4JVSA

Crystal structure of lepb gap domain from legionella drancourtii in complex with rab1-gdp and alf3
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
279
Chain Sequence
b'ATPPLLQMEQEQPFPELIRTWAGLLGQIGVESVRTEEVNFGQLAKCFNDYLNTVAEHCEQQNIWQHKREENHNFFTAFKPDASKAALHGHAYIAHYKESVILRHLSIVDPKTLGMLRFAPYEAPSTDYCRHFPDSPWAKMQRLATAGQNIILQLRLIQNGQMLEDDLPVLQKALDDFMQYKTEVDALLAHDTPVSTHDSSFFYDIDEQTLNAMSGDQLATICFEELNAPHPSRLIMRILKSDSLWQEVDDSLNGDAFMGRQDDICEKRNKICQWRQLVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein
publication title Structural analyses of Legionella LepB reveal a new GAP fold that catalytically mimics eukaryotic RasGAP
pubmed doi rcsb
source organism Legionella drancourtii
molecule tags Hydrolase activator/protein transport
total genus 88
structure length 279
sequence length 287
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4jvsA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jvsA02
4IRUA 4I1OB 4I1MA 4JW1A 4JVSA
chains in the Genus database with same CATH superfamily
4RD9A 2X0CA 1RJ9A 2JABA 5AYWD 3Q5MA 3RQFA 3SBTB 5E3AA 4UWGA 3APCA 1N4QA 3UINC 4L6RA 2CNWD 3T4RA 1BLXB 4ZHBA 4HOSA 4KC9A 4WUYA 2AW6A 2X38A 2HV7A 1H9GA 3Q4AB 5CEDB 3Q75A 5HKPA 3CHPA 2R03A 1N0QA 2B6CA 5COGA 2PNOA 4IGGA 3UIPC 1U2VG 2XLEA 4YNDA 3AG4C 2QLAA 4DX5D 2XZTG 3CEXA 2KBXA 4U5BE 2HMZA 3N71A 3ZRHA 4MQ9F 2XLVA 4BJ1A 5AENA 1VB5A 256BA 4G1TA 3EQLF 2LP4A 2GRMA 2EIME 2GDCA 5BQIA 1Z5ZA 3U66A 1TNOA 2AWIA 2IY0C 4GU5A 1SW6A 4UWKA 1HS6A 1YDIA 5A69A 3FU0A 3AG3E 4TUMA 4N6CA 4DVZA 3B13A 3CK8A 1EPUA 4AM9A 4Q4ZF 3S90A 2XEHA 4KVMA 5A7DB 2R7TA 5ARFA 4DBRA 2KNHA 4O1PA 2L7AA 2HSBA 2H7OA 4XEVA 5EILA 2W4MA 1C02A 5KYYA 2X6IA 4ACLA 4BFRA 4C7OA 3HXEA 3AG4E 4RG9A 4XEKA 5F28E 2H7VC 3V7OA 3QKYA 4GYWA 3RIPA 3AAAC 2XLMA 1DCQA 1HY5A 3T6BA 3IEGA 3ASGA 3CVQA 2OEWA 2OOCA 4AP2A 4CX9A 4JKVA 3B0UX 4YVQC 1H2TC 4U0SA 4U9DA 3QZCA 4U8YD 4EBBA 2UWJG 1PCXA 2A0UA 4XLNF 4MTGA 4EBKA 4D4NA 2EPNA 1FCHA 2CG2A 3V5XA 4O6MA 3UNGC 3LY7A 1KU2A 4NACA 3SD5A 1SVXA 1MX4A 3MKQB 1KPSB 3ZVVA 3EFOA 3NMKA 1LE2A 2X3MA 1XGWA 5FZTA 1P5QA 5ITZF 4E17A 4OIPF 4F1SA 2Q9CA 3V79K 1OXKA 1I5NA 1LIHA 2E0IA 3B7UX 3FUDA 1H7IA 1DC2A 4BEMJ 2I2OA 1N54A 2V5FA 4XEIG 3M79A 3FUMA 3C8GA 5LCWJ 2V8SE 1RW2A 3WODF 3G4XA 2QYUA 3ITFA 3TWXA 2EINC 1T6UA 2XSEA 3ZHEA 2P61A 5BV1A 1FMVA 2RKKA 1GS9A 4RLYA 3MYFA 3NBNB 2P9IG 1M57C 4IN3B 5KBAA 1WAO1 1MQSA 4A3TA 2PFDA 2J9VA 2Y39A 3DSUA 3RF3A 3U9MA 2A6EF 4IULA 5A23A 3DPYA 2UY1B 1YZAA 2NUPA 1TN7A 5CBNA 3CHOA 4N4WA 4OD5A 2OEVA 4U5HA 4XIFA 4CEMA 5CECB 2RD0A 4LCTA 2WMOA 2VTBA 2ZXRA 2LAHA 2EIKC 2OJED 3DE8A 4RDAA 2O9XA 4G7HF 2LFDA 4GA0A 2XS1A 3S7BA 2IYLD 1TQGA 3BEEA 4DI4A 4EZKA 4FAPB 2YHSA 3FUEA 3EIQC 4GAAA 2NUTA 1SR2A 2DB4A 1RCPA 2EILC 3L6AA 2ETSA 4BERA 2XXAA 3E34A 4FLHA 3MLGA 4EZLA 1RKEA 1WASA 1WTYA 3FOPA 1VTMP 2KCKA 1S63A 3T9KA 2IU1A 2Y69C 4J7TA 2HUJA 3S7DA 4TXRA 3ABKE 4Q94A 2LAIA 2HJ3A 3DSXA 5HQ8A 5IY5E 1K3ZD 3QARA 5F5HA 2P58C 1NA3A 3U4TA 3SXKA 1K8KG 3NG1A 1V55E 3QOUA 4K5AB 3JYYA 4ILGA 3JSZA 3SFYA 1H9TA 2MHKA 4M7CA 1J8MF 4CDAA 2XLDA 2QY9A 2OCCC 3K6BA 4XPXA 4J32B 4PFPA 1YA9A 4DX2A 5L0DA 2RD9A 2GFHA 2WB2A 3IQ5A 3UT4A 3QC1A 3ASOE 1BBHA 1QSPA 1JCSA 3MV3B 3JQ0A 4J8YA 1YCSB 4DLQA 2P9NG 4TUUA 3DE9A 4JJFA 3FOOA 3U3FA 1ZW2A 4JPSA 4OAUC 2CCYA 1BR1A 2I8BA 1Y6DA 1ZBPA 3VTXA 3DAFA 2ZD9A 3CKCA 3SQVA 4YN0B 4E85A 4J8DA 4AE4B 3T8MA 1KZOA 2ILRA 3GM1A 4FC8A 4U96D 3RKVA 1INZA 3D3MA 3DMDA 4JA7A 1R5ID 3UGPA 1U6HA 3UUXA 1NBBA 2L6GA 1TNBA 1D0XA 2OCCE 3IHYA 1N4RA 4GMLA 3LUTB 1U3DA 3FTWA 1BZ4A 3D9IA 4HXIA 5LOZA 1TJCA 4DXWA 2MRIA 1Q0MA 4ATGA 2R7WA 4CSAC 4DRJB 2CHZA 2J7PD 1KT1A 3DKAA 3TOLA 3LY9A 3LS8A 2YKZA 4G26A 3K1IC 1R4TA 1L7CA 3I4RB 2ZGGA 4O7GA 3VM6A 3L16A 4ANWA 1XZQA 4O60A 5BPPA 4DBQA 1C03A 3ESKA 3AQBA 2J9UA 4EZJA 1VK5A 4GMRA 3T6GB 1OR3A 4U8VD 1SA4A 2IQCA 2XQ0A 4U5CE 5ENQD 2NG1A 2XS8A 2L6JA 4BX9A 5JP7A 3VLDA 1UFBA 5ENSD 3TGOA 3LYAA 1FPPA 4YL0A 4CBEA 3G4ZA 2HV6A 3EG9A 3S27A 3GEEA 2QUPA 2OU6A 5JRAA 5CCLA 3FTVA 3PNLB 3CLJA 4XLPF 5EHHA 3LJ3A 3DSSA 4CS9C 4DJ9A 2VGXA 3ABLE 4LLEA 3GANA 4BG0A 4DI3A 4ZFHA 3ASDA 3GW4A 4CGVA 4WNFA 2WQ7A 4I43A 4A1SA 3I5QA 4OYSA 5BUZA 2Y3DA 3R2PA 1ELKA 3LJNA 1VMAA 5FZQA 2HJMA 2M63A 3NRHA 1OCOE 3O48A 3Q6NA 1TWGA 3RH3A 4B6IA 3DEPA 3QB2A 5HS0A 1ZZPA 3HDXA 3L8JA 4BTBA 1M2VB 3EH2A 4P9TA 1LTXA 4I1AA 2LUHA 4BY6A 3PZ2A 5EX3A 3U3BA 3NYMA 1E85A 3IV0A 2OJQA 3FUJA 4HRMB 1JCQA 1RXQA 3NYJA 5D66A 4NURA 3IQ6A 1EA8A 2L0IA 2VB6A 3BG0B 3A9CA 5JUAA 3JRTA 1ZW3A 5B1BE 4FA6A 5KNGA 3EGXB 2A69F 3EU9A 2D5RB 5KYWA 2JEKA 2WXJA 3W8HA 1LF8A 4IAQA 3PS6A 3PE4A 3PH0C 2NXPA 1U89A 2KXPC 2J8SD 4TV3A 3EZHA 5T4YA 3MKQA 5DLJA 2AVPA 3TK0A 2MYSA 2E87A 3V2OA 5FQ7A 3TQOA 1EI7A 5JT4A 2P9KG 4H7YA 1IYGA 3HIZA 1JPJA 4IAOA 1M2OA 2VCAA 3PZ3A 3SHFA 4OD4A 2VASA 2C04A 2W45A 2H7BA 3DSTA 1OCCE 3IBEA 3FFLA 4FHKA 2R7OA 5CRUA 2E2EA 3DJNB 4GZ6A 3FTYA 2FAPB 1E8WA 1UJJA 4CJOA 3GEIA 4CT0A 3EUVA 3TG4A 1EKYA 4URKA 4EPZA 4KXKB 1NLXA 1H2VC 1TR2A 4I1OB 4OVVA 1OUVA 1HG5A 2KGOA 4E18A 4CSAA 4F53A 1HXIA 5AJLA 4YDEA 2V4HC 3VLFA 2YQYA 1S64A 2MYOA 4XPYA 4O79A 3AU5A 1O1RA 2HFIA 3K1IA 4MVUA 4O6FA 3FUNA 4BJTA 2HSQA 3ECSA 5EIBE 3QW1A 3ZEFA 3KPHA 3GORA 4GCNA 2WXKA 1ST6A 4X8QA 1BI7B 3KYIA 5EYLA 3S2AA 4Z9JA 4MW8A 3DXJF 3NYLA 3FUHA 1HMDA 5G04J 5A6BD 3LAYA 1O1TA 3APFA 2R2LA 3JRMO 4DUIA 3ASNE 1Z3IX 3GZSA 3VF0A 3JTLO 4CDVA 5KYUB 1IZMA 3FWVA 2YINA 4G2VA 3UMHA 3CQGB 1VOMA 4PS8A 3DZAA 4KNVA 1NU7D 2A5UA 3D9PA 1JMWA 2WMNA 3FH5A 2PBEA 4F7AA 3D9JA 3LVQE 1VLSA 2AXUA 2FI7A 5AIJA 5B3IA 1QYMA 2VSOE 1S70B 2ASRA 4CS9A 4LNUD 4F4BA 1OCZE 3FTXA 5H7PA 1OWLA 1A17A 2EIJC 1QPUA 5JJTA 4GEHA 4JC7A 1XZPA 3GYZA 3L13A 4HFGA 4KZCA 2HE0A 2X6JA 5CRVA 2BKKB 1MNDA 3PDNA 2XM0A 2KJGA 3FAPB 4EECA 1TFKB 4YL3A 4ILHB 4JD2G 2HZ8A 5AC5A 3PREA 1OWNA 4GTSA 3WAQA 1FTSA 4V3IA 2JLBA 2GGFA 4PACA 3R7CA 1YAUO 3E30A 4X0RA 2VQ2A 3AG1E 4J8EA 4HI8A 4J7YA 3ZYKA 2IOSA 1YA7O 4JEAA 4ZLCA 2WB7A 5KJLA 2XRZA 1H6PA 5AQ7A 4GB9A 1XWJA 5BV0A 2HYZA 3X1OA 4UQZA 4I3MA 2F8YA 3QK0A 2LSVA 3AQCA 2P9UG 3DXMG 2LQGA 5BW8C 1HZ4A 4WNDA 4GZCA 4EUKB 4DPRA 1HG2A 3ZQYA 2EQXA 4HOUA 4AE4A 4HRNA 2EIJE 1E96B 3LNRA 3K33A 3TD7A 4B89A 4N3BA 3U9WA 4QI0A 5JLIA 3C3RA 4U5GA 2P1AA 1M56C 4PJJA 3U8VA 4FADA 2XGSA 1JWGA 3ZUVB 3T6JA 5KYNA 5CERB 2R9RB 3HHMA 3N24A 3PEUB 1MNEA 3AGUA 4GZDA 1PD0A 3FDHA 4BWRA 2W9YA 2YWAA 4CYMD 5M72A 2ZXWC 4QQIA 2VGYA 2J9BA 4JIOA 1SZIA 3QJZA 4XWJA 2J45A 3DSWA 4U7EB 4LDKA 1GM5A 5ARGA 2WVNA 2NSFA 2Q7FA 4HVBA 1Q0KA 1E90A 2Y0BG 3FU5A 4L1BA 2XPIA 4MVZA 4DX6D 3EGDB 3NZUA 3RRNB 1Z63A 3RKOF 3C5RA 2NYJA 3LS0A 1CGME 3H2VA 4O6NA 3ZNGA 3ABME 4CS8C 2F8XK 1OCRC 2P0NA 1DOWA 3EIJA 3DWLG 2C2LA 1SZ9A 2DYRC 2WZFA 1FAPB 2XM4A 2I1JA 2KZTA 4PH4B 3U3WA 2ZIRA 3L0IA 3CV0A 5FINA 3T5XA 3UPVA 2A6HF 3TJ5A 3ZWIA 3PUKA 2P2CP 4EKWA 2V5QC 4N6HA 5L0CA 2VH3A 2JPUA 3B9QA 2J49A 1JCRA 4G78A 4HOQA 3U5SA 3ZPJA 1HE1A 3C18A 3QAQA 2KW3C 4AX2A 2XRYA 4BTAA 1YYHA 1FFHA 1E84A 2FF4A 3AS8A 1N11A 4J30B 5COFA 2DGJA 1OCRE 4E0IA 1QNFA 3R7RA 1NFNA 1LS4A 4EBJA 4DRXE 1MYOA 4JE9A 4XQ1A 2DYRE 3E33A 4UI9J 3T8KA 5CBOA 5FZRA 4KYOB 3RW0A 3TAXA 3L82A 4F3VA 4JC8A 3L17A 3EU5A 4Y6CA 3TOMA 3GWNA 3PEVB 5C2YA 2BF0X 1MMAA 3M4BA 1M2VA 1V54C 2WQHA 1QZXA 3SZRA 1PAQA 5KYXB 3B95A 3NZSA 4A3VA 5HSWA 1SMYF 2ZGDA 3L08A 3HYMB 3CVVA 4N5CA 3UTMA 1WATA 1G4US 3PDMP 2P9SG 2J9WA 1KNYA 2WVIA 2ICWG 1X81A 4HBDA 5C1DA 2Y3GA 3U2LA 1QQEA 2CNWA 4LLCA 3K66A 3B0VC 3W4YA 4RQIA 3I5PA 1T5OA 2DIWA 3ULYA 3EGXA 1UW4B 3ZGQA 4AEZC 4PDXA 4NTFA 4DOZA 1A7DA 4JEHA 3G2TA 3X2QC 2XRHA 4IRUA 5G05C 1K04A 1EF1C 1N95A 1FVFA 1KTMA 4GTOA 4CIHA 3OTNA 3TJPA 3CEQA 4PJNA 3CSTA 2BL2A 2KYHA 1H6OA 3EHNA 3EHMA 2XPYA 3QVYA 3F6QA 4PS3A 3ZYQA 2Y3AA 4CRWA 2ZXOA 3VTYA 5D0OD 4NRHB 3CHQA 3FMSA 1V54E 5AARA 4XPWA 4U5FE 2DBAA 3AS5A 4I2ZA 3HNKA 4Z9IA 1MHQA 1GQAA 4OVUA 3RAUA 5A6KA 1D8DA 3ATPA 1LPEA 1BD8A 3C98A 4GTTA 1OR2A 2MOWA 2MHRA 2Y3HA 1KZPA 2JD3A 4MTFA 3AU4A 3LXUX 5JHBA 3KKBA 4MNDA 5JJ6A 1MX6A 2L6FA 4FU3A 4R7LA 3CVUA 4N06A 2CG3A 1LE4A 3X2QE 3GEHA 1GGQA 2M64A 3HKKA 2DZNA 4GQHA 1JPLA 4XKCA 2IOQA 2IM8A 5TJ5E 4GYTA 2EINE 3RRUA 3FEXA 4HEAJ 3T5VA 4YL1A 4PJMA 3TWVA 3FXHA 