4JVSA

Crystal structure of lepb gap domain from legionella drancourtii in complex with rab1-gdp and alf3
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
279
Chain Sequence
ATPPLLQMEQEQPFPELIRTWAGLLGQIGVESVRTEEVNFGQLAKCFNDYLNTVAEHCEQQNIWQHKREENHNFFTAFKPDASKAALHGHAYIAHYKESVILRHLSIVDPKTLGMLRFAPYEAPSTDYCRHFPDSPWAKMQRLATAGQNIILQLRLIQNGQMLEDDLPVLQKALDDFMQYKTEVDALLAHDTPVSTHDSSFFYDIDEQTLNAMSGDQLATICFEELNAPHPSRLIMRILKSDSLWQEVDDSLNGDAFMGRQDDICEKRNKICQWRQLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analyses of Legionella LepB reveal a new GAP fold that catalytically mimics eukaryotic RasGAP
pubmed doi rcsb
source organism Legionella drancourtii
molecule tags Hydrolase activator/protein transport
molecule keywords Putative uncharacterized protein
total genus 88
structure length 279
sequence length 287
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4jvsA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jvsA02
4JVSA 4IRUA 4I1MA 4JW1A 4I1OB
chains in the Genus database with same CATH superfamily
2AW6A 3RYLA 5ANRA 3CSFA 2NUTB 3DI5A 3K33A 1UN8A 3BU8A 4BX8A 1MHQA 4PFOA 3AJMA 4MVRA 3SY2A 5D92A 5GPGB 1GS9A 4EHMA 3AS8A 5LP0A 4BT8A 4ANWA 3X2QE 4XEIG 2D4UA 1MYOA 3LVRE 4U0SA 4U5FE 1MMGA 2XLMA 4WJ0A 3DAFA 5G04J 3B0PA 1AWCB 3KH2A 1WDYA 1LIHA 3T9OA 1OWPA 2H7OA 4YDWA 1Z3XA 1TNYA 2WXIA 3Q7GA 5HV9A 3MX3A 3HDXA 1VDYA 4ABNA 2BEDA 3C3QA 2ONDA 3ZG1A 1AEPA 2IXOA 3GW4A 3AG3C 3B9QA 3UX4A 3MFNA 5CIVA 1E7VA 3Q73A 1HX8A 4AE4A 1ZW3A 4GZCA 2IOSA 4I6JA 1J8MF 1IKND 4WNDA 2LFFA 3MKQA 2HR2A 3DM9B 4BPMA 3EHRA 3QARA 1IYGA 1QQEA 4YN0B 1Z63A 2ZIRA 4I9EA 4JXTA 4DX2A 3HRAA 3RW0A 3EH1A 3GWLA 5D91A 4L2YA 5F5HA 5M72A 3UM0A 1V55E 4ACKA 3NKEA 2AP3A 3QVZA 5G55A 4MVSA 4J7TA 1EPUA 1MQSA 4EBAA 4CX9A 1N4RA 2WVQA 5CI9A 3DSWA 3IKOB 4HEAJ 4C7OB 1APCA 2Z15A 4LCTA 2L9BA 2X51A 2YZSA 1OW8A 5JMND 2JEKA 1K3ZD 1U6HA 2EPKX 4FJZA 4IULA 4EECA 2QFCA 4ZLCA 2YRFA 4AY6A 3FAPB 1V54E 1OY3D 2AWIA 2L81A 4BTAA 3IPMO 1SYQA 3SXMA 2PQRA 4XX5A 5EX0A 2Y3GA 2NYJA 3E32A 4DJAA 3VLEA 1O3UA 1WN0A 1BZ4A 5KJMA 5C2YA 4I2WA 4EZJA 3EIJA 3PEVB 3IEEA 1L3PA 2LNIA 2GRLA 4EZKA 2A6HF 2NSGA 1FFTC 4KZCA 3NMIA 5F5FA 4Z68A 1YJGA 4IYPA 4M7CA 3FUNA 3LY9A 4ZFHA 4ATZD 4APOA 4TUMA 1LE2A 2HZ8A 4PFPA 5T3WA 1JCQA 2WXJA 4UWFA 5LX8A 3V7OA 1SZIA 4G25A 2Q9AA 2R25A 2I9CA 4K1OA 3QAQA 1R5ID 2BC5A 2VSXE 4HRLA 1NLXA 2DBAA 3TAXA 3GEEA 4HLEA 2I6HA 1CGME 3SZ7A 1HF8A 1ZU4A 2HM8A 4R32A 4ME2A 2HJMA 3S84A 2I8BA 2UUIA 2XL4A 3HVEA 1N4SA 3TJPA 3UM1A 1FVFA 3U9MA 4YJWA 4BSXA 1CPRA 2WVNA 4G7ZF 4AM9A 4CIHA 4XKCA 1KNYA 3URZA 4G8LA 3UT7A 3KEZA 3CVLA 2P9KG 2IM8A 2VSYA 2YL3A 3PZ1A 4GMJA 3DSTA 2ZXRA 2J07A 5FJYA 1QLEC 1X81A 3CHRA 4MW8A 4GB9A 4YL0A 4CS7A 5DS6A 3FEXA 1LPEA 2FGYA 3DWLG 2WXPA 4FLBA 3VF0A 1SQMA 3FTUA 3MCXA 2FF4A 2WB2A 1RJ9B 4U8VD 5JJ6A 3MYVA 1TFOB 1M56C 4XI9A 1V54C 1GQAA 1MQVA 1RXQA 4ER9A 3L17A 4GTOA 1HE9A 4CRWA 3EUVA 2P2CP 4J8EA 2M64A 3C8ZA 4OIOF 1K40A 3S7JA 2XCBA 5COFA 3QW1A 2IOLA 3VTYA 3ASHA 2C0LA 1FTSA 2KATA 3PMRA 5E75A 3TWWA 2JLBA 3CEXA 4XKBA 1R4TA 3S7FA 2YEVA 3HNLA 2DYSE 5DVWA 1OKKD 2GRPB 2VGXB 3LEOA 1NL4A 5AAOA 3JUIA 4CDVA 2ZU6B 3LY8A 4JTDB 2GRRB 4DRIB 3UKUG 3CSKA 3B29A 1JOGA 4NQFA 3ZSUA 5IY5C 2KJGA 3PE3A 4PDXA 5ENNA 3W9FA 4K0DA 3ZEFA 2V5FA 5AJDA 5B1BC 2AXVA 1LI5A 4GZ5A 1IQRA 4Q94A 4JKVA 3PNLB 3HLZA 5JA4D 1Q0MA 3V30A 5JS5A 4HRMB 2J9VA 3CHPA 1QBQA 1NFIE 5ENSD 3H65A 4CDRA 1SZAA 2LO6A 2WL8A 2PNNA 4WAFA 4NIKA 3ASOC 3EZIA 3SFZA 4CDYA 3FY4A 5HQ8A 4K0RA 3GANA 2ASRA 2XRHA 3HXDA 2EIJE 3DEPA 1TYQG 4U8HA 2QYUA 2X0CA 1NZNA 3GORA 1PV3A 1WATA 4PJMA 2OKUA 1KZOA 3ML8A 5ENQD 3EGDB 2NPUA 4NY3A 3AU5A 3TG4A 4YDOA 4J8FA 3QWWA 2B6CA 4RQIA 2GAQA 3AAAC 2KC7A 3DXJF 2L6FA 2L6BA 2WVOA 5E2QA 2IF4A 5ITZF 1MX4A 3I4GA 3JCKC 3AQBA 1Y6IA 2X38A 3SBTB 3FMSA 3UR3C 4GTSA 4O79A 3AJIA 3AS4A 3MV3B 1XZPA 5D0OD 3ASGA 3N0TA 4XPXA 2GGFA 2AXUA 1LVKA 4GA0A 5AN8A 4YL3A 1TWAA 4DUIA 4CS9C 1TJCA 2XGOA 2UY1B 1GM5A 4GMLA 4UWGA 1PAQA 1ZBPA 3LEWA 2A5EA 2DI3A 4X0RA 4BETA 4BG0A 3L6AA 2G3KA 1WWPA 4XLNF 5E3CA 1YCSB 3APDA 3ZHEA 3Q6NA 5COGA 2J9BA 2PZIA 3AOUA 1YYHA 3W9GA 1XZQA 3L8IA 5CCLA 3GEIA 1TJFA 1N11A 1YYXA 4FP7A 4OYSA 4OVUA 3BEEA 5HKPA 3ZYMA 5KYXA 3KS2A 2XLWA 3K1HA 3MKQB 3OTNA 5BXUA 1SVXA 1H6GA 2DZNA 3JRMO 4KMOA 2H7BA 3B7RL 1DNPA 2AVKA 5KYUA 2IOQA 4I44A 3Q9NC 2A0BA 4UDVA 1A41A 4OD5A 1LI7A 4P29A 5JJTA 3Q7AA 3QKYA 3IQ6A 3VRCA 1OWNA 3UUXA 3HKKA 3MYIA 1KU2A 3G2TA 5KYYB 4IWBA 4PJJA 2OQMA 5EKQD 5CHEE 2V3CC 3ZW3A 1JUQA 1AP7A 3IV0A 1N4PA 4GYTA 1UW4B 3UKRG 3Q6MA 3JCUQ 3CIAA 2RD9A 3CLJA 4YT2A 4DI3A 5JRAA 4G11A 3ABKE 4F53A 3DPYA 4A3TA 3FH5A 3UNGC 3OXFA 3G2SA 1YAUO 256BA 3ABMC 3OXGA 2XXAA 1Q0GA 1S05A 1ORJA 3VAYA 4AL1A 2KGOA 1H6KA 1O5HA 3U8VA 4WGZA 3EFOA 5LCWC 4HOUA 1MX6A 1E8ZA 4FX5A 4L6RA 3RIPA 4A1GA 3BEHA 4RBNA 1H6PA 4XI0A 2J08A 2EIKE 3NQPA 4A55A 3E30A 3IEGA 4OAUC 4N3CA 3FHEA 3EGDA 3RU0A 5FZTA 2XL6A 4DLQA 3KPHA 4I17A 3E37A 4EBKA 4QI0A 1TEZA 3U5SA 4GYOA 4DRXE 2BKGA 4JE9A 2LSUA 5FQ7A 3SXYA 3EG9B 4CSAC 3DRAA 1NBBA 4W9RA 3CVQA 4ANUA 1W3BA 3KMIA 2XM4A 3PZ4A 2KZTB 1G4US 2Y69E 1WY6A 4N2QA 1ZYRF 2HJ3A 3Q49B 5CMWA 3M79A 3MZLB 3FTXA 2VCBA 3ENEA 4E18A 5JSLA 3O48A 4HLLA 2HS5A 1RKEB 3UXGA 5J90A 3KD7A 2Q00A 4JVSA 4JTCB 3PUKA 5A6BA 4FHJA 2VGYA 3FAJA 2RD0A 3PZDA 2LUHA 3LDZA 3KSLA 4JCHA 2E2EA 4PS7A 3JYYA 2Y0BG 3NBNB 2AWCA 1H6OA 4KZ0A 4LEUA 3NMJA 1CGNA 3K7DA 4G0HA 4GCOA 3UT8A 3RSEG 2HO1A 2HV7A 1E84A 5A23A 1OR3A 2J8SD 3O6XA 1TNUA 1HFAA 3FOPA 3RKOF 2YL7A 4CIPA 2F0YA 2XEHA 1XWJA 5BV1A 3R7CA 3TWTA 3VYWA 4JC8A 1BDJB 3UIPC 1EKYA 4PR9A 3ZRHA 3UMHA 3UM3A 3JRTA 2X6HA 3FU6A 4HI9A 4DRHB 3W8IA 3V5XA 1OWOA 1MJ0A 5EGYA 5JUAA 5C1DA 3DEOA 5BPPA 4J7WA 5A69A 2PX3A 1TN8A 3D9KA 2HYZA 1HG2A 1TN6A 1U2VG 1JWFA 3PVLA 3B7UX 4MKTA 2L9JA 3H2UA 3LJNA 2DIWA 5F28E 3MJWA 3LNMB 2EILC 1BR2A 1H7IA 4JHRA 3PCVA 5B3IA 4AK9A 1QVXA 1VK5A 3IHVA 2KCLA 3UMIA 1Z3YA 4NCQA 2VB6A 1D0ZA 3SNXA 1QQ3A 3PNTB 3L82A 3JQ0A 1HG5A 1YZCA 2VSNA 4PACA 4HFFB 3UINC 3VTXA 5ARFA 1VMAA 2Q3TA 4I43A 3UM2A 3T5XA 1Z3IX 5TJ5E 5AQ7A 3EHMA 2QYJA 4G1TA 1TNZA 2H6IA 4I6GA 1ZHWA 4J8YA 4K5AB 1MNEA 3SHFA 4URKA 1FFHA 2EPNA 4A2NB 3ASFA 4C48B 3NMKA 3C7JA 2NXPA 3FVYA 3MA5A 2WXQA 3UGPA 4CEMA 3RQFA 2XXAB 5EX3A 4KC9A 3TWSA 1OCZE 4WWOA 4CZ2D 5EIDA 4E0HA 3ZGQA 5LCWJ 3QWVA 3ULEG 3FTSA 3LS8A 3JUEA 4N5QA 2BL2A 2IXMA 3GEHA 3VM6A 2V4HC 5H7PA 1G3NB 3N2ZB 3O10A 3NDBB 3ZFWA 4PUCA 2R2LA 1ZU2A 4MTGA 3PREA 1EF1C 3G50A 5A7DB 3SZRA 4AVXA 4KT6B 4B6IA 2OVFA 4JA7A 1RKCA 1SZ9A 2J9UA 2CFZA 2PM7A 5COMA 3ISMC 3JT1A 1VLTA 1D0YA 2IXNA 2JX0A 3ASDA 3AG2C 2XGSA 5JJ7A 4ANXA 1O87A 2WXMA 5BV0A 1G4WR 3E9VA 4BSZB 2QZAA 4NACA 2B0OE 2PFDA 3TQOA 1ZB1A 2P9NG 2O9XA 3H2VA 3V2OA 3HXEA 2P61A 3DSVA 4AEZC 2CW0F 1QPUA 2WXRA 3AS5A 1HY5A 2FO7A 2A1DD 3UPVA 2Y3DA 3OXLA 2IYLD 2Y3HA 3ZC4A 2EIJC 5EYLA 3UMVA 3SEOA 1N94A 3D9MA 2P9SG 1A7VA 3AG2E 3EPVA 4MTOA 3POVA 1O1TA 3LPZA 2XLOA 3OWTA 2IO3C 1WOLA 2X6FA 2M4EA 3OEOA 1A7DA 4RD9A 3OA1A 4I1OB 2ZXWE 1S7ZA 2YLGA 2DCPA 3SFYA 1YZAA 2A69F 3FOOA 3MKRA 4MVOA 4FWVA 3KYJA 2LSEA 2OJQA 3GM3A 3ESLA 2WQHA 3ZXSA 3Q7FA 4KVMA 4DBQA 4J6IA 1NA3A 5A6CA 2FAPB 3L22A 4OAVB 3RRNB 4C3BA 1JAFA 3EG9A 1E85A 3FH8A 3Q75A 1QKRA 5CRVA 2ZXOA 2RSEB 5B3SC 2CG3A 3Q5MA 3CK8A 4GU5A 5FZRA 3ECSA 3LJBA 3FTZA 4AE4B 3CQCB 2A4ZA 2WMOA 2LAIA 3ZNGA 4EPZA 2CGEA 3R7QA 5DS4A 4GQHA 3RQEA 4U5GA 3UQ3A 3V79K 2QUPA 4XEKA 3M1CB 3FH7A 3LLIA 4MS2A 4BJ5C 1D1CA 3HHMA 2PQNA 1E2XA 5FQ6A 2P58C 3TJ5A 1OW7A 3B7TA 4WNFA 4YVOA 2YVKA 4LDRA 2P9IG 2ZXPA 1EQ1A 4AV7A 4ILHB 4BEJA 5B3SE 1N0RA 3DAGA 4I1MA 4ANJA 4A63B 4DVYP 3KSQA 1D1BA 5DBKA 1BR1A 1WGWA 4MQ9F 4C7OA 5FCLA 2XENA 1UOHA 2LXLA 3I5QA 3JZ0A 2IBFA 3Q7LA 1EI7A 4TXQA 2EINC 1YLMA 4XLPF 1G5ZA 2WZGA 1E83A 2QE9A 2HMZA 1HH8A 5AARA 3T5VA 3X1OA 3APCA 3S7BA 3C72A 3NOCD 1YA7O 4EKWA 4UI9K 2KW3C 2I1JA 1QYMA 1CGOA 3KEAA 4XWJA 3DPDA 4Z9IA 3JSZA 5EDSA 4A3VA 4YDEA 5G2NA 3AU4A 3LXUX 3IBEA 3ASNC 3ZQYA 2LK4A 5LOZA 4R7LA 2W9YA 4DX5D 4U07A 2PF4E 3FP3A 3RVZA 2UWJG 3L54A 2DYRC 1WM5A 2ZGDA 1TFKB 1NA0A 2VCCA 1H0AA 3R9AB 1SMYF 3P2BA 4CYMD 4N2SA 3K9IA 3WHNA 3K6BA 2G62A 2GDCA 2FULA 4LRZA 3T9KA 4IGGA 2XQ0A 2OEVA 4BEMJ 5DIZA 2P1AA 2VSOE 