4JVZA

Structure of thermosynechococcus elongatus ccml
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
94
structure length
92
Chain Sequence
b'MKIARVCGTVTSTQKEDTLTGVKFLVLQYLGGEFLPDYEVAADTVGAGQDEWVLVSRGSAARHIINGTDKPIDAAVVAIIDTVSRDNYLLYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Two new high-resolution crystal structures of carboxysome pentamer proteins reveal high structural conservation of CcmL orthologs among distantly related cyanobacterial species.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Structural protein
total genus 11
structure length 92
sequence length 94
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4jvzA00
4N8X1 4JVZA 2HD3A 2Z9HA 4JW0A 2QW7A 4I7AA 2RCFA 5L37A 4N8FA
chains in the Genus database with same CATH superfamily
1QCBD 1IL2A 1B50A 3NK9A 4B3TL 3J80i 1YHQA 1EOVA 1FNUA 1K3BC 2VUMB 1ZYRC 4L8JA 3OTOL 1GKHA 2IHEA 5C4HA 5JPNC 4OEMB 1PRTC 3LNNA 4J1MA 4DK1A 1SNOA 1Z6HA 3K7UC 3QOJA 5CBAE 1MI2A 3TP5A 4NB3A 5I2XA 4N9PA 2PZWA 1A63A 2E2HB 4MN3A 4UHVA 1C0AA 2UU9Q 1SYDA 1VQ4A 4IFDJ 1G2TA 4DXFA 2ID0A 4ME5A 5CMDA 1PFSA 3GTQB 4DK3C 4LMQD 1LV9A 3CPFA 3U50C 1PZJD 4GLXA 4RAUC 4NP5A 1S5BD 4L5TA 5FJ8H 2R93H 3NQIA 1MJCA 4OWTB 1FGBD 1K8GA 1KDCA 3HOVG 2BA1A 1ASYA 4RWSC 1I50B 2QGQA 3MFGA 4K0KL 3K5OA 5IGGA 1IXRA 4O0AA 3TS2A 4DR7Q 4YCWA 1I6HB 1L0YB 2UXBL 4JYAL 1I3QB 3ULJA 4A3BG 2R92H 3M4OH 2B2UC 1NTGA 2NZHA 4NXNL 2EJFC 1V8QA 3FKIG 1PH5A 3RMHA 5EKIA 4YY3Q 1FR3A 1TS3A 2FJ2A 2DJGC 2FMMA 3U9OA 1Q1BA 1SLJA 3CQZH 1VQDA 2NBFA 4K8IA 2G5DA 3I91A 4C3IG 1Z7TA 4K5XA 4AH6A 3I4LA 3MWYW 3CCVA 4BY1B 2V4DA 2F0TA 1B8AA 1QVCA 3MAQA 1NCVA 3CF5A 2NWGA 3TREA 4XYOA 4EQNA 2E75C 4XIGS 4X6AH 2O2LD 2HDLA 2Q2IA 4JC0A 1IW7D 2JEBI 4L5QA 1FNWA 3KBGA 1K9MC 4HAEA 4IFDH 3M4YA 4CJ1B 5IYCG 3MXNB 1HR0W 2QDLA 4JI0L 1S4ZA 1YBYA 1V1QA 3CMAA 5FLXc 3HOUH 2UUBQ 4QCLA 2PPBC 4DR6L 1XTCD 1TWAH 4K6LA 5I2YA 4A3GG 1YZ6A 4X3TA 3HOYB 3S16B 1E2ZA 2F4VQ 4HCSA 4FF3A 4OELB 1KIXA 4Y52H 2AWNA 3X3NA 3MXNA 2E2JB 5KEEA 1IL8A 5EQ0A 1Q12A 1Q81C 4FF2A 3H3VI 1LTID 1HQRD 2VNUD 1BKBA 1SFOB 5T1GA 3CU7A 5CR3A 1GUOA 3CCRA 1PHJA 2E2HH 4DAMA 3T53B 4H13C 2WV6D 1R9TB 2BCOA 4JI1Q 1SDFA 1HZ9A 1PH1A 3T56B 3T1YL 1HZBA 1O7IA 1PH4A 3T16A 5GQOA 1HA6A 2B2WC 3J80E 3G6JB 5CGKA 2B63G 1WTQA 1WTWA 1S5DD 2XN9C 5FK9C 2ZJRA 4IUNA 3VA5A 1EQQA 1AW7A 2CW0D 4A76A 1I50H 1FL0A 3GV3A 2OQKA 2E5LL 3NXWA 4NXMQ 3NTHA 1QNKA 3KBXA 2KVMA 3RZDB 1I6HH 3NEMA 1I3QH 2TMPA 3K80C 3NTKA 2A8VA 3TZDA 1JR0D 3MZ5A 3NE5B 4GZYC 2LXKA 5I6YA 4OIKA 4EGVA 2K01A 3GTKB 4RKLA 2NVYB 5I9PA 1B3QA 1LUZA 5M3FG 1F9QA 4DAYB 4RGNA 3K58A 4O2DA 3NENA 5J39A 3K0YA 1TS5A 2SOBA 3BU2A 3IRBA 3U4VA 4DV0Q 1JJ2A 2JA5G 4BY1H 1PXUA 2VB2X 1YEZA 4B9WA 5FLXL 2NN6I 2UUCQ 4HIKA 1PTOC 3E6ZX 3GTMH 4RA8A 4HR7B 4DAYA 4HMJA 4TVAB 5JPMC 3ZYYX 1GUGA 4KMUC 1G291 2JA7G 3L9AX 5M3MB 3KLRA 3S1MB 1PYSB 1KABA 1LT4D 3ONAB 3SE0A 1HH2P 1Y1VB 3VDYA 2RSOA 4EX5A 2L9HA 5CV5A 4DGZA 3S1RB 2FXQA 1BUVT 4LFBL 1C48A 3FRPB 4I7AA 4RFBA 1PZKD 3H09A 1SAPA 3L2PA 3SHLA 2Z9HA 4ALPA 3S16H 1EEID 5EGTA 5L37A 1IBKQ 4BY7G 4RH6A 2J7ZA 4PZ6A 1BNZA 3FMCA 3AMUA 4DV3L 1HFNA 1ICFB 1EYCA 5IYDG 1AN8A 3GTLB 1X6OA 3CMEA 3I4NG 1QG7A 1VS0A 3L0OA 2Q2TA 1GO3E 1B7YB 4DR4L 2KEEA 1SFOH 2R7FA 5IOCA 2QDBA 2UUAQ 3DEPA 2I46A 2K33A 4R9WA 1D6EC 2J0TD 5FOBB 5GAGC 2OTJA 2WB1G 3S9WA 3DLLA 1HXYD 2UXDL 4WRDA 3HOZH 5JJIA 1H9MA 1HTLD 4JI5L 4KV6A 2HCIA 2G9HD 1DOMA 3UDIA 3OIQA 3ULLA 3VYRA 1TXYA 3UDXA 2LMCB 2OCEA 1HNWL 1H9KA 4IPHA 5COYA 4DV7L 1D1KA 3WWVA 1NMGA 2A73B 1XMQL 1Y8NB 1WTVA 1KLUD 1IZ6A 4EQ5A 4OWWB 1LACA 1F2LA 1PLFA 5EBCA 1QE6A 1N33Q 4IALA 1JCKB 1SNCA 2JSOA 2XNAC 3H3VC 4A3KB 1W6JA 1YIJA 1ML0D 5IP9H 1A6XA 4R4CA 3GTKH 3HOUG 3EROA 2IX0A 5JAVA 4FP5D 3TMEA 4GKJL 3A8IE 2FHTA 4BBRG 4CDCC 1J5EQ 3QWNA 2PQEA 5GAHC 3HOVB 1CTMA 1FD7D 4HIOA 1HUMA 1TWFH 3HKSA 4HIMA 1CHPD 2Z4HA 5M5YB 1K0SA 3W5OA 2LS01 4YHHQ 4JVZA 4CDEC 1Y14B 3E0EA 3K5MA 4WORA 4YIJA 4A3BB 1K83H 4P74A 5AJ3L 5C0XJ 2VXWA 1SMYC 1XMOL 2CWPA 5FLMH 4J6HA 3C46A 5HY6A 4JI2L 1SXTA 4ID6A 4A3EH 4TQUS 1XPRA 5M3MH 1EY8A 2LSSA 2ALYB 3QIAA 1EIHA 1EY0A 3S1RH 3S2DB 5LMNL 4KHPL 2BDNA 2AQ3B 4OO1G 4LF7Q 3VR3A 1RTNA 1VQNA 4K6DA 2I07B 2AHOB 4CKEA 1KLGD 4ILWA 3BYYB 2NZ1D 4DV4L 1TWGB 1DYQA 2Y0SB 1NR2A 3OHXC 3AYHB 2Y0SE 3EQLC 3I7FA 4FXKC 3GTLH 1TS2A 2EYHA 3NELA 2Q8RE 4DUZL 2CFMA 1HZAA 3M4PA 1QUQB 2R7ZB 4HJ8A 2HUGA 4LF5Q 3WOEA 1D5XC 2CVRA 3TP8A 2R3ZA 2A6EC 4DV6Q 2K03A 3NP8A 4LUZA 3PUWA 4A3GB 3EFXD 2UXCQ 3K59A 2GVAA 1G91A 5ELBA 3NWTA 5LMUQ 5CYUA 2F0NA 1QUQA 2R7DA 1II3A 3S24A 5C0XH 5D14A 2OQ0A 4FVMA 1K8OA 4DR2L 5C3EH 1MJEA 1RD9D 4C3HH 4J15A 3P20A 1FGUA 4RCOA 3U4ZA 4QUFA 4LF6L 5C4JB 3RD4A 4R8IA 3GO5A 1Q86C 4A3DG 1EY7A 4KY5A 1N32Q 4BBSG 5KYIA 4A3KH 1HTPA 4LAAA 