3UT7A 4A55A 3RQEA 2H8AA 5FT9A 3L54A 3BG1B 4CS8A 2PX3A 5AAOA 1A7VA 3NDBB 2J9QA 2XLOA 2C03A 1BU9A 2PQRA 5B3SC 4FULA 3W8IA 3UKUG 3TWSA 1JR8A 4GTVA 5AGFA 2FO7A 3FTZA 4BJ6C 1MMDA 2V26A 5KYUA 2R02A 1L5JA 2EIKE 2CGEA 2OOEA 1S7ZA 3PZ4A 4MVMA 1BR2A 4GCOA 4H7XA 1T6IA 2YEVA 4EIYA 4G8LA 3RJVA 4OINF 1TWAA 4HOTA 4DX7D 4BJ5C 3TXNA 3VAYA 1TEZA 3DI5A 2EILE 4H54A 3D9LA 4EWCA 4FJYA 4I6JA 5EKQD 2GRQB 3EDTB 1N52A 3LEVA 4GPMA 5AJDA 1LI7A 4WABA 4LDRA 2Y69E 4EQFA 5DS6A 4JVSA 3LEOA 3SP1A 2KSFA 4WWNA 4U9EA 4CT4A 4HLEA 2IO2C 5A6AA 1FVHA 3SXMA 1W3BA 4B94A 3HLZA 4AY6A 4MVRA 1E8YA 5DS5A 1MJ0A 2V4LA 5L3QA 1LI5A 2QC9A 2PX0A 4B93B 2WM9A 3DXKG 1IQUA 3PRZA 3MGBA 4NTAA 3ULQA 2YLIA 2DCPA 2FFHA 3RRMB 4YDYA 3W9GA 2Q4FA 1YARO 3V2XA 5JS5A 3AJMA 1XNFA 2P9LG 3ENEA 2WQ6A 4QFVA 1S05A 3ZSUA 4UUCA 3UM1A 2FULA 3GM2A 3MYVA 3A11A 2EPLX 4J6IA 3R9AB 1RJ9B 3PHF2 4JURI 5JJ7A 3EPVA 1TFOB 1VLTA 2ZU6B 2AJAA 3CGHA 4PUCA 3ONKA 3MJWA 4D10C 3FHDA 3MEKA 5COMA 2IXOA 3CVLA 5KJNA 4C48B 3FP3A 3R9MA 2LFFA 4GTPA 4K5BA 3FAJA 3SYNA 5E75A 3CZ6A 3FUIA 4UQYA 4BESA 5D91A 2VCCA 5DBKA 1C17M 3IEEA 3PZDA 3D9OA 3MKRA 3G2UA 3CIAA 3EGDA 2X6FA 3TWQA 4U0UA 2XL4A 3U2MA 2GA0A 3S84A 3SFXA 3UGOA 1B68A 4RBNA 3Q78A 1ZHYA 4YVOA 3AJIA 3V31A 4N3AA 2H6GA 4K0DA 4ANXA 2I1KA 5B1AC 2ETCA 4ANUA 3K1HA 4K0RA 2FO1E 3DWWA 2J46A 1YMPA 4MLPA 1OWPA 1E8ZA 1ORJA 3MX3A 3PUJA 4AOFA 1NZEA 1DNPA 3KD7A 5KYYB 2KCLA 3D9HA 5T3RA 3JCKC 4JW1A 3M4CA 4ZLDA 1G4WR 2A4ZA 2IJGX 2ZISA 4UQXA 3SXYA 1YYXA 2BC5A 1WM5A 2OKUA 4JCZA 2AP3A 5FCLA 2CHXA 1LKXA 4BJ6A 5EYPF 3D9KA 3HNJA 1FT1A 4XI0A 3GZ2A 3SFZA 4I2WA 1OW8A 4NCQA 2KCVA 5ANLA 1PC2A 3OXFA 3D9NA 4J8SA 1QBQA 3DM9B 1H6GA 3IHUA 3JCUQ 3LLKA 4BPMA 1DVPA 3LDZA 2LXMA 3OEOA 1V4AA 4HLLA 4BJ5A 4MW3A 3UR3C 2J7PA 5JMND 1DOVA 2YLDA 3SXZA 3U8PA 5KYXA 4QDLA 3EFOB 2XCCA 2Y4TA 1N94A 5L0GA 1N9AA 4XE0A 1TJFA 2R5SA 3RO2A 4G23A 5JVEA 1CGNA 3J06A 2VYIA 4LNGA 4NY3A 1JWFA 3TWTA 4OIQF 3L34A 2NSGA 1SF8A 4JJGA 4JTDB 2VCBA 1Y8MA 3U9JA 5E2QA 4MS6A 3ESLA 1Q2ZA 4EBAG 3AG2C 4F1PA 4HB5A 4XX5A 2LO6A 3C8GB 5EK0A 1JRAA 5L3VA 4APOA 3ZXSA 2CYDA 4NIKA 3S7JA 1Q0DA 2FEZA 1UG7A 3TWUA 4E0HA 3SY2A 4DJAA 3CQZA 2VSNA 4HS2A 1IXVA 4JHJA 2B0OE 2DYSC 5FQ6A 3HXDA 4AXHA 2WVOA 2NUPB 5FQ4A 5AC4A 3HTKC 1E8XA 2PF4E 1S0PA 5L0HA 1YLMA 4QI2A 1TNZA 2UY1A 3G2WA 4FJZA 5KNHD 3V30A 3Q47B 3MYIA 2WXLA 4ACKA 4N2QA 3MCXA 2IF4A 4FHJA 1AWCB 2VTBB 2KATA 5LP0A 3BU8A 4HQDA 2L6BA 1HE9A 2CHWA 1WWPA 1W2WA 3M1CB 4E7ZA 2GRNB 3WG7C 3SNHA 2GAQA 3Q73A 2R7QA 3US6A 4I6EA 3HVEB 2NUTB 1D8EA 5FWQA 2YVKA 2OV8A 2XXAB 3ML8A 4JA9A 3WHNA 4C3BA 4P9FA 2DYSE 1T6QA 3TG5A 1HW2A 4BEJA 1H0AA 1PY1A 3UX4A 3DBSA 3HXCA 2CFZA 2ETBA 2V0PA 1IKND 1QVXA 2F22A 2YL1A 4BT8A 5EIDA 4ATZD 4LSZE 3ZIBA 3KL4A 4Z68A 1Z3YA 4O6YA 3RIBA 4HI9A 2RFMA 2Y3BA 1FR0A 4MVQA 1UN9A 2TMVP 5AQBA 3JZ0A 5KCMA 1NG1A 2G3KA 4AK9A 2IBFA 4MS2A 3V5ZA 2WPVA 4E7SA 2RFAA 2WXMA 1HH8A 2H6FA 2HS5A 1FT2A 3EHRA 1U3CA 5CEAA 3N0TA 3TL5A 4JHRA 4B0ZA 2WXHA 1OW6A 3UMIA 3EJNA 1NP7A 2H6IA 3P1UA 2J08A 3KMIA 2IONA 1BI8B 5AQ9A 3UMKA 1G5ZA 2EPMX 2F0YA 3G2VA 5FZSA 4AJWA 2LSEA 3L22A 3G50A 4YT5A 3CHSA 3UI2A 2Y1LE 1WY6A 2WZLA 2XGMA 3ZXPA 5DIZA 3NQPA 4CIPA 3E9VA 1SA5A 5DQZA 5G05J 1G3NB 2WXRA 2XL8A 3TWRA 5L0FA 4I9CA 4L2YA 4KBLA 3S28A 5HI7A 4GTQA 3M15A 2VJ8A 1ZHWA 4M63A 2WXPA 2R25A 2WXQA 3JSEO 5JA4D 2WXFA 1D0ZA 2PM7A 1QZ2A 3D9MA 1Y6IA 3FU3A 3O6XA 2IOLA 3MA5A 4IWBA 3ML9A 2JX0A 2A68F 3ZQVA 4OAVB 1ZU4A 4G0HA 1D1BA 4JL0A 3VLEA 1WGWA 1HU3A 4CGWA 5GPGB 4A4AA 5J08A 4GTRA 3BEHA 5A6BA 4C0EA 2EIMC 2CFUA 1Z6AA 4Z9HA 4J8FA 5ENNA 1NFOA 3KYJA 1AVOB 3UM2A 3QW0A 1B89A 2AU5A 1K1BA 2KQ9A 1NFIE 3C72A 4PS7A 3HG0D 3AG3C 2LIGA 3TULA 3AGTA 4K5CA 3RK6A 4DRIB 1AUEA 1RMVA 1OKKD 4N5QA 4CDMA 4W8KA 2LNIA 1SQMA 2GRRB 2CW0F 2EPOA 1OY3D 2HM8A 3HNIA 3HJCA 2WVQA 2XL6A 1JUQA 3AS4A 3C8GD 3QDNA 1WG0A 1EDUA 3C8ZA 3EG9B 2R7XA 1I4ZA 4WAFA 2HKVA 3E4BA 3JXJA 1ZYRF 2WXOA 3FH7A 2ZXWE 2PZIA 3W2VA 1APCA 5ENPD 3JT1A 2VGXB 4U63A 4JTAB 1X5BA 2P9PG 3U0CA 3OXGA 2WL8A 3PNTB 1D1AA 2EPKX 3C63A 3SO8A 4DLOA 3W9FA 4AL1A 5BQHA 1NI1A 3DJUB 1T9KA 4CDYA 4ULVA 5G04C 3RSEG 4Q5SF 2IEJA 2YNQA 3J5PA 1A5EA 3J5QB 3FULA 1HO8A 3JYSA 4W9RA 3ULEG 3CVWA 3KSQA 3EH1A 1GW6A 3Q49B 3OWTA 1ZVZA 1UN8A 4DRHB 1OXBA 2X6KA 4OIRF 5EN5D 3ZVRA 4WGYA 4AVXA 1YA0A 4HFFB 2LSUA 1EYHA 4JEUA 2ETAA 2QZAA 4YK5A 4HORA 3RU0A 2IO3C 2J0WA 5L0JA 2V3CC 3PMRA 2QNLA 1LVKA 3C7JA 3E70C 3LESA 1HMOA 3CK9A 3MFNA 3LKUA 2LCHA 2YL3A 4A1GA 3SZ7A 4U8HA 5A6CA 5KJKA 4N2SA 3O39A 1D9SA 2XEEA 3PZ1A 5KYWB 1TN8A 4U5EE 2DVWA 4LACB 3U64A 4Q96A 1O87A 3L8IA 3CHRA 1Q0FA 1K40A 4P6IC 4I9EA 1FFTC 2YL7A 4XEFA 5FQ8A 2XEVA 3Q7FA 2GROB 1OW7A 1ZHXA 4OIOF 3DD7A 1D0YA 3SF4A 2FGYA 4A2NB 3Q7LA 4IB4A 1LD7A 1ZU2A 4L23A 4I1MA 3IXEA 4ILIA 1KLXA 1N0RA 3IQTA 1E7VA 1IHBA 2YHEA 4LERA 1OKKA 3IPMO 2RG8A 1OQCA 4O1OA 4WWPA 5JHAA 4ONSA 1TWCA 5CCMA 2R7VA 3ZU7B 4GMJA 4JRZA 2R17C 3CSFA 4LUNU 1BR4A 3CQCB 4BT9A 4YDOA 4RSYA 3QWVA 1Z6TA 1HX8A 5EGYA 3B7RL 4ANVA 1N4SA 5LFAA 4RVBA 5ENTD 2FBNA 3FHEA 4H4KC 3L9TA 4NQFA 3RVYA 4FX5A 5F5FA 4B8CB 1EQ1A 5E76A 3BQOA 1ZB1A 4U5DE 1IHGA 2XCBA 2QFCA 3KSLA 3GODA 3E37A 3MV2B 3ABKC 3TJ6A 4KMOA 1Z7Qc 4Q69A 1U0BB 2OG2A 3NOGD 4PJLA 5IY5C 3CVNA 4C3EA 3LPZA 4AIFA 2G62A 1E2XA 1A41A 3FY4A 3B71A 1V55C 1TR4A 3CHMA 2GRPB 2WZGA 5E33A 1MX2A 2A0BA 2XENA 1O1SA 3MBGA 2VSXE 3UQ3A 2L6HA 4CDNA 3HVEA 3ISMC 4GYOA 4LRZA 4YWQA 3NOCD 2QY7A 4MBGA 4ABNA 3LCAA 2Q9BA 2I9CA 2X51A 3ASOC 4CDRA 2RSEB 4CS7A 4BSXA 4J7WA 3CAXA 4FESA 3CR3A 3DEOA 4F6RD 3QNKA 4GTMA 3N2ZB 5DS4A 4RG6A 3ZYMA 5CMWA 3LY8A 5EDSA 2XHEA 3JQ1A 3T9OA 1CPRA 1CGOA 1MMNA 4G7OF 4KNWA 4AL0A 4CJGA 2C0LA 4N3CA 1TN6A 1JPNA 2F37A 3OXLA 2B0HA 4TRQA 3S7FA 5CI8A 4TXQA 2QTVA 3Q7AA 5FTPA 1J8YF 1TNUA 3NB2A 1NL4A 4BX8A 3UXGA 5KWDA 2YZSA 2P6VA 3HXBA 1NSGB 2YHCA 3ZN3A 5HV9A 3RYLA 3LS1A 3FU6A 5DQTA 1G8XA 3O10A 1WN0A 5B3SE 1FMWA 5BNWA 3LEWA 5K0IA 3NAWA 4ULWA 2AWCA 2VC9A 2PL2A 4UI9C 2G3VA 2ZPAA 2X6HA 5CHEE 1MQVA 1LS1A 1Y4CA 4NQ0A 2L9JA 1YYJA 3C3OA 4YT4A 5ENOD 3Q9NC 2OVBA 5G2NA 3DSVA 3IHVA 4KI2A 1ORYA 1TNYA 5ENRD 1ORSC 2AWYA 3KEZA 4Y6WA 1M6TA 3O55A 4IJJA 1TWHA 1NU9C 2CDQA 4K7BA 4WGZA 1E86A 1MMGA 5L0IA 4I17A 2YRFA 4MVOA 4A63B 4FWVA 3FUKA 3C3QA 2XGOA 1I4YA 3Q79A 4GYYA 1O5HA 2AXZA 4EHMA 4XKBA 5A6JA 3K9IA 5LCWC 3TWWA 3UMVA 4UWLA 5KJMA 4BSZB 3JUIA 5D0QD 4U95D 3ZTMA 3ZFWA 3R7QA 4EBAA 2XZDG 3JXIA 1H6KA 1LD8A 4W8PA 1K1AA 4KBQA 3B0PA 2QYJA 3ABLC 4L9PA 3G2SA 1Q0GA 2A5EA 4UWFA 2IXPA 1E7UA 4BEPA 3FEYA 2D4UA 4U0ZA 4LG6A 3B29A 3ZKJA 1Z5SC 3NMJA 3JYHA 2GRLA 4IYPA 2IXMA 1OCOC 5T1DB 4GA2A 1NA0A 2KZTB 4NC3A 2DZOA 3Q7GA 2KC3A 3B7BA 3H2UA 4WWOA 2R59A 1DCEA 4AV7A 4JEBA 5FJYA 4C9BB 4FLBA 5T3TA 2NC9A 1VYIA 1N4PA 4G24A 4G8KA 3URZA 3LNMB 3SI5A 4MTOA 1QKRA 1A7EA 4AY5A 3NF1A 4CZ2D 1T01A 1SZAA 1OT8A 3QWWA 1KT0A 4C7OB 3TXMA 1E83A 2L81A 4JZAA 4XI9A 5BXOA 2QE9A 5BQGA 4JB8P 2DWZA 5B1BC 3IQCA 4ANJA 3F47A 2BE5F 4ER9A 1YVIA 4JXTA 4BETA 2PP4A 2J07A 4G25A 4LDQA 3POVA 2KC7A 3S29A 1LM3B 3ZC4A 3DPDA 4PK4A 4UI9K 5AQAA 1H19A 4FP7A 2KM4A 4N39A 2AVKA 3Q9UC 3BUAA 1QQ3A 3UM0A 1RKCA 3QVZA 4GZ5A 3QMKA 3HXFA 3APDA 2ZXPA 1H2UA 5B1AE 4APFA 3KS2A 2P7VA 5G55A 1OCCC 3UM3A 3B7TA 2OVFA 2I15A 1WOLA 3UIOC 1VYKA 3RQGA 4YT2A 4U04A 2HMQA 4GPKA 4U07A 3NKDA 4D4XA 2LXLA 1ZU5A 1YJGA 3Q6MA 2BEDA 3ZDLA 4GA1A 4KT6B 3SGHA 3KH2A 2R7SA 3K7DA 3I4UA 2L0TB 2HO1A 2B0JA 4G11A 4JZYA 4WJ0A 1QLEC 2L9BA 4WNGA 2J09A 3E32A 3SEOA 3ZIMA 5CI9A 3RVZA 2W4BA 3S9OA 3ZHEB 1O3UA 1V74B 2YL0A 3QTHA 3O4ZA 2DI3A 2R7UA 2NPUA 3CVYA 3ZW3A 1L3PA 5ANRA 1IW7F 2C0MA 1HW1A 4DVYP 2WXGA 2Z15A 3CK7A 4HE8D 2YLGA 4HNAD 4LNBA 1JOGA 2IFUA 1TKNA 3FH8A 3Q15A 5J90A 5BUOA 3ASNC 2WXIA 3ZG1A 4PR9A 1VDYA 2GWWA 2J0XA 3ONLA 3BRJA 3CKBA 4I44A 3GZ1A 1OWOA 4IARA 1IQRA 2UUIA 3V5YA 3FDQA 3CVPA 2R05A 3VYWA 2NSZA 3HRAA 3OAWA 3ASFA 3QWPA 1RZ4A 4L7TA 2GW1A 2VSYA 3JUEA 3AG2E 5E3CA 2H6HA 3DM5A 3HNLA 3DRAA 1OWMA 4YT8A 2IXNA 2Q7RA 1F1MA 3FTSA 4MRUA 1ELRA 4EHPA 1HFAA 4YDWA 4DK5A 3VRCA 4C3DA 1OCZC 4KVOA 4UWHA 1N1CA 4R32A 2UUHA 1RKEB 3CSKA 3P2BA 3NKEA 4KZ0A 5BXUA 4MVSA 3UKRG 1TYQG 2MWQA 3PCVA 4B8AA 5T3WA 1K05A 4TXPA 3C62A 3AOUA 3I4GA 5D92A 1PD1A 1BPOA 4JTCB 1O5MA 1UJKA 3FUFA 1JAFA 2LK4A 2J4DA 3GM3A 1ZHZA 3EHQA 2WXNA 3SBSA 4CCAA 2LD6A 3AG1C 2Q00A 3WXXA 3FVYA 3S0XA 4HFKB 2Y4UA 3GWLA 3F46A 4YJWA 3WG7E 3H65A 3KEAA 3I3NA 4J0UA 3PVLA 4Q7CA 3UT8A 4G7ZF 3W2WA 2BKGA 4NTBA 5CIVA 3PE3A 2OEXA 3B7SA 4E6HA 5AN8A 5EX0A 3ZTZA 5T8IA 5LX8A 2PQNA 3MZLB 1NZNA 3L1MA 5D2MC 1AEPA 4DX1A 4PFOA 1MZCA 3FTUA 1FNTc 1ZHTA 2HR2A 2VGEA 4I6GA 1YZCA 3RO3A 1CPQA 2R7RA 3OA1A 5CMYA 5JSLA 3LJBA 4K1OA 1UG3A 2ONDA 1BDJB 1HE8A 3LLIA 4UDVA 2XPZA 4P29A 2BTDA 4ME2A 5DVWA 4MKTA 1OXJA 1ELWA 4LEUA 2Q3TA 2KK1A 1HF8A 4JHKA 1UOHA 1AP7A 1Z3XA 2AXVA 2XLWA 2J4BA 3RFYA 4XTKA 3ASHA 3LVRE 4K03A 5BT1A 4HRLA 2YQ8A 4JCHA 4C0MA 4M3OA 1D1CA 2Q9AA 3NMIA 2M4EA 4WNEA 4GZ3A 4L2LA 1PV3A 2A1DD 1A0BA 1WDYA 2PNNA 1SYQA 2J8WA 2BUGA 3DAGA 3ABMC 2XLHA 5HRYA 2I6HA 3IKOB 3EZIA 3KAEA 4XZ4A 1Z23A 3SNXA 3ZYLA 3CVXA 5FIOA 2PM6A 2OQMA