4I6EA 1ZZPA 3W2VA 4EWCA 2WB7A 1Q0KA 3JXIA 3O55A 4XPYA 3ZDLA 5CRUA 1HU3A 1T6QA 3J06A 3TK0A 1LD7A 2PP4A 2X6IA 4MS6A 2HSQA 3C3RA 2J9WA 1ZHYA 2ETSA 4E6HA 1HW1A 4DVZA 2P9PG 4O1OA 2LIGA 3UT4A 4J30B 1FR0A 2BKKB 3TD7A 2Y69C 1D8EA 4NQ0A 5E33A 3MGBA 3FWVA 2ETBA 3TWRA 2OCCC 2P0NA 1AVOB 5L0CA 3EDTB 3U2MA 4FAPB 3OAWA 1NZEA 2OU6A 2P9UG 3FU0A 4GCNA 4CJOA 5ANLA 4U5BE 1YMPA 4LDKA 4BX9A 1NFNA 2MHRA 3LVQE 1ZHTA 1KTMA 4G2VA 4CBEA 3DZAA 4TV3A 3IHUA 4HVBA 5BUOA 3TJ6A 1LTXA 1RCPA 3APFA 4DK5A 2BTDA 1G8XA 2UUHA 4JEBA 4GTTA 4P6IC 4JB8P 3US6A 4GPMA 4BJTA 2P9LG 3PE4A 2LFDA 5FINA 2HFIA 4UWHA 5KWDA 4XEFA 4GTMA 1UN9A 4CCAA 5CEDB 3S28A 3LYAA 4DRJB 4BJ6C 4P9TA 1EA8A 1OCOC 2NUPA 2CNWD 2F8XK 2IQCA 4XEVA 3UMKA 2J9QA 3B0VC 4K5CA 4DLOA 1IXVA 4E85A 3QK0A 4ANVA 1TQGA 4WNGA 3C18A 1HXIA 4MRUA 3M15A 3ZYLA 3IQTA 1M2OA 2YL0A 2R7QA 1DOWA 2OEWA 1JPNA 3DSXA 1JPLA 4FA6A 3S27A 4CS8C 3R2PA 3ZQVA 3L13A 1DC2A 2IO2C 1M2VA 3U4TA 1XGWA 3PZ3A 1RW2A 5AJLA 4RVBA 5FTPA 3RKVA 3RK6A 4Z9JA 4G26A 3SNHA 4V3IA 2KQ9A 1O1RA 1Y4CA 2XL8A 2R7UA 1QNFA 5KNHD 2M63A 4HOSA 1A17A 2MRIA 5D2MC 4O6NA 3TGOA 4UQZA 3HXCA 2XZDG 2KCKA 3CQZA 1OXKA 3CHOA 1YYJA 3CKCA 4BJ5A 1AUEA 3JXJA 3S2AA 2VQ2A 2MOWA 3PS6A 2PL2A 3LAYA 3SO8A 4HBDA 3G2UA 3ONKA 2EINE 5KYWA 4K7BA 3F47A 2JPUA 5A6BD 1MMNA 2V5QC 4QDLA 1GW6A 3ZVVA 3HVEB 1HE1A 2VGEA 1ORYA 3C8GB 1TNBA 5FT9A 3HYMB 1A5EA 4H7YA 4APFA 3ESKA 3SFXA 2QLAA 4CS9A 2R7VA 4PK4A 4TRQA 1JMWA 4DI4A 4MLPA 1DOVA 5L0GA 2RKKA 4AXHA 4JEAA 3M4CA 2YNQA 2ZXWC 1SW6A 3RO3A 5CBNA 5AGFA 1IW7F 4JEHA 3NB2A 5HI7A 5BQIA 1OKKA 1LS1A 2BE5F 3SI5A 2XRZA 4LDQA 1ZW2A 2HKVA 2J09A 3Q47B 1I5NA 3ZWIA 4O60A 1ORSC 3SGHA 2C2LA 4ZLDA 4YK5A 3C62A 5A6KA 1Y6DA 3F46A 1DCQA 4GZ6A 4UQYA 4N4WA 3J5QB 3B95A 3ZTMA 1HMDA 3FUFA 3QNKA 2QNLA 3TULA 4A1SA 4XIFA 2R7XA 3GODA 4JEUA 1QZXA 3L8JA 2XEVA 3WXXA 5IY5E 1BI7B 3U3FA 2NSFA 1VTMP 2LD6A 4O7GA 4AJWA 3QWPA 4D4NA 1OT8A 3CSTA 5BXOA 5FIOA 4L9PA 1FPPA 3ZU7B 4XQ1A 3DJNB 2QY7A 3U9JA 3EH2A 3LNRA 1V74B 2ZISA 2KK1A 3D9JA 2XHEA 3EGXA 1ELKA 4J32B 5L0DA 4HFGA 4KBQA 2IEJA 4Q7CA 4C9BB 1OCZC 3CVXA 1RJ9A 1Z6AA 1JR8A 1N4QA 2EPOA 2VJ8A 4MVMA 2ZGGA 3TWUA 4GZ3A 1E8YA 3T4RA 3EFOB 2KBXA 4BT9A 3E4BA 3RO2A 2HMQA 3ULYA 1FMVA 2PX0A 4UUCA 3FEYA 4HRNA 5KYXB 4B0ZA 1TR2A 1Z7Qc 2J7PA 4JTAB 1LKXA 2OG2A 3X2QC 3LEVA 4DXWA 4CDAA 1UG3A 2IXPA 2C0MA 5KYUB 5BT1A 4I1AA 1CPQA 5EYPF 3U0CA 3NAWA 4PJLA 5L0HA 4JZYA 2G3VA 2R7SA 1WG0A 3S7DA 4BJ6A 3ABLC 2X3MA 1PC2A 2H6HA 1O5MA 1SA4A 4B8CB 5DQTA 4NC3A 5L0FA 4BERA 1T9KA 5T1DB 1FT1A 2J8WA 3CHQA 4L7TA 4C0EA 2L6HA 3Q79A 1OCCE 3DBSA 4KNWA 1MZCA 1UJKA 1YDIA 2GROB 2HV6A 2R5SA 2OJED 1NSGB 2P7VA 2CHXA 2Q9CA 2FO1E 3CHMA 4F6RD 1Y8MA 3MLGA 1RKEA 2CHZA 5FZQA 2KC3A 4DJ9A 4YDYA 2R9RB 3K66A 2XEEA 1SF8A 2XM0A 3D9OA 5B1BE 1VYIA 2XLHA 3RRUA 2CCYA 1LM3B 4WWPA 4D10C 4AL0A 1KZPA 4N5CA 3CVWA 5T3TA 2R59A 4MW3A 5G05C 2EPMX 1WAO1 3RVYA 3S9OA 4UI9C 1U3CA 3ZN3A 3C98A 2LCHA 1E86A 2WVIA 2WZLA 3GZ1A 3QMKA 4E7SA 3AG4E 3BG0B 3FUIA 5BUZA 4FU3A 3CV0A 4HNAD 3ZHEB 2DYSC 4C3EA 2AVPA 2WXKA 3S90A 2LQGA 4CDMA 4YNDA 5B1AE 1E7UA 3D9PA 3ML9A 2R7RA 1E8XA 3U66A 4JHJA 4L2LA 5KYYA 2KM4A 3P1UA 4LNUD 4DOZA 4JD2G 3ZYQA 5CI8A 3MEKA 4XE0A 2WQ7A 2KYHA 4H4KC 3FULA 3SXZA 1TKNA 2ICWG 3ZKJA 5JT4A 2AXZA 4U9EA 5KYWB 2CYDA 4FESA 1H2VC 3CVNA 2I2OA 3ABME 2Y3BA 1JPJA 3DWWA 2CHWA 1ZHZA 1I4ZA 1VOMA 1LF8A 5CCMA 3QB2A 3QDNA 3T8KA 2WM9A 3CKBA 1OCOE 1N52A 3J5PA 5BNWA 5CBOA 3VLDA 2WXGA 1C17M 1KPSB 4FHKA 2J46A 3B71A 2H7VC 2LAHA 3NYJA 4N6CA 3WAQA 4G7HF 5KYNA 1S0PA 4BFRA 4CGWA 4O6YA 3B13A 1H19A 5T4YA 2WZFA 2PNOA 2I15A 1LS4A 3HXBA 4BTBA 1Z5ZA 5JVEA 1N9AA 4BY6A 1FVHA 4MVZA 3U2LA 4O1PA 4H54A 3C8GD 4TUUA 3U8PA 2A6EF 2XSEA 1PCXA 3TG5A 2GW1A 5ARGA 2KCVA 5AIJA 1OW6A 3RFYA 5EILA 2FBNA 4U5CE 3IHYA 5DS5A 3AG1C 2A68F 3SP1A 1T01A 2GRNB 4WABA 1GGQA 2J0WA 5BQHA 1NU9C 2KSFA 3BRJA 5HSWA 3LCAA 2DZOA 4ULWA 3GZSA 4KVOA 1ZU5A 3RIBA 3UTMA 2B0HA 4A4AA 1TNOA 1T6UA 5ENTD 3S0XA 1UJJA 3SBSA 4JZAA 3HJCA 1MX2A 4GTRA 5AQBA 2Y1LE 5KJNA 2I1KA 4UQXA 3AG4C 2F37A 4J7YA 3S29A 2W45A 2LSVA 3SD5A 4ACLA 4I9CA 3SXKA 2VTBA 4OIRF 1YARO 2XRYA 1L5JA 4DX6D 2RFMA 2YLDA 1Z23A 3DJUB 2R05A 3EIQC 1E96B 3CHSA 4OIPF 4Q5SF 3TL5A 1K8KG 4FJYA 4LG6A 5KJKA 4GYWA 1H2UA 1YA9A 5E3AA 5AC5A 2HE0A 4NTBA 2FEZA 3I3NA 4FC8A 4E0IA 1J8YF 1W2WA 3ATPA 4U8YD 4LLEA 3QC1A 1INZA 3WODF 2YWAA 3CK7A 3PH0C 3TXMA 2ETCA 1UG7A 1ZVZA 3PZ2A 1U89A 1WTYA 4AIFA 5KJLA 2KXPC 1D8DA 5G04C 2EQXA 1PD0A 3T6GB 4Q4ZF 1BU9A 2P6VA 4WUYA 3HXFA 2VTBB 4LSZE 3Q9UC 2X6JA 4EZLA 4OINF 1ZHXA 4JJFA 4PS3A 2L0IA 2R02A 3HG0D 5AQAA 4WNEA 2EIMC 4U9DA 4FADA 3LUTB 4AP2A 4IAQA 2VCAA 4RLYA 2AWYA 4AY5A 3AG3E 1IQUA 3JQ1A 3EZHA 2ZPAA 4F7AA 4ATGA 4IB4A 3W4YA 1ELWA 1H9TA 3FUKA 3SQVA 3D9HA 5JHBA 3E70C 4DPRA 4EBJA 4MNDA 5G05J 3B7BA 3CK9A 3IXEA 1OCRE 4U0UA 2WMNA 2XPIA 3LKUA 3D3MA 2ZD9A 4E7ZA 3RRMB 4JL0A 4GEHA 2KNHA 1P5QA 5AENA 4HI8A 5BW8C 3ZUVB 2V0PA 4JPSA 2WXNA 4YVQC 2OOEA 1HZ4A 3BG1B 1M2VB 1C03A 2HSBA 3QW0A 4KBLA 3Q15A 4CT4A 5DLJA 3O4ZA 2MYOA 4JA9A 1Q0FA 5ENRD 3EU5A 3RJVA 2DGJA 4P9FA 4XTKA 3GWNA 5FWQA 2CDQA 3FTWA 3EHNA 4U96D 3FUDA 3VLFA 4AOFA 2MWQA 1MMAA 3LLKA 2Q9BA 2L0TB 5CECB 3A9CA 4YT8A 4MVUA 4O6MA 4F3VA 4WGYA 3FDQA 3U9WA 4XPWA 4MBGA 3DMDA 2E87A 2Y39A 4LLCA 4MVQA 3DD7A 2NUTA 2JD3A 3FFLA 1JRAA 1IHBA 4TXRA 3TWVA 2EIME 5ENPD 3KKBA 3LY7A 3CVUA 1K04A 5DQZA 3MBGA 4Z9HA 4U04A 3SYNA 3AQCA 1S70B 1D9SA 3M4BA 3EJNA 1UFBA 1U3DA 3G4XA 5ENOD 1LD8A 2J4BA 3ZTZA 4CDNA 4UWKA 3TXNA 2IU1A 2L6GA 2J4DA 3UI2A 3A11A 4EBBA 3NYMA 1S64A 1L7CA 1VB5A 1BLXB 5T8IA 3V5ZA 4DX1A 3NKDA 3CAXA 2YL1A 4U5HA 4EHPA 1EYHA 3FUJA 2DVWA 2MHKA 3MV2B 2IY0C 2DB4A 1QSPA 4IARA 3PRZA 3FUMA 1KT0A 4Y6WA 3WG7E 3V31A 2R03A 3CVYA 2OOCA 3Q4AB 2DYRE 5FQ8A 4ULVA 1OXBA 4UI9J 4BWRA 1TWGA 2CG2A 3DKAA 4HXIA 4D4XA 3TWQA 3NOGD 2WXFA 2GRQB 1JCSA 4HB5A 2IFUA 1T5OA 1TR4A 3B0UX 4JHKA 1H2TC 3QTHA 1N1CA 3N71A 1Z6TA 3I4UA 4C3DA 1Q0DA 1SR2A 4KI2A 3WG7C 4U7EB 5EHHA 5D66A 3ONLA 4IN3B 4GTPA 4HORA 5EIBE 4B94A 3JTLO 4LNBA 2OVBA 4DBRA 3R7RA 4IJJA 3PUJA 2YKZA 1HE8A 1RZ4A 1HW2A 3FUEA 1N95A 3G2VA 1TN7A 1S63A 3ZIMA 3MYFA 3W2WA 1FNTc 2R7OA 2FI7A 4HFKB 4G23A 4U5DE 1OWMA 3QZCA 2H6FA 2XLVA 1B89A 4L23A 2J7PD 4IAOA 3Q78A 5K0IA 3NZSA 4G8KA 1ELRA 2L6JA 3ZXPA 2J0XA 1QZ2A 2ILRA 4N6HA 3FUHA 1OUVA 3EU9A 2Y4UA 3U64A 1D1AA 1PY1A 2YINA 5E76A 3AGUA 5JHAA 2LXMA 3L0IA 2IJGX 2YQYA 2BUGA 3HNIA 3IQ5A 2FFHA 3NZUA 2YHSA 4EBAG 2XCCA 4J8DA 5A6JA 2GRMA 4OVVA 3E33A 2NG1A 4HQDA 3PEUB 2V26A 2XS8A 1OCRC 1B68A 1U0BB 2YHCA 4Q69A 5KBAA 3CZ6A 5HRYA 3ULQA 3ZYKA 3DXMG 2Y3AA 4L1BA 3BQOA 1NP7A 4C0MA 4B8AA 1OCCC 2R7TA 3SF4A 1I4YA 3ABKC 3U3BA 3TWXA 4CT0A 3FHDA 4GAAA 4GMRA 2C03A 2TMVP 2YLIA 2H8AA 3C63A 2Y4TA 1N0QA 4JRZA 1OWLA 4CSAA 2VGXA 3L08A 3LS0A 4BJ1A 3CVPA 4YT5A 5KCMA 1C02A 3GM1A 2EILE 1RMVA 2XGMA 3LJ3A 5CERB 3L16A 3NG1A 3HTKC 2PM6A 1HO8A 2YQ8A 3TOLA 2F8YA 5T3RA 4EQFA 1O1SA 3GM2A 4JJGA 4U0ZA 1A0BA 3AGTA 1OR2A 3D9LA 4U5EE 1BR4A 3HIZA 2A5UA 4RSYA 5KNGA 1Z5SC 3NYLA 4M63A 1YA0A 4GTVA 5CEAA 1MNDA 2OEXA 1M6TA 4ILIA 3N24A 3T8MA 3LESA 4RG6A 4HOTA 2YHEA 5AQ9A 4N3BA 3EHQA 4B89A 4HE8D 4B93B 3GZ2A 2WXHA 1K05A 2R7WA 5EK0A 3PHF2 4IRUA 3QJZA 4FULA 3I4RB 5J08A 1NFOA 1M57C 5JLIA 4ONSA 1H9GA 4OIQF 3ASNE 2CNWA 4N39A 2Q7RA 1T6IA 3CR3A 4KNVA 1XNFA 4YT4A 1BD8A 1A7EA 2J49A 1PD1A 3RQGA 2XPZA 3KAEA 3U3WA 4U95D 1KLXA 2XS1A 4JC7A 3V2XA 3ZVRA 4PH4B 3V5YA 4E17A 4G78A 4J0UA 3E34A 4X8QA 5L3QA 1BI8B 4Q96A 4H7XA 4BEPA 4UWLA 4MTFA 4LACB 3L1MA 5A6AA 5LFAA 4Y6CA 3JSEO 3KL4A 5CMYA 2LP4A 3CQGB 2H6GA 1DCEA 2VH3A 4DX7D 4XZ4A 1TWHA 3DXKG 3ITFA 2NSZA 3FDHA 4N06A 2WPVA 3C3OA 3L9TA 3DE8A 3RH3A 3I5PA 5JP7A 2QC9A 1TWCA 1OQCA 3EQLF 2WQ6A 1E90A 2AU5A 3PDNA 2BF0X 2Q4FA 1KT1A 3G4ZA 3B7SA 3CGHA 4HS2A 2VC9A 5EN5D 4F4BA 4CS8A 4PS8A 1SA5A 3JYHA 4YWQA 3EGXB 4QQIA 4F1SA 1JWGA 4TXPA 4NTAA 5L3VA 4O6FA 3ASOE 3FU3A 4NURA 2NUPB 3DM5A 4WWNA 4LERA 2JABA 2PBEA 1E8WA 3DSUA 4M3OA 4EUKB 3TOMA 1D0XA 3NF1A 1VYKA 2GFHA 2CFUA 3IQCA 4GA2A 1K1AA 3LS1A 4RG9A 3RAUA 1V4AA 3FTVA 4QFVA 2C04A 4EIYA 3JYSA 1HS6A 1IHGA 3KYIA 4JW1A 3BUAA 3T6JA 3ABLE 3UGOA 2W4MA 3HNJA 3RF3A 3QVYA 4GTQA 4QI2A 5BQGA 1N54A 2IONA 2XLDA 1EDUA 1ST6A 1OXJA 2B0JA 4NTFA 1FMWA 2EPLX 1F1MA 4GYYA 5FZSA 2Q7FA 4W8KA 1FCHA 1Q2ZA 4U63A 4I3MA 4I2ZA 5L0IA 3C8GA 4LUNU 4F1PA 3L34A 3W8HA 4HOQA 1NG1A 1NI1A 2MYSA 3PDMP 5FQ4A 5HS0A 2R17C 2WXLA 3CVVA 1VLSA 2OV8A 3FTYA 1IZMA 5D0QD 2E0IA 2F22A 2AJAA 2XZTG 2KZTA 2W4BA 4NRHB 2ETAA 3HNKA 4G7OF 3C5RA 1DVPA 3CEQA 1YVIA 5AC4A 5L0JA 2NC9A 4J8SA 2A0UA 1WASA 4FLHA 3FXHA 1NU7D 2DWZA 2RG8A 2UY1A 4CGVA 1LE4A 2HUJA 3UIOC 3DE9A 3D9IA 4ILGA 2J45A 3QOUA 3ZIBA 2QY9A 3O39A 3AG1E 1X5BA 4YL1A 1V55C 2V4LA 2OCCE 3GYZA 2GA0A 4W8PA 4ZHBA 4CJGA 5B1AC 4KXKB 3K1IC 1FT2A 3ZPJA 2L7AA 1BPOA 3K1IA 3D9NA 3DSSA 1HMOA 4PJNA 4RDAA 4OD4A 4BESA 3G2WA 2RFAA 4G24A 3T6BA 1MMDA 4KYOB 4GZDA 4N3AA 4K5BA 2GWWA 3F6QA 2XPYA 3R9MA 2WXOA 1K1BA 4GPKA 2VYIA 4K03A 2VASA 1BBHA 2D5RB 2X6KA 1FAPB 4JCZA 2EIKC 4GA1A 4JIOA 1JCRA 3NRHA 4JURI 3FU5A 4AX2A 2V8SE 2QTVA 4LNGA 5AYWD 2XLEA