3I2ZA 1EOTA 5I9OA 1LT5D 2B63B 4OO1I 3BVMA 2Q8IB 1EIYB 1TU2B 2OT2A 4TKOB 4Y7NB 4APVA 4OX9L 1WCMG 2Q2HA 4LF8Q 1IBMQ 4A3CH 4UDUC 2Q8TA 2I5MX 1O7YA 3P1HA 1YI2A 3IKJA 2EYOA 1HCZA 3S1QB 3PO3H 1DONA 2X6LA 4A3FB 4NW2A 2K5VA 4DFAA 4F87A 2KHSA 2D9UA 3GTOH 2QILA 4H7BA 1IHZA 5IGBA 4GNXB 2XSCA 3RLFA 1QNUA 5M3FB 1HR0Q 1RODA 3NPPA 5C5MA 3I72A 5KNDA 2UU9L 3I70A 4DUYL 3S1NB 4A93G 3VR6A 1K28A 1ZYRD 3KLWA 1YJ9A 3S2DH 2L15A 1L0XB 5ELEA 1STAA 2Q2UA 2JA5B 1Q46A 1V43A 5EJWA 1PRTD 1WYDA 3RZOB 3GTGB 1YVCA 2EY5A 5KRUA 4HJ9A 1N34Q 2WACA 3WDNA 4WFN3 1RL2A 1X3PA 1SRUA 1AE3A 2X69A 2M9VA 2AKWB 1BBWA 1JOQA 2A69C 1TWGH 2CWAA 2JA7B 1I94L 1GUWA 1ET9A 2B8FA 1QZGA 2A19A 4G7ZC 2OTLA 3KF6B 1U4PA 2R7ZH 2F4IA 4XXEA 1CA6A 3HG9A 4YY3L 3CCUA 2B3GA 2QA4A 1EUJA 4J8QA 3S14B 2K05A 2MHVA 4X66Q 3HOXB 1HRJA 1F2YA 1TR5A 2F0MA 2EZVA 3R2TA 3KK7A 1U5KA 2CQOA 4CDDC 1B53A 3GD7A 2L4NA 3KF6A 3I4NB 3PGZA 4GN3B 1Y1WB 1ENCA 2RVLA 4Q5VA 1VQPA 4B3ML 2IY5B 5CC4A 1VQ5A 2IL8A 1ILPA 5J3BA 3I56A 3Q23A 1Q8KA 4G7OC 2NTSA 1T5EA 1X55A 2FMCA 3BDOA 5DM63 1LT3D 4BXXG 1B9MA 1PYBA 1SEBD 2E74C 4OIJA 4JBJA 3SGIA 4LK1C 2YTXA 2CCZA 3IAYA 5GAEC 4A3MH 4UAIA 5DNFA 2JA6G 2JE6I 2KJXA 2UUBL 3W3AA 2F0JA 3S2HB 1D5ZC 2H5XA 2K28A 2A1AA 4JI8L 5CV9A 4FXDA 3E9IA 2IPKD 4WJ3M 3URYA 3VR2A 1CHQD 4KJOA 4FF4A 3KDFB 3Q0AA 3A55A 5EAYA 2A68C 1AEXA 1TVXA 2A6HD 1AP0A 3H91A 4DR5Q 1I4PA 3SEBA 4A3FH 2JEAI 1HQMC 1D7QA 3K0XA 1E0BA 4RCNA 1UWVA 1IBLQ 3OWFA 4X3SA 1U4MA 1OO9B 3M85A 1JE4A 3K5NA 1XNQL 4IUQA 3PO2G 2MJ8A 3TN2A 3KDFA 3HZXA 4BBRB 2B39A 1JJGA 3H6MA 2GVBA 4R1JA 3LX0A 1A0IA 1S3OA 1O7LA 5IGCA 4GOPB 1IYVA 4JI1L 4JCVE 3K5LA 2JA8B 4A3IB 3CKIB 1L2FA 1V9PA 1F2MA 3FPPA 1SSOA 1SYGA 2JP1A 3G48A 4KI0A 2O5JC 3M7NA 4LFCL 5IWAL 1AZQA 5T1IA 4DV1L 3RZOH 2MNAA 1PA6A 1D5MC 3JAMc 1EYDA 4JK1C 4LFAQ 3IFTA 4NXML 4GOPA 5G3LD 2V1CC 2K50A 2C9OA 4NKLA 2B2TC 4RGTA 1PRTB 4P75A 3V2TA 4H44C 4QL5A 2ICIA 3OMGA 3KUPA 1LTLA 4XTCS 3FVQA 1YNND 4UPAA 3DWPA 3H0GG 5JJKA 1CZWA 1CQFA 3HOXH 2EXDA 2E2IH 3BZCA 5HGTA 1N8RC 1RJTA 1AFPA 4ZLTF 3T1HL 1C9OA 4M1UB 4DV0L 1GHKA 4O42A 3TBIB 2F0UA 1JT8A 3MXGA 4QB4A 2F0IA 1IKMA 4X3KA 4B3SQ 1JWUD 2RF4A 3UE0A 1Y1WH 1J8IA 3SVMA 1VMCA 4JPBW 4A3JG 4OL7A 3J81c 2K5NA 4B08A 1VCIA 4JI6Q 5H1SE 1JOKA 2PNRC 1B70B 2F0EA 2EYLA 4TRDA 1BDOA 2L12A 4K14A 4AQYQ 4OWXB 3EJIA 2DN8A 4KN4C 4JBKA 4QQBX 3CPWA 1RTOA 1B3AA 5IP7H 1LTBD 2NUCA 3A0JA 4LF4L 2M2LA 2B2UA 3FHWA 3SDZA 1XNRQ 4JV5L 1VQBA 1MD2D 4R4TA 4X62Q 4JI4Q 5C44G 4UP7A 1EY5A 4DR1L 3AB9A 4BBSB 4X64Q 5EBDA 3U58A 2VUMH 2C5CA 1I4HA 1SE8A 5JEAJ 2YTVA 1I5FA 4L5RC 1STGA 1A2UA 3CCQA 3JAML 2NN6G 2J4XA 2UUAL 3F2UA 2F0DA 4LF9Q 2JA8H 4A3IH 5GROA 4DK6C 1QB5D 5LMNW 2MQHA 1NR4A 3F2CA 5JJLA 4YWMA 1SYBA 4B3RQ 2ZT9C 3MVVA 4YWKA 5KYLA 1XPUA 2BH2A 3GTQH 5CV7A 2AMCB 3AQQA 1PVOA 4B3TQ 1EFID 5D65A 3I4MB 5IE8A 4HTHA 3D3RA 2L1BA 1BQQT 4DR3L 1DXMA 2PCFB 3MTSA 1H95A 5J22A 3D4DA 3TRZA 3QR8A 1VQAA 1Q8IA 2F0VA 3SK8A 3M9BA 2I5HA 5CORA 4BS9A 1EIGA 3O13A 1EEFD 4IUPA 3JAMi 4X65L 4FNFA 1GUSA 1GHJA 2OXPA 2N78A 3JC66 4KTAA 3A8KE 5FKAC 4Z9CB 1Y69U 3J81L 5C3WA 2Z6BA 1O80A 1R4QB 1BOSA 3CC2A 2K04A 1P8LA 3MHBA 4P2CB 3C3LA 4K0KQ 1X32A 5E3FA 2YYZA 4H02A 5IGEA 1GM5A 5JEAH 1X3QA 1EU3A 2K5WA 3A7LA 4P71A 3W2DA 4JYAQ 1XXGA 1F9PA 2K7VA 4C2MB 2B2WA 1K73C 1F2ZA 4NXNQ 5A2QL 3HOWB 4DPGA 3HS0C 1IW7C 3BZKA 4HCEA 3NBIA 1FYCA 5IYBH 4PQXA 2LXJA 1EQTA 3J81i 1L1OC 2JYOA 2HIXA 2MFIA 4P73A 1OTCA 2JN4A 4YCUA 1SMYD 4LF7L 5ELCA 1SYFA 1HA5A 3KF8A 2K6AA 5TSSA 2DGYA 5E4XA 4R4QA 3LGJA 5FJ8G 2R93G 4C3JB 3HOYH 1NSNS 1I4XA 3ND8A 1XJVA 1PTOB 1NUCA 5C3XA 2IX3A 1CK1A 4KKTA 4CJ2C 3D8GA 3CRLC 1VQMA 5DAUA 1A3VA 2E2JH 2JA6B 3K8AA 3EIVA 1NMFA 4I7ZC 4JI0Q 4DV6L 2NVQB 2R92G 1L1OB 1BCPC 1NBWA 2QKIC 4LUOA 1WOCA 3M3YB 4JI7L 5G3LF 4DR6Q 4ZUIA 1VQCA 3H15A 1HNZQ 2QF7A 2ASBA 1VQFA 1SJED 4L6TB 4QF4A 1P16A 1X54A 3P7JA 3X3MA 1R9TH 5IGFA 5C4XB 2ZXOA 4FXGC 4HEDA 1BR9A 2CKZB 1SE3A 1VQGA 2CH4A 1DCZA 2D5DA 1XPOA 3I4MH 1DOLA 1HUNA 1MGSA 1WJJA 1GOZA 1K3RA 5M5XB 1L1OA 2EYPA 2F0WA 2NVTB 2CHBD 5DEHA 3Q24A 4CKCA 4LUVA 4IURA 5HURA 1BCPB 1CKNB 4DNTB 5CV8A 3RZDH 1LTRD 2RCNA 5C6AA 1STYA 2B29A 4IFDG 4IUVA 1S5CD 1DJRD 4RGOS 1I4RA 1UEBA 2WINB 3E9HA 2D0PA 1WTPA 1IBML 4PMWA 4XT1B 5M9OA 2NVYH 3D0FA 5IGDA 3F2DA 1ESRA 2XWJB 4DV2L 1WD1A 1CKNA 2E5LQ 2Z6KC 4HJ5A 4CJ0B 2F3WA 5A35A 3I90A 4F88A 1X3EA 1MSHA 2ATWA 4K5VA 4ZAIA 3QOLA 3GV6A 2BA0A 3R8BA 5JJZA 5BN4A 4RGMA 1W3SA 2ICEC 4KD3A 2L55A 5EPKA 4C2MH 2VQFL 1FJGQ 3H0GB 1SNDA 2RA4A 2F03A 1HR0L 1A3UA 3S15B 4PMBA 3FKIB 1XYIA 3STBD 3M7GA 3S1MH 3I8ZA 4OGQC 2EY2A 4C3IB 1EWIA 1CM9A 1X65A 1Y1VH 2YV5A 5K36H 3R2IA 3KFUA 1SYEA 1JWMD 1M4VA 4F7XA 5LHY1 3EBEA 2M00A 3Q8DA 4C3JH 1FNVA 3ER0A 5AFWA 3VYTA 1SE2A 4KKSA 3UDFA 4A3LH 3BZDB 5ELNA 3F2BA 1UE1A 4IFDI 1QJOA 