chains in the Genus database with same CATH topology
4RD9A 1RJ9A 5AYWD 3Q5MA 3SBTB 5E3AA 4UWGA 3APCA 2CNWD 3T4RA 4HOSA 4KC9A 4WUYA 2AW6A 2X38A 2HV7A 3Q4AB 3CHPA 4YNDA 3AG4C 3N71A 4U5BE 3ZRHA 4MQ9F 4BJ1A 5AENA 4G1TA 3EQLF 2GRMA 1Z5ZA 3U66A 2AWIA 4GU5A 4UWKA 1HS6A 3FU0A 4DVZA 3B13A 3CK8A 1EPUA 4AM9A 4Q4ZF 4KVMA 5A7DB 2R7TA 5ARFA 4DBRA 2KNHA 2H7OA 2W4MA 5KYYA 2X6IA 4ACLA 4BFRA 4C7OA 4RG9A 2H7VC 3V7OA 4GYWA 3QKYA 3RIPA 3T6BA 3IEGA 3ASGA 3CVQA 4AP2A 3B0UX 4YVQC 1H2TC 4U0SA 3QZCA 4EBBA 2UWJG 1PCXA 4XLNF 1FCHA 2CG2A 4O6MA 3UNGC 3LY7A 1KU2A 4NACA 3SD5A 3MKQB 3ZVVA 3EFOA 2X3MA 1XGWA 1P5QA 4OIPF 4F1SA 2Q9CA 2E0IA 3B7UX 3FUDA 2I2OA 1N54A 2V5FA 3FUMA 5LCWJ 2V8SE 3WODF 3ITFA 2EINC 2XSEA 3ZHEA 5BV1A 1FMVA 1M57C 4IN3B 1WAO1 1MQSA 4A3TA 2PFDA 2J9VA 2Y39A 2A6EF 4IULA 5A23A 2UY1B 2NUPA 3CHOA 4OD5A 4U5HA 4XIFA 4CEMA 2RD0A 4LCTA 2WMOA 2VTBA 2ZXRA 2LAHA 2EIKC 4RDAA 2O9XA 4G7HF 4GA0A 3S7BA 2IYLD 3BEEA 4DI4A 4EZKA 2YHSA 3FUEA 3EIQC 4GAAA 2NUTA 2EILC 3L6AA 2XXAA 4FLHA 3MLGA 4EZLA 2KCKA 2IU1A 2Y69C 3S7DA 4Q94A 2LAIA 5HQ8A 3QARA 5F5HA 2P58C 1NA3A 3U4TA 3NG1A 3QOUA 4ILGA 3JSZA 2MHKA 1J8MF 2QY9A 2OCCC 3K6BA 4J32B 4PFPA 2GFHA 2WB2A 3UT4A 3QC1A 3MV3B 3JQ0A 4DLQA 4TUUA 4JJFA 4JPSA 1BR1A 2I8BA 1ZBPA 3VTXA 3DAFA 3CKCA 4YN0B 4E85A 4J8DA 4AE4B 3T8MA 2ILRA 4FC8A 3RKVA 1INZA 3D3MA 3DMDA 4JA7A 3UGPA 3UUXA 1D0XA 3IHYA 4GMLA 1U3DA 3FTWA 4HXIA 3D9IA 5LOZA 1TJCA 2MRIA 4ATGA 2R7WA 4CSAC 2CHZA 2J7PD 1KT1A 3LY9A 3LS8A 4G26A 3K1IC 3I4RB 4O7GA 3L16A 4ANWA 5BPPA 4DBQA 3ESKA 3AQBA 2J9UA 4EZJA 1VK5A 2IQCA 2XQ0A 4U5CE 2NG1A 2L6JA 4BX9A 3VLDA 3TGOA 3LYAA 4CBEA 2HV6A 3EG9A 3S27A 5CCLA 3FTVA 3PNLB 3CLJA 4XLPF 5EHHA 3LJ3A 4CS9C 2VGXA 4LLEA 3GANA 4BG0A 4DI3A 4CGVA 3ASDA 3GW4A 4WNFA 2WQ7A 4I43A 4A1SA 3I5QA 4OYSA 5BUZA 2Y3DA 1ELKA 5FZQA 1VMAA 2M63A 3NRHA 3O48A 3Q6NA 1TWGA 3RH3A 4B6IA 3QB2A 3HDXA 4BTBA 1M2VB 3EH2A 4I1AA 4BY6A 5EX3A 3NYMA 3IV0A 3FUJA 3NYJA 4NURA 2L0IA 2VB6A 3BG0B 3JRTA 4FA6A 3EGXB 2A69F 2D5RB 5KYWA 2JEKA 2WXJA 3W8HA 1LF8A 3PS6A 3PE4A 3PH0C 2NXPA 4TV3A 3EZHA 5T4YA 3MKQA 5DLJA 2AVPA 2MYSA 2E87A 5FQ7A 4H7YA 1IYGA 3HIZA 1JPJA 4IAOA 1M2OA 3SHFA 4OD4A 2VASA 2C04A 2W45A 2H7BA 3IBEA 3FFLA 4FHKA 2R7OA 2E2EA 3DJNB 4GZ6A 3FTYA 1E8WA 1UJJA 4CT0A 3TG4A 4URKA 4EPZA 4KXKB 1H2VC 1TR2A 4I1OB 4OVVA 1OUVA 1HG5A 2KGOA 4CSAA 4F53A 1HXIA 5AJLA 3VLFA 4O79A 3AU5A 4O6FA 3FUNA 4BJTA 3ECSA 3ZEFA 4GCNA 2WXKA 1ST6A 3S2AA 3DXJF 3NYLA 3FUHA 5G04J 3LAYA 3APFA 1Z3IX 3GZSA 5KYUB 1IZMA 3FWVA 2YINA 4G2VA 3UMHA 3CQGB 1VOMA 4PS8A 3DZAA 4KNVA 1NU7D 2A5UA 3D9PA 2WMNA 3FH5A 4F7AA 3D9JA 3LVQE 2AXUA 2FI7A 5AIJA 2VSOE 4CS9A 4F4BA 3FTXA 1OWLA 1A17A 2EIJC 5JJTA 4GEHA 3GYZA 4HFGA 4KZCA 3L13A 2X6JA 1MNDA 3PDNA 2KJGA 4EECA 4ILHB 3PREA 1OWNA 1FTSA 4V3IA 2JLBA 2GGFA 4X0RA 2VQ2A 4J8EA 3ZYKA 5KJLA 2IOSA 4ZLCA 2XRZA 2WB7A 4GB9A 5BV0A 3X1OA 4UQZA 4I3MA 3QK0A 2LSVA 3AQCA 5BW8C 1HZ4A 4WNDA 4GZCA 4DPRA 1HG2A 2EQXA 4HOUA 4AE4A 1E96B 3LNRA 3K33A 3TD7A 4B89A 4N3BA 3U9WA 4QI0A 4U5GA 1M56C 4PJJA 4FADA 2XGSA 1JWGA 3T6JA 5KYNA 3HHMA 3N24A 3PEUB 1MNEA 4GZDA 1PD0A 3FDHA 4BWRA 2W9YA 5M72A 2ZXWC 2VGYA 1SZIA 3QJZA 4XWJA 2J45A 5ARGA 2WVNA 2Q7FA 4HVBA 1E90A 3FU5A 4L1BA 2XPIA 3EGDB 3NZUA 3RRNB 1Z63A 3RKOF 3LS0A 4O6NA 4CS8C 1OCRC 3EIJA 2C2LA 1SZ9A 2DYRC 2WZFA 2I1JA 2KZTA 4PH4B 3U3WA 3L0IA 3CV0A 3T5XA 3UPVA 2A6HF 3PUKA 2VH3A 3B9QA 2J49A 4HOQA 3ZPJA 3QAQA 2KW3C 4AX2A 2XRYA 4BTAA 1FFHA 2FF4A 3AS8A 4J30B 2DGJA 1QNFA 3R7RA 4UI9J 5FZRA 4KYOB 3TAXA 4F3VA 4JC8A 3L17A 4Y6CA 3PEVB 5C2YA 2BF0X 1MMAA 1M2VA 1V54C 2WQHA 1QZXA 3SZRA 1PAQA 5KYXB 3NZSA 4A3VA 5HSWA 1SMYF 3L08A 3HYMB 3CVVA 4N5CA 2J9WA 2WVIA 5C1DA 2Y3GA 1QQEA 2CNWA 4LLCA 3K66A 3B0VC 3I5PA 2DIWA 3EGXA 1UW4B 3ZGQA 4AEZC 4PDXA 4JEHA 4DOZA 3G2TA 3X2QC 2XRHA 4IRUA 5G05C 1EF1C 1FVFA 4CIHA 3OTNA 3TJPA 3CEQA 4PJNA 3CSTA 3EHNA 3EHMA 2XPYA 4PS3A 3ZYQA 2Y3AA 4CRWA 2ZXOA 3VTYA 5D0OD 4NRHB 3CHQA 4U5FE 2DBAA 3AS5A 4I2ZA 1MHQA 4OVUA 3C98A 2MOWA 2Y3HA 2JD3A 3AU4A 3LXUX 5JHBA 3KKBA 4MNDA 5JJ6A 4FU3A 4R7LA 3CVUA 4N06A 2CG3A 4XKCA 1JPLA 2IOQA 4GYTA 3RRUA 3FEXA 4HEAJ 3T5VA 4PJMA 3UT7A 4A55A 5FT9A 3L54A 3BG1B 4CS8A 2PX3A 3NDBB 2J9QA 2C03A 2PQRA 5B3SC 4FULA 3W8IA 2FO7A 3FTZA 4BJ6C 1MMDA 2V26A 5KYUA 1L5JA 2CGEA 2OOEA 1S7ZA 1BR2A 4GCOA 4H7XA 2YEVA 3RJVA 4OINF 1TWAA 4HOTA 4BJ5C 3TXNA 3VAYA 1TEZA 3D9LA 4EWCA 4FJYA 4I6JA 5EKQD 3EDTB 1N52A 3LEVA 5AJDA 4EQFA 5DS6A 4JVSA 3SP1A 4WWNA 4CT4A 4HLEA 1FVHA 1W3BA 4B94A 3HLZA 4AY6A 1E8YA 5DS5A 2V4LA 5L3QA 2PX0A 2WM9A 1IQUA 3PRZA 3MGBA 3ULQA 2DCPA 2FFHA 3RRMB 1XNFA 3ENEA 2WQ6A 4QFVA 3ZSUA 2FULA 3MYVA 4J6IA 3R9AB 1RJ9B 3PHF2 4JURI 5JJ7A 3EPVA 2ZU6B 3CGHA 4PUCA 3ONKA 3MJWA 4D10C 3FHDA 3MEKA 2IXOA 3CVLA 5KJNA 3FP3A 3FAJA 3SYNA 5E75A 3CZ6A 3FUIA 4UQYA 5D91A 5DBKA 3IEEA 3PZDA 3D9OA 3MKRA 3G2UA 3CIAA 3EGDA 2X6FA 4U0UA 2XL4A 3UGOA 4RBNA 1ZHYA 4YVOA 4N3AA 4K0DA 4ANXA 2I1KA 5B1AC 4ANUA 3K1HA 4K0RA 2J46A 4MLPA 1OWPA 1E8ZA 3MX3A 3PUJA 4AOFA 1NZEA 1DNPA 3KD7A 5KYYB 2KCLA 5T3RA 3JCKC 4JW1A 4ZLDA 2A4ZA 2IJGX 4UQXA 1WM5A 2CHXA 5FCLA 1LKXA 4BJ6A 3D9KA 4XI0A 3GZ2A 3SFZA 4I2WA 2KCVA 5ANLA 1PC2A 3OXFA 3D9NA 4J8SA 3DM9B 3JCUQ 3LLKA 1DVPA 3LDZA 3OEOA 4BJ5A 3UR3C 2J7PA 5KYXA 4QDLA 3EFOB 2XCCA 2Y4TA 4XE0A 1TJFA 2R5SA 3RO2A 4G23A 2VYIA 4NY3A 1JWFA 4OIQF 3L34A 1SF8A 4JJGA 1Y8MA 5E2QA 4MS6A 3ESLA 4EBAG 3AG2C 4XX5A 2LO6A 5L3VA 4APOA 3ZXSA 3S7JA 2FEZA 4DJAA 3CQZA 2VSNA 4HS2A 4JHJA 2DYSC 5FQ6A 4AXHA 2WVOA 2NUPB 5FQ4A 3HTKC 1E8XA 2PF4E 1S0PA 2UY1A 3G2WA 4QI2A 4FJZA 3Q47B 2WXLA 4ACKA 4N2QA 3MCXA 2IF4A 4FHJA 2VTBB 2KATA 5LP0A 2CHWA 1W2WA 3M1CB 4E7ZA 3WG7C 3SNHA 2R7QA 4I6EA 3HVEB 2NUTB 5FWQA 2OV8A 2XXAB 3ML8A 4JA9A 4C3BA 3TG5A 1H0AA 4BEJA 1PY1A 3UX4A 3DBSA 2CFZA 2V0PA 4BT8A 3ZIBA 3KL4A 1Z3YA 4O6YA 3RIBA 2Y3BA 1UN9A 5KCMA 1NG1A 2G3KA 4AK9A 2WPVA 4E7SA 2WXMA 1HH8A 1U3CA 3N0TA 3TL5A 4JHRA 4B0ZA 2WXHA 3UMIA 3P1UA 3EJNA 1NP7A 2J08A 3KMIA 2IONA 3UMKA 3G2VA 5FZSA 4AJWA 2LSEA 3L22A 4YT5A 3CHSA 1WY6A 2WZLA 2XGMA 5DIZA 3NQPA 3E9VA 5DQZA 5G05J 2WXRA 4I9CA 4L2YA 4KBLA 3S28A 5HI7A 2VJ8A 1ZHWA 4M63A 2WXPA 2WXQA 2WXFA 1D0ZA 2PM7A 1QZ2A 3D9MA 1Y6IA 3FU3A 3O6XA 2IOLA 3MA5A 4IWBA 3ML9A 2A68F 1ZU4A 4G0HA 1D1BA 4JL0A 3VLEA 1WGWA 1HU3A 4CGWA 5J08A 4C0EA 2EIMC 2CFUA 1Z6AA 4J8FA 5ENNA 1B89A 2KQ9A 4PS7A 3AG3C 3RK6A 1OKKD 4CDMA 4W8KA 2LNIA 1SQMA 2CW0F 2HM8A 3HJCA 2WVQA 1JUQA 3AS4A 3QDNA 1EDUA 3EG9B 2R7XA 4WAFA 3E4BA 1ZYRF 2WXOA 3FH7A 2PZIA 3W2VA 3JT1A 2VGXB 4U63A 1X5BA 3OXGA 2WL8A 3PNTB 1D1AA 4DLOA 3DJUB 5G04C 4Q5SF 2YNQA 3FULA 1HO8A 3JYSA 4W9RA 3CVWA 3EH1A 1GW6A 3Q49B 3OWTA 1UN8A 2X6KA 4OIRF 3ZVRA 4AVXA 1YA0A 4HFFB 2LSUA 1EYHA 4JEUA 4HORA 3RU0A 2J0WA 2V3CC 3PMRA 1LVKA 3E70C 3LESA 3CK9A 3LKUA 4A1GA 3SZ7A 4U8HA 5A6CA 5KJKA 4N2SA 3O39A 5KYWB 4U5EE 4LACB 3U64A 4Q96A 1O87A 3CHRA 4P6IC 4I9EA 1FFTC 5FQ8A 2XEVA 1ZHXA 4OIOF 3DD7A 1D0YA 3SF4A 2FGYA 4A2NB 3Q7LA 1ZU2A 4L23A 4ILIA 4I1MA 1KLXA 1E7VA 2YHEA 4LERA 1OKKA 2RG8A 4WWPA 5JHAA 5CCMA 1TWCA 2R7VA 4GMJA 2R17C 3CSFA 4LUNU 1BR4A 3CQCB 4BT9A 4RSYA 3QWVA 1Z6TA 1HX8A 5EGYA 3B7RL 4ANVA 5LFAA 4RVBA 2FBNA 3FHEA 4H4KC 4FX5A 5F5FA 4B8CB 5E76A 4U5DE 1IHGA 2XCBA 2QFCA 3GODA 3MV2B 3ABKC 4KMOA 4Q69A 2OG2A 4PJLA 5IY5C 3CVNA 4C3EA 3LPZA 4AIFA 2G62A 3FY4A 1V55C 3CHMA 2WZGA 5E33A 2VSXE 3UQ3A 4CDNA 3HVEA 4GYOA 4LRZA 4YWQA 2QY7A 4ABNA 3LCAA 2Q9BA 