chains in the Genus database with same CATH topology
2AW6A 3RYLA 5ANRA 3CSFA 2NUTB 3K33A 1UN8A 4BX8A 1MHQA 4PFOA 5D92A 3AS8A 5LP0A 4BT8A 4ANWA 3LVRE 4U0SA 4U5FE 1MMGA 4WJ0A 3DAFA 5G04J 3B0PA 3KH2A 1OWPA 2H7OA 1Z3XA 2WXIA 3Q7GA 3MX3A 3HDXA 1VDYA 4ABNA 2ONDA 3ZG1A 2IXOA 3GW4A 3AG3C 3B9QA 3UX4A 1E7VA 1HX8A 4AE4A 4GZCA 2IOSA 4I6JA 1J8MF 4WNDA 3MKQA 2HR2A 3DM9B 3QARA 1IYGA 1QQEA 4YN0B 1Z63A 4I9EA 4JXTA 3EH1A 5D91A 4L2YA 5F5HA 5M72A 4ACKA 3NKEA 5G55A 1EPUA 1MQSA 4EBAA 2WVQA 5CI9A 3IKOB 4HEAJ 4C7OB 2Z15A 4LCTA 2L9BA 2X51A 2YZSA 2JEKA 4FJZA 4IULA 4EECA 2QFCA 4ZLCA 4AY6A 2AWIA 2L81A 4BTAA 2PQRA 4XX5A 5EX0A 2Y3GA 4DJAA 3VLEA 5KJMA 5C2YA 4I2WA 4EZJA 3EIJA 3PEVB 3IEEA 2LNIA 2GRLA 4EZKA 2A6HF 1FFTC 4KZCA 5F5FA 4IYPA 3FUNA 3LY9A 4APOA 5T3WA 4PFPA 2WXJA 4UWFA 5LX8A 3V7OA 1SZIA 4G25A 2Q9AA 2I9CA 3QAQA 2VSXE 2DBAA 3TAXA 4HLEA 2I6HA 3SZ7A 1HF8A 1ZU4A 2HM8A 4ME2A 3TJPA 2I8BA 2XL4A 3HVEA 1FVFA 4YJWA 4BSXA 2WVNA 4G7ZF 4AM9A 4CIHA 4XKCA 3URZA 3UT7A 3KEZA 3CVLA 2VSYA 4GMJA 2ZXRA 2J07A 5FJYA 1QLEC 3CHRA 4GB9A 4CS7A 5DS6A 3FEXA 2FGYA 2WXPA 4FLBA 1SQMA 3FTUA 3MCXA 2FF4A 2WB2A 1RJ9B 5JJ6A 3MYVA 1M56C 4XI9A 1V54C 3L17A 4CRWA 4J8EA 4OIOF 3S7JA 2XCBA 2IOLA 3VTYA 3ASHA 2C0LA 1FTSA 2KATA 3PMRA 5E75A 2JLBA 4XKBA 3S7FA 2YEVA 5DVWA 1OKKD 2VGXB 3JUIA 2ZU6B 3LY8A 3CSKA 3ZSUA 5IY5C 2KJGA 3PE3A 4PDXA 5ENNA 4K0DA 3ZEFA 2V5FA 5AJDA 5B1BC 2AXVA 4GZ5A 1IQRA 4Q94A 3PNLB 3HLZA 2J9VA 3CHPA 3H65A 4CDRA 1SZAA 2LO6A 2WL8A 4WAFA 3ASOC 3EZIA 3SFZA 3FY4A 5HQ8A 4K0RA 3GANA 2XRHA 4U8HA 1NZNA 4PJMA 3ML8A 3EGDB 4NY3A 3AU5A 3TG4A 4J8FA 3QWWA 2KC7A 3DXJF 2WVOA 5E2QA 2IF4A 3I4GA 3JCKC 3AQBA 1Y6IA 2X38A 3SBTB 3UR3C 4O79A 3AS4A 3MV3B 5D0OD 3ASGA 3N0TA 2GGFA 2AXUA 1LVKA 4GA0A 1TWAA 4CS9C 1TJCA 2XGOA 2UY1B 4GMLA 4UWGA 1PAQA 1ZBPA 3LEWA 4X0RA 4BG0A 3L6AA 2G3KA 4XLNF 5E3CA 3APDA 3ZHEA 3Q6NA 2PZIA 5CCLA 1TJFA 4FP7A 4OYSA 4OVUA 3BEEA 3ZYMA 5KYXA 3KS2A 3K1HA 3MKQB 3OTNA 4KMOA 2H7BA 3B7RL 1DNPA 5KYUA 2IOQA 4I44A 4OD5A 4P29A 5JJTA 3QKYA 3UUXA 1OWNA 3G2TA 1KU2A 5KYYB 4IWBA 4PJJA 5EKQD 5CHEE 2V3CC 3ZW3A 1JUQA 3IV0A 4GYTA 1UW4B 3Q6MA 3JCUQ 3CIAA 3CLJA 4YT2A 4DI3A 4G11A 4F53A 4A3TA 3FH5A 3UNGC 3OXFA 3G2SA 3ABMC 3OXGA 2XXAA 3VAYA 2KGOA 1H6KA 1O5HA 3EFOA 5LCWC 4HOUA 1E8ZA 4FX5A 3RIPA 4A1GA 4RBNA 4XI0A 2J08A 3NQPA 4A55A 3IEGA 4N3CA 3FHEA 3EGDA 3RU0A 4DLQA 4I17A 4QI0A 1TEZA 4GYOA 2LSUA 5FQ7A 3EG9B 4CSAC 4W9RA 3CVQA 4ANUA 1W3BA 3KMIA 2KZTB 1WY6A 4N2QA 1ZYRF 3Q49B 5CMWA 3MZLB 3FTXA 3ENEA 3O48A 5J90A 3KD7A 4JVSA 3PUKA 4FHJA 2VGYA 3FAJA 2RD0A 3PZDA 3LDZA 4JCHA 2E2EA 4PS7A 4KZ0A 4LEUA 3K7DA 4G0HA 4GCOA 3UT8A 2HO1A 2HV7A 5A23A 3O6XA 1HFAA 3RKOF 5BV1A 3VYWA 4JC8A 3ZRHA 3UMHA 3JRTA 2X6HA 3FU6A 3W8IA 1OWOA 5EGYA 5C1DA 5BPPA 2PX3A 3D9KA 2HYZA 1HG2A 1JWFA 3PVLA 3B7UX 4MKTA 2L9JA 2DIWA 3MJWA 2EILC 1BR2A 4JHRA 4AK9A 1VK5A 3IHVA 2KCLA 3UMIA 1Z3YA 2VB6A 1D0ZA 3SNXA 3PNTB 3JQ0A 1HG5A 2VSNA 4HFFB 3VTXA 5ARFA 1VMAA 2Q3TA 4I43A 3T5XA 1Z3IX 3EHMA 4G1TA 4I6GA 1ZHWA 1MNEA 3SHFA 4URKA 1FFHA 4A2NB 3ASFA 2NXPA 3FVYA 3MA5A 2WXQA 3UGPA 4CEMA 2XXAB 5EX3A 4KC9A 4WWOA 3ZGQA 5LCWJ 3QWVA 3FTSA 3LS8A 2IXMA 3N2ZB 3NDBB 3ZFWA 4PUCA 1ZU2A 3PREA 1EF1C 5A7DB 3SZRA 4AVXA 4KT6B 4B6IA 2OVFA 4JA7A 1SZ9A 2J9UA 2CFZA 2PM7A 3JT1A 1D0YA 2IXNA 3ASDA 3AG2C 2XGSA 5JJ7A 4ANXA 1O87A 2WXMA 5BV0A 3E9VA 4NACA 2PFDA 2O9XA 4AEZC 2CW0F 2WXRA 3AS5A 2FO7A 2A1DD 3UPVA 2Y3DA 3OXLA 2IYLD 2Y3HA 3ZC4A 2EIJC 3UMVA 3SEOA 3D9MA 3EPVA 3POVA 3LPZA 3OWTA 2X6FA 3OEOA 2M4EA 4RD9A 3OA1A 4I1OB 1S7ZA 2DCPA 2A69F 3MKRA 4FWVA 2LSEA 3ESLA 3ZXSA 2WQHA 4KVMA 4DBQA 4J6IA 1NA3A 5A6CA 3L22A 3RRNB 4C3BA 3EG9A 3FH8A 2ZXOA 5B3SC 2CG3A 3Q5MA 3CK8A 4GU5A 5FZRA 3ECSA 3LJBA 3FTZA 4AE4B 3CQCB 2A4ZA 2WMOA 2LAIA 4EPZA 2CGEA 3R7QA 5DS4A 4U5GA 3UQ3A 3M1CB 3FH7A 3LLIA 4BJ5C 1D1CA 3HHMA 2PQNA 5FQ6A 2P58C 3B7TA 4WNFA 4YVOA 2ZXPA 4AV7A 4ILHB 4BEJA 3DAGA 4I1MA 4ANJA 4DVYP 1D1BA 5DBKA 1BR1A 1WGWA 4MQ9F 4C7OA 5FCLA 3I5QA 3Q7LA 2EINC 4XLPF 2WZGA 1HH8A 3T5VA 3X1OA 3APCA 3S7BA 4UI9K 2KW3C 2I1JA 4XWJA 3DPDA 3JSZA 5EDSA 4A3VA 5G2NA 3AU4A 3LXUX 3IBEA 3ASNC 5LOZA 4R7LA 2W9YA 4U07A 2PF4E 3FP3A 2UWJG 3L54A 2DYRC 1WM5A 1NA0A 1H0AA 3R9AB 1SMYF 3P2BA 4N2SA 3K9IA 3K6BA 2G62A 2FULA 4LRZA 2XQ0A 5DIZA 2VSOE 4I6EA 3W2VA 4EWCA 2WB7A 1HU3A 2PP4A 2X6IA 4MS6A 2J9WA 1ZHYA 4E6HA 4DVZA 3UT4A 4J30B 3TD7A 2Y69C 4NQ0A 5E33A 3MGBA 3FWVA 2OCCC 3EDTB 3OAWA 1NZEA 4GCNA 3FU0A 5ANLA 4U5BE 4BX9A 3LVQE 1ZHTA 4G2VA 4CBEA 3DZAA 4TV3A 4HVBA 5BUOA 3APFA 4DK5A 2BTDA 1G8XA 4P6IC 4BJTA 3PE4A 4UWHA 4CCAA 1UN9A 3S28A 3LYAA 4BJ6C 1OCOC 2NUPA 2CNWD 2IQCA 3UMKA 2J9QA 3B0VC 4E85A 4DLOA 3QK0A 4ANVA 4WNGA 1HXIA 4MRUA 3ZYLA 1M2OA 2R7QA 1JPNA 1JPLA 4FA6A 3S27A 4CS8C 3L13A 1M2VA 3U4TA 1XGWA 5AJLA 4RVBA 5FTPA 3RKVA 3RK6A 4G26A 3SNHA 4V3IA 2KQ9A 2R7UA 1QNFA 2M63A 4HOSA 1A17A 2MRIA 4O6NA 3TGOA 4UQZA 2KCKA 3CQZA 3CHOA 3CKCA 4BJ5A 3S2AA 2VQ2A 2MOWA 3PS6A 2PL2A 3LAYA 3G2UA 3ONKA 5KYWA 4K7BA 3F47A 1MMNA 4QDLA 1GW6A 3ZVVA 3HVEB 5FT9A 3HYMB 4H7YA 4APFA 3ESKA 4CS9A 2R7VA 4PK4A 4TRQA 4DI4A 4MLPA 4AXHA 2YNQA 2ZXWC 3RO3A 1IW7F 4JEHA 5HI7A 1OKKA 1LS1A 2BE5F 3SI5A 2XRZA 2J09A 3Q47B 3SGHA 2C2LA 4ZLDA 3F46A 4GZ6A 4UQYA 3FUFA 3QNKA 4A1SA 4XIFA 2R7XA 3GODA 4JEUA 1QZXA 2XEVA 3WXXA 4O7GA 4AJWA 3QWPA 3CSTA 3DJNB 2QY7A 3EH2A 3LNRA 3D9JA 2XHEA 3EGXA 1ELKA 4J32B 4HFGA 4KBQA 4Q7CA 4C9BB 1OCZC 3CVXA 1Z6AA 1RJ9A 2VJ8A 4GZ3A 1E8YA 3T4RA 3EFOB 4BT9A 3E4BA 3RO2A 1FMVA 2PX0A 3FEYA 5KYXB 4B0ZA 1TR2A 2J7PA 1LKXA 2OG2A 3X2QC 3LEVA 2C0MA 1UG3A 2IXPA 5KYUB 5BT1A 4I1AA 4PJLA 4JZYA 2G3VA 2R7SA 3S7DA 4BJ6A 3ABLC 2X3MA 1PC2A 4B8CB 5DQTA 5T1DB 3CHQA 4L7TA 4C0EA 3DBSA 4KNWA 1UJKA 2HV6A 2R5SA 2P7VA 2CHXA 2Q9CA 3CHMA 1Y8MA 3MLGA 2CHZA 5FZQA 3K66A 1SF8A 3D9OA 1VYIA 3RRUA 4WWPA 4D10C 4N5CA 3CVWA 5T3TA 2R59A 5G05C 1WAO1 4UI9C 1U3CA 3ZN3A 3C98A 2WVIA 2WZLA 3GZ1A 3QMKA 4E7SA 3BG0B 3FUIA 5BUZA 4FU3A 3CV0A 3ZHEB 2DYSC 4C3EA 2AVPA 2WXKA 4CDMA 4YNDA 1E7UA 3ML9A 3D9PA 2R7RA 1E8XA 3U66A 4JHJA 4L2LA 5KYYA 2KM4A 3P1UA 4DOZA 3ZYQA 5CI8A 3MEKA 4XE0A 2WQ7A 4H4KC 3FULA 1TKNA 2AXZA 5KYWB 4FESA 1H2VC 3CVNA 2I2OA 2Y3BA 1JPJA 2CHWA 1ZHZA 1VOMA 1LF8A 5CCMA 3QB2A 3QDNA 2WM9A 3CKBA 1N52A 5BNWA 3VLDA 2WXGA 4FHKA 2J46A 2H7VC 2LAHA 3NYJA 4G7HF 5KYNA 1S0PA 4BFRA 4CGWA 4O6YA 3B13A 1H19A 5T4YA 2WZFA 4BTBA 1Z5ZA 4BY6A 1FVHA 4TUUA 2A6EF 2XSEA 1PCXA 3TG5A 2GW1A 5ARGA 2KCVA 5AIJA 3RFYA 2FBNA 4U5CE 3IHYA 5DS5A 3AG1C 2A68F 3SP1A 2J0WA 1NU9C 5HSWA 3LCAA 4ULWA 3GZSA 3RIBA 4KVOA 1ZU5A 3S0XA 1UJJA 3SBSA 4JZAA 3HJCA 5KJNA 2I1KA 4UQXA 3AG4C 3S29A 2W45A 2LSVA 3SD5A 4ACLA 4I9CA 2VTBA 4OIRF 2XRYA 1L5JA 1Z23A 3DJUB 3EIQC 1E96B 3CHSA 4OIPF 4Q5SF 3TL5A 4FJYA 5KJKA 4GYWA 1H2UA 5E3AA 2FEZA 3I3NA 4FC8A 1J8YF 1W2WA 4LLEA 3QC1A 1INZA 3WODF 3CK7A 3TXMA 3PH0C 4AIFA 5KJLA 5G04C 2EQXA 1PD0A 4Q4ZF 2P6VA 4WUYA 2VTBB 4EZLA 2X6JA 4OINF 1ZHXA 4JJFA 4PS3A 2L0IA 4WNEA 2EIMC 4FADA 4AP2A 4AY5A 1IQUA 3JQ1A 3EZHA 2ZPAA 4F7AA 4ATGA 1ELWA 3FUKA 5JHBA 3E70C 4DPRA 4MNDA 5G05J 3CK9A 4U0UA 2WMNA 2XPIA 3LKUA 3D3MA 4E7ZA 3RRMB 4JL0A 4GEHA 2KNHA 1P5QA 5AENA 5BW8C 2V0PA 4JPSA 2WXNA 4YVQC 2OOEA 1HZ4A 3BG1B 1M2VB 4KBLA 3Q15A 4CT4A 5DLJA 3O4ZA 4JA9A 3RJVA 2DGJA 4XTKA 5FWQA 2CDQA 3FTWA 3EHNA 3FUDA 3VLFA 4AOFA 2MWQA 1MMAA 3LLKA 2Q9BA 2L0TB 4YT8A 4O6MA 4F3VA 3FDQA 3U9WA 3DMDA 2E87A 2Y39A 4LLCA 3DD7A 