2B8GA 2KHIA 1A15A 2Z6KA 4QIWB 1Z47A 3U9SA 4QIWE 1LTAD 4IUUA 3M3YH 1JB3A 4DV5Q 1S72A 1UNSA 4LFBQ 1G6ZA 2ZXRA 3RR5A 3T51B 1ZXTA 2A69D 1B4OA 1NE3A 1YITA 5C4XH 2RDGA 1RIPA 5JOBA 1UAPA 4ME3A 1LO5D 3TP6A 1KHIA 5FLXE 1JMCA 4DV3Q 4QUCA 1SYCA 2RDHA 4BY1G 5M5XH 1AH9A 1CA5A 5A2QE 4JOIC 4ODGA 2EDGA 1LT6D 1H9SB 1C4QA 2BE5D 3D4RA 3CHBD 4DR4Q 2EY6A 1QZHA 2VQEL 5BN3A 1ESFA 3PUXA 3E0JA 1RCVD 4B9XA 1TIID 1YNJC 3LWEA 4XT3B 5IYBG 1JE5A 2D62A 3OIPA 2CH4W 3TEHB 1WTXA 2JXMB 1WTHA 3HP3A 4HSVA 4DNIA 3Q6SA 5ELFA 3ZJYC 1U4LA 3G7LA 4JI3Q 3K6OA 4BWGB 1F9SA 1H9SA 3PIP3 4IZ8A 3DXJC 3HOVH 1J6QA 1AZPA 3HGBA 3PIOA 4Q0FA 5M5YH 1XMQQ 4KY7A 3HRZC 1XTDA 4A3BH 3T4AC 4WJWA 2MGSA 1TWHB 3D31A 4V0BA 1HJPA 3H3VH 3S15H 3EVQA 3FKIH 5D3IB 5FO7B 3J80c 2XIWA 3BG3A 4JOIA 4MNOA 2F0PA 3E5SA 4KN7C 5IODA 1W6KA 1Y8OB 2KCCA 4C3IH 5FO8B 1C8CA 2IHFA 3CC7A 3FEWX 3HOZG 2YU9B 4FDBA 1O7ZA 4ZK9B 4DNRB 2SNMA 2JQOA 3DWQA 4E6IA 1W2BA 3A56A 2B2YC 1TS4A 2TSSA 2LFNA 1IYUA 1STNA 1WVLA 4DA2A 5IT9c 3BJUA 1VDZA 1XMOQ 3K57A 1Q3LA 2N55A 4JI2Q 2ZTCA 1QVGA 5HGQA 5IYCH 2Z4IA 4DR7L 1VQEA 1ICWA 2ZJPA 1CT1D 4K2KA 4H0LC 3NSWA 4ULLA 1BBUA 5IP9G 5LMNQ 4KHPQ 1U0LA 3HEJA 1E7ZA 4A3GH 2R93B 3E3XA 3DHQA 4MZ9A 2F0OA 4ZKCB 4YWLA 4BY7B 1GUTA 1R4PB 1EWCA 3R3OA 2ZM6Q 4GLVB 4B3SL 1SE4A 1KRSA 2IT1A 1S40A 4U68A 1XX8A 4DV4Q 1S5ED 1CI3M 3J7YW 1X3GA 5ELOA 2JA9A 3MEFA 4G57A 3TZUA 1YHBA 1CQVA 2KHJA 2NYZD 4MIUA 1STBA 3CW2C 1K8AC 4JBMA 4JI6L 4F8MA 1HNXQ 1YJNA 4GKKQ 1SJHD 2EYFA 3PV0A 5FLMG 2IWHA 2NVXB 3CCEA 5C4JH 1J9OA 1OXSC 4A3EG 2WB1B 2EYJA 2WB1E 5M3MG 4MHEA 1VQ8A 2KCNA 3VR4A 2B63H 1VQLA 4Y7NH 1OXVA 3TSSA 1Q82C 4EVOA 1KQSA 3F8TA 1NY4A 3J80L 4N8FA 4DR2Q 4PMCA 4X62L 4YCVA 2F4VL 1K8MA 1Q90A 1PFBA 3S1QH 2FINB 3A5ZB 2WP8J 1T5XD 2RSNA 1IKLA 3VA7A 1NAPA 3AFPA 1Q7YC 2F3IA 3NWSA 3QB3A 3I4OA 4AYBG 3HOUB 1Y8PB 4IO9A 3KOJA 5M3FH 1OXTA 5IT9L 1SBBB 4M8AA 3H94A 1VQ6A 4OONA 3C1EA 1WTRA 3S1NH 1LTGD 1PZID 2YU9H 3CAMA 2JA5H 2YTYA 1EY9A 5I6WA 3MXPA 4DKAC 2BH8A 3GTGH 1DGSA 2OEOA 5C0XG 3W1BA 5C3EG 2HD3A 2F0SA 2QEJC 4ABNA 4C3HG 1PH9A 2ENBA 2ZTEA 4G7HC 2K5HA 4S3SA 2JA7H 1JICA 1GXDC 1I4QA 4DUYQ 3CRKC 3LWUA 4JG2A 3BS1A 3ERQA 4A3KG 3J81j 4PZ8A 4NDXA 1PH6A 1ZKOA 2LY7A 3D4WA 3S14H 2SEBD 1N9WA 1B44D 1WFQA 2EJMA 4HMIA 4BY7H 1EY4A 1U9RA 4KJNA 3RN2A 1LLRD 4A3CG 1WTOA 2K4KA 4BA1I 2N3SA 2KECA 1UE7A 2OWOA 3G6EA 2HHHQ 4C56C 4NPSA 5IYDH 4FO2A 4RKBA 1I94Q 3PO3G 1E24A 2PW5A 2UUCL 4EQOA 3I4NH 4IJLA 1JOOA 1UE6A 1STEA 1XWEA 5F2DA 3KJOA 1PH8A 1VQHA 5ISRA 1MHWC 2I5LX 1CKMA 4DF7A 3PMFA 1CZGA 2NVXH 2N49A 2RDFA 2XWBB 2VW9A 4QMGA 5BR8Q 3B6YA 4RMFA 2MUYA 1PFMA 3FPUB 4DAPA 2KQ3A 2B2TA 3BDCA 3D6WA 3S2HH 1PTOD 3NUCA 5EPJA 3CCJA 5C0XI 4ZQ3A 1QOHA 1ZEQX 1OXXK 1KC8C 5CBEE 1IBKL 3A74A 4KKUA 4B3MQ 3GTMB 4FYDA 1BO0A 3CC4A 3PQIA 1K0RA 3OPOA 2KA7A 4BA2I 2PQAB 3S17B 4A3DB 2Y0SG 1LABA 2RCFA 3OMCA 4K5WA 3RLNA 4DAVA 2VL6A 2A6HC 4IOAA 2DY7A 3I3CA 1PRTF 4AIMA 1JWSD 1EZ6A 3CD6A 3CXCA 3DWAA 3MEHA 2R7ZG 1KNEA 1JORA 1HNZL 4JI8Q 2KOLA 1WCMB 4BBRH 2DJFC 3NHHA 1MIUA 2Z1CA 3BYTB 1D2BA 4IQZA 4LJZC 3SK4A 2NTTA 1PYWD 1RDPD 1N36Q 1X9NA 3AU7A 2F0FA 2PQAA 1G51A 4IUTA 3PUZA 1GD7A 2I0QA 4OX9Q 1ASZA 2XRSD 4A75A 1BCPD 4N9TA 4WJ4A 1EYAA 3HKZG 5JVH3 2B2VC 1RF2D 3OTOQ 4OHJA 2GN5A 4HIDA 3HFZB 1XNQQ 2L11A 4HJ7A 1STHA 1SNMA 3DUZA 1DD2A 2WAQG 3N6RA 1N33L 1RHPA 1X56A 2RHSB 4A93B 3OW2A 1D1IA 2AQ1B 5NUCA 3VYSA 4CHTB 3HOZB 2AUKA 2EYMA 4PV1C 4A3MG 3Q22A 4LFCQ 5IWAQ 4OO1H 4JBWA 4DV1Q 1J5EL 3AFQA 3MFYA 1YNNC 5EKLA 3UI2A 1KL9A 5KNCA 2EVBA 2EY1A 1E2VA 4UP9A 4YHHL 4OXPA 2E8GA 3GTJB 4A3FG 1GUNA 3T13A 3G71A 1FJGL 5IT9E 1CKOA 1GJXA 4GN5A 2MO0A 2UXBQ 3SR1A 3W1GA 3KF8B 2PI2E 4CKBA 1NJIC 2AUJD 1I6VC 3TQYA 5J1ZA 2B2VA 4I65A 4NMZA 5CV6A 4ZUJA 4IPDA 1QVFA 2FFKB 1L0WA 3SK5A 1TWFB 4XQJA 2EIFA 4JW0A 3DM1A 3R93A 3T1HQ 1BF4A 3OWEB 1U4RA 2ES2A 4KK7A 2MP1A 2D2CC 3J7AF 4ZYSA 4RHSA 1K83B 1V1OA 2C35B 2K52A 2PI2A 1CSPA 2HIVA 3ERSX 2PZUA 1PV4A 4FF1A 3RN5A 2OF1A 1PDQA 1TY2A 4A3EB 3S17H 2EE1A 4A3DH 5M5WB 4N8X1 1PH3A 4BBSH 1QILA 3EN2A 3ITPA 4HJAA 3NBHB 4DV5L 4POGA 1KAAA 3MXUA 4LF5L 4RG1A 3PF4A 4KHZA 1WCMH 1B1ZA 5CV4A 4L63B 2EXZA 1TQOA 2UXCL 3HOXG 2K5QA 4CDFC 2RKSA 2AQ2B 3KLSX 3FDTA 4LF4Q 1X3FA 3PCOB 4JV5Q 5LMUL 3ICEA 3NBHA 4DR1Q 2O5IC 1C7YA 4PNYA 2EJGC 1S5FD 1G8ZD 2A6ED 1KTKA 4R4OA 1G2SA 4AYBB 3CCSA 1Y1WG 3AEVA 1G6PA 4AYBE 5ELDA 3PO2B 1VF7A 1EIFA 4LWCA 1VQ9A 3DM3A 1SN8A 1E3PA 3J7A5 2PYKA 2CW0C 4A93H 1B2TA 2HQLA 1N32L 5DM73 1CFMA 2F52A 3EA6A 5KGUA 1KXLA 4JI3L 1WI5A 3OYYA 3T1YQ 2H4OA 2F0GA 4LF8L 1TWCB 4QJFA 3GDEA 2VZAA 5C3EB 1O78A 2O4XA 4DR3Q 5IP7G 3TP7A 4C3HB 1YNJD 5GADC 2WKCA 3GQBA 2IJ0A 1A2TA 4PZ7A 3GTJH 4PG3A 1HFGA 5KNBA 2PMZB 1PTOF 2PMZE 1VMPA 1SNPA 2WFWA 3JAME 4R4IA 4X65Q 3FP9A 2N8NA 1EFWA 3BVGA 4DN4M 2VUMG 2N88A 