FUE A;  4E18 A;  3LVQ E;  5ENQ D;  2Y4T A;  2OKU A;  4HOT A;  3ZG1 A;  3AS5 A;  2A5E A;  3EPV A;  2OVB A;  3S29 A;  3B0V C;  3JCK C;  4N6C A;  3UIO C;  4EBK A;  2OEX A;  5JHA A;  2J9W A;  3DJU B;  1MX6 A;  3LYA A;  1A7E A;  1O5M A;  1M56 C;  1SQM A;  2XGM A;  2IXN A;  4XEK A;  4GYW A;  3O39 A;  3RRM B;  3JSE O;  3K33 A;  4DJ9 A;  5A69 A;  1T01 A;  5G05 C;  1JCQ A;  2OOC A;  1QZX A;  4AL0 A;  4BTA A;  1L7C A;  3BRJ A;  2XM0 A;  4EEC A;  2XLV A;  4G7O F;  2FUL A;  4E6H A;  3I5Q A;  2YL1 A;  3NOG D;  4JHR A;  3R7C A;  4GZ3 A;  4G2V A;  4ER9 A;  3SBS A;  1VK5 A;  4PK4 A;  5ENO D;  3PE4 A;  4CRW A;  5EHH A;  3DSS A;  2H6G A;  3HVE B;  2AXU A;  1Q0D A;  3PZ4 A;  2P7V A;  1HH8 A;  2J09 A;  3D9I A;  4CIH A;  3TK0 A;  1GGQ A;  4E85 A;  2B0J A;  2DI3 A;  2AWY A;  4J0U A;  3DWL G;  4YDE A;  4ACL A;  1VMA A;  1TNU A;  4HFF B;  2Y69 C;  1M57 C;  1ELW A;  3WXX A;  5LOZ A;  3LNM B;  2D4U A;  3MFN A;  3UKR G;  3HNL A;  4ME2 A;  4ANV A;  1UJJ A;  2Y3D A;  4KVM A;  3KL4 A;  4BWR A;  2XCB A;  3MEK A;  1PY1 A;  3NQP A;  4L9P A;  3B7T A;  1IW7 F;  3AG1 C;  3RIB A;  4C3D A;  5L3V A;  4NUR A;  3EIJ A;  3ZVR A;  1D1C A;  3ASH A;  2FF4 A;  3U9W A;  3QW1 A;  2L9J A;  4HRM B;  4GAA A;  2L6J A;  4YDW A;  3G2T A;  1JPN A;  1H6G A;  3G4Z A;  3DM5 A;  3L8I A;  2J46 A;  2V0P A;  3DBS A;  2LNI A;  1C03 A;  2XZT G;  3KKB A;  2Y39 A;  3OA1 A;  3JT1 A;  3W4Y A;  3FEY A;  3F6Q A;  3T5X A;  3H65 A;  5DQT A;  2IFU A;  3ABM E;  3FU5 A;  4GA0 A;  4JA9 A;  3CHM A;  5G04 J;  3DXJ F;  2KCK A;  1HY5 A;  4JXT A;  2X6H A;  1KPS B;  1A0B A;  3B9Q A;  1Z3I X;  1I4Y A;  2WXN A;  4HB5 A;  3L13 A;  1JRA A;  2NUP B;  3O48 A;  2Y3A A;  1LE4 A;  2XL4 A;  3Q15 A;  3HNK A;  5B1B E;  2ZGG A;  3UGO A;  2ASR A;  1D1B A;  1WAO 1;  1OXB A;  2VJ8 A;  3LXU X;  1WN0 A;  3UNG C;  1BDJ B;  4HRN A;  4CIP A;  4O6N A;  3FH8 A;  3D9N A;  4GYY A;  3CVQ A;  2DZO A;  2WXP A;  2NUT A;  3E30 A;  3SO8 A;  4LG6 A;  5BQI A;  4JD2 G;  1TNZ A;  1JMW A;  2ZXR A;  3B7S A;  4MLP A;  3RJV A;  2EIK C;  3EJN A;  3RU0 A;  2PP4 A;  1U3D A;  3FUK A;  4DJA A;  1D9S A;  3Q47 B;  4AY5 A;  5DS5 A;  5L0D A;  1EPU A;  4R7L A;  4MRU A;  1JCR A;  3L6A A;  3LVR E;  4JKV A;  4AXH A;  4CS9 C;  1WM5 A;  4BPM A;  2X6I A;  4J7T A;  5JS5 A;  1AEP A;  3LEW A;  2P9S G;  3CGH A;  3SEO A;  3WOD F;  2MHR A;  4IB4 A;  1OUV A;  1WDY A;  4J32 B;  1YA0 A;  4PS8 A;  5B1A E;  2QZA A;  1ZW2 A;  4XTK A;  3KD7 A;  2WZL A;  1OCR E;  4G11 A;  4YWQ A;  4B8A A;  3Q73 A;  3CIA A;  3CST A;  3B7B A;  2A1D D;  4I44 A;  3PZD A;  1MMG A;  2J9B A;  3TWW A;  1G5Z A;  5BXO A;  3UMV A;  4CCA A;  1E8Y A;  1FT2 A;  4MVS A;  3CK9 A;  1OW6 A;  3DE9 A;  2TMV P;  3S7D A;  1TWC A;  2ICW G;  3ZDL A;  5B3S C;  3ZEF A;  1FPP A;  1HXI A;  2R02 A;  1Q2Z A;  4K5B A;  1EKY A;  4HQD A;  5CED B;  4HOQ A;  1AUE A;  2VGE A;  3ASD A;  4X0R A;  1MX4 A;  2EPO A;  5AQA A;  1H6K A;  3NDB B;  2V4L A;  1VTM P;  1D8E A;  1UW4 B;  1WY6 A;  4Q69 A;  3LKU A;  1TYQ G;  1FMV A;  1CGO A;  4XQ1 A;  4OD4 A;  4DRX E;  4EHP A;  1K8K G;  2DBA A;  1A17 A;  4CSA C;  4J8E A;  1N0Q A;  1HF8 A;  3CV0 A;  2J0X A;  2VSX E;  4FHJ A;  1RJ9 A;  2YHE A;  2L6H A;  1Z3X A;  3FHD A;  3DXM G;  4DX6 D;  1UG3 A;  3LEO A;  3DPY A;  2WVI A;  3FAJ A;  3WG7 E;  4AVX A;  4E7S A;  1MND A;  2XLE A;  3CEX A;  1S64 A;  3IV0 A;  3EUV A;  3CZ6 A;  1ORJ A;  2ZXP A;  3CKC A;  5KJL A;  3S28 A;  2XPY A;  4GA1 A;  4L7T A;  2KW3 C;  3C8G A;  5BUO A;  3EGD B;  3Q79 A;  2DB4 A;  5GPG B;  3MX3 A;  2IJG X;  3EHR A;  1Z5S C;  3IEG A;  4I2W A;  3HXB A;  3HDX A;  2J4B