2NUTA 2JD3A 3FFLA 3KKBA 3LY7A 3CVUA 5DQZA 4U04A 3SYNA 3AQCA 3EJNA 1U3DA 2J4BA 4CDNA 4UWKA 3TXNA 2IU1A 2J4DA 4EBBA 3NYMA 5T8IA 3NKDA 4U5HA 1EYHA 3FUJA 2MHKA 3MV2B 3PRZA 3FUMA 1KT0A 4Y6WA 3CVYA 3Q4AB 5FQ8A 4UI9J 4BWRA 1TWGA 2CG2A 4HXIA 2WXFA 2IFUA 3B0UX 4JHKA 1H2TC 1N1CA 3N71A 3I4UA 1Z6TA 4C3DA 4KI2A 3WG7C 5EHHA 3ONLA 4IN3B 4HORA 4B94A 2OVBA 4DBRA 3R7RA 4IJJA 3PUJA 1HE8A 3FUEA 3G2VA 3ZIMA 3W2WA 2R7OA 2FI7A 4HFKB 4G23A 4U5DE 1OWMA 3QZCA 1B89A 4L23A 2J7PD 4IAOA 3NZSA 1ELRA 2L6JA 2J0XA 1QZ2A 2ILRA 3FUHA 1OUVA 3U64A 2Y4UA 1D1AA 1PY1A 2YINA 5E76A 5JHAA 3L0IA 2IJGX 2BUGA 3NZUA 2FFHA 2YHSA 4EBAG 2XCCA 4J8DA 2GRMA 4OVVA 2NG1A 3PEUB 2V26A 1OCRC 4Q69A 2YHCA 3CZ6A 3ULQA 3ZYKA 2Y3AA 4L1BA 1NP7A 4C0MA 4B8AA 1OCCC 2R7TA 3SF4A 3ABKC 4CT0A 3FHDA 4GAAA 2C03A 2Y4TA 1OWLA 4CSAA 2VGXA 3L08A 3LS0A 4BJ1A 3CVPA 4YT5A 5KCMA 2XGMA 3LJ3A 3L16A 3NG1A 3HTKC 2PM6A 1HO8A 2YQ8A 4EQFA 5T3RA 4JJGA 4U0ZA 3D9LA 4U5EE 1BR4A 3HIZA 2A5UA 4RSYA 3NYLA 4M63A 1YA0A 1MNDA 3T8MA 4ILIA 3N24A 3LESA 4RG6A 4HOTA 2YHEA 4N3BA 4B89A 4HE8D 3GZ2A 2WXHA 2R7WA 3PHF2 4IRUA 3QJZA 4FULA 3I4RB 5J08A 1M57C 4OIQF 2CNWA 4N39A 3CR3A 4KNVA 1XNFA 4YT4A 2J49A 1PD1A 3KAEA 2XPZA 3U3WA 1KLXA 3ZVRA 4PH4B 4J0UA 5L3QA 4Q96A 4H7XA 4UWLA 4LACB 5LFAA 4Y6CA 3KL4A 5CMYA 3CQGB 2VH3A 4XZ4A 1TWHA 3ITFA 2NSZA 3FDHA 4N06A 2WPVA 3RH3A 3I5PA 1TWCA 3EQLF 2WQ6A 1E90A 3PDNA 2BF0X 1KT1A 3B7SA 3CGHA 4HS2A 4F4BA 4CS8A 4PS8A 3JYHA 4YWQA 3EGXB 4F1SA 1JWGA 5L3VA 4O6FA 3FU3A 4NURA 2NUPB 3DM5A 4WWNA 4LERA 1E8WA 4M3OA 1D0XA 3NF1A 1VYKA 2GFHA 2CFUA 4GA2A 3LS1A 4RG9A 3FTVA 4QFVA 2C04A 3JYSA 1HS6A 1IHGA 4JW1A 3T6JA 3UGOA 2W4MA 4QI2A 1N54A 2IONA 1EDUA 1ST6A 2B0JA 1FMWA 4GYYA 5FZSA 2Q7FA 4W8KA 1FCHA 4U63A 4I3MA 4I2ZA 4LUNU 3L34A 3W8HA 4HOQA 1NG1A 2MYSA 5FQ4A 2R17C 2WXLA 3CVVA 2OV8A 3FTYA 1IZMA 5D0QD 2E0IA 2KZTA 2W4BA 4NRHB 4G7OF 1DVPA 3CEQA 2NC9A 4J8SA 4FLHA 2RG8A 1NU7D 2UY1A 4CGVA 3D9IA 4ILGA 2J45A 3QOUA 3ZIBA 2QY9A 3O39A 1X5BA 1V55C 2V4LA 3GYZA 5B1AC 4KXKB 3K1IC 3ZPJA 1BPOA 3D9NA 4RDAA 4PJNA 4OD4A 3G2WA 4G24A 3T6BA 1MMDA 4KYOB 4GZDA 4N3AA 2XPYA 2WXOA 4GPKA 2VYIA 4K03A 2VASA 2D5RB 2X6KA 2EIKC 4GA1A 3NRHA 4JURI 3FU5A 4AX2A 2V8SE 2QTVA 5AYWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVS A;  4IRU A;  4I1M A;  4JW1 A;  4I1O B; 
#chains in the Genus database with same CATH topology
 2AW6 A;  3RYL A;  5ANR A;  3CSF A;  2NUT B;  3DI5 A;  3K33 A;  1UN8 A;  3BU8 A;  4BX8 A;  1MHQ A;  4PFO A;  3AJM A;  4MVR A;  3SY2 A;  5D92 A;  5GPG B;  1GS9 A;  4EHM A;  3AS8 A;  5LP0 A;  4BT8 A;  4ANW A;  3X2Q E;  4XEI G;  2D4U A;  1MYO A;  3LVR E;  4U0S A;  4U5F E;  1MMG A;  2XLM A;  4WJ0 A;  3DAF A;  5G04 J;  3B0P A;  1AWC B;  3KH2 A;  1WDY A;  1LIH A;  3T9O A;  1OWP A;  2H7O A;  4YDW A;  1Z3X A;  1TNY A;  2WXI A;  3Q7G A;  5HV9 A;  3MX3 A;  3HDX A;  1VDY A;  4ABN A;  2BED A;  3C3Q A;  2OND A;  3ZG1 A;  1AEP A;  2IXO A;  3GW4 A;  3AG3 C;  3B9Q A;  3UX4 A;  3MFN A;  5CIV A;  1E7V A;  3Q73 A;  1HX8 A;  4AE4 A;  1ZW3 A;  4GZC A;  2IOS A;  4I6J A;  1J8M F;  1IKN D;  4WND A;  2LFF A;  3MKQ A;  2HR2 A;  3DM9 B;  4BPM A;  3EHR A;  3QAR A;  1IYG A;  1QQE A;  4YN0 B;  1Z63 A;  2ZIR A;  4I9E A;  4JXT A;  4DX2 A;  3HRA A;  3RW0 A;  3EH1 A;  3GWL A;  5D91 A;  4L2Y A;  5F5H A;  5M72 A;  3UM0 A;  1V55 E;  4ACK A;  3NKE A;  2AP3 A;  3QVZ A;  5G55 A;  4MVS A;  4J7T A;  1EPU A;  1MQS A;  4EBA A;  4CX9 A;  1N4R A;  2WVQ A;  5CI9 A;  3DSW A;  3IKO B;  4HEA J;  4C7O B;  1APC A;  2Z15 A;  4LCT A;  2L9B A;  2X51 A;  2YZS A;  1OW8 A;  5JMN D;  2JEK A;  1K3Z D;  1U6H A;  2EPK X;  4FJZ A;  4IUL A;  4EEC A;  2QFC A;  4ZLC A;  2YRF A;  4AY6 A;  3FAP B;  1V54 E;  1OY3 D;  2AWI A;  2L81 A;  4BTA A;  3IPM O;  1SYQ A;  3SXM A;  2PQR A;  4XX5 A;  5EX0 A;  2Y3G A;  2NYJ A;  3E32 A;  4DJA A;  3VLE A;  1O3U A;  1WN0 A;  1BZ4 A;  5KJM A;  5C2Y A;  4I2W A;  4EZJ A;  3EIJ A;  3PEV B;  3IEE A;  1L3P A;  2LNI A;  2GRL A;  4EZK A;  2A6H F;  2NSG A;  1FFT C;  4KZC A;  3NMI A;  5F5F A;  4Z68 A;  1YJG A;  4IYP A;  4M7C A;  3FUN A;  3LY9 A;  4ZFH A;  4ATZ D;  4APO A;  4TUM A;  1LE2 A;  2HZ8 A;  4PFP A;  5T3W A;  1JCQ A;  2WXJ A;  4UWF A;  5LX8 A;  3V7O A;  1SZI A;  4G25 A;  2Q9A A;  2R25 A;  2I9C A;  4K1O A;  3QAQ A;  1R5I D;  2BC5 A;  2VSX E;  4HRL A;  1NLX A;  2DBA A;  3TAX A;  3GEE A;  4HLE A;  2I6H A;  1CGM E;  3SZ7 A;  1HF8 A;  1ZU4 A;  2HM8 A;  4R32 A;  4ME2 A;  2HJM A;  3S84 A;  2I8B A;  2UUI A;  2XL4 A;  3HVE A;  1N4S A;  3TJP A;  3UM1 A;  1FVF A;  3U9M A;  4YJW A;  4BSX A;  1CPR A;  2WVN A;  4G7Z F;  4AM9 A;  4CIH A;  4XKC A;  1KNY A;  3URZ A;  4G8L A;  3UT7 A;  3KEZ A;  3CVL A;  2P9K G;  2IM8 A;  2VSY A;  2YL3 A;  3PZ1 A;  4GMJ A;  3DST A;  2ZXR A;  2J07 A;  5FJY A;  1QLE C;  1X81 A;  3CHR A;  4MW8 A;  4GB9 A;  4YL0 A;  4CS7 A;  5DS6 A;  3FEX A;  1LPE A;  2FGY A;  3DWL G;  2WXP A;  4FLB A;  3VF0 A;  1SQM A;  3FTU A;  3MCX A;  2FF4 A;  2WB2 A;  1RJ9 B;  4U8V D;  5JJ6 A;  3MYV A;  1TFO B;  1M56 C;  4XI9 A;  1V54 C;  1GQA A;  1MQV A;  1RXQ A;  4ER9 A;  3L17 A;  4GTO A;  1HE9 A;  4CRW A;  3EUV A;  2P2C P;  4J8E A;  2M64 A;  3C8Z A;  4OIO F;  1K40 A;  3S7J A;  2XCB A;  5COF A;  3QW1 A;  2IOL A;  3VTY A;  3ASH A;  2C0L A;  1FTS A;  2KAT A;  3PMR A;  5E75 A;  3TWW A;  2JLB A;  3CEX A;  4XKB A;  1R4T A;  3S7F A;  2YEV A;  3HNL A;  2DYS E;  5DVW A;  1OKK D;  2GRP B;  2VGX B;  3LEO A;  1NL4 A;  5AAO A;  3JUI A;  4CDV A;  2ZU6 B;  3LY8 A;  4JTD B;  2GRR B;  4DRI B;  3UKU G;  3CSK A;  3B29 A;  1JOG A;  4NQF A;  3ZSU A;  5IY5 C;  2KJG A;  3PE3 A;  4PDX A;  5ENN A;  3W9F A;  4K0D A;  3ZEF A;  2V5F A;  5AJD A;  5B1B C;  2AXV A;  1LI5 A;  4GZ5 A;  1IQR A;  4Q94 A;  4JKV A;  3PNL B;  3HLZ A;  5JA4 D;  1Q0M A;  3V30 A;  5JS5 A;  4HRM B;  2J9V A;  3CHP A;  1QBQ A;  1NFI E;  5ENS D;  3H65 A;  4CDR A;  1SZA A;  2LO6 A;  2WL8 A;  2PNN A;  4WAF A;  4NIK A;  3ASO C;  3EZI A;  3SFZ A;  4CDY A;  3FY4 A;  5HQ8 A;  4K0R A;  3GAN A;  2ASR A;  2XRH A;  3HXD A;  2EIJ E;  3DEP A;  1TYQ G;  4U8H A;  2QYU A;  2X0C A;  1NZN A;  3GOR A;  1PV3 A;  1WAT A;  4PJM A;  2OKU A;  1KZO A;  3ML8 A;  5ENQ D;  3EGD B;  2NPU A;  4NY3 A;  3AU5 A;  3TG4 A;  4YDO A;  4J8F A;  3QWW A;  2B6C A;  4RQI A;  2GAQ A;  3AAA C;  2KC7 A;  3DXJ F;  2L6F A;  2L6B A;  2WVO A;  5E2Q A;  2IF4 A;  5ITZ F;  1MX4 A;  3I4G A;  3JCK C;  3AQB A;  1Y6I A;  2X38 A;  3SBT B;  3FMS A;  3UR3 C;  4GTS A;  4O79 A;  3AJI A;  3AS4 A;  3MV3 B;  1XZP A;  5D0O D;  3ASG A;  3N0T A;  4XPX A;  2GGF A;  2AXU A;  1LVK A;  4GA0 A;  5AN8 A;  4YL3 A;  1TWA A;  4DUI A;  4CS9 C;  1TJC A;  2XGO A;  2UY1 B;  1GM5 A;  4GML A;  4UWG A;  1PAQ A;  1ZBP A;  3LEW A;  2A5E A;  2DI3 A;  4X0R A;  4BET A;  4BG0 A;  3L6A A;  2G3K A;  1WWP A;  4XLN F;  5E3C A;  1YCS B;  3APD A;  3ZHE A;  3Q6N A;  5COG A;  2J9B A;  2PZI A;  3AOU A;  1YYH A;  3W9G A;  1XZQ A;  3L8I A;  5CCL A;  3GEI A;  1TJF A;  1N11 A;  1YYX A;  4FP7 A;  4OYS A;  4OVU A;  3BEE A;  5HKP A;  3ZYM A;  5KYX A;  3KS2 A;  2XLW A;  3K1H A;  3MKQ B;  3OTN A;  5BXU A;  1SVX A;  1H6G A;  2DZN A;  3JRM O;  4KMO A;  2H7B A;  3B7R L;  1DNP A;  2AVK A;  5KYU A;  2IOQ A;  4I44 A;  3Q9N C;  2A0B A;  4UDV A;  1A41 A;  4OD5 A;  1LI7 A;  4P29 A;  5JJT A;  3Q7A A;  3QKY A;  3IQ6 A;  3VRC A;  1OWN A;  3UUX A;  3HKK A;  3MYI A;  1KU2 A;  3G2T A;  5KYY B;  4IWB A;  4PJJ A;  2OQM A;  5EKQ D;  5CHE E;  2V3C C;  3ZW3 A;  1JUQ A;  1AP7 A;  3IV0 A;  1N4P A;  4GYT A;  1UW4 B;  3UKR G;  3Q6M A;  3JCU Q;  3CIA A;  2RD9 A;  3CLJ A;  4YT2 A;  4DI3 A;  5JRA A;  4G11 A;  3ABK E;  4F53 A;  3DPY A;  4A3T A;  3FH5 A;  3UNG C;  3OXF A;  3G2S A;  1YAU O;  256B A;  3ABM C;  3OXG A;  2XXA A;  1Q0G A;  1S05 A;  1ORJ A;  3VAY A;  4AL1 A;  2KGO A;  1H6K A;  1O5H A;  3U8V A;  4WGZ A;  3EFO A;  5LCW C;  4HOU A;  1MX6 A;  1E8Z A;  4FX5 A;  4L6R A;  3RIP A;  4A1G A;  3BEH A;  4RBN A;  1H6P A;  4XI0 A;  2J08 A;  2EIK E;  3NQP A;  4A55 A;  3E30 A;  3IEG A;  4OAU C;  4N3C A;  3FHE A;  3EGD A;  3RU0 A;  5FZT A;  2XL6 A;  4DLQ A;  3KPH A;  4I17 A;  3E37 A;  4EBK