1IYJB 2F0KA 2A74C 2F0LA 4IPCA 1BXTA 2A5HA 3IL8A 1RKNA 4XYQA 1JQYD 3BDLA 2QCPX 1H9RA 2K5DA 4GS3A 3HOWH 1VF5C 2JA8G 4LNQA 4A3IG 5IIFA 3V96A 2VB3X 1EY6A 1YHAA 1E2WA 1FVIA 1LTTD 3PO3B 3I55A 3GTPB 2MPMA 3OSOA 1ENFA 4V190 2QEXA 3C1FA 1N34L 3GTOB 4KHVA 5D3DA 3PF5A 3NQTA 3G4SA 2EOTA 4A3JB 3ND9A 4KLKA 1PTOH 4HSPA 4XQQA 4DK0A 3OW7A 4BXXH 3QG1A 3SXHA 3RLOA 3IFDA 5M5WH 1EWHA 3P75A 3KYHC 1BCPF 1ET6A 1MKHA 2WIIB 4QY7A 2XRQD 2JA6H 3L7ZC 3J81E 2E2DC 5EPLA 2NVQH 4XDXA 2PZTA 2SDFA 2K32A 1A62A 2WKDA 4TSSA 4EQPA 4X66L 2K14A 4UY8C 2EQSA 1YNXA 1F9RA 2ZM6L 1DM0B 2R61A 5C44B 1CUKA 1EQVA 3KJPA 2E76C 2KENA 1SROA 4POFA 2ZXPA 1JB7A 1CSQA 1KNAA 2EPBA 4XQNA 1NNXA 5JVG3 1LTSD 5JEAG 4IJHA 3VR5A 5C5LA 2PNHA 2NVTH 5KIXA 3J7ZC 3PO2H 3RUZA 1HNXL 4L5SA 5K5PA 1BVSA 1QWYA 1UUPA 3MA2B 4UP8A 3K7AB 3WOFA 4GKKL 1TY0A 4C1NI 2K75A 4JI7Q 1PH7A 5DLQE 2P5ZX 2F3VA 3D6CA 2H1EA 5IY0A 2GA4B 3DMUA 2X6GA 2VY3A 1E1TA 2AWOA 4DU9A 3PIPA 2UXDQ 3CCLA 2CQAA 2D0OA 2JK8A 4JI5Q 3VYUA 5BN5A 1B9NA 3HKZB 1TWCH 2KUMA 2DY8A 3HKZE 2DNCA 2ZJQA 4A4IA 4C1NK 1ONLA 1HNWQ 3HOYG 2WAQB 4DV7Q 4DR5L 2BDOA 2WAQE 5FO9B 2NZOA 3F1ZA 2F0QA 2DUDA 1I4GA 1A8VA 2DNEA 1IBLL 5EKKA 1KRTA 4GNXC 4A3MB 1F77A 1MBYA 4U673 5LL6X 3H0GH 2KEDA 2HQEA 1EYGA 1EZ8A 2L0CA 3PUYA 2A68D 2XGTA 3J7AV 4GKJQ 2XVSA 1Q1EA 1WD0A 2F0HA 2L5TA 4DV2Q 5E1FA 3A7AB 2BOSA 4RHRA 1BBXC 3STBC 3GTPH 1E1OA 2IW3A 2VS1A 4ZCKA 1KDAA 1SMXA 3PIO3 4X3UA 3I4MG 1YJWA 1EQRA 2HCCA 4A3JH 4LFAL 2XTIA 5AJ3Q 1KDBA 1M90C 4K8JA 2VQFQ 3SK6A 2KBNA 1GVPA 3K81C 2Z8LA 1M1KC 2G9DA 2R6GA 4ZRZA 1KAWA 3UDGA 1VQ7A 1EL0A 3C2PA 1JC7A 2K1BA 4G4KA 2RHQB 1VQKA 1A3TA 5E7NA 3A54A 3L3OC 3QJYA 1M8AA 4K2LA 4QGUA 2NB0A 4GNXA 4GLAC 1HPCA 1AE2A 1TT2A 4R8NA 3PSIA 2HT1A 1E22A 4DXGA 1VQOA 3GP7A 1Z9FA 1EU4A 1PH2A 3RNUA 4IOCA 5C44H 2HHHL 2LKVA 4MTKA 1LM0A 3DEOA 3MC0B 5C4ZA 4KY6A 2F1MA 2PW7A 1LYLA 4MTNA 3NTIA 1TKWB 2NN6H 1DOKA 1JJCB 3K7AH 3M4OB 4DUZQ 2R92B 2SNSA 3V05A 5I4DA 3N52A 4HN7A 2KCMA 2B2YA 2E2IB 1SR3A 2RQXA 4O1NA 2BE5C 2ZTDA 5BR8L 2IX1A 1D8LA 3HOWG 2JJQA 1DZ1A 5E4WC 3PUVA 1HZCA 3CQZB 5LL6S 4KD4A 4AQYL 3TDQA 4IN3A 4CGYB 4LW1A 3A5UA 5K36G 1Y1VG 1PFNA 1VQIA 3ULPA 1V1PB 3A8JE 2RBMA 1PMRA 1SNQA 3TS0A 2Z0SA 1XNRL 3CCMA 1ENAA 4C3JG 1VQJA 3CP0A 3UE1A 4JI4L 2PO4A 2VQEQ 1ILQA 4A3LG 4X64L 1KD1C 2QW7A 2MO1A 4IPGA 4LF6Q 1UEAB 4CBVA 1OXUA 1TWHH 4P72A 3BVZA 4GOPC 1MSGA 1V1PA 3OOCA 3QO2A 2HDMA 4GN4B 4LF9L 1T9HA 1TWAB 1N36L 1HHVA 4ZKBB 1H9JA 5C4XG 3KLSA 4B3RL 3I73A 3M4QA 2KCTA 1UE5A
chains in the Genus database with same CATH topology
4N8X1 4JVZA 2HD3A 2Z9HA 4JW0A 2QW7A 4I7AA 2RCFA 5L37A 4N8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N8X 1;  4JVZ A;  2HD3 A;  2Z9H A;  4JW0 A;  2QW7 A;  4I7A A;  2RCF A;  5L37 A;  4N8F A; 
#chains in the Genus database with same CATH topology
 1QCB D;  1IL2 A;  1B50 A;  3NK9 A;  4B3T L;  3J80 i;  1YHQ A;  1EOV A;  1FNU A;  1K3B C;  2VUM B;  1ZYR C;  4L8J A;  3OTO L;  1GKH A;  2IHE A;  5C4H A;  5JPN C;  4OEM B;  1PRT C;  3LNN A;  4J1M A;  4DK1 A;  1SNO A;  1Z6H A;  3K7U C;  3QOJ A;  5CBA E;  1MI2 A;  3TP5 A;  4NB3 A;  5I2X A;  4N9P A;  2PZW A;  1A63 A;  2E2H B;  4MN3 A;  4UHV A;  1C0A A;  2UU9 Q;  1SYD A;  1VQ4 A;  4IFD J;  1G2T A;  4DXF A;  2ID0 A;  4ME5 A;  5CMD A;  1PFS A;  3GTQ B;  4DK3 C;  4LMQ D;  1LV9 A;  3CPF A;  3U50 C;  1PZJ D;  4GLX A;  4RAU C;  4NP5 A;  1S5B D;  4L5T A;  5FJ8 H;  2R93 H;  3NQI A;  1MJC A;  4OWT B;  1FGB D;  1K8G A;  1KDC A;  3HOV G;  2BA1 A;  1ASY A;  4RWS C;  1I50 B;  2QGQ A;  3MFG A;  4K0K L;  3K5O A;  5IGG A;  1IXR A;  4O0A A;  3TS2 A;  4DR7 Q;  4YCW A;  1I6H B;  1L0Y B;  2UXB L;  4JYA L;  1I3Q B;  3ULJ A;  4A3B G;  2R92 H;  3M4O H;  2B2U C;  1NTG A;  2NZH A;  4NXN L;  2EJF C;  1V8Q A;  3FKI G;  1PH5 A;  3RMH A;  5EKI A;  4YY3 Q;  1FR3 A;  1TS3 A;  2FJ2 A;  2DJG C;  2FMM A;  3U9O A;  1Q1B A;  1SLJ A;  3CQZ H;  1VQD A;  2NBF A;  4K8I A;  2G5D A;  3I91 A;  4C3I G;  1Z7T A;  4K5X A;  4AH6 A;  3I4L A;  3MWY W;  3CCV A;  4BY1 B;  2V4D A;  2F0T A;  1B8A A;  1QVC A;  3MAQ A;  1NCV A;  3CF5 A;  2NWG A;  3TRE A;  4XYO A;  4EQN A;  2E75 C;  4XIG S;  4X6A H;  2O2L D;  2HDL A;  2Q2I A;  4JC0 A;  1IW7 D;  2JEB I;  4L5Q A;  1FNW A;  3KBG A;  1K9M C;  4HAE A;  4IFD H;  3M4Y A;  4CJ1 B;  5IYC G;  3MXN B;  1HR0 W;  2QDL A;  4JI0 L;  1S4Z A;  1YBY A;  1V1Q A;  3CMA A;  5FLX c;  3HOU H;  2UUB Q;  4QCL A;  2PPB C;  4DR6 L;  1XTC D;  1TWA H;  4K6L A;  5I2Y A;  4A3G G;  1YZ6 A;  4X3T A;  3HOY B;  3S16 B;  1E2Z A;  2F4V Q;  4HCS A;  4FF3 A;  4OEL B;  1KIX A;  4Y52 H;  2AWN A;  3X3N A;  3MXN A;  2E2J B;  5KEE A;  1IL8 A;  5EQ0 A;  1Q12 A;  1Q81 C;  4FF2 A;  3H3V I;  1LTI D;  1HQR D;  2VNU D;  1BKB A;  1SFO B;  5T1G A;  3CU7 