A;  1ELR A;  4DUI A;  5FQ7 A;  1O87 A;  2J4D A;  1FTS A;  2ETB A;  4F1S A;  1A7V A;  2WXM A;  4RQI A;  1UFB A;  4XLN F;  3EU5 A;  3R7R A;  3KH2 A;  1N4P A;  2L0I A;  2X6K A;  3UMH A;  4F1P A;  1TWH A;  2EPL X;  3AQB A;  2VSY A;  1V54 E;  2P6V A;  2ZXO A;  1FT1 A;  4A55 A;  4L2L A;  1ZZP A;  4N6H A;  5AAR A;  4LLC A;  4CDM A;  4GTQ A;  4OVV A;  3FOP A;  2R2L A;  1ZU4 A;  4J8D A;  2GDC A;  2HR2 A;  2IBF A;  2J45 A;  2W9Y A;  3LLK A;  4N06 A;  4W9R A;  2OEV A;  2CYD A;  3DE8 A;  3TWU A;  1BR4 A;  3SXM A;  4ANJ A;  3EZI A;  4J30 B;  4MW8 A;  5E3C A;  3RRU A;  3BEE A;  3QWW A;  3CR3 A;  4CS7 A;  3E33 A;  4GZ5 A;  3DD7 A;  3UM0 A;  3OTN A;  5ITZ F;  2OEW A;  3BG0 B;  4CT0 A;  1LTX A;  2V26 A;  4KVO A;  1UJK A;  1XGW A;  1N9A A;  2R03 A;  3B0U X;  3Q9N C;  4OAU C;  2R7T A;  1TNY A;  1BI8 B;  2PX3 A;  5CI8 A;  3J5P A;  1RKE B;  3IHU A;  3CHP A;  3ESK A;  5FT9 A;  1JWG A;  2ETC A;  3UM3 A;  4WNG A;  3EHN A;  4MTG A;  1N4R A;  3QC1 A;  1NU9 C;  3RIP A;  3S90 A;  1TN8 A;  4LCT A;  3ZQY A;  2MOW A;  4IYP A;  4G25 A;  2BUG A;  4MVM A;  2HJM A;  2V5Q C;  2M4E A;  2Q4F A;  3E9V A;  3SP1 A;  5JJT A;  4EIY A;  3RKO F;  3IQ6 A;  2R17 C;  2I15 A;  4ILH B;  1NG1 A;  3E34 A;  4J8S A;  4URK A;  1EI7 A;  4GZ6 A;  2P1A A;  5ENN A;  1LKX A;  3EG9 A;  2A0U A;  1WWP A;  4XWJ A;  3C3R A;  2XS1 A;  3PS6 A;  3FHE A;  2WMO A;  2R05 A;  4U07 A;  3KYI A;  3MLG A;  2EPK X;  4J8F A;  5LCW J;  4U0Z A;  2F8X K;  1ZU2 A;  1N1C A;  1HFA A;  4I2Z A;  4AE4 B;  4GML A;  3EGX B;  2Y4U A;  2CNW D;  2I8B A;  4NCQ A;  1JUQ A;  4H7X A;  5BW8 C;  4GTV A;  4K1O A;  2GRQ B;  1TN6 A;  5KYN A;  3W8H A;  3DEO A;  2PX0 A;  5G05 J;  2RD0 A;  3JZ0 A;  5AN8 A;  3ULQ A;  3CVL A;  4UQX A;  3TXN A;  3EFO B;  3PE3 A;  4BJ6 C;  4OIO F;  2CG2 A;  3SNX A;  3N71 A;  4CJO A;  2C0L A;  1NZN A;  3NKD A;  3DSX A;  5CRU A;  3CVX A;  1WOL A;  3J06 A;  5KYW A;  5ARG A;  1LD8 A;  1B89 A;  1N0R A;  3BUA A;  5F5H A;  4JB8 P;  5T3T A;  1JPJ A;  4DRI B;  5F28 E;  3UIP C;  2BED A;  3ZYQ A;  1VYI A;  3FTZ A;  4LNB A;  1HMD A;  2XL6 A;  1GM5 A;  2CHX A;  5G2N A;  3AG4 C;  3CVU A;  3K1I A;  2Q00 A;  1Z5Z A;  5A6B D;  2FFH A;  4I1M A;  1OCC C;  4ULW A;  2VTB A;  4LAC B;  1DOW A;  2RFM A;  1E8X A;  3ASN E;  4LUN U;  5KYY B;  4TXP A;  3IHY A;  5L0C A;  2P9U G;  4JZY A;  4UDV A;  1JR8 A;  5AAO A;  4I3M A;  3ATP A;  2KM4 A;  2VSO E;  3APC A;  5EDS A;  5ENT D;  3JRM O;  1U3C A;  5BQG A;  1VYK A;  3P1U A;  2H7V C;  4Y6W A;  1N94 A;  4DI4 A;  1K1A A;  1BR2 A;  5KYX B;  4IAO A;  1OT8 A;  3QMK A;  4DRJ B;  4YN0 B;  3IQT A;  3W9G A;  5CCL A;  2HJ3 A;  1I4Z A;  5E76 A;  4Q4Z F;  3UMI A;  1AWC B;  3BG1 B;  2LCH A;  3M4C A;  3KAE A;  5ENR D;  2GRP B;  3CLJ A;  2WXF A;  3Q7F A;  1DNP A;  4Q7C A;  4A3V A;  3RSE G;  1IQR A;  1FCH A;  3ASO E;  3UUX A;  1Q0F A;  4G23 A;  3PZ3 A;  2NXP A;  3LS1 A;  2YVK A;  4BET A;  1BZ4 A;  5KYU B;  1KNY A;  1E8W A;  3GM2 A;  4AY6 A;  4P9F A;  2JLB A;  2I1J A;  1S63 A;  5L0I A;  4GMJ A;  4U5E E;  2BKK B;  2XEN A;  3QKY A;  1JPL A;  2IXP A;  2YQ8 A;  2HM8 A;  3LPZ A;  4DLO A;  2M64 A;  1IXV A;  4WWO A;  2VCB A;  3PZ2 A;  2AXZ A;  2LIG A;  3ZTM A;  2ETS A;  2WB7 A;  2YLI A;  2GRM A;  2AWI A;  4GEH A;  3ZSU A;  3I4R B;  3L82 A;  3KYJ A;  3PEV B;  3C62 A;  2QYJ A;  1F1M A;  5KNH D;  5DIZ A;  1V4A A;  4LDK A;  1A41 A;  3L34 A;  3ZU7 B;  4U96 D;  4K5A B;  2XEV A;  4XPW A;  2LK4 A;  1FFT C;  5FZS A;  3K6B A;  2PFD A;  4EUK B;  4IAR A;  2GAQ A;  3JCU Q;  1EDU A;  4EZJ A;  1TWG A;  3CQZ A;  4B8C B;  4NTB A;  2V4H C;  2JX0 A;  1SVX