A;  4QI0 A;  1TEZ A;  3U5S A;  4GYO A;  4DRX E;  2BKG A;  4JE9 A;  2LSU A;  5FQ7 A;  3SXY A;  3EG9 B;  4CSA C;  3DRA A;  1NBB A;  4W9R A;  3CVQ A;  4ANU A;  1W3B A;  3KMI A;  2XM4 A;  3PZ4 A;  2KZT B;  1G4U S;  2Y69 E;  1WY6 A;  4N2Q A;  1ZYR F;  2HJ3 A;  3Q49 B;  5CMW A;  3M79 A;  3MZL B;  3FTX A;  2VCB A;  3ENE A;  4E18 A;  5JSL A;  3O48 A;  4HLL A;  2HS5 A;  1RKE B;  3UXG A;  5J90 A;  3KD7 A;  2Q00 A;  4JVS A;  4JTC B;  3PUK A;  5A6B A;  4FHJ A;  2VGY A;  3FAJ A;  2RD0 A;  3PZD A;  2LUH A;  3LDZ A;  3KSL A;  4JCH A;  2E2E A;  4PS7 A;  3JYY A;  2Y0B G;  3NBN B;  2AWC A;  1H6O A;  4KZ0 A;  4LEU A;  3NMJ A;  1CGN A;  3K7D A;  4G0H A;  4GCO A;  3UT8 A;  3RSE G;  2HO1 A;  2HV7 A;  1E84 A;  5A23 A;  1OR3 A;  2J8S D;  3O6X A;  1TNU A;  1HFA A;  3FOP A;  3RKO F;  2YL7 A;  4CIP A;  2F0Y A;  2XEH A;  1XWJ A;  5BV1 A;  3R7C A;  3TWT A;  3VYW A;  4JC8 A;  1BDJ B;  3UIP C;  1EKY A;  4PR9 A;  3ZRH A;  3UMH A;  3UM3 A;  3JRT A;  2X6H A;  3FU6 A;  4HI9 A;  4DRH B;  3W8I A;  3V5X A;  1OWO A;  1MJ0 A;  5EGY A;  5JUA A;  5C1D A;  3DEO A;  5BPP A;  4J7W A;  5A69 A;  2PX3 A;  1TN8 A;  3D9K A;  2HYZ A;  1HG2 A;  1TN6 A;  1U2V G;  1JWF A;  3PVL A;  3B7U X;  4MKT A;  2L9J A;  3H2U A;  3LJN A;  2DIW A;  5F28 E;  3MJW A;  3LNM B;  2EIL C;  1BR2 A;  1H7I A;  4JHR A;  3PCV A;  5B3I A;  4AK9 A;  1QVX A;  1VK5 A;  3IHV A;  2KCL A;  3UMI A;  1Z3Y A;  4NCQ A;  2VB6 A;  1D0Z A;  3SNX A;  1QQ3 A;  3PNT B;  3L82 A;  3JQ0 A;  1HG5 A;  1YZC A;  2VSN A;  4PAC A;  4HFF B;  3UIN C;  3VTX A;  5ARF A;  1VMA A;  2Q3T A;  4I43 A;  3UM2 A;  3T5X A;  1Z3I X;  5TJ5 E;  5AQ7 A;  3EHM A;  2QYJ A;  4G1T A;  1TNZ A;  2H6I A;  4I6G A;  1ZHW A;  4J8Y A;  4K5A B;  1MNE A;  3SHF A;  4URK A;  1FFH A;  2EPN A;  4A2N B;  3ASF A;  4C48 B;  3NMK A;  3C7J A;  2NXP A;  3FVY A;  3MA5 A;  2WXQ A;  3UGP A;  4CEM A;  3RQF A;  2XXA B;  5EX3 A;  4KC9 A;  3TWS A;  1OCZ E;  4WWO A;  4CZ2 D;  5EID A;  4E0H A;  3ZGQ A;  5LCW J;  3QWV A;  3ULE G;  3FTS A;  3LS8 A;  3JUE A;  4N5Q A;  2BL2 A;  2IXM A;  3GEH A;  3VM6 A;  2V4H C;  5H7P A;  1G3N B;  3N2Z B;  3O10 A;  3NDB B;  3ZFW A;  4PUC A;  2R2L A;  1ZU2 A;  4MTG A;  3PRE A;  1EF1 C;  3G50 A;  5A7D B;  3SZR A;  4AVX A;  4KT6 B;  4B6I A;  2OVF A;  4JA7 A;  1RKC A;  1SZ9 A;  2J9U A;  2CFZ A;  2PM7 A;  5COM A;  3ISM C;  3JT1 A;  1VLT A;  1D0Y A;  2IXN A;  2JX0 A;  3ASD A;  3AG2 C;  2XGS A;  5JJ7 A;  4ANX A;  1O87 A;  2WXM A;  5BV0 A;  1G4W R;  3E9V A;  4BSZ B;  2QZA A;  4NAC A;  2B0O E;  2PFD A;  3TQO A;  1ZB1 A;  2P9N G;  2O9X A;  3H2V A;  3V2O A;  3HXE A;  2P61 A;  3DSV A;  4AEZ C;  2CW0 F;  1QPU A;  2WXR A;  3AS5 A;  1HY5 A;  2FO7 A;  2A1D D;  3UPV A;  2Y3D A;  3OXL A;  2IYL D;  2Y3H A;  3ZC4 A;  2EIJ C;  5EYL A;  3UMV A;  3SEO A;  1N94 A;  3D9M A;  2P9S G;  1A7V A;  3AG2 E;  3EPV A;  4MTO A;  3POV A;  1O1T A;  3LPZ A;  2XLO A;  3OWT A;  2IO3 C;  1WOL A;  2X6F A;  2M4E A;  3OEO A;  1A7D A;  4RD9 A;  3OA1 A;  4I1O B;  2ZXW E;  1S7Z A;  2YLG A;  2DCP A;  3SFY A;  1YZA A;  2A69 F;  3FOO A;  3MKR A;  4MVO A;  4FWV A;  3KYJ A;  2LSE A;  2OJQ A;  3GM3 A;  3ESL A;  2WQH A;  3ZXS A;  3Q7F A;  4KVM A;  4DBQ A;  4J6I A;  1NA3 A;  5A6C A;  2FAP B;  3L22 A;  4OAV B;  3RRN B;  4C3B A;  1JAF A;  3EG9 A;  1E85 A;  3FH8 A;  3Q75 A;  1QKR A;  5CRV A;  2ZXO A;  2RSE B;  5B3S C;  2CG3 A;  3Q5M A;  3CK8 A;  4GU5 A;  5FZR A;  3ECS A;  3LJB A;  3FTZ A;  4AE4 B;  3CQC B;  2A4Z A;  2WMO A;  2LAI A;  3ZNG A;  4EPZ A;  2CGE A;  3R7Q A;  5DS4 A;  4GQH A;  3RQE A;  4U5G A;  3UQ3 A;  3V79 K;  2QUP A;  4XEK A;  3M1C B;  3FH7 A;  3LLI A;  4MS2 A;  4BJ5 C;  1D1C A;  3HHM A;  2PQN A;  1E2X A;  5FQ6 A;  2P58 C;  3TJ5 A;  1OW7 A;  3B7T A;  4WNF A;  4YVO A;  2YVK A;  4LDR A;  2P9I G;  2ZXP A;  1EQ1 A;  4AV7 A;  4ILH B;  4BEJ A;  5B3S E;  1N0R A;  3DAG A;  4I1M A;  4ANJ A;  4A63 B;  4DVY P;  3KSQ A;  1D1B A;  5DBK A;  1BR1 A;  1WGW A;  4MQ9 F;  4C7O A;  5FCL A;  2XEN A;  1UOH A;  2LXL A;  3I5Q A;  3JZ0 A;  2IBF A;  3Q7L A;  1EI7 A;  4TXQ A;  2EIN C;  1YLM A;  4XLP F;  1G5Z A;  2WZG A;  1E83 A;  2QE9 A;  2HMZ A;  1HH8 A;  5AAR A;  3T5V A;  3X1O A;  3APC A;  3S7B A;  3C72 A;  3NOC D;  1YA7 O;  4EKW A;  4UI9 K;  2KW3 C;  2I1J A;  1QYM A;  1CGO A;  3KEA A;  4XWJ A;  3DPD A;  4Z9I A;  3JSZ A;  5EDS A;  4A3V A;  4YDE A;  5G2N A;  3AU4 A;  3LXU X;  3IBE A;  3ASN C;  3ZQY A;  2LK4 A;  5LOZ A;  4R7L A;  2W9Y A;  4DX5 D;  4U07 A;  2PF4 E;  3FP3 A;  3RVZ A;  2UWJ G;  3L54 A;  2DYR C;  1WM5 A;  2ZGD A;  1TFK B;  1NA0 A;  2VCC A;  1H0A A;  3R9A B;  1SMY F;  3P2B A;  4CYM D;  4N2S A;  3K9I A;  3WHN A;  3K6B A;  2G62 A;  2GDC A;  2FUL A;  4LRZ A;  3T9K A;  4IGG A;  2XQ0 A;  2OEV A;  4BEM J;  5DIZ A;  2P1A A;  2VSO E;  4I6E A;  1ZZP A;  3W2V A;  4EWC A;  2WB7 A;  1Q0K A;  3JXI A;  3O55 A;  4XPY A;  3ZDL A;  5CRU A;  1HU3 A;  1T6Q A;  3J06 A;  3TK0 A;  1LD7 A;  2PP4 A;  2X6I A;  4MS6 A;  2HSQ A;  3C3R A;  2J9W A;  1ZHY A;  2ETS A;  4E6H A;  1HW1 A;  4DVZ A;  2P9P G;  4O1O A;  2LIG A;  3UT4 A;  4J30 B;  1FR0 A;  2BKK B;  3TD7 A;  2Y69 C;  1D8E A;  4NQ0 A;  5E33 A;  3MGB A;  3FWV A;  2ETB A;  3TWR A;  2OCC C;  2P0N A;  1AVO B;  5L0C A;  3EDT B;  3U2M A;  4FAP B;  3OAW A;  1NZE A;  2OU6 A;  2P9U G;  3FU0 A;  4GCN A;  4CJO A;  5ANL A;  4U5B E;  1YMP A;  4LDK A;  4BX9 A;  1NFN A;  2MHR A;  3LVQ E;  1ZHT A;  1KTM A;  4G2V A;  4CBE A;  3DZA A;  4TV3 A;  3IHU A;  4HVB A;  5BUO A;  3TJ6 A;  1LTX A;  1RCP A;  3APF A;  4DK5 A;  2BTD A;  1G8X A;  2UUH A;  4JEB A;  4GTT A;  4P6I C;  4JB8 P;  3US6 A;  4GPM A;  4BJT A;  2P9L G;  3PE4 A;  2LFD A;  5FIN A;  2HFI A;  4UWH A;  5KWD A;  4XEF A;  4GTM A;  1UN9 A;  4CCA A;  5CED B;  3S28 A;  3LYA A;  4DRJ B;  4BJ6 C;  4P9T A;  1EA8 A;  1OCO C;  2NUP A;  2CNW D;  2F8X K;  2IQC A;  4XEV A;  3UMK A;  2J9Q A;  3B0V C;  4K5C A;  4DLO A;  1IXV A;  4E85 A;  3QK0 A;  4ANV A;  1TQG A;  4WNG A;  3C18 A;  1HXI A;  4MRU A;  3M15 A;  3ZYL A;  3IQT A;  1M2O A;  2YL0 A;  2R7Q A;  1DOW A;  2OEW A;  1JPN A;  3DSX A;  1JPL A;  4FA6 A;  3S27 A;  4CS8 C;  3R2P A;  3ZQV A;  3L13 A;  1DC2 A;  2IO2 C;  1M2V A;  3U4T A;  1XGW A;  3PZ3 A;  1RW2 A;  5AJL A;  4RVB A;  5FTP A;  3RKV A;  3RK6 A;  4Z9J A;  4G26 A;  3SNH A;  4V3I A;  2KQ9 A;  1O1R A;  1Y4C A;  2XL8 A;  2R7U A;  1QNF A;  5KNH D;  2M63 A;  4HOS A;  1A17 A;  2MRI A;  5D2M C;  4O6N A;  3TGO A;  4UQZ A;  3HXC A;  2XZD G;  2KCK A;  3CQZ A;  1OXK A;  3CHO A;  1YYJ A;  3CKC A;  4BJ5 A;  1AUE A;  3JXJ A;  3S2A A;  2VQ2 A;  2MOW A;  3PS6 A;  2PL2 A;  3LAY A;  3SO8 A;  4HBD A;  3G2U A;  3ONK A;  2EIN E;  5KYW A;  4K7B A;  3F47 A;  2JPU A;  5A6B D;  1MMN A;  2V5Q C;  4QDL A;  1GW6 A;  3ZVV A;  3HVE B;  1HE1 A;  2VGE A;  1ORY A;  3C8G B;  1TNB A;  5FT9 A;  3HYM B;  1A5E A;  4H7Y A;  4APF A;  3ESK A;  3SFX A;  2QLA A;  4CS9 A;  2R7V A;  4PK4 A;  4TRQ A;  1JMW A;  4DI4 A;  4MLP A;  1DOV A;  5L0G A;  2RKK A;  4AXH A;  4JEA A;  3M4C A;  2YNQ A;  2ZXW C;  1SW6 A;  3RO3 A;  5CBN A;  5AGF A;  1IW7 F;  4JEH A;  3NB2 A;  5HI7 A;  5BQI A;  1OKK A;  1LS1 A;  2BE5 F;  3SI5 A;  2XRZ A;  4LDQ A;  1ZW2 A;  2HKV A;  2J09 A;  3Q47 B;  1I5N A;  3ZWI A;  4O60 A;  1ORS C;  3SGH A;  2C2L A;  4ZLD A;  4YK5 A;  3C62 A;  5A6K A;  1Y6D A;  3F46 A;  1DCQ A;  4GZ6 A;  4UQY A;  4N4W A;  3J5Q B;  3B95 A;  3ZTM A;  1HMD A;  3FUF A;  3QNK A;  2QNL A;  3TUL A;  4A1S A;  4XIF A;  2R7X A;  3GOD A;  4JEU A;  1QZX A;  3L8J A;  2XEV A;  3WXX A;  5IY5 E;  1BI7 B;  3U3F A;  2NSF A;  1VTM P;  2LD6 A;  4O7G A;  4AJW A;  3QWP A;  4D4N A;  1OT8 A;  3CST A;  5BXO A;  5FIO A;  4L9P A;  1FPP A;  3ZU7 B;  4XQ1 A;  3DJN B;  2QY7 A;  3U9J A;  3EH2 A;  3LNR A;  1V74 B;  2ZIS A;  2KK1 A;  3D9J A;  2XHE A;  3EGX A;  1ELK A;  4J32 B;  5L0D A;  4HFG A;  4KBQ A;  2IEJ A;  4Q7C A;  4C9B B;  1OCZ C;  3CVX A;  1RJ9 A;  1Z6A A;  1JR8 A;  1N4Q A;  2EPO A;  2VJ8 A;  4MVM A;  2ZGG A;  3TWU A;  4GZ3 A;  1E8Y A;  3T4R A;  3EFO B;  2KBX A;  4BT9 A;  3E4B A;  3RO2 A;  2HMQ A;  3ULY A;  1FMV A;  2PX0 A;  4UUC