A;  5CR3 A;  1GUO A;  3CCR A;  1PHJ A;  2E2H H;  4DAM A;  3T53 B;  4H13 C;  2WV6 D;  1R9T B;  2BCO A;  4JI1 Q;  1SDF A;  1HZ9 A;  1PH1 A;  3T56 B;  3T1Y L;  1HZB A;  1O7I A;  1PH4 A;  3T16 A;  5GQO A;  1HA6 A;  2B2W C;  3J80 E;  3G6J B;  5CGK A;  2B63 G;  1WTQ A;  1WTW A;  1S5D D;  2XN9 C;  5FK9 C;  2ZJR A;  4IUN A;  3VA5 A;  1EQQ A;  1AW7 A;  2CW0 D;  4A76 A;  1I50 H;  1FL0 A;  3GV3 A;  2OQK A;  2E5L L;  3NXW A;  4NXM Q;  3NTH A;  1QNK A;  3KBX A;  2KVM A;  3RZD B;  1I6H H;  3NEM A;  1I3Q H;  2TMP A;  3K80 C;  3NTK A;  2A8V A;  3TZD A;  1JR0 D;  3MZ5 A;  3NE5 B;  4GZY C;  2LXK A;  5I6Y A;  4OIK A;  4EGV A;  2K01 A;  3GTK B;  4RKL A;  2NVY B;  5I9P A;  1B3Q A;  1LUZ A;  5M3F G;  1F9Q A;  4DAY B;  4RGN A;  3K58 A;  4O2D A;  3NEN A;  5J39 A;  3K0Y A;  1TS5 A;  2SOB A;  3BU2 A;  3IRB A;  3U4V A;  4DV0 Q;  1JJ2 A;  2JA5 G;  4BY1 H;  1PXU A;  2VB2 X;  1YEZ A;  4B9W A;  5FLX L;  2NN6 I;  2UUC Q;  4HIK A;  1PTO C;  3E6Z X;  3GTM H;  4RA8 A;  4HR7 B;  4DAY A;  4HMJ A;  4TVA B;  5JPM C;  3ZYY X;  1GUG A;  4KMU C;  1G29 1;  2JA7 G;  3L9A X;  5M3M B;  3KLR A;  3S1M B;  1PYS B;  1KAB A;  1LT4 D;  3ONA B;  3SE0 A;  1HH2 P;  1Y1V B;  3VDY A;  2RSO A;  4EX5 A;  2L9H A;  5CV5 A;  4DGZ A;  3S1R B;  2FXQ A;  1BUV T;  4LFB L;  1C48 A;  3FRP B;  4I7A A;  4RFB A;  1PZK D;  3H09 A;  1SAP A;  3L2P A;  3SHL A;  2Z9H A;  4ALP A;  3S16 H;  1EEI D;  5EGT A;  5L37 A;  1IBK Q;  4BY7 G;  4RH6 A;  2J7Z A;  4PZ6 A;  1BNZ A;  3FMC A;  3AMU A;  4DV3 L;  1HFN A;  1ICF B;  1EYC A;  5IYD G;  1AN8 A;  3GTL B;  1X6O A;  3CME A;  3I4N G;  1QG7 A;  1VS0 A;  3L0O A;  2Q2T A;  1GO3 E;  1B7Y B;  4DR4 L;  2KEE A;  1SFO H;  2R7F A;  5IOC A;  2QDB A;  2UUA Q;  3DEP A;  2I46 A;  2K33 A;  4R9W A;  1D6E C;  2J0T D;  5FOB B;  5GAG C;  2OTJ A;  2WB1 G;  3S9W A;  3DLL A;  1HXY D;  2UXD L;  4WRD A;  3HOZ H;  5JJI A;  1H9M A;  1HTL D;  4JI5 L;  4KV6 A;  2HCI A;  2G9H D;  1DOM A;  3UDI A;  3OIQ A;  3ULL A;  3VYR A;  1TXY A;  3UDX A;  2LMC B;  2OCE A;  1HNW L;  1H9K A;  4IPH A;  5COY A;  4DV7 L;  1D1K A;  3WWV A;  1NMG A;  2A73 B;  1XMQ L;  1Y8N B;  1WTV A;  1KLU D;  1IZ6 A;  4EQ5 A;  4OWW B;  1LAC A;  1F2L A;  1PLF A;  5EBC A;  1QE6 A;  1N33 Q;  4IAL A;  1JCK B;  1SNC A;  2JSO A;  2XNA C;  3H3V C;  4A3K B;  1W6J A;  1YIJ A;  1ML0 D;  5IP9 H;  1A6X A;  4R4C A;  3GTK H;  3HOU G;  3ERO A;  2IX0 A;  5JAV A;  4FP5 D;  3TME A;  4GKJ L;  3A8I E;  2FHT A;  4BBR G;  4CDC C;  1J5E Q;  3QWN A;  2PQE A;  5GAH C;  3HOV B;  1CTM A;  1FD7 D;  4HIO A;  1HUM A;  1TWF H;  3HKS A;  4HIM A;  1CHP D;  2Z4H A;  5M5Y B;  1K0S A;  3W5O A;  2LS0 1;  4YHH Q;  4JVZ A;  4CDE C;  1Y14 B;  3E0E A;  3K5M A;  4WOR A;  4YIJ A;  4A3B B;  1K83 H;  4P74 A;  5AJ3 L;  5C0X J;  2VXW A;  1SMY C;  1XMO L;  2CWP A;  5FLM H;  4J6H A;  3C46 A;  5HY6 A;  4JI2 L;  1SXT A;  4ID6 A;  4A3E H;  4TQU S;  1XPR A;  5M3M H;  1EY8 A;  2LSS A;  2ALY B;  3QIA A;  1EIH A;  1EY0 A;  3S1R H;  3S2D B;  5LMN L;  4KHP L;  2BDN A;  2AQ3 B;  4OO1 G;  4LF7 Q;  3VR3 A;  1RTN A;  1VQN A;  4K6D A;  2I07 B;  2AHO B;  4CKE A;  1KLG D;  4ILW A;  3BYY B;  2NZ1 D;  4DV4 L;  1TWG B;  1DYQ A;  2Y0S B;  1NR2 A;  3OHX C;  3AYH B;  2Y0S E;  3EQL C;  3I7F A;  4FXK C;  3GTL H;  1TS2 A;  2EYH A;  3NEL A;  2Q8R E;  4DUZ L;  2CFM A;  1HZA A;  3M4P A;  1QUQ B;  2R7Z B;  4HJ8 A;  2HUG A;  4LF5 Q;  3WOE A;  1D5X C;  2CVR A;  3TP8 A;  2R3Z A;  2A6E C;  4DV6 Q;  2K03 A;  3NP8 A;  4LUZ A;  3PUW A;  4A3G B;  3EFX D;  2UXC Q;  3K59 A;  2GVA A;  1G91 A;  5ELB A;  3NWT A;  5LMU Q;  5CYU A;  2F0N A;  1QUQ A;  2R7D A;  1II3 A;  3S24 A;  5C0X H;  5D14 A;  2OQ0 A;  4FVM A;  1K8O A;  4DR2 L;  5C3E H;  1MJE A;  1RD9 D;  4C3H H;  4J15 A;  3P20 A;  1FGU A;  4RCO A;  3U4Z A;  4QUF A;  4LF6 L;  5C4J B;  3RD4 A;  4R8I A;  3GO5 A;  1Q86 C;  4A3D G;  1EY7 A;  4KY5 A;  1N32 Q;  4BBS G;  5KYI A;  4A3K H;  1HTP A;  4LAA A;  3I2Z A;  1EOT A;  5I9O A;  1LT5 D;  2B63 B;  4OO1 I;  3BVM A;  2Q8I B;  1EIY B;  1TU2 B;  2OT2 A;  4TKO B;  4Y7N B;  4APV A;  4OX9 L;  1WCM G;  2Q2H A;  4LF8 Q;  1IBM Q;  4A3C H;  4UDU C;  2Q8T A;  2I5M X;  1O7Y A;  3P1H A;  1YI2 A;  3IKJ A;  2EYO A;  1HCZ A;  3S1Q B;  3PO3 H;  1DON A;  2X6L A;  4A3F B;  4NW2 A;  2K5V A;  4DFA A;  4F87 A;  2KHS A;  2D9U A;  3GTO H;  2QIL A;  4H7B A;  1IHZ A;  5IGB A;  4GNX B;  2XSC A;  3RLF A;  1QNU A;  5M3F B;  1HR0 Q;  1ROD A;  3NPP A;  5C5M A;  3I72 A;  5KND A;  2UU9 L;  3I70 A;  4DUY L;  3S1N B;  4A93 G;  3VR6 A;  1K28 A;  1ZYR D;  3KLW A;  1YJ9 A;  3S2D H;  2L15 A;  1L0X B;  5ELE A;  1STA A;  2Q2U A;  2JA5 B;  1Q46 A;  1V43 A;  5EJW A;  1PRT D;  1WYD A;  3RZO B;  3GTG B;  1YVC A;  2EY5 A;  5KRU A;  