A;  5EIL A;  3TWS A;  2F8Y A;  3D9M A;  2EIM E;  4J7Y A;  1ZHT A;  1MX2 A;  4XEF A;  4ZLD A;  2AW6 A;  4HBD A;  5KJN A;  3AG3 E;  3HRA A;  4OIQ F;  4JIO A;  2F37 A;  2XXA B;  3L17 A;  4PH4 B;  2GA0 A;  1UOH A;  5CEA A;  1CGN A;  1I5N A;  1TFK B;  4YDO A;  1Z6T A;  2EIL E;  3QAQ A;  5HKP A;  1TNB A;  3LEV A;  4GCO A;  1ZVZ A;  4CDV A;  3FTU A;  4WND A;  4WNF A;  3O6X A;  2B6C A;  5JJ6 A;  2WXL A;  5B1B C;  3GZ1 A;  5BUZ A;  2KBX A;  5AJD A;  3TWX A;  4K5C A;  2LFD A;  1G3N B;  5E2Q A;  2GGF A;  1JAF A;  4XI0 A;  4QDL A;  5D2M C;  4QI0 A;  4N3A A;  2ZD9 A;  5JLI A;  5JUA A;  5B3I A;  4MTO A;  4B0Z A;  3L22 A;  4FES A;  1OWL A;  3I3N A;  3T9K A;  2VGY A;  3K9I A;  4EBA A;  3PCV A;  3VM6 A;  4UI9 K;  3QVY A;  1O5H A;  3RO2 A;  4F7A A;  5TJ5 E;  4E17 A;  1MYO A;  1Z7Q c;  4O6M A;  1X5B A;  3S7J A;  4IJJ A;  5C1D A;  3FU3 A;  3U5S A;  2AU5 A;  4JCZ A;  5LCW C;  3J5Q B;  4HOR A;  2AP3 A;  2D5R B;  2IQC A;  4G78 A;  3FH5 A;  2LSV A;  1HO8 A;  2R7V A;  4FLB A;  3NZS A;  4NAC A;  4OAV B;  3ZYK A;  4GTP A;  4AK9 A;  3V2O A;  2CW0 F;  4C3E A;  3HTK C;  2UY1 B;  3P2B A;  2JEK A;  4PJL A;  4U63 A;  1S0P A;  4DPR A;  1CPQ A;  2YKZ A;  4XKC A;  1Q0G A;  2JD3 A;  3M79 A;  3BQO A;  4CS8 A;  2V8S E;  1XZP A;  1PC2 A;  5B1A C;  3T6J A;  2QE9 A;  3VYW A;  5AC4 A;  1OCR C;  1HX8 A;  3UIN C;  1OXK A;  4I6J A;  2XM4 A;  4DK5 A;  3PUJ A;  3QOU A;  3GEE A;  5A23 A;  3H2U A;  3LES A;  4CX9 A;  5AQ7 A;  1W3B A;  4L6R A;  3CSF A;  4N39 A;  3AJI A;  4A3T A;  1YVI A;  3HYM B;  2P9N G;  2UWJ G;  3CHQ A;  4FAP B;  1HW1 A;  4P29 A;  4UWG A;  3NMK A;  1EQ1 A;  3NB2 A;  3ZNG A;  5COF A;  2H7B A;  3RQE A;  3W8I A;  2BL2 A;  2YZS A;  2QY7 A;  5BNW A;  5BPP A;  1UN9 A;  4GYO A;  3K7D A;  4JVS A;  2BC5 A;  5AQB A;  2OOE A;  4XPY A;  5E3A A;  2IM8 A;  3NYL A;  1FNT c;  1TKN A;  5J90 A;  2ZGD A;  1NFI E;  1T6U A;  3DPD A;  4GTM A;  3ECS A;  2L6F A;  5CI9 A;  3JUI A;  3V79 K;  1OR2 A;  2I9C A;  4WGY A;  1OWN A;  1PV3 A;  3F47 A;  3HJC A;  3ZYL A;  4CJG A;  4NRH B;  3APD A;  3EQL F;  3CK8 A;  4JEA A;  3UXG A;  1BU9 A;  3WG7 C;  2XGO A;  5CMW A;  1B68 A;  4CGV A;  4YK5 A;  2VSN A;  5A6J A;  3LJN A;  4U04 A;  2CHZ A;  1TEZ A;  4PJN A;  3FU6 A;  256B A;  3ZUV B;  5EGY A;  4BT8 A;  5KNG A;  1OKK A;  3FEX A;  3FUD A;  1Y8M A;  2H7O A;  4WGZ A;  2KYH A;  3V5X A;  4N2Q A;  4M3O A;  2HUJ A;  1V54 C;  4KC9 A;  3UTM A;  4CDN A;  4JCH A;  3ISM C;  3V7O A;  3FVY A;  3N2Z B;  1M2O A;  3ZIM A;  3U64 A;  4CGW A;  1MMN A;  3DAG A;  2E0I A;  5ARF A;  5EK0 A;  2BE5 F;  5FCL A;  4G26 A;  3TWT A;  3D9H A;  3S7F A;  3TL5 A;  1H2U A;  4DX1 A;  1FFH A;  4V3I A;  1NA0 A;  4DBQ A;  3SXK A;  3B0P A;  4JC7 A;  3DI5 A;  3V31 A;  4GTO A;  3Q4A B;  3C5R A;  4UI9 C;  1H2T C;  2Q7R A;  2I6H A;  3FDH A;  2VCC A;  3IXE A;  2CG3 A;  4PDX A;  2W4M A;  2WQH A;  4YVO A;  5KWD A;  4XLP F;  4Z9H A;  2Y3G A;  4K03 A;  4JHJ A;  3Q7L A;  3AGT A;  1NFO A;  4YL1 A;  2OV8 A;  3ZKJ A;  2WQ7 A;  3S2A A;  4HOS A;  5HRY A;  4K0D A;  3HHM A;  4DBR A;  3MYF A;  3G2V A;  3K1H A;  4LNG A;  1LE2 A;  2BKG A;  2MYO A;  5KJM A;  1M6T A;  5CEC B;  1YAR O;  2DZN A;  3LY7 A;  3PVL A;  2LFF A;  5BXU A;  3JYY A;  3IPM O;  2ETA A;  3UPV A;  1U6H A;  2WPV A;  3ZXP A;  2NUT B;  4MBG A;  1C17 M;  3US6 A;  2IY0 C;  1FMW A;  5FTP A;  3PMR A;  4AM9 A;  4CDY A;  1E85 A;  3JXJ A;  4NQ0 A;  4XX5 A;  2HYZ A;  2IXO A;  4FP7 A;  4GMR A;  3ZW3 A;  3SXZ A;  2IO2 C;  3B13 A;  1N4S A;  4U8Y D;  4A1G A;  1TFO B;  2RSE B;  5HSW A;  1D0Y A;  2VB6 A;  3E70 C;  4HFG A;  2CFU A;  2PZI