A;  3FEY A;  4HRN A;  5KYX B;  4B0Z A;  1TR2 A;  1Z7Q c;  2J7P A;  4JTA B;  1LKX A;  2OG2 A;  3X2Q C;  3LEV A;  4DXW A;  4CDA A;  1UG3 A;  2IXP A;  2C0M A;  5KYU B;  5BT1 A;  4I1A A;  1CPQ A;  5EYP F;  3U0C A;  3NAW A;  4PJL A;  5L0H A;  4JZY A;  2G3V A;  2R7S A;  1WG0 A;  3S7D A;  4BJ6 A;  3ABL C;  2X3M A;  1PC2 A;  2H6H A;  1O5M A;  1SA4 A;  4B8C B;  5DQT A;  4NC3 A;  5L0F A;  4BER A;  1T9K A;  5T1D B;  1FT1 A;  2J8W A;  3CHQ A;  4L7T A;  4C0E A;  2L6H A;  3Q79 A;  1OCC E;  3DBS A;  4KNW A;  1MZC A;  1UJK A;  1YDI A;  2GRO B;  2HV6 A;  2R5S A;  2OJE D;  1NSG B;  2P7V A;  2CHX A;  2Q9C A;  2FO1 E;  3CHM A;  4F6R D;  1Y8M A;  3MLG A;  1RKE A;  2CHZ A;  5FZQ A;  2KC3 A;  4DJ9 A;  4YDY A;  2R9R B;  3K66 A;  2XEE A;  1SF8 A;  2XM0 A;  3D9O A;  5B1B E;  1VYI A;  2XLH A;  3RRU A;  2CCY A;  1LM3 B;  4WWP A;  4D10 C;  4AL0 A;  1KZP A;  4N5C A;  3CVW A;  5T3T A;  2R59 A;  4MW3 A;  5G05 C;  2EPM X;  1WAO 1;  3RVY A;  3S9O A;  4UI9 C;  1U3C A;  3ZN3 A;  3C98 A;  2LCH A;  1E86 A;  2WVI A;  2WZL A;  3GZ1 A;  3QMK A;  4E7S A;  3AG4 E;  3BG0 B;  3FUI A;  5BUZ A;  4FU3 A;  3CV0 A;  4HNA D;  3ZHE B;  2DYS C;  4C3E A;  2AVP A;  2WXK A;  3S90 A;  2LQG A;  4CDM A;  4YND A;  5B1A E;  1E7U A;  3D9P A;  3ML9 A;  2R7R A;  1E8X A;  3U66 A;  4JHJ A;  4L2L A;  5KYY A;  2KM4 A;  3P1U A;  4LNU D;  4DOZ A;  4JD2 G;  3ZYQ A;  5CI8 A;  3MEK A;  4XE0 A;  2WQ7 A;  2KYH A;  4H4K C;  3FUL A;  3SXZ A;  1TKN A;  2ICW G;  3ZKJ A;  5JT4 A;  2AXZ A;  4U9E A;  5KYW B;  2CYD A;  4FES A;  1H2V C;  3CVN A;  2I2O A;  3ABM E;  2Y3B A;  1JPJ A;  3DWW A;  2CHW A;  1ZHZ A;  1I4Z A;  1VOM A;  1LF8 A;  5CCM A;  3QB2 A;  3QDN A;  3T8K A;  2WM9 A;  3CKB A;  1OCO E;  1N52 A;  3J5P A;  5BNW A;  5CBO A;  3VLD A;  2WXG A;  1C17 M;  1KPS B;  4FHK A;  2J46 A;  3B71 A;  2H7V C;  2LAH A;  3NYJ A;  4N6C A;  3WAQ A;  4G7H F;  5KYN A;  1S0P A;  4BFR A;  4CGW A;  4O6Y A;  3B13 A;  1H19 A;  5T4Y A;  2WZF A;  2PNO A;  2I15 A;  1LS4 A;  3HXB A;  4BTB A;  1Z5Z A;  5JVE A;  1N9A A;  4BY6 A;  1FVH A;  4MVZ A;  3U2L A;  4O1P A;  4H54 A;  3C8G D;  4TUU A;  3U8P A;  2A6E F;  2XSE A;  1PCX A;  3TG5 A;  2GW1 A;  5ARG A;  2KCV A;  5AIJ A;  1OW6 A;  3RFY A;  5EIL A;  2FBN A;  4U5C E;  3IHY A;  5DS5 A;  3AG1 C;  2A68 F;  3SP1 A;  1T01 A;  2GRN B;  4WAB A;  1GGQ A;  2J0W A;  5BQH A;  1NU9 C;  2KSF A;  3BRJ A;  5HSW A;  3LCA A;  2DZO A;  4ULW A;  3GZS A;  4KVO A;  1ZU5 A;  3RIB A;  3UTM A;  2B0H A;  4A4A A;  1TNO A;  1T6U A;  5ENT D;  3S0X A;  1UJJ A;  3SBS A;  4JZA A;  3HJC A;  1MX2 A;  4GTR A;  5AQB A;  2Y1L E;  5KJN A;  2I1K A;  4UQX A;  3AG4 C;  2F37 A;  4J7Y A;  3S29 A;  2W45 A;  2LSV A;  3SD5 A;  4ACL A;  4I9C A;  3SXK A;  2VTB A;  4OIR F;  1YAR O;  2XRY A;  1L5J A;  4DX6 D;  2RFM A;  2YLD A;  1Z23 A;  3DJU B;  2R05 A;  3EIQ C;  1E96 B;  3CHS A;  4OIP F;  4Q5S F;  3TL5 A;  1K8K G;  4FJY A;  4LG6 A;  5KJK A;  4GYW A;  1H2U A;  1YA9 A;  5E3A A;  5AC5 A;  2HE0 A;  4NTB A;  2FEZ A;  3I3N A;  4FC8 A;  4E0I A;  1J8Y F;  1W2W A;  3ATP A;  4U8Y D;  4LLE A;  3QC1 A;  1INZ A;  3WOD F;  2YWA A;  3CK7 A;  3PH0 C;  3TXM A;  2ETC A;  1UG7 A;  1ZVZ A;  3PZ2 A;  1U89 A;  1WTY A;  4AIF A;  5KJL A;  2KXP C;  1D8D A;  5G04 C;  2EQX A;  1PD0 A;  3T6G B;  4Q4Z F;  1BU9 A;  2P6V A;  4WUY A;  3HXF A;  2VTB B;  4LSZ E;  3Q9U C;  2X6J A;  4EZL A;  4OIN F;  1ZHX A;  4JJF A;  4PS3 A;  2L0I A;  2R02 A;  3HG0 D;  5AQA A;  4WNE A;  2EIM C;  4U9D A;  4FAD A;  3LUT B;  4AP2 A;  4IAQ A;  2VCA A;  4RLY A;  2AWY A;  4AY5 A;  3AG3 E;  1IQU A;  3JQ1 A;  3EZH A;  2ZPA A;  4F7A A;  4ATG A;  4IB4 A;  3W4Y A;  1ELW A;  1H9T A;  3FUK A;  3SQV A;  3D9H A;  5JHB A;  3E70 C;  4DPR A;  4EBJ A;  4MND A;  5G05 J;  3B7B A;  3CK9 A;  3IXE A;  1OCR E;  4U0U A;  2WMN A;  2XPI A;  3LKU A;  3D3M A;  2ZD9 A;  4E7Z A;  3RRM B;  4JL0 A;  4GEH A;  2KNH A;  1P5Q A;  5AEN A;  4HI8 A;  5BW8 C;  3ZUV B;  2V0P A;  4JPS A;  2WXN A;  4YVQ C;  2OOE A;  1HZ4 A;  3BG1 B;  1M2V B;  1C03 A;  2HSB A;  3QW0 A;  4KBL A;  3Q15 A;  4CT4 A;  5DLJ A;  3O4Z A;  2MYO A;  4JA9 A;  1Q0F A;  5ENR D;  3EU5 A;  3RJV A;  2DGJ A;  4P9F A;  4XTK A;  3GWN A;  5FWQ A;  2CDQ A;  3FTW A;  3EHN A;  4U96 D;  3FUD A;  3VLF A;  4AOF A;  2MWQ A;  1MMA A;  3LLK A;  2Q9B A;  2L0T B;  5CEC B;  3A9C A;  4YT8 A;  4MVU A;  4O6M A;  4F3V A;  4WGY A;  3FDQ A;  3U9W A;  4XPW A;  4MBG A;  3DMD A;  2E87 A;  2Y39 A;  4LLC A;  4MVQ A;  3DD7 A;  2NUT A;  2JD3 A;  3FFL A;  1JRA A;  1IHB A;  4TXR A;  3TWV A;  2EIM E;  5ENP D;  3KKB A;  3LY7 A;  3CVU A;  1K04 A;  5DQZ A;  3MBG A;  4Z9H A;  4U04 A;  3SYN A;  3AQC A;  1S70 B;  1D9S A;  3M4B A;  3EJN A;  1UFB A;  1U3D A;  3G4X A;  5ENO D;  1LD8 A;  2J4B A;  3ZTZ A;  4CDN A;  4UWK A;  3TXN A;  2IU1 A;  2L6G A;  2J4D A;  3UI2 A;  3A11 A;  4EBB A;  3NYM A;  1S64 A;  1L7C A;  1VB5 A;  1BLX B;  5T8I A;  3V5Z A;  4DX1 A;  3NKD A;  3CAX A;  2YL1 A;  4U5H A;  4EHP A;  1EYH A;  3FUJ A;  2DVW A;  2MHK A;  3MV2 B;  2IY0 C;  2DB4 A;  1QSP A;  4IAR A;  3PRZ A;  3FUM A;  1KT0 A;  4Y6W A;  3WG7 E;  3V31 A;  2R03 A;  3CVY A;  2OOC A;  3Q4A B;  2DYR E;  5FQ8 A;  4ULV A;  1OXB A;  4UI9 J;  4BWR A;  1TWG A;  2CG2 A;  3DKA A;  4HXI A;  4D4X A;  3TWQ A;  3NOG D;  2WXF A;  2GRQ B;  1JCS A;  4HB5 A;  2IFU A;  1T5O A;  1TR4 A;  3B0U X;  4JHK A;  1H2T C;  3QTH A;  1N1C A;  3N71 A;  1Z6T A;  3I4U A;  4C3D A;  1Q0D A;  1SR2 A;  4KI2 A;  3WG7 C;  4U7E B;  5EHH A;  5D66 A;  3ONL A;  4IN3 B;  4GTP A;  4HOR A;  5EIB E;  4B94 A;  3JTL O;  4LNB A;  2OVB A;  4DBR A;  3R7R A;  4IJJ A;  3PUJ A;  2YKZ A;  1HE8 A;  1RZ4 A;  1HW2 A;  3FUE A;  1N95 A;  3G2V A;  1TN7 A;  1S63 A;  3ZIM A;  3MYF A;  3W2W A;  1FNT c;  2R7O A;  2FI7 A;  4HFK B;  4G23 A;  4U5D E;  1OWM A;  3QZC A;  2H6F A;  2XLV A;  1B89 A;  4L23 A;  2J7P D;  4IAO A;  3Q78 A;  5K0I A;  3NZS A;  4G8K A;  1ELR A;  2L6J A;  3ZXP A;  2J0X A;  1QZ2 A;  2ILR A;  4N6H A;  3FUH A;  1OUV A;  3EU9 A;  2Y4U A;  3U64 A;  1D1A A;  1PY1 A;  2YIN A;  5E76 A;  3AGU A;  5JHA A;  2LXM A;  3L0I A;  2IJG X;  2YQY A;  2BUG A;  3HNI A;  3IQ5 A;  2FFH A;  3NZU A;  2YHS A;  4EBA G;  2XCC A;  4J8D A;  5A6J A;  2GRM A;  4OVV A;  3E33 A;  2NG1 A;  4HQD A;  3PEU B;  2V26 A;  2XS8 A;  1OCR C;  1B68 A;  1U0B B;  2YHC A;  4Q69 A;  5KBA A;  3CZ6 A;  5HRY A;  3ULQ A;  3ZYK A;  3DXM G;  2Y3A A;  4L1B A;  3BQO A;  1NP7 A;  4C0M A;  4B8A A;  1OCC C;  2R7T A;  3SF4 A;  1I4Y A;  3ABK C;  3U3B A;  3TWX A;  4CT0 A;  3FHD A;  4GAA A;  4GMR A;  2C03 A;  2TMV P;  2YLI A;  2H8A A;  3C63 A;  2Y4T A;  1N0Q A;  4JRZ A;  1OWL A;  4CSA A;  2VGX A;  3L08 A;  3LS0 A;  4BJ1 A;  3CVP A;  4YT5 A;  5KCM A;  1C02 A;  3GM1 A;  2EIL E;  1RMV A;  2XGM A;  3LJ3 A;  5CER B;  3L16 A;  3NG1 A;  3HTK C;  2PM6 A;  1HO8 A;  2YQ8 A;  3TOL A;  2F8Y A;  5T3R A;  4EQF A;  1O1S A;  3GM2 A;  4JJG A;  4U0Z A;  1A0B A;  3AGT A;  1OR2 A;  3D9L A;  4U5E E;  1BR4 A;  3HIZ A;  2A5U A;  4RSY A;  5KNG A;  1Z5S C;  3NYL A;  4M63 A;  1YA0 A;  4GTV A;  5CEA A;  1MND A;  2OEX A;  1M6T A;  4ILI A;  3N24 A;  3T8M A;  3LES A;  4RG6 A;  4HOT A;  2YHE A;  5AQ9 A;  4N3B A;  3EHQ A;  4B89 A;  4HE8 D;  4B93 B;  3GZ2 A;  2WXH A;  1K05 A;  2R7W A;  5EK0 A;  3PHF 2;  4IRU A;  3QJZ A;  4FUL A;  3I4R B;  5J08 A;  1NFO A;  1M57 C;  5JLI A;  4ONS A;  1H9G A;  4OIQ F;  3ASN E;  2CNW A;  4N39 A;  2Q7R A;  1T6I A;  3CR3 A;  4KNV A;  1XNF A;  4YT4 A;  1BD8 A;  1A7E A;  2J49 A;  1PD1 A;  3RQG A;  2XPZ A;  3KAE A;  3U3W A;  4U95 D;  1KLX A;  2XS1 A;  4JC7 A;  3V2X A;  3ZVR A;  4PH4 B;  3V5Y A;  4E17 A;  4G78 A;  4J0U A;  3E34 A;  4X8Q A;  5L3Q A;  1BI8 B;  4Q96 A;  4H7X A;  4BEP A;  4UWL A;  4MTF A;  4LAC B;  3L1M A;  5A6A A;  5LFA A;  4Y6C A;  3JSE O;  3KL4 A;  5CMY A;  2LP4 A;  3CQG B;  2H6G A;  1DCE A;  2VH3 A;  4DX7 D;  4XZ4 A;  1TWH A;  3DXK G;  3ITF A;  2NSZ A;  3FDH A;  4N06 A;  2WPV A;  3C3O A;  3L9T A;  3DE8 A;  3RH3 A;  3I5P A;  5JP7 A;  2QC9 A;  1TWC A;  1OQC A;  3EQL F;  2WQ6 A;  1E90 A;  2AU5 A;  3PDN A;  2BF0 X;  2Q4F A;  