2I9CA 2X51A 3ASOC 4CDRA 4CS7A 4BSXA 3CR3A 4FESA 3QNKA 3N2ZB 5DS4A 4RG6A 3ZYMA 5CMWA 3LY8A 5EDSA 2XHEA 3JQ1A 1MMNA 4G7OF 4KNWA 2C0LA 4N3CA 1JPNA 3OXLA 4TRQA 3S7FA 5CI8A 2QTVA 5FTPA 1J8YF 4BX8A 2YZSA 2P6VA 2YHCA 3ZN3A 3RYLA 3LS1A 3FU6A 5DQTA 1G8XA 1FMWA 5BNWA 3LEWA 4ULWA 2PL2A 4UI9C 2G3VA 2ZPAA 2X6HA 5CHEE 1LS1A 4NQ0A 2L9JA 4YT4A 2OVBA 5G2NA 3IHVA 4KI2A 3KEZA 4Y6WA 4IJJA 1TWHA 1NU9C 2CDQA 4K7BA 1MMGA 4I17A 4FWVA 3FUKA 2XGOA 4GYYA 1O5HA 2AXZA 4XKBA 3K9IA 5LCWC 3UMVA 4UWLA 5KJMA 3JUIA 5D0QD 3ZFWA 3R7QA 4EBAA 1H6KA 4KBQA 3B0PA 3ABLC 3G2SA 4UWFA 2IXPA 1E7UA 3FEYA 4U0ZA 3JYHA 2GRLA 4IYPA 2IXMA 1OCOC 5T1DB 4GA2A 1NA0A 2KZTB 3Q7GA 4WWOA 2R59A 4AV7A 5FJYA 4C9BB 4FLBA 5T3TA 2NC9A 1VYIA 4G24A 3URZA 3SI5A 4AY5A 3NF1A 1SZAA 3QWWA 1KT0A 4C7OB 3TXMA 2L81A 4JZAA 4XI9A 5B1BC 4ANJA 3F47A 2BE5F 4JXTA 2PP4A 2J07A 4G25A 3POVA 2KC7A 3S29A 3ZC4A 3DPDA 4PK4A 4UI9K 1H19A 4FP7A 2KM4A 4N39A 4GZ5A 3QMKA 3APDA 2ZXPA 1H2UA 4APFA 3KS2A 2P7VA 5G55A 1OCCC 3B7TA 2OVFA 1VYKA 4YT2A 4U04A 4GPKA 4U07A 3NKDA 1ZU5A 3Q6MA 4GA1A 4KT6B 3SGHA 3KH2A 2R7SA 3K7DA 3I4UA 2L0TB 2HO1A 2B0JA 4G11A 4JZYA 4WJ0A 1QLEC 2L9BA 4WNGA 2J09A 3SEOA 3ZIMA 5CI9A 2W4BA 3ZHEB 3O4ZA 2R7UA 3CVYA 3ZW3A 5ANRA 1IW7F 2C0MA 4DVYP 2WXGA 2Z15A 3CK7A 4HE8D 2IFUA 1TKNA 3FH8A 3Q15A 5J90A 5BUOA 3ASNC 2WXIA 3ZG1A 1VDYA 2J0XA 3ONLA 3CKBA 4I44A 3GZ1A 1OWOA 1IQRA 3FDQA 3CVPA 3VYWA 3OAWA 2NSZA 3ASFA 3QWPA 4L7TA 2GW1A 2VSYA 5E3CA 3DM5A 1OWMA 4YT8A 2IXNA 3FTSA 4MRUA 1ELRA 1HFAA 4DK5A 4C3DA 1OCZC 4KVOA 4UWHA 1N1CA 3CSKA 3P2BA 3NKEA 4KZ0A 2MWQA 4B8AA 5T3WA 3I4GA 5D92A 1PD1A 1BPOA 3FUFA 1UJKA 2J4DA 1ZHZA 2WXNA 3SBSA 4CCAA 3AG1C 3WXXA 3FVYA 3S0XA 4HFKB 2Y4UA 3F46A 4YJWA 3H65A 3I3NA 4J0UA 3PVLA 4Q7CA 3UT8A 4G7ZF 3W2WA 3PE3A 3B7SA 4E6HA 5EX0A 5T8IA 5LX8A 2PQNA 3MZLB 1NZNA 4PFOA 3FTUA 1ZHTA 2HR2A 4I6GA 3RO3A 2R7RA 3OA1A 5CMYA 3LJBA 1UG3A 2ONDA 1HE8A 3LLIA 2XPZA 4P29A 2BTDA 4ME2A 5DVWA 4MKTA 1ELWA 4LEUA 2Q3TA 1HF8A 4JHKA 1Z3XA 2AXVA 2J4BA 3RFYA 4XTKA 3ASHA 3LVRE 4K03A 5BT1A 2YQ8A 4JCHA 4C0MA 4M3OA 1D1CA 2Q9AA 2M4EA 4WNEA 4GZ3A 4L2LA 2A1DD 2BUGA 3DAGA 3ABMC 2I6HA 3IKOB 3EZIA 3KAEA 4XZ4A 1Z23A 3SNXA 3ZYLA 3CVXA 2PM6A 2HYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IRU A;  4I1O B;  4I1M A;  4JW1 A;  4JVS A; 
#chains in the Genus database with same CATH topology
 4RD9 A;  2X0C A;  1RJ9 A;  2JAB A;  5AYW D;  3Q5M A;  3RQF A;  3SBT B;  5E3A A;  4UWG A;  3APC A;  1N4Q A;  3UIN C;  4L6R A;  2CNW D;  3T4R A;  1BLX B;  4ZHB A;  4HOS A;  4KC9 A;  4WUY A;  2AW6 A;  2X38 A;  2HV7 A;  1H9G A;  3Q4A B;  5CED B;  3Q75 A;  5HKP A;  3CHP A;  2R03 A;  1N0Q A;  2B6C A;  5COG A;  2PNO A;  4IGG A;  3UIP C;  1U2V G;  2XLE A;  4YND A;  3AG4 C;  2QLA A;  4DX5 D;  2XZT G;  3CEX A;  2KBX A;  4U5B E;  2HMZ A;  3N71 A;  3ZRH A;  4MQ9 F;  2XLV A;  4BJ1 A;  5AEN A;  1VB5 A;  256B A;  4G1T A;  3EQL F;  2LP4 A;  2GRM A;  2EIM E;  2GDC A;  5BQI A;  1Z5Z A;  3U66 A;  1TNO A;  2AWI A;  2IY0 C;  4GU5 A;  1SW6 A;  4UWK A;  1HS6 A;  1YDI A;  5A69 A;  3FU0 A;  3AG3 E;  4TUM A;  4N6C A;  4DVZ A;  3B13 A;  3CK8 A;  1EPU A;  4AM9 A;  4Q4Z F;  3S90 A;  2XEH A;  4KVM A;  5A7D B;  2R7T A;  5ARF A;  4DBR A;  2KNH A;  4O1P A;  2L7A A;  2HSB A;  2H7O A;  4XEV A;  5EIL A;  2W4M A;  1C02 A;  5KYY A;  2X6I A;  4ACL A;  4BFR A;  4C7O A;  3HXE A;  3AG4 E;  4RG9 A;  4XEK A;  5F28 E;  2H7V C;  3V7O A;  3QKY A;  4GYW A;  3RIP A;  3AAA C;  2XLM A;  1DCQ A;  1HY5 A;  3T6B A;  3IEG A;  3ASG A;  3CVQ A;  2OEW A;  2OOC A;  4AP2 A;  4CX9 A;  4JKV A;  3B0U X;  4YVQ C;  1H2T C;  4U0S A;  4U9D A;  3QZC A;  4U8Y D;  4EBB A;  2UWJ G;  1PCX A;  2A0U A;  4XLN F;  4MTG A;  4EBK A;  4D4N A;  2EPN A;  1FCH A;  2CG2 A;  3V5X A;  4O6M A;  3UNG C;  3LY7 A;  1KU2 A;  4NAC A;  3SD5 A;  1SVX A;  1MX4 A;  3MKQ B;  1KPS B;  3ZVV A;  3EFO A;  3NMK A;  1LE2 A;  2X3M A;  1XGW A;  5FZT A;  1P5Q A;  5ITZ F;  4E17 A;  4OIP F;  4F1S A;  2Q9C A;  3V79 K;  1OXK A;  1I5N A;  1LIH A;  2E0I A;  3B7U X;  3FUD A;  1H7I A;  1DC2 A;  4BEM J;  2I2O A;  1N54 A;  2V5F A;  4XEI G;  3M79 A;  3FUM A;  3C8G A;  5LCW J;  2V8S E;  1RW2 A;  3WOD F;  3G4X A;  2QYU A;  3ITF A;  3TWX A;  2EIN C;  1T6U A;  2XSE A;  3ZHE A;  2P61 A;  5BV1 A;  1FMV A;  2RKK A;  1GS9 A;  4RLY A;  3MYF A;  3NBN B;  2P9I G;  1M57 C;  4IN3 B;  5KBA A;  1WAO 1;  1MQS A;  4A3T A;  2PFD A;  2J9V A;  2Y39 A;  3DSU A;  3RF3 A;  3U9M A;  2A6E F;  4IUL A;  5A23 A;  3DPY A;  2UY1 B;  1YZA A;  2NUP A;  1TN7 A;  5CBN A;  3CHO A;  4N4W A;  4OD5 A;  2OEV A;  4U5H A;  4XIF A;  4CEM A;  5CEC B;  2RD0 A;  4LCT A;  2WMO A;  2VTB A;  2ZXR A;  2LAH A;  2EIK C;  2OJE D;  3DE8 A;  4RDA A;  2O9X A;  4G7H F;  2LFD A;  4GA0 A;  2XS1 A;  3S7B A;  2IYL D;  1TQG A;  3BEE A;  4DI4 A;  4EZK A;  4FAP B;  2YHS A;  3FUE A;  3EIQ C;  4GAA A;  2NUT A;  1SR2 A;  2DB4 A;  1RCP A;  2EIL C;  3L6A A;  2ETS A;  4BER A;  2XXA A;  3E34 A;  4FLH A;  3MLG A;  4EZL A;  1RKE A;  1WAS A;  1WTY A;  3FOP A;  1VTM P;  2KCK A;  1S63 A;  3T9K A;  2IU1 A;  2Y69 C;  4J7T A;  2HUJ A;  3S7D A;  4TXR A;  3ABK E;  4Q94 A;  2LAI A;  2HJ3 A;  3DSX A;  5HQ8 A;  5IY5 E;  1K3Z D;  3QAR A;  5F5H A;  2P58 C;  1NA3 A;  3U4T A;  3SXK A;  1K8K G;  3NG1 A;  1V55 E;  3QOU A;  4K5A B;  3JYY A;  4ILG A;  3JSZ A;  3SFY A;  1H9T A;  2MHK A;  4M7C A;  1J8M F;  4CDA A;  2XLD A;  2QY9 A;  2OCC C;  3K6B A;  4XPX A;  4J32 B;  4PFP A;  1YA9 A;  4DX2 A;  5L0D A;  2RD9 A;  2GFH A;  2WB2 A;  3IQ5 A;  3UT4 A;  3QC1 A;  3ASO E;  1BBH A;  1QSP A;  1JCS A;  3MV3 B;  3JQ0 A;  4J8Y A;  1YCS B;  4DLQ A;  2P9N G;  4TUU A;  3DE9 A;  4JJF A;  3FOO A;  3U3F A;  1ZW2 A;  4JPS A;  4OAU C;  2CCY A;  1BR1 A;  2I8B A;  1Y6D A;  1ZBP A;  3VTX A;  3DAF A;  2ZD9 A;  3CKC A;  3SQV A;  4YN0 B;  4E85 A;  4J8D A;  4AE4 B;  3T8M A;  1KZO A;  2ILR A;  3GM1 A;  4FC8 A;  4U96 D;  3RKV A;  1INZ A;  3D3M A;  3DMD A;  4JA7 A;  1R5I D;  3UGP A;  1U6H A;  3UUX A;  1NBB A;  2L6G A;  1TNB A;  1D0X A;  2OCC E;  3IHY A;  1N4R A;  4GML A;  3LUT B;  1U3D A;  3FTW A;  1BZ4 A;  3D9I A;  4HXI A;  5LOZ A;  1TJC A;  4DXW A;  2MRI A;  1Q0M A;  4ATG A;  2R7W A;  4CSA C;  4DRJ B;  2CHZ A;  2J7P D;  1KT1 A;  3DKA A;  3TOL A;  3LY9 A;  3LS8 A;  2YKZ A;  4G26 A;  3K1I C;  1R4T A;  1L7C A;  3I4R B;  2ZGG A;  4O7G A;  3VM6 A;  3L16 A;  4ANW A;  1XZQ A;  4O60 A;  5BPP A;  4DBQ A;  1C03 A;  3ESK A;  3AQB A;  2J9U A;  4EZJ A;  1VK5 A;  4GMR A;  3T6G B;  1OR3 A;  4U8V D;  1SA4 A;  2IQC A;  2XQ0 A;  4U5C E;  5ENQ D;  2NG1 A;  2XS8 A;  2L6J A;  4BX9 A;  5JP7 A;  3VLD A;  1UFB A;  5ENS D;  3TGO A;  3LYA A;  1FPP A;  4YL0 A;  4CBE A;  3G4Z A;  2HV6 A;  3EG9 A;  3S27 A;  3GEE A;  2QUP A;  2OU6 A;  5JRA A;  5CCL A;  3FTV A;  3PNL B;  3CLJ A;  4XLP F;  5EHH A;  3LJ3 A;  3DSS A;  4CS9 C;  4DJ9 A;  2VGX A;  3ABL E;  4LLE A;  3GAN A;  4BG0 A;  4DI3 A;  4ZFH A;  3ASD A;  3GW4 A;  4CGV A;  4WNF A;  2WQ7 A;  4I43 A;  4A1S A;  3I5Q A;  4OYS A;  5BUZ A;  2Y3D A;  3R2P A;  1ELK A;  3LJN A;  1VMA A;  5FZQ A;  2HJM A;  2M63 A;  3NRH A;  1OCO E;  3O48 A;  3Q6N A;  1TWG A;  3RH3 A;  4B6I A;  3DEP A;  3QB2 A;  5HS0 A;  1ZZP A;  3HDX A;  3L8J A;  4BTB A;  1M2V B;  3EH2 A;  4P9T A;  1LTX A;  4I1A A;  2LUH A;  4BY6 A;  3PZ2 A;  5EX3 A;  3U3B A;  3NYM A;  1E85 A;  3IV0 A;  2OJQ A;  3FUJ A;  4HRM B;  1JCQ A;  1RXQ A;  3NYJ A;  5D66 A;  4NUR A;  3IQ6 A;  1EA8 A;  2L0I A;  2VB6 A;  3BG0 B;  3A9C A;  5JUA A;  3JRT A;  1ZW3 A;  5B1B E;  4FA6 A;  5KNG A;  3EGX B;  2A69 F;  3EU9 A;  2D5R B;  5KYW A;  2JEK A;  2WXJ A;  3W8H A;  1LF8 A;  4IAQ A;  3PS6 A;  3PE4 A;  3PH0 C;  2NXP A;  1U89 A;  2KXP C;  2J8S D;  4TV3 A;  3EZH A;  5T4Y A;  3MKQ A;  5DLJ A;  2AVP A;  3TK0 A;  2MYS A;  2E87 A;  3V2O A;  5FQ7 A;  3TQO A;  1EI7 A;  5JT4 A;  2P9K G;  4H7Y A;  1IYG A;  3HIZ A;  1JPJ A;  4IAO A;  1M2O A;  2VCA A;  3PZ3 A;  3SHF A;  4OD4 A;  2VAS A;  2C04 A;  2W45 A;  2H7B A;  3DST A;  1OCC E;  3IBE A;  3FFL A;  4FHK A;  2R7O A;  5CRU A;  2E2E A;  3DJN B;  4GZ6 A;  3FTY A;  2FAP B;  1E8W A;  1UJJ A;  4CJO A;  3GEI