A;  5CBN A;  2NSG A;  4RLY A;  1FAP B;  1LI5 A;  4U8H A;  4JEU A;  3ZIB A;  3MBG A;  2HSQ A;  2J7P A;  2WVN A;  3VLE A;  3CQC B;  2L7A A;  3LLI A;  3ONL A;  4GU5 A;  5EYP F;  2IOS A;  1RW2 A;  3DM9 B;  1NBB A;  2KC3 A;  2Q3T A;  1YZA A;  3Q6N A;  3NZU A;  2CNW A;  4RG6 A;  3UKU G;  4JE9 A;  2AXV A;  2WQ6 A;  2YQY A;  4CBE A;  1XZQ A;  1E8Z A;  2P58 C;  2XZD G;  2HE0 A;  3POV A;  5HS0 A;  3IKO B;  2RKK A;  4AP2 A;  3ZQV A;  4U0U A;  1LIH A;  4PJJ A;  5DLJ A;  4UWF A;  2VGX A;  1WAT A;  1EYH A;  1U0B B;  2XSE A;  3DAF A;  4ULV A;  3UM2 A;  2WXR A;  3SFY A;  2XEE A;  4PAC A;  3FY4 A;  2Q9B A;  2R25 A;  4CT4 A;  4AV7 A;  3FH7 A;  2MHK A;  1PD0 A;  2OU6 A;  1OW8 A;  2NPU A;  1T6I A;  1R4T A;  4OYS A;  3UQ3 A;  1OCO E;  2CHW A;  5BQH A;  3LJB A;  3JQ1 A;  3AQC A;  1LI7 A;  2XPZ A;  2WVQ A;  2YEV A;  3ASN C;  1VLT A;  2YLG A;  1YAU O;  4UQY A;  2PM6 A;  1DVP A;  3FTW A;  2ZU6 B;  1SZI A;  5A6B A;  5AJL A;  4MS6 A;  1JCS A;  3G2W A;  2QY9 A;  4JRZ A;  2KNH A;  1FVF A;  2ZXW E;  3B7R L;  3S9O A;  3SHF A;  1GW6 A;  3KSQ A;  1RJ9 B;  2HO1 A;  5G55 A;  3H2V A;  3MCX A;  1T9K A;  2H6I A;  3KEA A;  3LJ3 A;  4KNW A;  1L3P A;  1OWO A;  2M63 A;  4JJF A;  3W2V A;  3APF A;  4GCN A;  3ML9 A;  4AJW A;  2A6H F;  3LY9 A;  2R7Q A;  2AVK A;  2A0B A;  3C8G B;  4RBN A;  1KLX A;  3C98 A;  4ACK A;  2DYS E;  3U0C A;  4N3C A;  3ASO C;  1GS9 A;  3K66 A;  2G62 A;  1HMO A;  4UWK A;  5AEN A;  3T8K A;  2YLD A;  5H7P A;  4TUU A;  2Y0B G;  2FO1 E;  1RKC A;  3PDN A;  4BJ1 A;  1E90 A;  5T3W A;  1U2V G;  3DRA A;  2CCY A;  3M15 A;  3WHN A;  4KT6 B;  5CCM A;  3TQO A;  2VQ2 A;  1XNF A;  3PDM P;  3TG4 A;  5FQ8 A;  3SI5 A;  3CSK A;  1OWM A;  4ATG A;  4IAQ A;  4U7E B;  5FZQ A;  3SY2 A;  3RVZ A;  4MS2 A;  4IUL A;  3L1M A;  2YL0 A;  3KPH A;  3SYN A;  1O3U A;  5JVE A;  5AC5 A;  3U2L A;  3QB2 A;  4YND A;  3CAX A;  3PUK A;  3MYV A;  3AJM A;  2MRI A;  2X51 A;  1YYX A;  3RQF A;  4GZC A;  4MVZ A;  2IU1 A;  4BEM J;  3SZR A;  3UT7 A;  2LXL A;  5KJK A;  4YT2 A;  2ZIR A;  3A9C A;  1HE1 A;  4W8P A;  1HG5 A;  5FIO A;  4LNU D;  2EIN E;  2DIW A;  1K40 A;  4YT8 A;  1QKR A;  1OCZ E;  1QZ2 A;  4OD5 A;  1LVK A;  4CZ2 D;  3QWV A;  3E4B A;  5EN5 D;  4O1P A;  5CBO A;  2A6E F;  4JPS A;  1SA4 A;  2GRR B;  3TOM A;  2EIM C;  3VTX A;  1IHB A;  2A68 F;  4UUC A;  2KGO A;  2HSB A;  3RYL A;  1HZ4 A;  4U5F E;  4N4W A;  2KK1 A;  3FUH A;  5IY5 E;  3FUI A;  4C0E A;  3AG3 C;  3X2Q E;  4MVQ A;  4G8K A;  2FBN A;  5A6K A;  1LD7 A;  4BX8 A;  1YMP A;  3RVY A;  4O6Y A;  3C8G D;  2EIL C;  3EH2 A;  3G2U A;  1NL4 A;  1TR2 A;  4A63 B;  3Q49 B;  1H6P A;  2QFC A;  3D9O A;  3TWV A;  1TQG A;  4YVQ C;  1Z23 A;  4JTD B;  5JRA A;  2HV6 A;  1BI7 B;  4BJ5 A;  2YWA A;  3FAP B;  5ENS D;  3CVY A;  4YL3 A;  4J8Y A;  4U5D E;  1C02 A;  3EG9 B;  1Z63 A;  1MNE A;  1PD1 A;  3OAW A;  2IO3 C;  4I9C A;  3G50 A;  1V55 E;  3U4T A;  5HV9 A;  3AG2 E;  3GOR A;  4AOF A;  3SNH A;  3TJ5 A;  2IOQ A;  3CVV A;  2X0C A;  2VYI A;  4G7Z F;  4U0S A;  2DYR E;  2XQ0 A;  3T8M A;  3MKQ A;  1L5J A;  3ITF A;  2L81 A;  4O79 A;  1U89 A;  3U9M A;  3RK6 A;  4EBA G;  4BTB A;  4FC8 A;  1QPU A;  2DWZ A;  3EU9 A;  2CGE A;  3JYS A;  3Q9U C;  4KZC A;  2WXI A;  4RVB A;  4JHK A;  3KSL A;  4FU3 A;  3LUT B;  5T3R A;  2R7X A;  4BT9 A;  2CDQ A;  4EKW A;  3VAY A;  1P5Q A;  3CKB A;  1EF1 C;  1D1A A;  1HU3 A;  5CER B;  5KYW B;  4MKT A;  3Q6M A;  1IHG A;  4MW3 A;  4E7Z A;  3TJP A;  3ASG A;  1ZW3 A;  3TG5 A;  4IRU A;  2E2E A;  3L08 A;  3D3M A;  3SFZ A;  4EBJ A;  1QQE A;  3D9J A;  4XE0 A;  2HKV A;  4ZFH A;  3FTX A;  2R9R B;  4AX2 A;  4OIN F;  4ONS A;  4F4B A;  1AP7 A;  3AOU A;  4LLE A;  3QDN A;  1HW2 A;  5D92 A;  3C8Z A;  2XRY A;  1ZHW A;  1D8D A;  4NQF A;  3HNI A;  2VTB B;  4E0I A;  4EQF A;  3HG0 D;  3ZHE A;  5D66 A;  2PL2 A;  4RSY A;  2KZT A; 