1KT1 A;  3G4Z A;  3B7S A;  3CGH A;  4HS2 A;  2VC9 A;  5EN5 D;  4F4B A;  4CS8 A;  4PS8 A;  1SA5 A;  3JYH A;  4YWQ A;  3EGX B;  4QQI A;  4F1S A;  1JWG A;  4TXP A;  4NTA A;  5L3V A;  4O6F A;  3ASO E;  3FU3 A;  4NUR A;  2NUP B;  3DM5 A;  4WWN A;  4LER A;  2JAB A;  2PBE A;  1E8W A;  3DSU A;  4M3O A;  4EUK B;  3TOM A;  1D0X A;  3NF1 A;  1VYK A;  2GFH A;  2CFU A;  3IQC A;  4GA2 A;  1K1A A;  3LS1 A;  4RG9 A;  3RAU A;  1V4A A;  3FTV A;  4QFV A;  2C04 A;  4EIY A;  3JYS A;  1HS6 A;  1IHG A;  3KYI A;  4JW1 A;  3BUA A;  3T6J A;  3ABL E;  3UGO A;  2W4M A;  3HNJ A;  3RF3 A;  3QVY A;  4GTQ A;  4QI2 A;  5BQG A;  1N54 A;  2ION A;  2XLD A;  1EDU A;  1ST6 A;  1OXJ A;  2B0J A;  4NTF A;  1FMW A;  2EPL X;  1F1M A;  4GYY A;  5FZS A;  2Q7F A;  4W8K A;  1FCH A;  1Q2Z A;  4U63 A;  4I3M A;  4I2Z A;  5L0I A;  3C8G A;  4LUN U;  4F1P A;  3L34 A;  3W8H A;  4HOQ A;  1NG1 A;  1NI1 A;  2MYS A;  3PDM P;  5FQ4 A;  5HS0 A;  2R17 C;  2WXL A;  3CVV A;  1VLS A;  2OV8 A;  3FTY A;  1IZM A;  5D0Q D;  2E0I A;  2F22 A;  2AJA A;  2XZT G;  2KZT A;  2W4B A;  4NRH B;  2ETA A;  3HNK A;  4G7O F;  3C5R A;  1DVP A;  3CEQ A;  1YVI A;  5AC4 A;  5L0J A;  2NC9 A;  4J8S A;  2A0U A;  1WAS A;  4FLH A;  3FXH A;  1NU7 D;  2DWZ A;  2RG8 A;  2UY1 A;  4CGV A;  1LE4 A;  2HUJ A;  3UIO C;  3DE9 A;  3D9I A;  4ILG A;  2J45 A;  3QOU A;  3ZIB A;  2QY9 A;  3O39 A;  3AG1 E;  1X5B A;  4YL1 A;  1V55 C;  2V4L A;  2OCC E;  3GYZ A;  2GA0 A;  4W8P A;  4ZHB A;  4CJG A;  5B1A C;  4KXK B;  3K1I C;  1FT2 A;  3ZPJ A;  2L7A A;  1BPO A;  3K1I A;  3D9N A;  3DSS A;  1HMO A;  4PJN A;  4RDA A;  4OD4 A;  4BES A;  3G2W A;  2RFA A;  4G24 A;  3T6B A;  1MMD A;  4KYO B;  4GZD A;  4N3A A;  4K5B A;  2GWW A;  3F6Q A;  2XPY A;  3R9M A;  2WXO A;  1K1B A;  4GPK A;  2VYI A;  4K03 A;  2VAS A;  1BBH A;  2D5R B;  2X6K A;  1FAP B;  4JCZ A;  2EIK C;  4GA1 A;  4JIO A;  1JCR A;  3NRH A;  4JUR I;  3FU5 A;  4AX2 A;  2V8S E;  2QTV A;  4LNG A;  5AYW D;  2XLE A; 
#chains in the Genus database with same CATH homology
 2AW6 A;  3RYL A;  5ANR A;  3CSF A;  2NUT B;  3K33 A;  1UN8 A;  4BX8 A;  1MHQ A;  4PFO A;  5D92 A;  3AS8 A;  5LP0 A;  4BT8 A;  4ANW A;  3LVR E;  4U0S A;  4U5F E;  1MMG A;  4WJ0 A;  3DAF A;  5G04 J;  3B0P A;  3KH2 A;  1OWP A;  2H7O A;  1Z3X A;  2WXI A;  3Q7G A;  3MX3 A;  3HDX A;  1VDY A;  4ABN A;  2OND A;  3ZG1 A;  2IXO A;  3GW4 A;  3AG3 C;  3B9Q A;  3UX4 A;  1E7V A;  1HX8 A;  4AE4 A;  4GZC A;  2IOS A;  4I6J A;  1J8M F;  4WND A;  3MKQ A;  2HR2 A;  3DM9 B;  3QAR A;  1IYG A;  1QQE A;  4YN0 B;  1Z63 A;  4I9E A;  4JXT A;  3EH1 A;  5D91 A;  4L2Y A;  5F5H A;  5M72 A;  4ACK A;  3NKE A;  5G55 A;  1EPU A;  1MQS A;  4EBA A;  2WVQ A;  5CI9 A;  3IKO B;  4HEA J;  4C7O B;  2Z15 A;  4LCT A;  2L9B A;  2X51 A;  2YZS A;  2JEK A;  4FJZ A;  4IUL A;  4EEC A;  2QFC A;  4ZLC A;  4AY6 A;  2AWI A;  2L81 A;  4BTA A;  2PQR A;  4XX5 A;  5EX0 A;  2Y3G A;  4DJA A;  3VLE A;  5KJM A;  5C2Y A;  4I2W A;  4EZJ A;  3EIJ A;  3PEV B;  3IEE A;  2LNI A;  2GRL A;  4EZK A;  2A6H F;  1FFT C;  4KZC A;  5F5F A;  4IYP A;  3FUN A;  3LY9 A;  4APO A;  5T3W A;  4PFP A;  2WXJ A;  4UWF A;  5LX8 A;  3V7O A;  1SZI A;  4G25 A;  2Q9A A;  2I9C A;  3QAQ A;  2VSX E;  2DBA A;  3TAX A;  4HLE A;  2I6H A;  3SZ7 A;  1HF8 A;  1ZU4 A;  2HM8 A;  4ME2 A;  3TJP A;  2I8B A;  2XL4 A;  3HVE A;  1FVF A;  4YJW A;  4BSX A;  2WVN A;  4G7Z F;  4AM9 A;  4CIH A;  4XKC A;  3URZ A;  3UT7 A;  3KEZ A;  3CVL A;  2VSY A;  4GMJ A;  2ZXR A;  2J07 A;  5FJY A;  1QLE C;  3CHR A;  4GB9 A;  4CS7 A;  5DS6 A;  3FEX A;  2FGY A;  2WXP A;  4FLB A;  1SQM A;  3FTU A;  3MCX A;  2FF4 A;  2WB2 A;  1RJ9 B;  5JJ6 A;  3MYV A;  1M56 C;  4XI9 A;  1V54 C;  3L17 A;  4CRW A;  4J8E A;  4OIO F;  3S7J A;  2XCB A;  2IOL A;  3VTY A;  3ASH A;  2C0L A;  1FTS A;  2KAT A;  3PMR A;  5E75 A;  2JLB A;  4XKB A;  3S7F A;  2YEV A;  5DVW A;  1OKK D;  2VGX B;  3JUI A;  2ZU6 B;  3LY8 A;  3CSK A;  3ZSU A;  5IY5 C;  2KJG A;  3PE3 A;  4PDX A;  5ENN A;  4K0D A;  3ZEF A;  2V5F A;  5AJD A;  5B1B C;  2AXV A;  4GZ5 A;  1IQR A;  4Q94 A;  3PNL B;  3HLZ A;  2J9V A;  3CHP A;  3H65 A;  4CDR A;  1SZA A;  2LO6 A;  2WL8 A;  4WAF A;  3ASO C;  3EZI A;  3SFZ A;  3FY4 A;  5HQ8 A;  4K0R A;  3GAN A;  2XRH A;  4U8H A;  1NZN A;  4PJM A;  3ML8 A;  3EGD B;  4NY3 A;  3AU5 A;  3TG4 A;  4J8F A;  3QWW A;  2KC7 A;  3DXJ F;  2WVO A;  5E2Q A;  2IF4 A;  3I4G A;  3JCK C;  3AQB A;  1Y6I A;  2X38 A;  3SBT B;  3UR3 C;  4O79 A;  3AS4 A;  3MV3 B;  5D0O D;  3ASG A;  3N0T A;  2GGF A;  2AXU A;  1LVK A;  4GA0 A;  1TWA A;  4CS9 C;  1TJC A;  2XGO A;  2UY1 B;  4GML A;  4UWG A;  1PAQ A;  1ZBP A;  3LEW A;  4X0R A;  4BG0 A;  3L6A A;  2G3K A;  4XLN F;  5E3C A;  3APD A;  3ZHE A;  3Q6N A;  2PZI A;  5CCL A;  1TJF A;  4FP7 A;  4OYS A;  4OVU A;  3BEE A;  3ZYM A;  5KYX A;  3KS2 A;  3K1H A;  3MKQ B;  3OTN A;  4KMO A;  2H7B A;  3B7R L;  1DNP A;  5KYU A;  2IOQ A;  4I44 A;  4OD5 A;  4P29 A;  5JJT A;  3QKY A;  3UUX A;  1OWN A;  3G2T A;  1KU2 A;  5KYY B;  4IWB A;  4PJJ A;  5EKQ D;  5CHE E;  2V3C C;  3ZW3 A;  1JUQ A;  3IV0 A;  4GYT A;  1UW4 B;  3Q6M A;  3JCU Q;  3CIA A;  3CLJ A;  4YT2 A;  4DI3 A;  4G11 A;  4F53 A;  4A3T A;  3FH5 A;  3UNG C;  3OXF A;  3G2S A;  3ABM C;  3OXG A;  2XXA A;  3VAY A;  2KGO A;  1H6K A;  1O5H A;  3EFO A;  5LCW C;  4HOU A;  1E8Z A;  4FX5 A;  3RIP A;  4A1G A;  4RBN A;  4XI0 A;  2J08 A;  3NQP A;  4A55 A;  3IEG A;  4N3C A;  3FHE A;  3EGD A;  3RU0 A;  4DLQ A;  4I17 A;  4QI0 A;  1TEZ A;  4GYO A;  2LSU A;  5FQ7 A;  3EG9 B;  4CSA C;  4W9R A;  3CVQ A;  4ANU A;  1W3B A;  3KMI A;  2KZT B;  1WY6 A;  4N2Q A;  1ZYR F;  3Q49 B;  5CMW A;  3MZL B;  3FTX A;  3ENE A;  3O48 A;  5J90 A;  3KD7 A;  4JVS A;  3PUK A;  4FHJ A;  2VGY A;  3FAJ A;  2RD0 A;  3PZD A;  3LDZ A;  4JCH A;  2E2E A;  4PS7 A;  4KZ0 A;  4LEU A;  3K7D A;  4G0H A;  4GCO A;  3UT8 A;  2HO1 A;  2HV7 A;  5A23 A;  3O6X A;  1HFA A;  3RKO F;  5BV1 A;  3VYW A;  4JC8 A;  3ZRH A;  3UMH A;  3JRT A;  2X6H A;  3FU6 A;  3W8I A;  1OWO A;  5EGY A;  5C1D A;  5BPP A;  2PX3 A;  3D9K A;  2HYZ A;  1HG2 A;  1JWF A;  3PVL A;  3B7U X;  4MKT A;  2L9J A;  2DIW A;  3MJW A;  2EIL C;  1BR2 A;  4JHR A;  4AK9 A;  1VK5 A;  3IHV A;  2KCL A;  3UMI A;  1Z3Y A;  2VB6 A;  1D0Z A;  3SNX A;  3PNT B;  3JQ0 A;  1HG5 A;  2VSN A;  4HFF B;  3VTX A;  5ARF A;  1VMA A;  2Q3T A;  4I43 A;  3T5X A;  1Z3I X;  3EHM A;  4G1T A;  4I6G A;  1ZHW A;  1MNE A;  3SHF A;  4URK A;  1FFH A;  4A2N B;  3ASF A;  2NXP A;  3FVY A;  3MA5 A;  2WXQ A;  3UGP A;  4CEM A;  2XXA B;  5EX3 A;  4KC9 A;  4WWO A;  3ZGQ A;  5LCW J;  3QWV A;  3FTS A;  3LS8 A;  2IXM A;  3N2Z B;  3NDB B;  3ZFW A;  4PUC A;  1ZU2 A;  3PRE A;  1EF1 C;  5A7D B;  3SZR A;  4AVX A;  4KT6 B;  4B6I A;  2OVF A;  4JA7 A;  1SZ9 A;  2J9U A;  2CFZ A;  2PM7 A;  3JT1 A;  1D0Y A;  2IXN A;  3ASD A;  3AG2 C;  2XGS A;  5JJ7 A;  4ANX A;  1O87 A;  2WXM A;  5BV0 A;  3E9V A;  4NAC A;  2PFD A;  2O9X A;  4AEZ C;  2CW0 F;  2WXR A;  3AS5 A;  2FO7 A;  2A1D D;  3UPV A;  2Y3D A;  3OXL A;  2IYL D;  2Y3H A;  3ZC4 A;  2EIJ C;  3UMV A;  3SEO A;  3D9M A;  3EPV A;  3POV A;  3LPZ A;  3OWT A;  2X6F A;  3OEO A;  2M4E A;  4RD9 A;  3OA1 A;  4I1O B;  1S7Z A;  2DCP A;  2A69 F;  3MKR A;  4FWV A;  2LSE A;  3ESL A;  3ZXS A;  2WQH A;  4KVM A;  4DBQ A;  4J6I A;  1NA3 A;  5A6C A;  3L22 A;  3RRN B;  4C3B A;  3EG9 A;  3FH8 A;  2ZXO A;  5B3S C;  2CG3 A;  3Q5M A;  3CK8 A;  4GU5 A;  5FZR A;  3ECS A;  3LJB A;  3FTZ A;  4AE4 B;  3CQC B;  2A4Z A;  2WMO A;  2LAI A;  4EPZ A;  2CGE A;  3R7Q A;  5DS4 A;  4U5G A;  3UQ3 A;  3M1C B;  3FH7 A;  3LLI A;  4BJ5 C;  1D1C A;  3HHM A;  2PQN A;  5FQ6 A;  2P58 C;  3B7T A;  4WNF A;  4YVO A;  2ZXP A;  4AV7 A;  4ILH B;  4BEJ A;  3DAG A;  4I1M A;  4ANJ A;  4DVY P;  1D1B A;  5DBK A;  1BR1 A;  1WGW A;  4MQ9 F;  4C7O A;  5FCL A;  3I5Q A;  3Q7L A;  2EIN C;  4XLP F;  2WZG A;  1HH8 A;  3T5V A;  3X1O A;  3APC A;  3S7B A;  4UI9 K;  2KW3 C;  2I1J A;  4XWJ A;  3DPD A;  3JSZ A;  5EDS A;  4A3V A;  5G2N A;  3AU4 A;  3LXU X;  3IBE A;  3ASN C;  5LOZ A;  4R7L A;  2W9Y A;  4U07 A;  2PF4 E;  