A;  4CT0 A;  3EUV A;  3TG4 A;  1EKY A;  4URK A;  4EPZ A;  4KXK B;  1NLX A;  1H2V C;  1TR2 A;  4I1O B;  4OVV A;  1OUV A;  1HG5 A;  2KGO A;  4E18 A;  4CSA A;  4F53 A;  1HXI A;  5AJL A;  4YDE A;  2V4H C;  3VLF A;  2YQY A;  1S64 A;  2MYO A;  4XPY A;  4O79 A;  3AU5 A;  1O1R A;  2HFI A;  3K1I A;  4MVU A;  4O6F A;  3FUN A;  4BJT A;  2HSQ A;  3ECS A;  5EIB E;  3QW1 A;  3ZEF A;  3KPH A;  3GOR A;  4GCN A;  2WXK A;  1ST6 A;  4X8Q A;  1BI7 B;  3KYI A;  5EYL A;  3S2A A;  4Z9J A;  4MW8 A;  3DXJ F;  3NYL A;  3FUH A;  1HMD A;  5G04 J;  5A6B D;  3LAY A;  1O1T A;  3APF A;  2R2L A;  3JRM O;  4DUI A;  3ASN E;  1Z3I X;  3GZS A;  3VF0 A;  3JTL O;  4CDV A;  5KYU B;  1IZM A;  3FWV A;  2YIN A;  4G2V A;  3UMH A;  3CQG B;  1VOM A;  4PS8 A;  3DZA A;  4KNV A;  1NU7 D;  2A5U A;  3D9P A;  1JMW A;  2WMN A;  3FH5 A;  2PBE A;  4F7A A;  3D9J A;  3LVQ E;  1VLS A;  2AXU A;  2FI7 A;  5AIJ A;  5B3I A;  1QYM A;  2VSO E;  1S70 B;  2ASR A;  4CS9 A;  4LNU D;  4F4B A;  1OCZ E;  3FTX A;  5H7P A;  1OWL A;  1A17 A;  2EIJ C;  1QPU A;  5JJT A;  4GEH A;  4JC7 A;  1XZP A;  3GYZ A;  3L13 A;  4HFG A;  4KZC A;  2HE0 A;  2X6J A;  5CRV A;  2BKK B;  1MND A;  3PDN A;  2XM0 A;  2KJG A;  3FAP B;  4EEC A;  1TFK B;  4YL3 A;  4ILH B;  4JD2 G;  2HZ8 A;  5AC5 A;  3PRE A;  1OWN A;  4GTS A;  3WAQ A;  1FTS A;  4V3I A;  2JLB A;  2GGF A;  4PAC A;  3R7C A;  1YAU O;  3E30 A;  4X0R A;  2VQ2 A;  3AG1 E;  4J8E A;  4HI8 A;  4J7Y A;  3ZYK A;  2IOS A;  1YA7 O;  4JEA A;  4ZLC A;  2WB7 A;  5KJL A;  2XRZ A;  1H6P A;  5AQ7 A;  4GB9 A;  1XWJ A;  5BV0 A;  2HYZ A;  3X1O A;  4UQZ A;  4I3M A;  2F8Y A;  3QK0 A;  2LSV A;  3AQC A;  2P9U G;  3DXM G;  2LQG A;  5BW8 C;  1HZ4 A;  4WND A;  4GZC A;  4EUK B;  4DPR A;  1HG2 A;  3ZQY A;  2EQX A;  4HOU A;  4AE4 A;  4HRN A;  2EIJ E;  1E96 B;  3LNR A;  3K33 A;  3TD7 A;  4B89 A;  4N3B A;  3U9W A;  4QI0 A;  5JLI A;  3C3R A;  4U5G A;  2P1A A;  1M56 C;  4PJJ A;  3U8V A;  4FAD A;  2XGS A;  1JWG A;  3ZUV B;  3T6J A;  5KYN A;  5CER B;  2R9R B;  3HHM A;  3N24 A;  3PEU B;  1MNE A;  3AGU A;  4GZD A;  1PD0 A;  3FDH A;  4BWR A;  2W9Y A;  2YWA A;  4CYM D;  5M72 A;  2ZXW C;  4QQI A;  2VGY A;  2J9B A;  4JIO A;  1SZI A;  3QJZ A;  4XWJ A;  2J45 A;  3DSW A;  4U7E B;  4LDK A;  1GM5 A;  5ARG A;  2WVN A;  2NSF A;  2Q7F A;  4HVB A;  1Q0K A;  1E90 A;  2Y0B G;  3FU5 A;  4L1B A;  2XPI A;  4MVZ A;  4DX6 D;  3EGD B;  3NZU A;  3RRN B;  1Z63 A;  3RKO F;  3C5R A;  2NYJ A;  3LS0 A;  1CGM E;  3H2V A;  4O6N A;  3ZNG A;  3ABM E;  4CS8 C;  2F8X K;  1OCR C;  2P0N A;  1DOW A;  3EIJ A;  3DWL G;  2C2L A;  1SZ9 A;  2DYR C;  2WZF A;  1FAP B;  2XM4 A;  2I1J A;  2KZT A;  4PH4 B;  3U3W A;  2ZIR A;  3L0I A;  3CV0 A;  5FIN A;  3T5X A;  3UPV A;  2A6H F;  3TJ5 A;  3ZWI A;  3PUK A;  2P2C P;  4EKW A;  2V5Q C;  4N6H A;  5L0C A;  2VH3 A;  2JPU A;  3B9Q A;  2J49 A;  1JCR A;  4G78 A;  4HOQ A;  3U5S A;  3ZPJ A;  1HE1 A;  3C18 A;  3QAQ A;  2KW3 C;  4AX2 A;  2XRY A;  4BTA A;  1YYH A;  1FFH A;  1E84 A;  2FF4 A;  3AS8 A;  1N11 A;  4J30 B;  5COF A;  2DGJ A;  1OCR E;  4E0I A;  1QNF A;  3R7R A;  1NFN A;  1LS4 A;  4EBJ A;  4DRX E;  1MYO A;  4JE9 A;  4XQ1 A;  2DYR E;  3E33 A;  4UI9 J;  3T8K A;  5CBO A;  5FZR A;  4KYO B;  3RW0 A;  3TAX A;  3L82 A;  4F3V A;  4JC8 A;  3L17 A;  3EU5 A;  4Y6C A;  3TOM A;  3GWN A;  3PEV B;  5C2Y A;  2BF0 X;  1MMA A;  3M4B A;  1M2V A;  1V54 C;  2WQH A;  1QZX A;  3SZR A;  1PAQ A;  5KYX B;  3B95 A;  3NZS A;  4A3V A;  5HSW A;  1SMY F;  2ZGD A;  3L08 A;  3HYM B;  3CVV A;  4N5C A;  3UTM A;  1WAT A;  1G4U S;  3PDM P;  2P9S G;  2J9W A;  1KNY A;  2WVI A;  2ICW G;  1X81 A;  4HBD A;  5C1D A;  2Y3G A;  3U2L A;  1QQE A;  2CNW A;  4LLC A;  3K66 A;  3B0V C;  3W4Y A;  4RQI A;  3I5P A;  1T5O A;  2DIW A;  3ULY A;  3EGX A;  1UW4 B;  3ZGQ A;  4AEZ C;  4PDX A;  4NTF A;  4DOZ A;  1A7D A;  4JEH A;  3G2T A;  3X2Q C;  2XRH A;  4IRU A;  5G05 C;  1K04 A;  1EF1 C;  1N95 A;  1FVF A;  1KTM A;  4GTO A;  4CIH A;  3OTN A;  3TJP A;  3CEQ A;  4PJN A;  3CST A;  2BL2 A;  2KYH A;  1H6O A;  3EHN A;  3EHM A;  2XPY A;  3QVY A;  3F6Q A;  4PS3 A;  3ZYQ A;  2Y3A A;  4CRW A;  2ZXO A;  3VTY A;  5D0O D;  4NRH B;  3CHQ A;  3FMS A;  1V54 E;  5AAR A;  4XPW A;  4U5F E;  2DBA A;  3AS5 A;  4I2Z A;  3HNK A;  4Z9I A;  1MHQ A;  1GQA A;  4OVU A;  3RAU A;  5A6K A;  1D8D A;  3ATP A;  1LPE A;  1BD8 A;  3C98 A;  4GTT A;  1OR2 A;  2MOW A;  2MHR A;  2Y3H A;  1KZP A;  2JD3 A;  4MTF A;  3AU4 A;  3LXU X;  5JHB A;  3KKB A;  4MND A;  5JJ6 A;  1MX6 A;  2L6F A;  4FU3 A;  4R7L A;  3CVU A;  4N06 A;  2CG3 A;  1LE4 A;  3X2Q E;  3GEH A;  1GGQ A;  2M64 A;  3HKK A;  2DZN A;  4GQH A;  1JPL A;  4XKC A;  2IOQ A;  2IM8 A;  5TJ5 E;  4GYT A;  2EIN E;  3RRU A;  3FEX A;  4HEA J;  3T5V A;  4YL1 A;  4PJM A;  3TWV A;  3FXH A;  3UT7 A;  4A55 A;  3RQE A;  2H8A A;  5FT9 A;  3L54 A;  3BG1 B;  4CS8 A;  2PX3 A;  5AAO A;  1A7V A;  3NDB B;  2J9Q A;  2XLO A;  2C03 A;  1BU9 A;  2PQR A;  5B3S C;  4FUL A;  3W8I A;  3UKU G;  3TWS A;  1JR8 A;  4GTV A;  5AGF A;  2FO7 A;  3FTZ A;  4BJ6 C;  1MMD A;  2V26 A;  5KYU A;  2R02 A;  1L5J A;  2EIK E;  2CGE A;  2OOE A;  1S7Z A;  3PZ4 A;  4MVM A;  1BR2 A;  4GCO A;  4H7X A;  1T6I A;  2YEV A;  4EIY A;  4G8L A;  3RJV A;  4OIN F;  1TWA A;  4HOT A;  4DX7 D;  4BJ5 C;  3TXN A;  3VAY A;  1TEZ A;  3DI5 A;  2EIL E;  4H54 A;  3D9L A;  4EWC A;  4FJY A;  4I6J A;  5EKQ D;  2GRQ B;  3EDT B;  1N52 A;  3LEV A;  4GPM A;  5AJD A;  1LI7 A;  4WAB A;  4LDR A;  2Y69 E;  4EQF A;  5DS6 A;  4JVS A;  3LEO A;  3SP1 A;  2KSF A;  4WWN A;  4U9E A;  4CT4 A;  4HLE A;  2IO2 C;  5A6A A;  1FVH A;  3SXM A;  1W3B A;  4B94 A;  3HLZ A;  4AY6 A;  4MVR A;  1E8Y A;  5DS5 A;  1MJ0 A;  2V4L A;  5L3Q A;  1LI5 A;  2QC9 A;  2PX0 A;  4B93 B;  2WM9 A;  3DXK G;  1IQU A;  3PRZ A;  3MGB A;  4NTA A;  3ULQ A;  2YLI A;  2DCP A;  2FFH A;  3RRM B;  4YDY A;  3W9G A;  2Q4F A;  1YAR O;  3V2X A;  5JS5 A;  3AJM A;  1XNF A;  2P9L G;  3ENE A;  2WQ6 A;  4QFV A;  1S05 A;  3ZSU A;  4UUC A;  3UM1 A;  2FUL A;  3GM2 A;  3MYV A;  3A11 A;  2EPL X;  4J6I A;  3R9A B;  1RJ9 B;  3PHF 2;  4JUR I;  5JJ7 A;  3EPV A;  1TFO B;  1VLT A;  2ZU6 B;  2AJA A;  3CGH A;  4PUC A;  3ONK A;  3MJW A;  4D10 C;  3FHD A;  3MEK A;  5COM A;  2IXO A;  3CVL A;  5KJN A;  4C48 B;  3FP3 A;  3R9M A;  2LFF A;  4GTP A;  4K5B A;  3FAJ A;  3SYN A;  5E75 A;  3CZ6 A;  3FUI A;  4UQY A;  4BES A;  5D91 A;  2VCC A;  5DBK A;  1C17 M;  3IEE A;  3PZD A;  3D9O A;  3MKR A;  3G2U A;  3CIA A;  3EGD A;  2X6F A;  3TWQ A;  4U0U A;  2XL4 A;  3U2M A;  2GA0 A;  3S84 A;  3SFX A;  3UGO A;  1B68 A;  4RBN A;  3Q78 A;  1ZHY A;  4YVO A;  3AJI A;  3V31 A;  4N3A A;  2H6G A;  4K0D A;  4ANX A;  2I1K A;  5B1A C;  2ETC A;  4ANU A;  3K1H A;  4K0R A;  2FO1 E;  3DWW A;  2J46 A;  1YMP A;  4MLP A;  1OWP A;  1E8Z A;  1ORJ A;  3MX3 A;  3PUJ A;  4AOF A;  1NZE A;  1DNP A;  3KD7 A;  5KYY B;  2KCL A;  3D9H A;  5T3R A;  3JCK C;  4JW1 A;  3M4C A;  4ZLD A;  1G4W R;  2A4Z A;  2IJG X;  2ZIS A;  4UQX A;  3SXY A;  1YYX A;  2BC5 A;  1WM5 A;  2OKU A;  4JCZ A;  2AP3 A;  5FCL A;  2CHX A;  1LKX A;  4BJ6 A;  5EYP F;  3D9K A;  3HNJ A;  1FT1 A;  4XI0 A;  3GZ2 A;  3SFZ A;  4I2W A;  1OW8 A;  4NCQ A;  2KCV A;  5ANL A;  1PC2 A;  3OXF A;  3D9N A;  4J8S A;  1QBQ A;  3DM9 B;  1H6G A;  3IHU A;  3JCU Q;  3LLK A;  4BPM A;  1DVP A;  3LDZ A;  2LXM A;  3OEO A;  1V4A A;  4HLL A;  4BJ5 A;  4MW3 A;  3UR3 C;  2J7P A;  5JMN D;  1DOV A;  2YLD A;  3SXZ A;  3U8P A;  5KYX A;  4QDL A;  3EFO B;  2XCC A;  2Y4T A;  1N94 A;  5L0G A;  1N9A A;  4XE0 A;  1TJF A;  2R5S A;  3RO2 A;  4G23 A;  5JVE A;  1CGN A;  3J06 A;  2VYI A;  4LNG A;  4NY3 A;  1JWF A;  3TWT A;  4OIQ F;  3L34 A;  2NSG A;  1SF8 A;  4JJG A;  4JTD B;  2VCB A;  1Y8M A;  3U9J A;  5E2Q A;  4MS6 A;  3ESL A;  1Q2Z A;  4EBA G;  3AG2 C;  4F1P A;  4HB5 A;  4XX5 A;  2LO6 A;  3C8G B;  5EK0 A;  1JRA A;  5L3V A;  4APO A;  3ZXS A;  2CYD A;  4NIK A;  3S7J A;  1Q0D A;  2FEZ A;  1UG7 A;  3TWU A;  4E0H A;  3SY2 A;  4DJA A;  3CQZ A;  2VSN A;  4HS2 A;  1IXV A;  4JHJ A;  2B0O E;  2DYS C;  5FQ6 A;  3HXD A;  4AXH A;  