#chains in the Genus database with same CATH homology
 1D0X A;  3LS0 A;  5BT1 A;  4I43 A;  4BSX A;  2WZF A;  3T4R A;  2V5F A;  2XGS A;  3VLD A;  2W45 A;  4PUC A;  1M2V A;  2IOL A;  5DBK A;  3QAR A;  3NRH A;  4QI2 A;  1MMA A;  4FA6 A;  1PAQ A;  4U5C E;  3O4Z A;  5LP0 A;  4GZD A;  4UI9 J;  3T5V A;  3GOD A;  4KYO B;  1S7Z A;  4BEJ A;  4FHK A;  4EZL A;  3CHR A;  4O7G A;  3Q5M A;  2FGY A;  3RKV A;  4C0M A;  2C0M A;  4OVU A;  4YT5 A;  1QNF A;  4I9E A;  4PFP A;  2VAS A;  4N2S A;  3QNK A;  3ABM C;  2XRH A;  4HVB A;  5DS4 A;  3ZPJ A;  3K1I C;  4XIF A;  3CQG B;  4JC8 A;  2R7R A;  4JJG A;  4C3B A;  3FTV A;  4N3B A;  2V3C C;  3NYJ A;  2I2O A;  1NU7 D;  3D9P A;  3HVE A;  1SMY F;  4KNV A;  5EX3 A;  1Z3Y A;  3DMD A;  3MJW A;  3RH3 A;  2OG2 A;  2NSZ A;  4HS2 A;  2WL8 A;  4NY3 A;  4BFR A;  4G0H A;  1OWP A;  3FDQ A;  4B94 A;  3PNL B;  3SD5 A;  2DCP A;  2MWQ A;  5DS6 A;  3QK0 A;  2KCL A;  4ANU A;  4Q96 A;  5DVW A;  4ZLC A;  4LER A;  3GZS A;  3CVW A;  1IQU A;  4CS9 A;  4O6F A;  2WXG A;  3JSZ A;  5T8I A;  3JQ0 A;  3UGP A;  2PM7 A;  3ZVV A;  1H19 A;  3NKE A;  4APF A;  3FUN A;  3FUF A;  2X38 A;  5C2Y A;  4UWH A;  1HE8 A;  3MV2 B;  2J9U A;  3ZRH A;  2LSE A;  4H4K C;  1INZ A;  4W8K A;  4DOZ A;  4ANX A;  4KBQ A;  1ZYR F;  5BV1 A;  3OXF A;  4JW1 A;  5DQZ A;  2NUP A;  2YHS A;  3FU0 A;  1IZM A;  3IHV A;  2O9X A;  3LNR A;  2VH3 A;  4KI2 A;  4Q94 A;  4C7O A;  4FJZ A;  1HG2 A;  2R7S A;  3KMI A;  3I5P A;  2PQN A;  3PH0 C;  1H0A A;  2WMN A;  2X3M A;  4CSA A;  4AEZ C;  3FUJ A;  3VLF A;  5HI7 A;  4L23 A;  4EWC A;  3FUM A;  5D91 A;  1W2W A;  4I17 A;  4XKB A;  3S0X A;  4FAD A;  1OCO C;  4MQ9 F;  3EHM A;  3OWT A;  2J9Q A;  4A1S A;  3FTS A;  3UT4 A;  4RG9 A;  1LS1 A;  5JJ7 A;  4F53 A;  2ZXW C;  4C7O B;  3MKR A;  4FUL A;  2BF0 X;  3D9L A;  4GPK A;  4WJ0 A;  3SBT B;  4EPZ A;  2LAH A;  4U5H A;  5T1D B;  3OXG A;  4IN3 B;  4LEU A;  4I1O B;  4A2N B;  3ZN3 A;  4K0R A;  3LCA A;  1QLE C;  1TJC A;  2J08 A;  3L16 A;  2LO6 A;  4UQZ A;  3EIQ C;  1SZA A;  4CS8 C;  5E33 A;  2ILR A;  2WXO A;  4RDA A;  2DYS C;  3AU4 A;  2IF4 A;  1VOM A;  4XZ4 A;  2KQ9 A;  2KAT A;  5CMY A;  2WXJ A;  4DVZ A;  5CHE E;  3UR3 C;  2Z15 A;  1MMD A;  3AS8 A;  3CVN A;  5FWQ A;  4LRZ A;  2PF4 E;  3ML8 A;  3PNT B;  4TRQ A;  3G2S A;  5D0Q D;  5AYW D;  4B6I A;  2FEZ A;  3FTY A;  2GRL A;  4L2Y A;  3EGD A;  1MHQ A;  3D9K A;  3FWV A;  3LAY A;  1MQS A;  2WM9 A;  3GAN A;  5M72 A;  3NYM A;  2QTV A;  1NA3 A;  3DJN B;  2FO7 A;  4G24 A;  1BPO A;  2BTD A;  2R59 A;  3X1O A;  1SF8 A;  2KJG A;  2LSU A;  4G1T A;  2EIN C;  3OEO A;  1OCZ C;  3AS4 A;  3S7B A;  5FJY A;  4IWB A;  2YIN A;  3QWP A;  4GYT A;  1E7U A;  5IY5 C;  3X2Q C;  3FUL A;  4HFK B;  3MZL B;  3TD7 A;  2L9B A;  4C9B B;  2DGJ A;  1SZ9 A;  5EX0 A;  3ZYM A;  5HQ8 A;  4KMO A;  3RFY A;  4BJ6 A;  2XHE A;  2R7O A;  1ZHX A;  2WZG A;  2A69 F;  1Z6A A;  5F5F A;  4U5B E;  1IYG A;  5J08 A;  4BX9 A;  4XI9 A;  3ASF A;  2R7U A;  4JEH A;  2ION A;  1ZHY A;  1V55 C;  2WXH A;  1OKK D;  3AG2 C;  3URZ A;  5ANR A;  1H2V C;  2XRZ A;  2DYR C;  3PRZ A;  1FVH A;  4CDR A;  1KT1 A;  4HE8 D;  3GYZ A;  3RRN B;  1JWF A;  4M63 A;  3RO3 A;  3SF4 A;  3NF1 A;  2CFZ A;  3ZC4 A;  2Q9C A;  3AU5 A;  3T6B A;  2L0T B;  1HS6 A;  2R5S A;  3QJZ A;  5FQ4 A;  3KS2 A;  2WVO A;  2Y3B A;  4FJY A;  4DVY P;  4ABN A;  