4HJ9 A;  1N34 Q;  2WAC A;  3WDN A;  4WFN 3;  1RL2 A;  1X3P A;  1SRU A;  1AE3 A;  2X69 A;  2M9V A;  2AKW B;  1BBW A;  1JOQ A;  2A69 C;  1TWG H;  2CWA A;  2JA7 B;  1I94 L;  1GUW A;  1ET9 A;  2B8F A;  1QZG A;  2A19 A;  4G7Z C;  2OTL A;  3KF6 B;  1U4P A;  2R7Z H;  2F4I A;  4XXE A;  1CA6 A;  3HG9 A;  4YY3 L;  3CCU A;  2B3G A;  2QA4 A;  1EUJ A;  4J8Q A;  3S14 B;  2K05 A;  2MHV A;  4X66 Q;  3HOX B;  1HRJ A;  1F2Y A;  1TR5 A;  2F0M A;  2EZV A;  3R2T A;  3KK7 A;  1U5K A;  2CQO A;  4CDD C;  1B53 A;  3GD7 A;  2L4N A;  3KF6 A;  3I4N B;  3PGZ A;  4GN3 B;  1Y1W B;  1ENC A;  2RVL A;  4Q5V A;  1VQP A;  4B3M L;  2IY5 B;  5CC4 A;  1VQ5 A;  2IL8 A;  1ILP A;  5J3B A;  3I56 A;  3Q23 A;  1Q8K A;  4G7O C;  2NTS A;  1T5E A;  1X55 A;  2FMC A;  3BDO A;  5DM6 3;  1LT3 D;  4BXX G;  1B9M A;  1PYB A;  1SEB D;  2E74 C;  4OIJ A;  4JBJ A;  3SGI A;  4LK1 C;  2YTX A;  2CCZ A;  3IAY A;  5GAE C;  4A3M H;  4UAI A;  5DNF A;  2JA6 G;  2JE6 I;  2KJX A;  2UUB L;  3W3A A;  2F0J A;  3S2H B;  1D5Z C;  2H5X A;  2K28 A;  2A1A A;  4JI8 L;  5CV9 A;  4FXD A;  3E9I A;  2IPK D;  4WJ3 M;  3URY A;  3VR2 A;  1CHQ D;  4KJO A;  4FF4 A;  3KDF B;  3Q0A A;  3A55 A;  5EAY A;  2A68 C;  1AEX A;  1TVX A;  2A6H D;  1AP0 A;  3H91 A;  4DR5 Q;  1I4P A;  3SEB A;  4A3F H;  2JEA I;  1HQM C;  1D7Q A;  3K0X A;  1E0B A;  4RCN A;  1UWV A;  1IBL Q;  3OWF A;  4X3S A;  1U4M A;  1OO9 B;  3M85 A;  1JE4 A;  3K5N A;  1XNQ L;  4IUQ A;  3PO2 G;  2MJ8 A;  3TN2 A;  3KDF A;  3HZX A;  4BBR B;  2B39 A;  1JJG A;  3H6M A;  2GVB A;  4R1J A;  3LX0 A;  1A0I A;  1S3O A;  1O7L A;  5IGC A;  4GOP B;  1IYV A;  4JI1 L;  4JCV E;  3K5L A;  2JA8 B;  4A3I B;  3CKI B;  1L2F A;  1V9P A;  1F2M A;  3FPP A;  1SSO A;  1SYG A;  2JP1 A;  3G48 A;  4KI0 A;  2O5J C;  3M7N A;  4LFC L;  5IWA L;  1AZQ A;  5T1I A;  4DV1 L;  3RZO H;  2MNA A;  1PA6 A;  1D5M C;  3JAM c;  1EYD A;  4JK1 C;  4LFA Q;  3IFT A;  4NXM L;  4GOP A;  5G3L D;  2V1C C;  2K50 A;  2C9O A;  4NKL A;  2B2T C;  4RGT A;  1PRT B;  4P75 A;  3V2T A;  4H44 C;  4QL5 A;  2ICI A;  3OMG A;  3KUP A;  1LTL A;  4XTC S;  3FVQ A;  1YNN D;  4UPA A;  3DWP A;  3H0G G;  5JJK A;  1CZW A;  1CQF A;  3HOX H;  2EXD A;  2E2I H;  3BZC A;  5HGT A;  1N8R C;  1RJT A;  1AFP A;  4ZLT F;  3T1H L;  1C9O A;  4M1U B;  4DV0 L;  1GHK A;  4O42 A;  3TBI B;  2F0U A;  1JT8 A;  3MXG A;  4QB4 A;  2F0I A;  1IKM A;  4X3K A;  4B3S Q;  1JWU D;  2RF4 A;  3UE0 A;  1Y1W H;  1J8I A;  3SVM A;  1VMC A;  4JPB W;  4A3J G;  4OL7 A;  3J81 c;  2K5N A;  4B08 A;  1VCI A;  4JI6 Q;  5H1S E;  1JOK A;  2PNR C;  1B70 B;  2F0E A;  2EYL A;  4TRD A;  1BDO A;  2L12 A;  4K14 A;  4AQY Q;  4OWX B;  3EJI A;  2DN8 A;  4KN4 C;  4JBK A;  4QQB X;  3CPW A;  1RTO A;  1B3A A;  5IP7 H;  1LTB D;  2NUC A;  3A0J A;  4LF4 L;  2M2L A;  2B2U A;  3FHW A;  3SDZ A;  1XNR Q;  4JV5 L;  1VQB A;  1MD2 D;  4R4T A;  4X62 Q;  4JI4 Q;  5C44 G;  4UP7 A;  1EY5 A;  4DR1 L;  3AB9 A;  4BBS B;  4X64 Q;  5EBD A;  3U58 A;  2VUM H;  2C5C A;  1I4H A;  1SE8 A;  5JEA J;  2YTV A;  1I5F A;  4L5R C;  1STG A;  1A2U A;  3CCQ A;  3JAM L;  2NN6 G;  2J4X A;  2UUA L;  3F2U A;  2F0D A;  4LF9 Q;  2JA8 H;  4A3I H;  5GRO A;  4DK6 C;  1QB5 D;  5LMN W;  2MQH A;  1NR4 A;  3F2C A;  5JJL A;  4YWM A;  1SYB A;  4B3R Q;  2ZT9 C;  3MVV A;  4YWK A;  5KYL A;  1XPU A;  2BH2 A;  3GTQ H;  5CV7 A;  2AMC B;  3AQQ A;  1PVO A;  4B3T Q;  1EFI D;  5D65 A;  3I4M B;  5IE8 A;  4HTH A;  3D3R A;  2L1B A;  1BQQ T;  4DR3 L;  1DXM A;  2PCF B;  3MTS A;  1H95 A;  5J22 A;  3D4D A;  3TRZ A;  3QR8 A;  1VQA A;  1Q8I A;  2F0V A;  3SK8 A;  3M9B A;  2I5H A;  5COR A;  4BS9 A;  1EIG A;  3O13 A;  1EEF D;  4IUP A;  3JAM i;  4X65 L;  4FNF A;  1GUS A;  1GHJ A;  2OXP A;  2N78 A;  3JC6 6;  4KTA A;  3A8K E;  5FKA C;  4Z9C B;  1Y69 U;  3J81 L;  5C3W A;  2Z6B A;  1O80 A;  1R4Q B;  1BOS A;  3CC2 A;  2K04 A;  1P8L A;  3MHB A;  4P2C B;  3C3L A;  4K0K Q;  1X32 A;  5E3F A;  2YYZ A;  4H02 A;  5IGE A;  1GM5 A;  5JEA H;  1X3Q A;  1EU3 A;  2K5W A;  3A7L A;  4P71 A;  3W2D A;  4JYA Q;  1XXG A;  1F9P A;  2K7V A;  4C2M B;  2B2W A;  1K73 C;  1F2Z A;  4NXN Q;  5A2Q L;  3HOW B;  4DPG A;  3HS0 C;  1IW7 C;  3BZK A;  4HCE A;  3NBI A;  1FYC A;  5IYB H;  4PQX A;  2LXJ A;  1EQT A;  3J81 i;  1L1O C;  2JYO A;  2HIX A;  2MFI A;  4P73 A;  1OTC A;  2JN4 A;  4YCU A;  1SMY D;  4LF7 L;  5ELC A;  1SYF A;  1HA5 A;  3KF8 A;  2K6A A;  5TSS A;  2DGY A;  5E4X A;  4R4Q A;  3LGJ A;  5FJ8 G;  2R93 G;  4C3J B;  3HOY H;  1NSN S;  1I4X A;  3ND8 A;  1XJV A;  1PTO B;  1NUC A;  5C3X A;  2IX3 A;  1CK1 A;  4KKT A;  4CJ2 C;  3D8G A;  3CRL C;  1VQM A;  5DAU A;  1A3V A;  2E2J H;  2JA6 B;  3K8A A;  3EIV A;  1NMF A;  4I7Z C;  4JI0 Q;  4DV6 L;  2NVQ B;  2R92 G;  1L1O