2WVO A;  2NUP B;  5FQ4 A;  5AC4 A;  3HTK C;  1E8X A;  2PF4 E;  1S0P A;  5L0H A;  1YLM A;  4QI2 A;  1TNZ A;  2UY1 A;  3G2W A;  4FJZ A;  5KNH D;  3V30 A;  3Q47 B;  3MYI A;  2WXL A;  4ACK A;  4N2Q A;  3MCX A;  2IF4 A;  4FHJ A;  1AWC B;  2VTB B;  2KAT A;  5LP0 A;  3BU8 A;  4HQD A;  2L6B A;  1HE9 A;  2CHW A;  1WWP A;  1W2W A;  3M1C B;  4E7Z A;  2GRN B;  3WG7 C;  3SNH A;  2GAQ A;  3Q73 A;  2R7Q A;  3US6 A;  4I6E A;  3HVE B;  2NUT B;  1D8E A;  5FWQ A;  2YVK A;  2OV8 A;  2XXA B;  3ML8 A;  4JA9 A;  3WHN A;  4C3B A;  4P9F A;  2DYS E;  1T6Q A;  3TG5 A;  1HW2 A;  4BEJ A;  1H0A A;  1PY1 A;  3UX4 A;  3DBS A;  3HXC A;  2CFZ A;  2ETB A;  2V0P A;  1IKN D;  1QVX A;  2F22 A;  2YL1 A;  4BT8 A;  5EID A;  4ATZ D;  4LSZ E;  3ZIB A;  3KL4 A;  4Z68 A;  1Z3Y A;  4O6Y A;  3RIB A;  4HI9 A;  2RFM A;  2Y3B A;  1FR0 A;  4MVQ A;  1UN9 A;  2TMV P;  5AQB A;  3JZ0 A;  5KCM A;  1NG1 A;  2G3K A;  4AK9 A;  2IBF A;  4MS2 A;  3V5Z A;  2WPV A;  4E7S A;  2RFA A;  2WXM A;  1HH8 A;  2H6F A;  2HS5 A;  1FT2 A;  3EHR A;  1U3C A;  5CEA A;  3N0T A;  3TL5 A;  4JHR A;  4B0Z A;  2WXH A;  1OW6 A;  3UMI A;  3EJN A;  1NP7 A;  2H6I A;  3P1U A;  2J08 A;  3KMI A;  2ION A;  1BI8 B;  5AQ9 A;  3UMK A;  1G5Z A;  2EPM X;  2F0Y A;  3G2V A;  5FZS A;  4AJW A;  2LSE A;  3L22 A;  3G50 A;  4YT5 A;  3CHS A;  3UI2 A;  2Y1L E;  1WY6 A;  2WZL A;  2XGM A;  3ZXP A;  5DIZ A;  3NQP A;  4CIP A;  3E9V A;  1SA5 A;  5DQZ A;  5G05 J;  1G3N B;  2WXR A;  2XL8 A;  3TWR A;  5L0F A;  4I9C A;  4L2Y A;  4KBL A;  3S28 A;  5HI7 A;  4GTQ A;  3M15 A;  2VJ8 A;  1ZHW A;  4M63 A;  2WXP A;  2R25 A;  2WXQ A;  3JSE O;  5JA4 D;  2WXF A;  1D0Z A;  2PM7 A;  1QZ2 A;  3D9M A;  1Y6I A;  3FU3 A;  3O6X A;  2IOL A;  3MA5 A;  4IWB A;  3ML9 A;  2JX0 A;  2A68 F;  3ZQV A;  4OAV B;  1ZU4 A;  4G0H A;  1D1B A;  4JL0 A;  3VLE A;  1WGW A;  1HU3 A;  4CGW A;  5GPG B;  4A4A A;  5J08 A;  4GTR A;  3BEH A;  5A6B A;  4C0E A;  2EIM C;  2CFU A;  1Z6A A;  4Z9H A;  4J8F A;  5ENN A;  1NFO A;  3KYJ A;  1AVO B;  3UM2 A;  3QW0 A;  1B89 A;  2AU5 A;  1K1B A;  2KQ9 A;  1NFI E;  3C72 A;  4PS7 A;  3HG0 D;  3AG3 C;  2LIG A;  3TUL A;  3AGT A;  4K5C A;  3RK6 A;  4DRI B;  1AUE A;  1RMV A;  1OKK D;  4N5Q A;  4CDM A;  4W8K A;  2LNI A;  1SQM A;  2GRR B;  2CW0 F;  2EPO A;  1OY3 D;  2HM8 A;  3HNI A;  3HJC A;  2WVQ A;  2XL6 A;  1JUQ A;  3AS4 A;  3C8G D;  3QDN A;  1WG0 A;  1EDU A;  3C8Z A;  3EG9 B;  2R7X A;  1I4Z A;  4WAF A;  2HKV A;  3E4B A;  3JXJ A;  1ZYR F;  2WXO A;  3FH7 A;  2ZXW E;  2PZI A;  3W2V A;  1APC A;  5ENP D;  3JT1 A;  2VGX B;  4U63 A;  4JTA B;  1X5B A;  2P9P G;  3U0C A;  3OXG A;  2WL8 A;  3PNT B;  1D1A A;  2EPK X;  3C63 A;  3SO8 A;  4DLO A;  3W9F A;  4AL1 A;  5BQH A;  1NI1 A;  3DJU B;  1T9K A;  4CDY A;  4ULV A;  5G04 C;  3RSE G;  4Q5S F;  2IEJ A;  2YNQ A;  3J5P A;  1A5E A;  3J5Q B;  3FUL A;  1HO8 A;  3JYS A;  4W9R A;  3ULE G;  3CVW A;  3KSQ A;  3EH1 A;  1GW6 A;  3Q49 B;  3OWT A;  1ZVZ A;  1UN8 A;  4DRH B;  1OXB A;  2X6K A;  4OIR F;  5EN5 D;  3ZVR A;  4WGY A;  4AVX A;  1YA0 A;  4HFF B;  2LSU A;  1EYH A;  4JEU A;  2ETA A;  2QZA A;  4YK5 A;  4HOR A;  3RU0 A;  2IO3 C;  2J0W A;  5L0J A;  2V3C C;  3PMR A;  2QNL A;  1LVK A;  3C7J A;  3E70 C;  3LES A;  1HMO A;  3CK9 A;  3MFN A;  3LKU A;  2LCH A;  2YL3 A;  4A1G A;  3SZ7 A;  4U8H A;  5A6C A;  5KJK A;  4N2S A;  3O39 A;  1D9S A;  2XEE A;  3PZ1 A;  5KYW B;  1TN8 A;  4U5E E;  2DVW A;  4LAC B;  3U64 A;  4Q96 A;  1O87 A;  3L8I A;  3CHR A;  1Q0F A;  1K40 A;  4P6I C;  4I9E A;  1FFT C;  2YL7 A;  4XEF A;  5FQ8 A;  2XEV A;  3Q7F A;  2GRO B;  1OW7 A;  1ZHX A;  4OIO F;  3DD7 A;  1D0Y A;  3SF4 A;  2FGY A;  4A2N B;  3Q7L A;  4IB4 A;  1LD7 A;  1ZU2 A;  4L23 A;  4I1M A;  3IXE A;  4ILI A;  1KLX A;  1N0R A;  3IQT A;  1E7V A;  1IHB A;  2YHE A;  4LER A;  1OKK A;  3IPM O;  2RG8 A;  1OQC A;  4O1O A;  4WWP A;  5JHA A;  4ONS A;  1TWC A;  5CCM A;  2R7V A;  3ZU7 B;  4GMJ A;  4JRZ A;  2R17 C;  3CSF A;  4LUN U;  1BR4 A;  3CQC B;  4BT9 A;  4YDO A;  4RSY A;  3QWV A;  1Z6T A;  1HX8 A;  5EGY A;  3B7R L;  4ANV A;  1N4S A;  5LFA A;  4RVB A;  5ENT D;  2FBN A;  3FHE A;  4H4K C;  3L9T A;  4NQF A;  3RVY A;  4FX5 A;  5F5F A;  4B8C B;  1EQ1 A;  5E76 A;  3BQO A;  1ZB1 A;  4U5D E;  1IHG A;  2XCB A;  2QFC A;  3KSL A;  3GOD A;  3E37 A;  3MV2 B;  3ABK C;  3TJ6 A;  4KMO A;  1Z7Q c;  4Q69 A;  1U0B B;  2OG2 A;  3NOG D;  4PJL A;  5IY5 C;  3CVN A;  4C3E A;  3LPZ A;  4AIF A;  2G62 A;  1E2X A;  1A41 A;  3FY4 A;  3B71 A;  1V55 C;  1TR4 A;  3CHM A;  2GRP B;  2WZG A;  5E33 A;  1MX2 A;  2A0B A;  2XEN A;  1O1S A;  3MBG A;  2VSX E;  3UQ3 A;  2L6H A;  4CDN A;  3HVE A;  3ISM C;  4GYO A;  4LRZ A;  4YWQ A;  3NOC D;  2QY7 A;  4MBG A;  4ABN A;  3LCA A;  2Q9B A;  2I9C A;  2X51 A;  3ASO C;  4CDR A;  2RSE B;  4CS7 A;  4BSX A;  4J7W A;  3CAX A;  4FES A;  3CR3 A;  3DEO A;  4F6R D;  3QNK A;  4GTM A;  3N2Z B;  5DS4 A;  4RG6 A;  3ZYM A;  5CMW A;  3LY8 A;  5EDS A;  2XHE A;  3JQ1 A;  3T9O A;  1CPR A;  1CGO A;  1MMN A;  4G7O F;  4KNW A;  4AL0 A;  4CJG A;  2C0L A;  4N3C A;  1TN6 A;  1JPN A;  2F37 A;  3OXL A;  2B0H A;  4TRQ A;  3S7F A;  5CI8 A;  4TXQ A;  2QTV A;  3Q7A A;  5FTP A;  1J8Y F;  1TNU A;  3NB2 A;  1NL4 A;  4BX8 A;  3UXG A;  5KWD A;  2YZS A;  2P6V A;  3HXB A;  1NSG B;  2YHC A;  3ZN3 A;  5HV9 A;  3RYL A;  3LS1 A;  3FU6 A;  5DQT A;  1G8X A;  3O10 A;  1WN0 A;  5B3S E;  1FMW A;  5BNW A;  3LEW A;  5K0I A;  3NAW A;  4ULW A;  2AWC A;  2VC9 A;  2PL2 A;  4UI9 C;  2G3V A;  2ZPA A;  2X6H A;  5CHE E;  1MQV A;  1LS1 A;  1Y4C A;  4NQ0 A;  2L9J A;  1YYJ A;  3C3O A;  4YT4 A;  5ENO D;  3Q9N C;  2OVB A;  5G2N A;  3DSV A;  3IHV A;  4KI2 A;  1ORY A;  1TNY A;  5ENR D;  1ORS C;  2AWY A;  3KEZ A;  4Y6W A;  1M6T A;  3O55 A;  4IJJ A;  1TWH A;  1NU9 C;  2CDQ A;  4K7B A;  4WGZ A;  1E86 A;  1MMG A;  5L0I A;  4I17 A;  2YRF A;  4MVO A;  4A63 B;  4FWV A;  3FUK A;  3C3Q A;  2XGO A;  1I4Y A;  3Q79 A;  4GYY A;  1O5H A;  2AXZ A;  4EHM A;  4XKB A;  5A6J A;  3K9I A;  5LCW C;  3TWW A;  3UMV A;  4UWL A;  5KJM A;  4BSZ B;  3JUI A;  5D0Q D;  4U95 D;  3ZTM A;  3ZFW A;  3R7Q A;  4EBA A;  2XZD G;  3JXI A;  1H6K A;  1LD8 A;  4W8P A;  1K1A A;  4KBQ A;  3B0P A;  2QYJ A;  3ABL C;  4L9P A;  3G2S A;  1Q0G A;  2A5E A;  4UWF A;  2IXP A;  1E7U A;  4BEP A;  3FEY A;  2D4U A;  4U0Z A;  4LG6 A;  3B29 A;  3ZKJ A;  1Z5S C;  3NMJ A;  3JYH A;  2GRL A;  4IYP A;  2IXM A;  1OCO C;  5T1D B;  4GA2 A;  1NA0 A;  2KZT B;  4NC3 A;  2DZO A;  3Q7G A;  2KC3 A;  3B7B A;  3H2U A;  4WWO A;  2R59 A;  1DCE A;  4AV7 A;  4JEB A;  5FJY A;  4C9B B;  4FLB A;  5T3T A;  2NC9 A;  1VYI A;  1N4P A;  4G24 A;  4G8K A;  3URZ A;  3LNM B;  3SI5 A;  4MTO A;  1QKR A;  1A7E A;  4AY5 A;  3NF1 A;  4CZ2 D;  1T01 A;  1SZA A;  1OT8 A;  3QWW A;  1KT0 A;  4C7O B;  3TXM A;  1E83 A;  2L81 A;  4JZA A;  4XI9 A;  5BXO A;  2QE9 A;  5BQG A;  4JB8 P;  2DWZ A;  5B1B C;  3IQC A;  4ANJ A;  3F47 A;  2BE5 F;  4ER9 A;  1YVI A;  4JXT A;  4BET A;  2PP4 A;  2J07 A;  4G25 A;  4LDQ A;  3POV A;  2KC7 A;  3S29 A;  1LM3 B;  3ZC4 A;  3DPD A;  4PK4 A;  4UI9 K;  5AQA A;  1H19 A;  4FP7 A;  2KM4 A;  4N39 A;  2AVK A;  3Q9U C;  3BUA A;  1QQ3 A;  3UM0 A;  1RKC A;  3QVZ A;  4GZ5 A;  3QMK A;  3HXF A;  3APD A;  2ZXP A;  1H2U A;  5B1A E;  4APF A;  3KS2 A;  2P7V A;  5G55 A;  1OCC C;  3UM3 A;  3B7T A;  2OVF A;  2I15 A;  1WOL A;  3UIO C;  1VYK A;  3RQG A;  4YT2 A;  4U04 A;  2HMQ A;  4GPK A;  4U07 A;  3NKD A;  4D4X A;  2LXL A;  1ZU5 A;  1YJG A;  3Q6M A;  2BED A;  3ZDL A;  4GA1 A;  4KT6 B;  3SGH A;  3KH2 A;  2R7S A;  3K7D A;  3I4U A;  2L0T B;  2HO1 A;  2B0J A;  4G11 A;  4JZY A;  4WJ0 A;  1QLE C;  2L9B A;  4WNG A;  2J09 A;  3E32 A;  3SEO A;  3ZIM A;  5CI9 A;  3RVZ A;  2W4B A;  3S9O A;  3ZHE B;  1O3U A;  1V74 B;  2YL0 A;  3QTH A;  3O4Z A;  2DI3 A;  2R7U A;  2NPU A;  3CVY A;  3ZW3 A;  1L3P A;  5ANR A;  1IW7 F;  2C0M A;  1HW1 A;  4DVY P;  2WXG A;  2Z15 A;  3CK7 A;  4HE8 D;  2YLG A;  4HNA D;  4LNB A;  1JOG A;  2IFU A;  1TKN A;  3FH8 A;  3Q15 A;  5J90 A;  5BUO A;  3ASN C;  2WXI A;  3ZG1 A;  4PR9 A;  1VDY A;  2GWW A;  2J0X