3FP3 A;  2UWJ G;  3L54 A;  2DYR C;  1WM5 A;  1NA0 A;  1H0A A;  3R9A B;  1SMY F;  3P2B A;  4N2S A;  3K9I A;  3K6B A;  2G62 A;  2FUL A;  4LRZ A;  2XQ0 A;  5DIZ A;  2VSO E;  4I6E A;  3W2V A;  4EWC A;  2WB7 A;  1HU3 A;  2PP4 A;  2X6I A;  4MS6 A;  2J9W A;  1ZHY A;  4E6H A;  4DVZ A;  3UT4 A;  4J30 B;  3TD7 A;  2Y69 C;  4NQ0 A;  5E33 A;  3MGB A;  3FWV A;  2OCC C;  3EDT B;  3OAW A;  1NZE A;  4GCN A;  3FU0 A;  5ANL A;  4U5B E;  4BX9 A;  3LVQ E;  1ZHT A;  4G2V A;  4CBE A;  3DZA A;  4TV3 A;  4HVB A;  5BUO A;  3APF A;  4DK5 A;  2BTD A;  1G8X A;  4P6I C;  4BJT A;  3PE4 A;  4UWH A;  4CCA A;  1UN9 A;  3S28 A;  3LYA A;  4BJ6 C;  1OCO C;  2NUP A;  2CNW D;  2IQC A;  3UMK A;  2J9Q A;  3B0V C;  4E85 A;  4DLO A;  3QK0 A;  4ANV A;  4WNG A;  1HXI A;  4MRU A;  3ZYL A;  1M2O A;  2R7Q A;  1JPN A;  1JPL A;  4FA6 A;  3S27 A;  4CS8 C;  3L13 A;  1M2V A;  3U4T A;  1XGW A;  5AJL A;  4RVB A;  5FTP A;  3RKV A;  3RK6 A;  4G26 A;  3SNH A;  4V3I A;  2KQ9 A;  2R7U A;  1QNF A;  2M63 A;  4HOS A;  1A17 A;  2MRI A;  4O6N A;  3TGO A;  4UQZ A;  2KCK A;  3CQZ A;  3CHO A;  3CKC A;  4BJ5 A;  3S2A A;  2VQ2 A;  2MOW A;  3PS6 A;  2PL2 A;  3LAY A;  3G2U A;  3ONK A;  5KYW A;  4K7B A;  3F47 A;  1MMN A;  4QDL A;  1GW6 A;  3ZVV A;  3HVE B;  5FT9 A;  3HYM B;  4H7Y A;  4APF A;  3ESK A;  4CS9 A;  2R7V A;  4PK4 A;  4TRQ A;  4DI4 A;  4MLP A;  4AXH A;  2YNQ A;  2ZXW C;  3RO3 A;  1IW7 F;  4JEH A;  5HI7 A;  1OKK A;  1LS1 A;  2BE5 F;  3SI5 A;  2XRZ A;  2J09 A;  3Q47 B;  3SGH A;  2C2L A;  4ZLD A;  3F46 A;  4GZ6 A;  4UQY A;  3FUF A;  3QNK A;  4A1S A;  4XIF A;  2R7X A;  3GOD A;  4JEU A;  1QZX A;  2XEV A;  3WXX A;  4O7G A;  4AJW A;  3QWP A;  3CST A;  3DJN B;  2QY7 A;  3EH2 A;  3LNR A;  3D9J A;  2XHE A;  3EGX A;  1ELK A;  4J32 B;  4HFG A;  4KBQ A;  4Q7C A;  4C9B B;  1OCZ C;  3CVX A;  1Z6A A;  1RJ9 A;  2VJ8 A;  4GZ3 A;  1E8Y A;  3T4R A;  3EFO B;  4BT9 A;  3E4B A;  3RO2 A;  1FMV A;  2PX0 A;  3FEY A;  5KYX B;  4B0Z A;  1TR2 A;  2J7P A;  1LKX A;  2OG2 A;  3X2Q C;  3LEV A;  2C0M A;  1UG3 A;  2IXP A;  5KYU B;  5BT1 A;  4I1A A;  4PJL A;  4JZY A;  2G3V A;  2R7S A;  3S7D A;  4BJ6 A;  3ABL C;  2X3M A;  1PC2 A;  4B8C B;  5DQT A;  5T1D B;  3CHQ A;  4L7T A;  4C0E A;  3DBS A;  4KNW A;  1UJK A;  2HV6 A;  2R5S A;  2P7V A;  2CHX A;  2Q9C A;  3CHM A;  1Y8M A;  3MLG A;  2CHZ A;  5FZQ A;  3K66 A;  1SF8 A;  3D9O A;  1VYI A;  3RRU A;  4WWP A;  4D10 C;  4N5C A;  3CVW A;  5T3T A;  2R59 A;  5G05 C;  1WAO 1;  4UI9 C;  1U3C A;  3ZN3 A;  3C98 A;  2WVI A;  2WZL A;  3GZ1 A;  3QMK A;  4E7S A;  3BG0 B;  3FUI A;  5BUZ A;  4FU3 A;  3CV0 A;  3ZHE B;  2DYS C;  4C3E A;  2AVP A;  2WXK A;  4CDM A;  4YND A;  1E7U A;  3ML9 A;  3D9P A;  2R7R A;  1E8X A;  3U66 A;  4JHJ A;  4L2L A;  5KYY A;  2KM4 A;  3P1U A;  4DOZ A;  3ZYQ A;  5CI8 A;  3MEK A;  4XE0 A;  2WQ7 A;  4H4K C;  3FUL A;  1TKN A;  2AXZ A;  5KYW B;  4FES A;  1H2V C;  3CVN A;  2I2O A;  2Y3B A;  1JPJ A;  2CHW A;  1ZHZ A;  1VOM A;  1LF8 A;  5CCM A;  3QB2 A;  3QDN A;  2WM9 A;  3CKB A;  1N52 A;  5BNW A;  3VLD A;  2WXG A;  4FHK A;  2J46 A;  2H7V C;  2LAH A;  3NYJ A;  4G7H F;  5KYN A;  1S0P A;  4BFR A;  4CGW A;  4O6Y A;  3B13 A;  1H19 A;  5T4Y A;  2WZF A;  4BTB A;  1Z5Z A;  4BY6 A;  1FVH A;  4TUU A;  2A6E F;  2XSE A;  1PCX A;  3TG5 A;  2GW1 A;  5ARG A;  2KCV A;  5AIJ A;  3RFY A;  2FBN A;  4U5C E;  3IHY A;  5DS5 A;  3AG1 C;  2A68 F;  3SP1 A;  2J0W A;  1NU9 C;  5HSW A;  3LCA A;  4ULW A;  3GZS A;  3RIB A;  4KVO A;  1ZU5 A;  3S0X A;  1UJJ A;  3SBS A;  4JZA A;  3HJC A;  5KJN A;  2I1K A;  4UQX A;  3AG4 C;  3S29 A;  2W45 A;  2LSV A;  3SD5 A;  4ACL A;  4I9C A;  2VTB A;  4OIR F;  2XRY A;  1L5J A;  1Z23 A;  3DJU B;  3EIQ C;  1E96 B;  3CHS A;  4OIP F;  4Q5S F;  3TL5 A;  4FJY A;  5KJK A;  4GYW A;  1H2U A;  5E3A A;  2FEZ A;  3I3N A;  4FC8 A;  1J8Y F;  1W2W A;  4LLE A;  3QC1 A;  1INZ A;  3WOD F;  3CK7 A;  3TXM A;  3PH0 C;  4AIF A;  5KJL A;  5G04 C;  2EQX A;  1PD0 A;  4Q4Z F;  2P6V A;  4WUY A;  2VTB B;  4EZL A;  2X6J A;  4OIN F;  1ZHX A;  4JJF A;  4PS3 A;  2L0I A;  4WNE A;  2EIM C;  4FAD A;  4AP2 A;  4AY5 A;  1IQU A;  3JQ1 A;  3EZH A;  2ZPA A;  4F7A A;  4ATG A;  1ELW A;  3FUK A;  5JHB A;  3E70 C;  4DPR A;  4MND A;  5G05 J;  3CK9 A;  4U0U A;  2WMN A;  2XPI A;  3LKU A;  3D3M A;  4E7Z A;  3RRM B;  4JL0 A;  4GEH A;  2KNH A;  1P5Q A;  5AEN A;  5BW8 C;  2V0P A;  4JPS A;  2WXN A;  4YVQ C;  2OOE A;  1HZ4 A;  3BG1 B;  1M2V B;  4KBL A;  3Q15 A;  4CT4 A;  5DLJ A;  3O4Z A;  4JA9 A;  3RJV A;  2DGJ A;  4XTK A;  5FWQ A;  2CDQ A;  3FTW A;  3EHN A;  3FUD A;  3VLF A;  4AOF A;  2MWQ A;  1MMA A;  3LLK A;  2Q9B A;  2L0T B;  4YT8 A;  4O6M A;  4F3V A;  3FDQ A;  3U9W A;  3DMD A;  2E87 A;  2Y39 A;  4LLC A;  3DD7 A;  2NUT A;  2JD3 A;  3FFL A;  3KKB A;  3LY7 A;  3CVU A;  5DQZ A;  4U04 A;  3SYN A;  3AQC A;  3EJN A;  1U3D A;  2J4B A;  4CDN A;  4UWK A;  3TXN A;  2IU1 A;  2J4D A;  4EBB A;  3NYM A;  5T8I A;  3NKD A;  4U5H A;  1EYH A;  3FUJ A;  2MHK A;  3MV2 B;  3PRZ A;  3FUM A;  1KT0 A;  4Y6W A;  3CVY A;  3Q4A B;  5FQ8 A;  4UI9 J;  4BWR A;  1TWG A;  2CG2 A;  4HXI A;  2WXF A;  2IFU A;  3B0U X;  4JHK A;  1H2T C;  1N1C A;  3N71 A;  3I4U A;  1Z6T A;  4C3D A;  4KI2 A;  3WG7 C;  5EHH A;  3ONL A;  4IN3 B;  4HOR A;  4B94 A;  2OVB A;  4DBR A;  3R7R A;  4IJJ A;  3PUJ A;  1HE8 A;  3FUE A;  3G2V A;  3ZIM A;  3W2W A;  2R7O A;  2FI7 A;  4HFK B;  4G23 A;  4U5D E;  1OWM A;  3QZC A;  1B89 A;  4L23 A;  2J7P D;  4IAO A;  3NZS A;  1ELR A;  2L6J A;  2J0X A;  1QZ2 A;  2ILR A;  3FUH A;  1OUV A;  3U64 A;  2Y4U A;  1D1A A;  1PY1 A;  2YIN A;  5E76 A;  5JHA A;  3L0I A;  2IJG X;  2BUG A;  3NZU A;  2FFH A;  2YHS A;  4EBA G;  2XCC A;  4J8D A;  2GRM A;  4OVV A;  2NG1 A;  3PEU B;  2V26 A;  1OCR C;  4Q69 A;  2YHC A;  3CZ6 A;  3ULQ A;  3ZYK A;  2Y3A A;  4L1B A;  1NP7 A;  4C0M A;  4B8A A;  1OCC C;  2R7T A;  3SF4 A;  3ABK C;  4CT0 A;  3FHD A;  4GAA A;  2C03 A;  2Y4T A;  1OWL A;  4CSA A;  2VGX A;  3L08 A;  3LS0 A;  4BJ1 A;  3CVP A;  4YT5 A;  5KCM A;  2XGM A;  3LJ3 A;  3L16 A;  3NG1 A;  3HTK C;  2PM6 A;  1HO8 A;  2YQ8 A;  4EQF A;  5T3R A;  4JJG A;  4U0Z A;  3D9L A;  4U5E E;  1BR4 A;  3HIZ A;  2A5U A;  4RSY A;  3NYL A;  4M63 A;  1YA0 A;  1MND A;  3T8M A;  4ILI A;  3N24 A;  3LES A;  4RG6 A;  4HOT A;  2YHE A;  4N3B A;  4B89 A;  4HE8 D;  3GZ2 A;  2WXH A;  2R7W A;  3PHF 2;  4IRU A;  3QJZ A;  4FUL A;  3I4R B;  5J08 A;  1M57 C;  4OIQ F;  2CNW A;  4N39 A;  3CR3 A;  4KNV A;  1XNF A;  4YT4 A;  2J49 A;  1PD1 A;  3KAE A;  2XPZ A;  3U3W A;  1KLX A;  3ZVR A;  4PH4 B;  4J0U A;  5L3Q A;  4Q96 A;  4H7X A;  4UWL A;  4LAC B;  5LFA A;  4Y6C A;  3KL4 A;  5CMY A;  3CQG B;  2VH3 A;  4XZ4 A;  1TWH A;  3ITF A;  2NSZ A;  3FDH A;  4N06 A;  2WPV A;  3RH3 A;  3I5P A;  1TWC A;  3EQL F;  2WQ6 A;  1E90 A;  3PDN A;  2BF0 X;  1KT1 A;  3B7S A;  3CGH A;  4HS2 A;  4F4B A;  4CS8 A;  4PS8 A;  3JYH A;  4YWQ A;  3EGX B;  4F1S A;  1JWG A;  5L3V A;  4O6F A;  3FU3 A;  4NUR A;  2NUP B;  3DM5 A;  4WWN A;  4LER A;  1E8W A;  4M3O A;  1D0X A;  3NF1 A;  1VYK A;  2GFH A;  2CFU A;  4GA2 A;  3LS1 A;  4RG9 A;  3FTV A;  4QFV A;  2C04 A;  3JYS A;  1HS6 A;  1IHG A;  4JW1 A;  3T6J A;  3UGO A;  2W4M A;  4QI2 A;  1N54 A;  2ION A;  1EDU A;  1ST6 A;  2B0J A;  1FMW A;  4GYY A;  5FZS A;  2Q7F A;  4W8K A;  1FCH A;  4U63 A;  4I3M A;  4I2Z A;  4LUN U;  3L34 A;  3W8H A;  4HOQ A;  1NG1 A;  2MYS A;  5FQ4 A;  2R17 C;  2WXL A;  3CVV A;  2OV8 A;  3FTY A;  1IZM A;  5D0Q D;  2E0I A;  2KZT A;  2W4B A;  4NRH B;  4G7O F;  1DVP A;  3CEQ A;  2NC9 A;  4J8S A;  4FLH A;  2RG8 A;  1NU7 D;  2UY1 A;  4CGV A;  3D9I A;  4ILG A;  2J45 A;  3QOU A;  3ZIB A;  2QY9 A;  3O39 A;  1X5B A;  1V55 C;  2V4L A;  3GYZ A;  5B1A C;  4KXK B;  3K1I C;  3ZPJ A;  1BPO A;  3D9N A;  4RDA A;  4PJN A;  4OD4 A;  3G2W A;  4G24 A;  3T6B A;  1MMD A;  4KYO B;  4GZD A;  4N3A A;  2XPY A;  2WXO A;  4GPK A;  2VYI A;  4K03 A;  2VAS A;  2D5R B;  2X6K A;  2EIK C;  4GA1 A;  3NRH A;  4JUR I;  3FU5 A;  4AX2 A;  2V8S E;  2QTV A;  5AYW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...