2VGX B;  2C03 A;  4AE4 A;  3EGX A;  2X6J A;  1WGW A;  3ESL A;  4RD9 A;  3MA5 A;  2XPI A;  2WXQ A;  4PS3 A;  3EH1 A;  2I1K A;  2Q9A A;  5L3Q A;  3EFO A;  4EBB A;  1BR1 A;  1ZBP A;  4UWL A;  3MV3 B;  2NC9 A;  1ZHZ A;  1UN8 A;  3ONK A;  1PCX A;  5G04 C;  4Y6C A;  5D0O D;  4WWN A;  4N5C A;  2J9V A;  4WWP A;  4OIR F;  3U3W A;  4F3V A;  2E87 A;  5JHB A;  1J8M F;  2KCV A;  3FP3 A;  1NZE A;  1E96 B;  2J7P D;  2Q7F A;  5KYY A;  2EQX A;  4BJT A;  2C2L A;  2LAI A;  4EZK A;  2J0W A;  3L54 A;  3OXL A;  3ZGQ A;  3R7Q A;  3Q7G A;  2G3V A;  3HIZ A;  2R7W A;  2YHC A;  4KBL A;  2GFH A;  4K7B A;  3EDT B;  5A6C A;  3TXM A;  2NG1 A;  5ANL A;  5KYX A;  4J6I A;  5FQ6 A;  3ZFW A;  2AVP A;  4ILI A;  3F46 A;  4JL0 A;  5AIJ A;  4WAF A;  4HXI A;  3TAX A;  2GW1 A;  2OND A;  2WB2 A;  4HLE A;  4TV3 A;  1ST6 A;  3SZ7 A;  3CK7 A;  3UMK A;  3TGO A;  5KYU A;  3JYH A;  3L0I A;  4DI3 A;  3MGB A;  3R9A B;  3S27 A;  2OCC C;  4H7Y A;  4P6I C;  2WXK A;  2A4Z A;  4GA2 A;  4ANW A;  3IBE A;  3UT8 A;  3U66 A;  3FFL A;  3JRT A;  3UX4 A;  2C04 A;  3ABL C;  4YT4 A;  4QFV A;  3I4U A;  4HEA J;  3ABK C;  3CEQ A;  4JA7 A;  3LS8 A;  2J07 A;  4B89 A;  4Q5S F;  4I1A A;  2XCC A;  2FI7 A;  4D10 C;  5EKQ D;  1TWA A;  4I6E A;  3ENE A;  1N54 A;  4BG0 A;  3IEE A;  3LDZ A;  2HV7 A;  5KCM A;  3CVP A;  3ZXS A;  3PEU B;  5T4Y A;  2EIJ C;  1G8X A;  2XXA A;  3GW4 A;  3MKQ B;  2W4B A;  2G3K A;  1J8Y F;  3QZC A;  1LF8 A;  3KEZ A;  2A5U A;  3HLZ A;  3W2W A;  3GZ2 A;  1KU2 A;  3EZH A;  1ZU5 A;  3NG1 A;  3M1C B;  5LX8 A;  4APO A;  3LY8 A;  1D0Z A;  2OVF A;  4PJM A;  3I4G A;  3N0T A;  4L1B A;  1NP7 A;  5FZR A;  4FWV A;  4FLH A;  5LFA A;  3PRE A;  5A7D B;  1Y6I A;  3CHO A;  2X6F A;  3CHS A;  4CEM A;  2RG8 A;  4YJW A;  4FX5 A;  4GB9 A;  2KC7 A;  1E7V A;  2Y3H A;  3B7U X;  3ZHE B;  4PFO A;  4JZA A;  2KZT B;  4ILG A;  2IYL D;  4KZ0 A;  3DZA A;  4BJ5 C;  1VDY A;  3SGH A;  4PS7 A;  1ELK A;  2UY1 A;  1M2V B;  1N52 A;  5BV0 A;  2ZPA A;  1KT0 A;  4OIP F;  5E75 A;  2J49 A;  3N24 A;  4WUY A;  2MYS A;  2YNQ A;  4G7H F;  4JUR I;  2PQR A;  4WNE A;  3VTY A;  4U5G A;  4DLQ A;  4HOU A;  4MND A;  4I6G A;  4KXK B;  3PHF 2;  4BY6 A;  4AIF A;  2IXM A;  1TJF A;  3FUE A;  3LVQ E;  2Y4T A;  4HOT A;  3ZG1 A;  3AS5 A;  3EPV A;  2OVB A;  3S29 A;  3B0V C;  3JCK C;  5JHA A;  2J9W A;  3DJU B;  3LYA A;  1M56 C;  1SQM A;  2XGM A;  2IXN A;  4GYW A;  3O39 A;  3RRM B;  3K33 A;  5G05 C;  1QZX A;  4BTA A;  4EEC A;  4G7O F;  2FUL A;  4E6H A;  3I5Q A;  4JHR A;  4GZ3 A;  4G2V A;  3SBS A;  1VK5 A;  4PK4 A;  3PE4 A;  4CRW A;  5EHH A;  3HVE B;  2AXU A;  2P7V A;  1HH8 A;  2J09 A;  3D9I A;  4CIH A;  4E85 A;  2B0J A;  4J0U A;  4ACL A;  1VMA A;  4HFF B;  2Y69 C;  1M57 C;  1ELW A;  3WXX A;  5LOZ A;  4ME2 A;  4ANV A;  1UJJ A;  2Y3D A;  4KVM A;  3KL4 A;  4BWR A;  2XCB A;  3MEK A;  1PY1 A;  3NQP A;  3B7T A;  1IW7 F;  3AG1 C;  3RIB A;  4C3D A;  5L3V A;  4NUR A;  3EIJ A;  3ZVR A;  1D1C A;  3ASH A;  2FF4 A;  3U9W A;  2L9J A;  4GAA A;  2L6J A;  3G2T A;  1JPN A;  3DM5 A;  2J46 A;  2V0P A;  3DBS A;  2LNI A;  3KKB A;  2Y39 A;  3OA1 A;  3JT1 A;  3FEY A;  3T5X A;  3H65 A;  5DQT A;  2IFU A;  3FU5 A;  4GA0 A;  4JA9 A;  3CHM A;  5G04 J;  3DXJ F;  2KCK A;  4JXT A;  2X6H A;  3B9Q A;  1Z3I X;  2WXN A;  3L13 A;  2NUP B;  3O48 A;  2Y3A A;  2XL4 A;  3Q15 A;  3UGO A;  1D1B A;  1WAO 1;  2VJ8 A;  3LXU X;  3UNG C;  4O6N A;  3FH8 A;  3D9N A;  4GYY A;  3CVQ A;  2WXP A;  2NUT A;  2ZXR A;  3B7S A;  4MLP A;  3RJV A;  2EIK C;  3EJN A;  3RU0 A;  2PP4 A;  1U3D A;  3FUK A;  4DJA A;  3Q47 B;  4AY5 A;  5DS5 A;  