A;  3ONL A;  3BRJ A;  3CKB A;  4I44 A;  3GZ1 A;  1OWO A;  4IAR A;  1IQR A;  2UUI A;  3V5Y A;  3FDQ A;  3CVP A;  2R05 A;  3VYW A;  2NSZ A;  3HRA A;  3OAW A;  3ASF A;  3QWP A;  1RZ4 A;  4L7T A;  2GW1 A;  2VSY A;  3JUE A;  3AG2 E;  5E3C A;  2H6H A;  3DM5 A;  3HNL A;  3DRA A;  1OWM A;  4YT8 A;  2IXN A;  2Q7R A;  1F1M A;  3FTS A;  4MRU A;  1ELR A;  4EHP A;  1HFA A;  4YDW A;  4DK5 A;  3VRC A;  4C3D A;  1OCZ C;  4KVO A;  4UWH A;  1N1C A;  4R32 A;  2UUH A;  1RKE B;  3CSK A;  3P2B A;  3NKE A;  4KZ0 A;  5BXU A;  4MVS A;  3UKR G;  1TYQ G;  2MWQ A;  3PCV A;  4B8A A;  5T3W A;  1K05 A;  4TXP A;  3C62 A;  3AOU A;  3I4G A;  5D92 A;  1PD1 A;  1BPO A;  4JTC B;  1O5M A;  1UJK A;  3FUF A;  1JAF A;  2LK4 A;  2J4D A;  3GM3 A;  1ZHZ A;  3EHQ A;  2WXN A;  3SBS A;  4CCA A;  2LD6 A;  3AG1 C;  2Q00 A;  3WXX A;  3FVY A;  3S0X A;  4HFK B;  2Y4U A;  3GWL A;  3F46 A;  4YJW A;  3WG7 E;  3H65 A;  3KEA A;  3I3N A;  4J0U A;  3PVL A;  4Q7C A;  3UT8 A;  4G7Z F;  3W2W A;  2BKG A;  4NTB A;  5CIV A;  3PE3 A;  2OEX A;  3B7S A;  4E6H A;  5AN8 A;  5EX0 A;  3ZTZ A;  5T8I A;  5LX8 A;  2PQN A;  3MZL B;  1NZN A;  3L1M A;  5D2M C;  1AEP A;  4DX1 A;  4PFO A;  1MZC A;  3FTU A;  1FNT c;  1ZHT A;  2HR2 A;  2VGE A;  4I6G A;  1YZC A;  3RO3 A;  1CPQ A;  2R7R A;  3OA1 A;  5CMY A;  5JSL A;  3LJB A;  4K1O A;  1UG3 A;  2OND A;  1BDJ B;  1HE8 A;  3LLI A;  4UDV A;  2XPZ A;  4P29 A;  2BTD A;  4ME2 A;  5DVW A;  4MKT A;  1OXJ A;  1ELW A;  4LEU A;  2Q3T A;  2KK1 A;  1HF8 A;  4JHK A;  1UOH A;  1AP7 A;  1Z3X A;  2AXV A;  2XLW A;  2J4B A;  3RFY A;  4XTK A;  3ASH A;  3LVR E;  4K03 A;  5BT1 A;  4HRL A;  2YQ8 A;  4JCH A;  4C0M A;  4M3O A;  1D1C A;  2Q9A A;  3NMI A;  2M4E A;  4WNE A;  4GZ3 A;  4L2L A;  1PV3 A;  2A1D D;  1A0B A;  1WDY A;  2PNN A;  1SYQ A;  2J8W A;  2BUG A;  3DAG A;  3ABM C;  2XLH A;  5HRY A;  2I6H A;  3IKO B;  3EZI A;  3KAE A;  4XZ4 A;  1Z23 A;  3SNX A;  3ZYL A;  3CVX A;  5FIO A;  2PM6 A;  2OQM A; 
#chains in the Genus database with same CATH homology
 4RD9 A;  1RJ9 A;  5AYW D;  3Q5M A;  3SBT B;  5E3A A;  4UWG A;  3APC A;  2CNW D;  3T4R A;  4HOS A;  4KC9 A;  4WUY A;  2AW6 A;  2X38 A;  2HV7 A;  3Q4A B;  3CHP A;  4YND A;  3AG4 C;  3N71 A;  4U5B E;  3ZRH A;  4MQ9 F;  4BJ1 A;  5AEN A;  4G1T A;  3EQL F;  2GRM A;  1Z5Z A;  3U66 A;  2AWI A;  4GU5 A;  4UWK A;  1HS6 A;  3FU0 A;  4DVZ A;  3B13 A;  3CK8 A;  1EPU A;  4AM9 A;  4Q4Z F;  4KVM A;  5A7D B;  2R7T A;  5ARF A;  4DBR A;  2KNH A;  2H7O A;  2W4M A;  5KYY A;  2X6I A;  4ACL A;  4BFR A;  4C7O A;  4RG9 A;  2H7V C;  3V7O A;  4GYW A;  3QKY A;  3RIP A;  3T6B A;  3IEG A;  3ASG A;  3CVQ A;  4AP2 A;  3B0U X;  4YVQ C;  1H2T C;  4U0S A;  3QZC A;  4EBB A;  2UWJ G;  1PCX A;  4XLN F;  1FCH A;  2CG2 A;  4O6M A;  3UNG C;  3LY7 A;  1KU2 A;  4NAC A;  3SD5 A;  3MKQ B;  3ZVV A;  3EFO A;  2X3M A;  1XGW A;  1P5Q A;  4OIP F;  4F1S A;  2Q9C A;  2E0I A;  3B7U X;  3FUD A;  2I2O A;  1N54 A;  2V5F A;  3FUM A;  5LCW J;  2V8S E;  3WOD F;  3ITF A;  2EIN C;  2XSE A;  3ZHE A;  5BV1 A;  1FMV A;  1M57 C;  4IN3 B;  1WAO 1;  1MQS A;  4A3T A;  2PFD A;  2J9V A;  2Y39 A;  2A6E F;  4IUL A;  5A23 A;  2UY1 B;  2NUP A;  3CHO A;  4OD5 A;  4U5H A;  4XIF A;  4CEM A;  2RD0 A;  4LCT A;  2WMO A;  2VTB A;  2ZXR A;  2LAH A;  2EIK C;  4RDA A;  2O9X A;  4G7H F;  4GA0 A;  3S7B A;  2IYL D;  3BEE A;  4DI4 A;  4EZK A;  2YHS A;  3FUE A;  3EIQ C;  4GAA A;  2NUT A;  2EIL C;  3L6A A;  2XXA A;  4FLH A;  3MLG A;  4EZL A;  2KCK A;  2IU1 A;  2Y69 C;  3S7D A;  4Q94 A;  2LAI A;  5HQ8 A;  3QAR A;  5F5H A;  2P58 C;  1NA3 A;  3U4T A;  3NG1 A;  3QOU A;  4ILG A;  3JSZ A;  2MHK A;  1J8M F;  2QY9 A;  2OCC C;  3K6B A;  4J32 B;  4PFP A;  2GFH A;  2WB2 A;  3UT4 A;  3QC1 A;  3MV3 B;  3JQ0 A;  4DLQ A;  4TUU A;  4JJF A;  4JPS A;  1BR1 A;  2I8B A;  1ZBP A;  3VTX A;  3DAF A;  3CKC A;  4YN0 B;  4E85 A;  4J8D A;  4AE4 B;  3T8M A;  2ILR A;  4FC8 A;  3RKV A;  1INZ A;  3D3M A;  3DMD A;  4JA7 A;  3UGP A;  3UUX A;  1D0X A;  3IHY A;  4GML A;  1U3D A;  3FTW A;  4HXI A;  3D9I A;  5LOZ A;  1TJC A;  2MRI A;  4ATG A;  2R7W A;  4CSA C;  2CHZ A;  2J7P D;  1KT1 A;  3LY9 A;  3LS8 A;  4G26 A;  3K1I C;  3I4R B;  4O7G A;  3L16 A;  4ANW A;  5BPP A;  4DBQ A;  3ESK A;  3AQB A;  2J9U A;  4EZJ A;  1VK5 A;  2IQC A;  2XQ0 A;  4U5C E;  2NG1 A;  2L6J A;  4BX9 A;  3VLD A;  3TGO A;  3LYA A;  4CBE A;  2HV6 A;  3EG9 A;  3S27 A;  5CCL A;  3FTV A;  3PNL B;  3CLJ A;  4XLP F;  5EHH A;  3LJ3 A;  4CS9 C;  2VGX A;  4LLE A;  3GAN A;  4BG0 A;  4DI3 A;  4CGV A;  3ASD A;  3GW4 A;  4WNF A;  2WQ7 A;  4I43 A;  4A1S A;  3I5Q A;  4OYS A;  5BUZ A;  2Y3D A;  1ELK A;  5FZQ A;  1VMA A;  2M63 A;  3NRH A;  3O48 A;  3Q6N A;  1TWG A;  3RH3 A;  4B6I A;  3QB2 A;  3HDX A;  4BTB A;  1M2V B;  3EH2 A;  4I1A A;  4BY6 A;  5EX3 A;  3NYM A;  3IV0 A;  3FUJ A;  3NYJ A;  4NUR A;  2L0I A;  2VB6 A;  3BG0 B;  3JRT A;  4FA6 A;  3EGX B;  2A69 F;  2D5R B;  5KYW A;  2JEK A;  2WXJ A;  3W8H A;  1LF8 A;  3PS6 A;  3PE4 A;  3PH0 C;  2NXP A;  4TV3 A;  3EZH A;  5T4Y A;  3MKQ A;  5DLJ A;  2AVP A;  2MYS A;  2E87 A;  5FQ7 A;  4H7Y A;  1IYG A;  3HIZ A;  1JPJ A;  4IAO A;  1M2O A;  3SHF A;  4OD4 A;  2VAS A;  2C04 A;  2W45 A;  2H7B A;  3IBE A;  3FFL A;  4FHK A;  2R7O A;  2E2E A;  3DJN B;  4GZ6 A;  3FTY A;  1E8W A;  1UJJ A;  4CT0 A;  3TG4 A;  4URK A;  4EPZ A;  4KXK B;  1H2V C;  1TR2 A;  4I1O B;  4OVV A;  1OUV A;  1HG5 A;  2KGO A;  4CSA A;  4F53 A;  1HXI A;  5AJL A;  3VLF A;  4O79 A;  3AU5 A;  4O6F A;  3FUN A;  4BJT A;  3ECS A;  3ZEF A;  4GCN A;  2WXK A;  1ST6 A;  3S2A A;  3DXJ F;  3NYL A;  3FUH A;  5G04 J;  3LAY A;  3APF A;  1Z3I X;  3GZS A;  5KYU B;  1IZM A;  3FWV A;  2YIN A;  4G2V A;  3UMH A;  3CQG B;  1VOM A;  4PS8 A;  3DZA A;  4KNV A;  1NU7 D;  2A5U A;  3D9P A;  2WMN A;  3FH5 A;  4F7A A;  3D9J A;  3LVQ E;  2AXU A;  2FI7 A;  5AIJ A;  2VSO E;  4CS9 A;  4F4B A;  3FTX A;  1OWL A;  1A17 A;  2EIJ C;  5JJT A;  4GEH A;  3GYZ A;  4HFG A;  4KZC A;  3L13 A;  2X6J A;  1MND A;  3PDN A;  2KJG A;  4EEC A;  4ILH B;  3PRE A;  1OWN A;  1FTS A;  4V3I A;  2JLB A;  2GGF A;  4X0R A;  2VQ2 A;  4J8E A;  3ZYK A;  5KJL A;  2IOS A;  4ZLC A;  2XRZ A;  2WB7 A;  4GB9 A;  5BV0 A;  3X1O A;  4UQZ A;  4I3M A;  3QK0 A;  2LSV A;  3AQC A;  5BW8 C;  1HZ4 A;  4WND A;  4GZC A;  4DPR A;  1HG2 A;  2EQX A;  4HOU A;  4AE4 A;  1E96 B;  3LNR A;  3K33 A;  3TD7 A;  4B89 A;  4N3B A;  3U9W A;  4QI0 A;  4U5G A;  1M56 C;  4PJJ A;  4FAD A;  2XGS A;  1JWG A;  3T6J A;  5KYN A;  3HHM A;  3N24 A;  3PEU B;  1MNE A;  4GZD A;  1PD0 A;  3FDH A;  4BWR A;  2W9Y A;  5M72 A;  2ZXW C;  2VGY A;  1SZI A;  3QJZ A;  4XWJ A;  2J45 A;  5ARG A;  2WVN A;  2Q7F A;  4HVB A;  1E90 A;  3FU5 A;  4L1B A;  2XPI A;  3EGD B;  3NZU A;  3RRN B;  1Z63 A;  3RKO F;  3LS0 A;  4O6N A;  4CS8 C;  1OCR C;  3EIJ A;  2C2L A;  1SZ9 A;  2DYR C;  2WZF A;  2I1J A;  2KZT A;  4PH4 B;  3U3W A;  3L0I A;  3CV0 A;  3T5X A;  3UPV A;  2A6H F;  3PUK A;  2VH3 A;  3B9Q A;  2J49 A;  4HOQ A;  3ZPJ A;  3QAQ A;  2KW3 C;  4AX2 A;  2XRY A;  4BTA A;  1FFH A;  2FF4 A;  3AS8 A;  4J30 B;  2DGJ A;  1QNF A;  3R7R A;  4UI9 J;  5FZR A;  4KYO B;  3TAX A;  4F3V A;  4JC8 A;  3L17 A;  4Y6C A;  3PEV B;  5C2Y A;  2BF0 X;  1MMA A;  1M2V A;  1V54 C;  2WQH A;  1QZX A;  3SZR A;  1PAQ A;  5KYX B;  3NZS A;  4A3V A;  5HSW A;  1SMY F;  3L08 A;  3HYM B;  3CVV A;  4N5C A;  2J9W A;  2WVI A;  5C1D A;  2Y3G A;  1QQE A;  2CNW A;  4LLC A;  3K66 A;  3B0V C;  3I5P A;  2DIW A;  3EGX A;  1UW4 B;  3ZGQ A;  4AEZ C;  4PDX A;  4JEH A;  4DOZ A;  3G2T A;  3X2Q C;  2XRH A;  4IRU A;  5G05 C;  1EF1 C;  1FVF A;  4CIH A;  3OTN A;  3TJP A;  3CEQ A;  4PJN A;  3CST A;  3EHN A;  3EHM A;  2XPY A;  4PS3 A;  3ZYQ A;  2Y3A A;  4CRW A;  2ZXO A;  3VTY A;  5D0O D;  4NRH B;  3CHQ A;  4U5F E;  2DBA A;  3AS5 A;  4I2Z A;  1MHQ A;  4OVU A;  3C98 A;  2MOW A;  2Y3H A;  2JD3 A;  3AU4 A;  3LXU X;  5JHB A;  3KKB A;  4MND A;  5JJ6 A;  4FU3 A;  4R7L A;  3CVU A;  4N06 A;  2CG3 A;  4XKC A;  1JPL A;  2IOQ A;  4GYT A;  3RRU A;  3FEX A;  4HEA J;  3T5V A;  4PJM A;  3UT7 A;  4A55 A;  