B;  1BCP C;  1NBW A;  2QKI C;  4LUO A;  1WOC A;  3M3Y B;  4JI7 L;  5G3L F;  4DR6 Q;  4ZUI A;  1VQC A;  3H15 A;  1HNZ Q;  2QF7 A;  2ASB A;  1VQF A;  1SJE D;  4L6T B;  4QF4 A;  1P16 A;  1X54 A;  3P7J A;  3X3M A;  1R9T H;  5IGF A;  5C4X B;  2ZXO A;  4FXG C;  4HED A;  1BR9 A;  2CKZ B;  1SE3 A;  1VQG A;  2CH4 A;  1DCZ A;  2D5D A;  1XPO A;  3I4M H;  1DOL A;  1HUN A;  1MGS A;  1WJJ A;  1GOZ A;  1K3R A;  5M5X B;  1L1O A;  2EYP A;  2F0W A;  2NVT B;  2CHB D;  5DEH A;  3Q24 A;  4CKC A;  4LUV A;  4IUR A;  5HUR A;  1BCP B;  1CKN B;  4DNT B;  5CV8 A;  3RZD H;  1LTR D;  2RCN A;  5C6A A;  1STY A;  2B29 A;  4IFD G;  4IUV A;  1S5C D;  1DJR D;  4RGO S;  1I4R A;  1UEB A;  2WIN B;  3E9H A;  2D0P A;  1WTP A;  1IBM L;  4PMW A;  4XT1 B;  5M9O A;  2NVY H;  3D0F A;  5IGD A;  3F2D A;  1ESR A;  2XWJ B;  4DV2 L;  1WD1 A;  1CKN A;  2E5L Q;  2Z6K C;  4HJ5 A;  4CJ0 B;  2F3W A;  5A35 A;  3I90 A;  4F88 A;  1X3E A;  1MSH A;  2ATW A;  4K5V A;  4ZAI A;  3QOL A;  3GV6 A;  2BA0 A;  3R8B A;  5JJZ A;  5BN4 A;  4RGM A;  1W3S A;  2ICE C;  4KD3 A;  2L55 A;  5EPK A;  4C2M H;  2VQF L;  1FJG Q;  3H0G B;  1SND A;  2RA4 A;  2F03 A;  1HR0 L;  1A3U A;  3S15 B;  4PMB A;  3FKI B;  1XYI A;  3STB D;  3M7G A;  3S1M H;  3I8Z A;  4OGQ C;  2EY2 A;  4C3I B;  1EWI A;  1CM9 A;  1X65 A;  1Y1V H;  2YV5 A;  5K36 H;  3R2I A;  3KFU A;  1SYE A;  1JWM D;  1M4V A;  4F7X A;  5LHY 1;  3EBE A;  2M00 A;  3Q8D A;  4C3J H;  1FNV A;  3ER0 A;  5AFW A;  3VYT A;  1SE2 A;  4KKS A;  3UDF A;  4A3L H;  3BZD B;  5ELN A;  3F2B A;  1UE1 A;  4IFD I;  1QJO A;  2B8G A;  2KHI A;  1A15 A;  2Z6K A;  4QIW B;  1Z47 A;  3U9S A;  4QIW E;  1LTA D;  4IUU A;  3M3Y H;  1JB3 A;  4DV5 Q;  1S72 A;  1UNS A;  4LFB Q;  1G6Z A;  2ZXR A;  3RR5 A;  3T51 B;  1ZXT A;  2A69 D;  1B4O A;  1NE3 A;  1YIT A;  5C4X H;  2RDG A;  1RIP A;  5JOB A;  1UAP A;  4ME3 A;  1LO5 D;  3TP6 A;  1KHI A;  5FLX E;  1JMC A;  4DV3 Q;  4QUC A;  1SYC A;  2RDH A;  4BY1 G;  5M5X H;  1AH9 A;  1CA5 A;  5A2Q E;  4JOI C;  4ODG A;  2EDG A;  1LT6 D;  1H9S B;  1C4Q A;  2BE5 D;  3D4R A;  3CHB D;  4DR4 Q;  2EY6 A;  1QZH A;  2VQE L;  5BN3 A;  1ESF A;  3PUX A;  3E0J A;  1RCV D;  4B9X A;  1TII D;  1YNJ C;  3LWE A;  4XT3 B;  5IYB G;  1JE5 A;  2D62 A;  3OIP A;  2CH4 W;  3TEH B;  1WTX A;  2JXM B;  1WTH A;  3HP3 A;  4HSV A;  4DNI A;  3Q6S A;  5ELF A;  3ZJY C;  1U4L A;  3G7L A;  4JI3 Q;  3K6O A;  4BWG B;  1F9S A;  1H9S A;  3PIP 3;  4IZ8 A;  3DXJ C;  3HOV H;  1J6Q A;  1AZP A;  3HGB A;  3PIO A;  4Q0F A;  5M5Y H;  1XMQ Q;  4KY7 A;  3HRZ C;  1XTD A;  4A3B H;  3T4A C;  4WJW A;  2MGS A;  1TWH B;  3D31 A;  4V0B A;  1HJP A;  3H3V H;  3S15 H;  3EVQ A;  3FKI H;  5D3I B;  5FO7 B;  3J80 c;  2XIW A;  3BG3 A;  4JOI A;  4MNO A;  2F0P A;  3E5S A;  4KN7 C;  5IOD A;  1W6K A;  1Y8O B;  2KCC A;  4C3I H;  5FO8 B;  1C8C A;  2IHF A;  3CC7 A;  3FEW X;  3HOZ G;  2YU9 B;  4FDB A;  1O7Z A;  4ZK9 B;  4DNR B;  2SNM A;  2JQO A;  3DWQ A;  4E6I A;  1W2B A;  3A56 A;  2B2Y C;  1TS4 A;  2TSS A;  2LFN A;  1IYU A;  1STN A;  1WVL A;  4DA2 A;  5IT9 c;  3BJU A;  1VDZ A;  1XMO Q;  3K57 A;  1Q3L A;  2N55 A;  4JI2 Q;  2ZTC A;  1QVG A;  5HGQ A;  5IYC H;  2Z4I A;  4DR7 L;  1VQE A;  1ICW A;  2ZJP A;  1CT1 D;  4K2K A;  4H0L C;  3NSW A;  4ULL A;  1BBU A;  5IP9 G;  5LMN Q;  4KHP Q;  1U0L A;  3HEJ A;  1E7Z A;  4A3G H;  2R93 B;  3E3X A;  3DHQ A;  4MZ9 A;  2F0O A;  4ZKC B;  4YWL A;  4BY7 B;  1GUT A;  1R4P B;  1EWC A;  3R3O A;  2ZM6 Q;  4GLV B;  4B3S L;  1SE4 A;  1KRS A;  2IT1 A;  1S40 A;  4U68 A;  1XX8 A;  4DV4 Q;  1S5E D;  1CI3 M;  3J7Y W;  1X3G A;  5ELO A;  2JA9 A;  3MEF A;  4G57 A;  3TZU A;  1YHB A;  1CQV A;  2KHJ A;  2NYZ D;  4MIU A;  1STB A;  3CW2 C;  1K8A C;  4JBM A;  4JI6 L;  4F8M A;  1HNX Q;  1YJN A;  4GKK Q;  1SJH D;  2EYF A;  3PV0 A;  5FLM G;  2IWH A;  2NVX B;  3CCE A;  5C4J H;  1J9O A;  1OXS C;  4A3E G;  2WB1 B;  2EYJ A;  2WB1 E;  5M3M G;  4MHE A;  1VQ8 A;  2KCN A;  3VR4 A;  2B63 H;  1VQL A;  4Y7N H;  1OXV A;  3TSS A;  1Q82 C;  4EVO A;  1KQS A;  3F8T A;  1NY4 A;  3J80 L;  4N8F A;  4DR2 Q;  4PMC A;  4X62 L;  4YCV A;  2F4V L;  1K8M A;  1Q90 A;  1PFB A;  3S1Q H;  2FIN B;  3A5Z B;  2WP8 J;  1T5X D;  2RSN A;  1IKL A;  3VA7 A;  1NAP A;  3AFP A;  1Q7Y C;  2F3I A;  3NWS A;  3QB3 A;  3I4O A;  4AYB G;  3HOU B;  1Y8P B;  4IO9 A;  3KOJ A;  5M3F H;  1OXT A;  5IT9 L;  1SBB B;  4M8A A;  3H94 A;  1VQ6 A;  4OON A;  3C1E A;  1WTR A;  3S1N H;  1LTG D;  1PZI D;  2YU9 H;  3CAM A;  2JA5 H;  2YTY A;  1EY9 A;  5I6W A;  3MXP A;  4DKA C;  2BH8 A;  3GTG H;  1DGS A;  2OEO A;  5C0X G;  3W1B A;  5C3E G;  2HD3 A;  2F0S A;  2QEJ C;  4ABN A;  4C3H G;  1PH9 A;  2ENB A;  2ZTE A;  4G7H C;  2K5H A;  4S3S A;  2JA7 H;  1JIC A;  