1EPU A;  4R7L A;  4MRU A;  3L6A A;  3LVR E;  4AXH A;  4CS9 C;  1WM5 A;  2X6I A;  3LEW A;  3CGH A;  3SEO A;  3WOD F;  1OUV A;  4J32 B;  1YA0 A;  4PS8 A;  4XTK A;  3KD7 A;  2WZL A;  4G11 A;  4YWQ A;  4B8A A;  3CIA A;  3CST A;  2A1D D;  4I44 A;  3PZD A;  1MMG A;  3UMV A;  4CCA A;  1E8Y A;  3CK9 A;  3S7D A;  1TWC A;  5B3S C;  3ZEF A;  1HXI A;  4HOQ A;  3ASD A;  4X0R A;  1H6K A;  3NDB B;  2V4L A;  1UW4 B;  1WY6 A;  4Q69 A;  3LKU A;  1FMV A;  4OD4 A;  2DBA A;  1A17 A;  4CSA C;  4J8E A;  1HF8 A;  3CV0 A;  2J0X A;  2VSX E;  4FHJ A;  1RJ9 A;  2YHE A;  1Z3X A;  3FHD A;  1UG3 A;  2WVI A;  3FAJ A;  4AVX A;  4E7S A;  1MND A;  3IV0 A;  3CZ6 A;  2ZXP A;  3CKC A;  5KJL A;  3S28 A;  2XPY A;  4GA1 A;  4L7T A;  2KW3 C;  5BUO A;  3EGD B;  3MX3 A;  2IJG X;  3IEG A;  4I2W A;  3HDX A;  2J4B A;  1ELR A;  5FQ7 A;  1O87 A;  2J4D A;  1FTS A;  4F1S A;  2WXM A;  4XLN F;  3R7R A;  3KH2 A;  2L0I A;  2X6K A;  3UMH A;  1TWH A;  3AQB A;  2VSY A;  2P6V A;  2ZXO A;  4A55 A;  4L2L A;  4LLC A;  4CDM A;  4OVV A;  1ZU4 A;  4J8D A;  2HR2 A;  2J45 A;  2W9Y A;  3LLK A;  4N06 A;  4W9R A;  1BR4 A;  4ANJ A;  3EZI A;  4J30 B;  5E3C A;  3RRU A;  3BEE A;  3QWW A;  3CR3 A;  4CS7 A;  4GZ5 A;  3DD7 A;  3OTN A;  3BG0 B;  4CT0 A;  2V26 A;  4KVO A;  1UJK A;  1XGW A;  3B0U X;  2R7T A;  2PX3 A;  5CI8 A;  3CHP A;  3ESK A;  5FT9 A;  1JWG A;  4WNG A;  3EHN A;  4LCT A;  3QC1 A;  1NU9 C;  3RIP A;  2MOW A;  4IYP A;  4G25 A;  2BUG A;  2M4E A;  3E9V A;  3SP1 A;  5JJT A;  3RKO F;  2R17 C;  4ILH B;  1NG1 A;  4J8S A;  4URK A;  4GZ6 A;  5ENN A;  1LKX A;  3EG9 A;  4XWJ A;  3PS6 A;  3FHE A;  2WMO A;  4U07 A;  3MLG A;  4J8F A;  5LCW J;  4U0Z A;  1ZU2 A;  1N1C A;  1HFA A;  4I2Z A;  4AE4 B;  4GML A;  3EGX B;  2Y4U A;  2CNW D;  2I8B A;  1JUQ A;  4H7X A;  5BW8 C;  5KYN A;  3W8H A;  2PX0 A;  5G05 J;  2RD0 A;  3ULQ A;  3CVL A;  4UQX A;  3TXN A;  3EFO B;  3PE3 A;  4BJ6 C;  4OIO F;  2CG2 A;  3SNX A;  3N71 A;  2C0L A;  1NZN A;  3NKD A;  3CVX A;  5KYW A;  5ARG A;  1B89 A;  5F5H A;  5T3T A;  1JPJ A;  3ZYQ A;  1VYI A;  3FTZ A;  2CHX A;  5G2N A;  3AG4 C;  3CVU A;  1Z5Z A;  2FFH A;  4I1M A;  1OCC C;  4ULW A;  2VTB A;  4LAC B;  1E8X A;  4LUN U;  5KYY B;  3IHY A;  4JZY A;  4I3M A;  2KM4 A;  2VSO E;  3APC A;  5EDS A;  1U3C A;  1VYK A;  3P1U A;  2H7V C;  4Y6W A;  4DI4 A;  1BR2 A;  5KYX B;  4IAO A;  3QMK A;  4YN0 B;  5CCL A;  5E76 A;  4Q4Z F;  3UMI A;  3BG1 B;  3KAE A;  3CLJ A;  2WXF A;  1DNP A;  4Q7C A;  4A3V A;  1IQR A;  1FCH A;  3UUX A;  4G23 A;  2NXP A;  3LS1 A;  5KYU B;  1E8W A;  4AY6 A;  2JLB A;  2I1J A;  4GMJ A;  4U5E E;  3QKY A;  1JPL A;  2IXP A;  2YQ8 A;  2HM8 A;  3LPZ A;  4DLO A;  4WWO A;  2AXZ A;  2WB7 A;  2GRM A;  2AWI A;  4GEH A;  3ZSU A;  3I4R B;  3PEV B;  5DIZ A;  3L34 A;  2XEV A;  1FFT C;  5FZS A;  3K6B A;  2PFD A;  3JCU Q;  1EDU A;  4EZJ A;  1TWG A;  3CQZ A;  4B8C B;  3D9M A;  1ZHT A;  4ZLD A;  2AW6 A;  5KJN A;  4OIQ F;  2XXA B;  3L17 A;  4PH4 B;  1Z6T A;  3QAQ A;  3LEV A;  4GCO A;  3FTU A;  4WND A;  4WNF A;  3O6X A;  5JJ6 A;  2WXL A;  5B1B C;  3GZ1 A;  5BUZ A;  5AJD A;  5E2Q A;  2GGF A;  4XI0 A;  4QDL A;  4QI0 A;  4N3A A;  4B0Z A;  3L22 A;  4FES A;  1OWL A;  3I3N A;  2VGY A;  3K9I A;  4EBA A;  4UI9 K;  1O5H A;  3RO2 A;  4F7A A;  4O6M A;  1X5B A;  3S7J A;  4IJJ A;  5C1D A;  3FU3 A;  5LCW C;  4HOR A;  2D5R B;  2IQC A;  3FH5 A;  2LSV A;  1HO8 A;  2R7V A;  4FLB A;  3NZS A;  4NAC A;  3ZYK A;  4AK9 A;  2CW0 F;  4C3E A;  3HTK C;  2UY1 B;  3P2B A;  2JEK A;  4PJL A;  4U63 A;  1S0P A;  4DPR A;  4XKC A;  2JD3 A;  4CS8 A;  2V8S E;  1PC2 A;  5B1A