5FT9 A;  3L54 A;  3BG1 B;  4CS8 A;  2PX3 A;  3NDB B;  2J9Q A;  2C03 A;  2PQR A;  5B3S C;  4FUL A;  3W8I A;  2FO7 A;  3FTZ A;  4BJ6 C;  1MMD A;  2V26 A;  5KYU A;  1L5J A;  2CGE A;  2OOE A;  1S7Z A;  1BR2 A;  4GCO A;  4H7X A;  2YEV A;  3RJV A;  4OIN F;  1TWA A;  4HOT A;  4BJ5 C;  3TXN A;  3VAY A;  1TEZ A;  3D9L A;  4EWC A;  4FJY A;  4I6J A;  5EKQ D;  3EDT B;  1N52 A;  3LEV A;  5AJD A;  4EQF A;  5DS6 A;  4JVS A;  3SP1 A;  4WWN A;  4CT4 A;  4HLE A;  1FVH A;  1W3B A;  4B94 A;  3HLZ A;  4AY6 A;  1E8Y A;  5DS5 A;  2V4L A;  5L3Q A;  2PX0 A;  2WM9 A;  1IQU A;  3PRZ A;  3MGB A;  3ULQ A;  2DCP A;  2FFH A;  3RRM B;  1XNF A;  3ENE A;  2WQ6 A;  4QFV A;  3ZSU A;  2FUL A;  3MYV A;  4J6I A;  3R9A B;  1RJ9 B;  3PHF 2;  4JUR I;  5JJ7 A;  3EPV A;  2ZU6 B;  3CGH A;  4PUC A;  3ONK A;  3MJW A;  4D10 C;  3FHD A;  3MEK A;  2IXO A;  3CVL A;  5KJN A;  3FP3 A;  3FAJ A;  3SYN A;  5E75 A;  3CZ6 A;  3FUI A;  4UQY A;  5D91 A;  5DBK A;  3IEE A;  3PZD A;  3D9O A;  3MKR A;  3G2U A;  3CIA A;  3EGD A;  2X6F A;  4U0U A;  2XL4 A;  3UGO A;  4RBN A;  1ZHY A;  4YVO A;  4N3A A;  4K0D A;  4ANX A;  2I1K A;  5B1A C;  4ANU A;  3K1H A;  4K0R A;  2J46 A;  4MLP A;  1OWP A;  1E8Z A;  3MX3 A;  3PUJ A;  4AOF A;  1NZE A;  1DNP A;  3KD7 A;  5KYY B;  2KCL A;  5T3R A;  3JCK C;  4JW1 A;  4ZLD A;  2A4Z A;  2IJG X;  4UQX A;  1WM5 A;  2CHX A;  5FCL A;  1LKX A;  4BJ6 A;  3D9K A;  4XI0 A;  3GZ2 A;  3SFZ A;  4I2W A;  2KCV A;  5ANL A;  1PC2 A;  3OXF A;  3D9N A;  4J8S A;  3DM9 B;  3JCU Q;  3LLK A;  1DVP A;  3LDZ A;  3OEO A;  4BJ5 A;  3UR3 C;  2J7P A;  5KYX A;  4QDL A;  3EFO B;  2XCC A;  2Y4T A;  4XE0 A;  1TJF A;  2R5S A;  3RO2 A;  4G23 A;  2VYI A;  4NY3 A;  1JWF A;  4OIQ F;  3L34 A;  1SF8 A;  4JJG A;  1Y8M A;  5E2Q A;  4MS6 A;  3ESL A;  4EBA G;  3AG2 C;  4XX5 A;  2LO6 A;  5L3V A;  4APO A;  3ZXS A;  3S7J A;  2FEZ A;  4DJA A;  3CQZ A;  2VSN A;  4HS2 A;  4JHJ A;  2DYS C;  5FQ6 A;  4AXH A;  2WVO A;  2NUP B;  5FQ4 A;  3HTK C;  1E8X A;  2PF4 E;  1S0P A;  2UY1 A;  3G2W A;  4QI2 A;  4FJZ A;  3Q47 B;  2WXL A;  4ACK A;  4N2Q A;  3MCX A;  2IF4 A;  4FHJ A;  2VTB B;  2KAT A;  5LP0 A;  2CHW A;  1W2W A;  3M1C B;  4E7Z A;  3WG7 C;  3SNH A;  2R7Q A;  4I6E A;  3HVE B;  2NUT B;  5FWQ A;  2OV8 A;  2XXA B;  3ML8 A;  4JA9 A;  4C3B A;  3TG5 A;  1H0A A;  4BEJ A;  1PY1 A;  3UX4 A;  3DBS A;  2CFZ A;  2V0P A;  4BT8 A;  3ZIB A;  3KL4 A;  1Z3Y A;  4O6Y A;  3RIB A;  2Y3B A;  1UN9 A;  5KCM A;  1NG1 A;  2G3K A;  4AK9 A;  2WPV A;  4E7S A;  2WXM A;  1HH8 A;  1U3C A;  3N0T A;  3TL5 A;  4JHR A;  4B0Z A;  2WXH A;  3UMI A;  3P1U A;  3EJN A;  1NP7 A;  2J08 A;  3KMI A;  2ION A;  3UMK A;  3G2V A;  5FZS A;  4AJW A;  2LSE A;  3L22 A;  4YT5 A;  3CHS A;  1WY6 A;  2WZL A;  2XGM A;  5DIZ A;  3NQP A;  3E9V A;  5DQZ A;  5G05 J;  2WXR A;  4I9C A;  4L2Y A;  4KBL A;  3S28 A;  5HI7 A;  2VJ8 A;  1ZHW A;  4M63 A;  2WXP A;  2WXQ A;  2WXF A;  1D0Z A;  2PM7 A;  1QZ2 A;  3D9M A;  1Y6I A;  3FU3 A;  3O6X A;  2IOL A;  3MA5 A;  4IWB A;  3ML9 A;  2A68 F;  1ZU4 A;  4G0H A;  1D1B A;  4JL0 A;  3VLE A;  1WGW A;  1HU3 A;  4CGW A;  5J08 A;  4C0E A;  2EIM C;  2CFU A;  1Z6A A;  4J8F A;  5ENN A;  1B89 A;  2KQ9 A;  4PS7 A;  3AG3 C;  3RK6 A;  1OKK D;  4CDM A;  4W8K A;  2LNI A;  1SQM A;  2CW0 F;  2HM8 A;  3HJC A;  2WVQ A;  1JUQ A;  3AS4 A;  3QDN A;  1EDU A;  3EG9 B;  2R7X A;  4WAF A;  3E4B A;  1ZYR F;  2WXO A;  3FH7 A;  2PZI A;  3W2V A;  3JT1 A;  2VGX B;  4U63 A;  1X5B A;  3OXG A;  2WL8 A;  3PNT B;  1D1A A;  4DLO A;  3DJU B;  5G04 C;  4Q5S F;  2YNQ A;  3FUL A;  1HO8 A;  3JYS A;  4W9R A;  3CVW A;  3EH1 A;  1GW6 A;  3Q49 B;  3OWT A;  1UN8 A;  2X6K A;  4OIR F;  3ZVR A;  4AVX A;  1YA0 A;  4HFF B;  2LSU A;  1EYH A;  4JEU A;  4HOR A;  3RU0 A;  2J0W A;  2V3C C;  3PMR A;  1LVK A;  3E70 C;  3LES A;  3CK9 A;  3LKU A;  4A1G A;  3SZ7 A;  4U8H A;  5A6C A;  5KJK A;  4N2S A;  3O39 A;  5KYW B;  4U5E E;  4LAC B;  3U64 A;  4Q96 A;  1O87 A;  3CHR A;  4P6I C;  4I9E A;  1FFT C;  5FQ8 A;  2XEV A;  1ZHX A;  4OIO F;  3DD7 A;  1D0Y A;  3SF4 A;  2FGY A;  4A2N B;  3Q7L A;  1ZU2 A;  4L23 A;  4ILI A;  4I1M A;  1KLX A;  1E7V A;  2YHE A;  4LER A;  1OKK A;  2RG8 A;  4WWP A;  5JHA A;  5CCM A;  1TWC A;  2R7V A;  4GMJ A;  2R17 C;  3CSF A;  4LUN U;  1BR4 A;  3CQC B;  4BT9 A;  4RSY A;  3QWV A;  1Z6T A;  1HX8 A;  5EGY A;  3B7R L;  4ANV A;  5LFA A;  4RVB A;  2FBN A;  3FHE A;  4H4K C;  4FX5 A;  5F5F A;  4B8C B;  5E76 A;  4U5D E;  1IHG A;  2XCB A;  2QFC A;  3GOD A;  3MV2 B;  3ABK C;  4KMO A;  4Q69 A;  2OG2 A;  4PJL A;  5IY5 C;  3CVN A;  4C3E A;  3LPZ A;  4AIF A;  2G62 A;  3FY4 A;  1V55 C;  3CHM A;  2WZG A;  5E33 A;  2VSX E;  3UQ3 A;  4CDN A;  3HVE A;  4GYO A;  4LRZ A;  4YWQ A;  2QY7 A;  4ABN A;  3LCA A;  2Q9B A;  2I9C A;  2X51 A;  3ASO C;  4CDR A;  4CS7 A;  4BSX A;  3CR3 A;  4FES A;  3QNK A;  3N2Z B;  5DS4 A;  4RG6 A;  3ZYM A;  5CMW A;  3LY8 A;  5EDS A;  2XHE A;  3JQ1 A;  1MMN A;  4G7O F;  4KNW A;  2C0L A;  4N3C A;  1JPN A;  3OXL A;  4TRQ A;  3S7F A;  5CI8 A;  2QTV A;  5FTP A;  1J8Y F;  4BX8 A;  2YZS A;  2P6V A;  2YHC A;  3ZN3 A;  3RYL A;  3LS1 A;  3FU6 A;  5DQT A;  1G8X A;  1FMW A;  5BNW A;  3LEW A;  4ULW A;  2PL2 A;  4UI9 C;  2G3V A;  2ZPA A;  2X6H A;  5CHE E;  1LS1 A;  4NQ0 A;  2L9J A;  4YT4 A;  2OVB A;  5G2N A;  3IHV A;  4KI2 A;  3KEZ A;  4Y6W A;  4IJJ A;  1TWH A;  1NU9 C;  2CDQ A;  4K7B A;  1MMG A;  4I17 A;  4FWV A;  3FUK A;  2XGO A;  4GYY A;  1O5H A;  2AXZ A;  4XKB A;  3K9I A;  5LCW C;  3UMV A;  4UWL A;  5KJM A;  3JUI A;  5D0Q D;  3ZFW A;  3R7Q A;  4EBA A;  1H6K A;  4KBQ A;  3B0P A;  3ABL C;  3G2S A;  4UWF A;  2IXP A;  1E7U A;  3FEY A;  4U0Z A;  3JYH A;  2GRL A;  4IYP A;  2IXM A;  1OCO C;  5T1D B;  4GA2 A;  1NA0 A;  2KZT B;  3Q7G A;  4WWO A;  2R59 A;  4AV7 A;  5FJY A;  4C9B B;  4FLB A;  5T3T A;  2NC9 A;  1VYI A;  4G24 A;  3URZ A;  3SI5 A;  4AY5 A;  3NF1 A;  1SZA A;  3QWW A;  1KT0 A;  4C7O B;  3TXM A;  2L81 A;  4JZA A;  4XI9 A;  5B1B C;  4ANJ A;  3F47 A;  2BE5 F;  4JXT A;  2PP4 A;  2J07 A;  4G25 A;  3POV A;  2KC7 A;  3S29 A;  3ZC4 A;  3DPD A;  4PK4 A;  4UI9 K;  1H19 A;  4FP7 A;  2KM4 A;  4N39 A;  4GZ5 A;  3QMK A;  3APD A;  2ZXP A;  1H2U A;  4APF A;  3KS2 A;  2P7V A;  5G55 A;  1OCC C;  3B7T A;  2OVF A;  1VYK A;  4YT2 A;  4U04 A;  4GPK A;  4U07 A;  3NKD A;  1ZU5 A;  3Q6M A;  4GA1 A;  4KT6 B;  3SGH A;  3KH2 A;  2R7S A;  3K7D A;  3I4U A;  2L0T B;  2HO1 A;  2B0J A;  4G11 A;  4JZY A;  4WJ0 A;  1QLE C;  2L9B A;  4WNG A;  2J09 A;  3SEO A;  3ZIM A;  5CI9 A;  2W4B A;  3ZHE B;  3O4Z A;  2R7U A;  3CVY A;  3ZW3 A;  5ANR A;  1IW7 F;  2C0M A;  4DVY P;  2WXG A;  2Z15 A;  3CK7 A;  4HE8 D;  2IFU A;  1TKN A;  3FH8 A;  3Q15 A;  5J90 A;  5BUO A;  3ASN C;  2WXI A;  3ZG1 A;  1VDY A;  2J0X A;  3ONL A;  3CKB A;  4I44 A;  3GZ1 A;  1OWO A;  1IQR A;  3FDQ A;  3CVP A;  3VYW A;  3OAW A;  2NSZ A;  3ASF A;  3QWP A;  4L7T A;  2GW1 A;  2VSY A;  5E3C A;  3DM5 A;  1OWM A;  4YT8 A;  2IXN A;  3FTS A;  4MRU A;  1ELR A;  1HFA A;  4DK5 A;  4C3D A;  1OCZ C;  4KVO A;  4UWH A;  1N1C A;  3CSK A;  3P2B A;  3NKE A;  4KZ0 A;  2MWQ A;  4B8A A;  5T3W A;  3I4G A;  5D92 A;  1PD1 A;  1BPO A;  3FUF A;  1UJK A;  2J4D A;  1ZHZ A;  2WXN A;  3SBS A;  4CCA A;  3AG1 C;  3WXX A;  3FVY A;  3S0X A;  4HFK B;  2Y4U A;  3F46 A;  4YJW A;  3H65 A;  3I3N A;  4J0U A;  3PVL A;  4Q7C A;  3UT8 A;  4G7Z F;  3W2W A;  3PE3 A;  3B7S A;  4E6H A;  5EX0 A;  5T8I A;  5LX8 A;  2PQN A;  3MZL B;  1NZN A;  4PFO A;  3FTU A;  1ZHT A;  2HR2 A;  4I6G A;  3RO3 A;  2R7R A;  3OA1 A;  5CMY A;  3LJB A;  1UG3 A;  2OND A;  1HE8 A;  3LLI A;  2XPZ A;  4P29 A;  2BTD A;  4ME2 A;  5DVW A;  4MKT A;  1ELW A;  4LEU A;  2Q3T A;  1HF8 A;  4JHK A;  1Z3X A;  2AXV A;  2J4B A;  3RFY A;  4XTK A;  3ASH A;  3LVR E;  4K03 A;  5BT1 A;  2YQ8 A;  4JCH A;  4C0M A;  4M3O A;  1D1C A;  2Q9A A;  2M4E A;  4WNE A;  4GZ3 A;  4L2L A;  2A1D D;  2BUG A;  3DAG A;  3ABM C;  2I6H A;  3IKO B;  3EZI A;  3KAE A;  4XZ4 A;  1Z23 A;  3SNX A;  3ZYL A;  3CVX A;  2PM6 A;  2HYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...