C;  3T6J A;  3VYW A;  1OCR C;  1HX8 A;  4I6J A;  4DK5 A;  3PUJ A;  3QOU A;  5A23 A;  3LES A;  1W3B A;  3CSF A;  4N39 A;  4A3T A;  3HYM B;  2UWJ G;  3CHQ A;  4P29 A;  4UWG A;  2H7B A;  3W8I A;  2YZS A;  2QY7 A;  5BNW A;  5BPP A;  1UN9 A;  4GYO A;  3K7D A;  4JVS A;  2OOE A;  5E3A A;  3NYL A;  1TKN A;  5J90 A;  3DPD A;  3ECS A;  5CI9 A;  3JUI A;  2I9C A;  1OWN A;  3F47 A;  3HJC A;  3ZYL A;  4NRH B;  3APD A;  3EQL F;  3CK8 A;  3WG7 C;  2XGO A;  5CMW A;  4CGV A;  2VSN A;  4U04 A;  2CHZ A;  1TEZ A;  4PJN A;  3FU6 A;  5EGY A;  4BT8 A;  1OKK A;  3FEX A;  3FUD A;  1Y8M A;  2H7O A;  4N2Q A;  4M3O A;  1V54 C;  4KC9 A;  4CDN A;  4JCH A;  3V7O A;  3FVY A;  3N2Z B;  1M2O A;  3ZIM A;  3U64 A;  4CGW A;  1MMN A;  3DAG A;  2E0I A;  5ARF A;  2BE5 F;  5FCL A;  4G26 A;  3S7F A;  3TL5 A;  1H2U A;  1FFH A;  4V3I A;  1NA0 A;  4DBQ A;  3B0P A;  3Q4A B;  4UI9 C;  1H2T C;  3FDH A;  2I6H A;  4PDX A;  2CG3 A;  4YVO A;  2W4M A;  2WQH A;  4XLP F;  2Y3G A;  4K03 A;  4JHJ A;  3Q7L A;  2OV8 A;  2WQ7 A;  3S2A A;  4HOS A;  4K0D A;  3HHM A;  4DBR A;  3G2V A;  3K1H A;  5KJM A;  3LY7 A;  3PVL A;  3UPV A;  2WPV A;  2NUT B;  1FMW A;  5FTP A;  3PMR A;  4AM9 A;  4XX5 A;  4NQ0 A;  2HYZ A;  2IXO A;  4FP7 A;  3ZW3 A;  3B13 A;  4A1G A;  5HSW A;  1D0Y A;  2VB6 A;  3E70 C;  4HFG A;  2CFU A;  2PZI A;  4U8H A;  4JEU A;  3ZIB A;  3VLE A;  2J7P A;  2WVN A;  3CQC B;  3ONL A;  3LLI A;  4GU5 A;  2IOS A;  3DM9 B;  4RG6 A;  2Q3T A;  3Q6N A;  3NZU A;  2CNW A;  2AXV A;  2WQ6 A;  4CBE A;  1E8Z A;  2P58 C;  3POV A;  3IKO B;  4AP2 A;  4U0U A;  4PJJ A;  4UWF A;  5DLJ A;  2VGX A;  1EYH A;  2XSE A;  3DAF A;  2WXR A;  3FY4 A;  2Q9B A;  4CT4 A;  4AV7 A;  3FH7 A;  2MHK A;  1PD0 A;  4OYS A;  3UQ3 A;  2CHW A;  3LJB A;  3JQ1 A;  3AQC A;  2XPZ A;  2WVQ A;  2YEV A;  3ASN C;  4UQY A;  2PM6 A;  1DVP A;  3FTW A;  2ZU6 B;  1SZI A;  5AJL A;  4MS6 A;  3G2W A;  2QY9 A;  2KNH A;  1FVF A;  3B7R L;  3SHF A;  1GW6 A;  1RJ9 B;  2HO1 A;  5G55 A;  3MCX A;  3LJ3 A;  4KNW A;  1OWO A;  2M63 A;  4JJF A;  3W2V A;  3APF A;  4GCN A;  3ML9 A;  4AJW A;  2A6H F;  3LY9 A;  2R7Q A;  4RBN A;  1KLX A;  3C98 A;  4ACK A;  4N3C A;  3ASO C;  3K66 A;  2G62 A;  4UWK A;  5AEN A;  4TUU A;  3PDN A;  4BJ1 A;  1E90 A;  5T3W A;  4KT6 B;  5CCM A;  2VQ2 A;  1XNF A;  3TG4 A;  5FQ8 A;  3SI5 A;  3CSK A;  1OWM A;  4ATG A;  5FZQ A;  4IUL A;  3SYN A;  3QB2 A;  4YND A;  3PUK A;  3MYV A;  2MRI A;  2X51 A;  4GZC A;  2IU1 A;  3SZR A;  3UT7 A;  5KJK A;  4YT2 A;  1HG5 A;  2DIW A;  4YT8 A;  1QZ2 A;  4OD5 A;  1LVK A;  3QWV A;  3E4B A;  2A6E F;  4JPS A;  3VTX A;  2EIM C;  2A68 F;  2KGO A;  3RYL A;  1HZ4 A;  4U5F E;  3FUH A;  3FUI A;  4C0E A;  3AG3 C;  2FBN A;  4BX8 A;  4O6Y A;  2EIL C;  3EH2 A;  3G2U A;  1TR2 A;  3Q49 B;  2QFC A;  3D9O A;  4YVQ C;  1Z23 A;  2HV6 A;  4BJ5 A;  3CVY A;  4U5D E;  3EG9 B;  1Z63 A;  1MNE A;  1PD1 A;  3OAW A;  4I9C A;  3U4T A;  4AOF A;  3SNH A;  2IOQ A;  3CVV A;  2VYI A;  4G7Z F;  4U0S A;  2XQ0 A;  3T8M A;  3MKQ A;  1L5J A;  3ITF A;  2L81 A;  4O79 A;  3RK6 A;  4EBA G;  4BTB A;  4FC8 A;  2CGE A;  3JYS A;  4KZC A;  2WXI A;  4RVB A;  4JHK A;  4FU3 A;  5T3R A;  2R7X A;  4BT9 A;  2CDQ A;  1P5Q A;  3VAY A;  3CKB A;  1EF1 C;  1D1A A;  1HU3 A;  5KYW B;  4MKT A;  3Q6M A;  1IHG A;  4E7Z A;  3TJP A;  3ASG A;  3TG5 A;  4IRU A;  3L08 A;  2E2E A;  3D3M A;  3SFZ A;  1QQE A;  3D9J A;  4XE0 A;  3FTX A;  4AX2 A;  4OIN F;  4F4B A;  4LLE A;  3QDN A;  5D92 A;  2XRY A;  1ZHW A;  2VTB B;  4EQF A;  3ZHE A;  2PL2 A;  4RSY A;  2KZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...