1GXD C;  1I4Q A;  4DUY Q;  3CRK C;  3LWU A;  4JG2 A;  3BS1 A;  3ERQ A;  4A3K G;  3J81 j;  4PZ8 A;  4NDX A;  1PH6 A;  1ZKO A;  2LY7 A;  3D4W A;  3S14 H;  2SEB D;  1N9W A;  1B44 D;  1WFQ A;  2EJM A;  4HMI A;  4BY7 H;  1EY4 A;  1U9R A;  4KJN A;  3RN2 A;  1LLR D;  4A3C G;  1WTO A;  2K4K A;  4BA1 I;  2N3S A;  2KEC A;  1UE7 A;  2OWO A;  3G6E A;  2HHH Q;  4C56 C;  4NPS A;  5IYD H;  4FO2 A;  4RKB A;  1I94 Q;  3PO3 G;  1E24 A;  2PW5 A;  2UUC L;  4EQO A;  3I4N H;  4IJL A;  1JOO A;  1UE6 A;  1STE A;  1XWE A;  5F2D A;  3KJO A;  1PH8 A;  1VQH A;  5ISR A;  1MHW C;  2I5L X;  1CKM A;  4DF7 A;  3PMF A;  1CZG A;  2NVX H;  2N49 A;  2RDF A;  2XWB B;  2VW9 A;  4QMG A;  5BR8 Q;  3B6Y A;  4RMF A;  2MUY A;  1PFM A;  3FPU B;  4DAP A;  2KQ3 A;  2B2T A;  3BDC A;  3D6W A;  3S2H H;  1PTO D;  3NUC A;  5EPJ A;  3CCJ A;  5C0X I;  4ZQ3 A;  1QOH A;  1ZEQ X;  1OXX K;  1KC8 C;  5CBE E;  1IBK L;  3A74 A;  4KKU A;  4B3M Q;  3GTM B;  4FYD A;  1BO0 A;  3CC4 A;  3PQI A;  1K0R A;  3OPO A;  2KA7 A;  4BA2 I;  2PQA B;  3S17 B;  4A3D B;  2Y0S G;  1LAB A;  2RCF A;  3OMC A;  4K5W A;  3RLN A;  4DAV A;  2VL6 A;  2A6H C;  4IOA A;  2DY7 A;  3I3C A;  1PRT F;  4AIM A;  1JWS D;  1EZ6 A;  3CD6 A;  3CXC A;  3DWA A;  3MEH A;  2R7Z G;  1KNE A;  1JOR A;  1HNZ L;  4JI8 Q;  2KOL A;  1WCM B;  4BBR H;  2DJF C;  3NHH A;  1MIU A;  2Z1C A;  3BYT B;  1D2B A;  4IQZ A;  4LJZ C;  3SK4 A;  2NTT A;  1PYW D;  1RDP D;  1N36 Q;  1X9N A;  3AU7 A;  2F0F A;  2PQA A;  1G51 A;  4IUT A;  3PUZ A;  1GD7 A;  2I0Q A;  4OX9 Q;  1ASZ A;  2XRS D;  4A75 A;  1BCP D;  4N9T A;  4WJ4 A;  1EYA A;  3HKZ G;  5JVH 3;  2B2V C;  1RF2 D;  3OTO Q;  4OHJ A;  2GN5 A;  4HID A;  3HFZ B;  1XNQ Q;  2L11 A;  4HJ7 A;  1STH A;  1SNM A;  3DUZ A;  1DD2 A;  2WAQ G;  3N6R A;  1N33 L;  1RHP A;  1X56 A;  2RHS B;  4A93 B;  3OW2 A;  1D1I A;  2AQ1 B;  5NUC A;  3VYS A;  4CHT B;  3HOZ B;  2AUK A;  2EYM A;  4PV1 C;  4A3M G;  3Q22 A;  4LFC Q;  5IWA Q;  4OO1 H;  4JBW A;  4DV1 Q;  1J5E L;  3AFQ A;  3MFY A;  1YNN C;  5EKL A;  3UI2 A;  1KL9 A;  5KNC A;  2EVB A;  2EY1 A;  1E2V A;  4UP9 A;  4YHH L;  4OXP A;  2E8G A;  3GTJ B;  4A3F G;  1GUN A;  3T13 A;  3G71 A;  1FJG L;  5IT9 E;  1CKO A;  1GJX A;  4GN5 A;  2MO0 A;  2UXB Q;  3SR1 A;  3W1G A;  3KF8 B;  2PI2 E;  4CKB A;  1NJI C;  2AUJ D;  1I6V C;  3TQY A;  5J1Z A;  2B2V A;  4I65 A;  4NMZ A;  5CV6 A;  4ZUJ A;  4IPD A;  1QVF A;  2FFK B;  1L0W A;  3SK5 A;  1TWF B;  4XQJ A;  2EIF A;  4JW0 A;  3DM1 A;  3R93 A;  3T1H Q;  1BF4 A;  3OWE B;  1U4R A;  2ES2 A;  4KK7 A;  2MP1 A;  2D2C C;  3J7A F;  4ZYS A;  4RHS A;  1K83 B;  1V1O A;  2C35 B;  2K52 A;  2PI2 A;  1CSP A;  2HIV A;  3ERS X;  2PZU A;  1PV4 A;  4FF1 A;  3RN5 A;  2OF1 A;  1PDQ A;  1TY2 A;  4A3E B;  3S17 H;  2EE1 A;  4A3D H;  5M5W B;  4N8X 1;  1PH3 A;  4BBS H;  1QIL A;  3EN2 A;  3ITP A;  4HJA A;  3NBH B;  4DV5 L;  4POG A;  1KAA A;  3MXU A;  4LF5 L;  4RG1 A;  3PF4 A;  4KHZ A;  1WCM H;  1B1Z A;  5CV4 A;  4L63 B;  2EXZ A;  1TQO A;  2UXC L;  3HOX G;  2K5Q A;  4CDF C;  2RKS A;  2AQ2 B;  3KLS X;  3FDT A;  4LF4 Q;  1X3F A;  3PCO B;  4JV5 Q;  5LMU L;  3ICE A;  3NBH A;  4DR1 Q;  2O5I C;  1C7Y A;  4PNY A;  2EJG C;  1S5F D;  1G8Z D;  2A6E D;  1KTK A;  4R4O A;  1G2S A;  4AYB B;  3CCS A;  1Y1W G;  3AEV A;  1G6P A;  4AYB E;  5ELD A;  3PO2 B;  1VF7 A;  1EIF A;  4LWC A;  1VQ9 A;  3DM3 A;  1SN8 A;  1E3P A;  3J7A 5;  2PYK A;  2CW0 C;  4A93 H;  1B2T A;  2HQL A;  1N32 L;  5DM7 3;  1CFM A;  2F52 A;  3EA6 A;  5KGU A;  1KXL A;  4JI3 L;  1WI5 A;  3OYY A;  3T1Y Q;  2H4O A;  2F0G A;  4LF8 L;  1TWC B;  4QJF A;  3GDE A;  2VZA A;  5C3E B;  1O78 A;  2O4X A;  4DR3 Q;  5IP7 G;  3TP7 A;  4C3H B;  1YNJ D;  5GAD C;  2WKC A;  3GQB A;  2IJ0 A;  1A2T A;  4PZ7 A;  3GTJ H;  4PG3 A;  1HFG A;  5KNB A;  2PMZ B;  1PTO F;  2PMZ E;  1VMP A;  1SNP A;  2WFW A;  3JAM E;  4R4I A;  4X65 Q;  3FP9 A;  2N8N A;  1EFW A;  3BVG A;  4DN4 M;  2VUM G;  2N88 A;  1IYJ B;  2F0K A;  2A74 C;  2F0L A;  4IPC A;  1BXT A;  2A5H A;  3IL8 A;  1RKN A;  4XYQ A;  1JQY D;  3BDL A;  2QCP X;  1H9R A;  2K5D A;  4GS3 A;  3HOW H;  1VF5 C;  2JA8 G;  4LNQ A;  4A3I G;  5IIF A;  3V96 A;  2VB3 X;  1EY6 A;  1YHA A;  1E2W A;  1FVI A;  1LTT D;  3PO3 B;  3I55 A;  3GTP B;  2MPM A;  3OSO A;  1ENF A;  4V19 0;  2QEX A;  3C1F A;  1N34 L;  3GTO B;  4KHV A;  5D3D A;  3PF5 A;  3NQT A;  3G4S A;  2EOT A;  4A3J B;  3ND9 A;  4KLK A;  1PTO H;  4HSP A;  4XQQ A;  4DK0 A;  3OW7 A;  4BXX H;  3QG1 A;  3SXH A;  3RLO A;  3IFD A;  5M5W H;  1EWH A;  3P75 A;  3KYH C;  1BCP F;  1ET6 A;  1MKH A;  2WII B;  4QY7 A;  2XRQ D;  2JA6 H;  3L7Z C;  3J81 E;  2E2D C;  5EPL A;  2NVQ H;  4XDX A;  2PZT A;  2SDF A;  2K32 A;  1A62 A;  2WKD A;  4TSS A;  4EQP A;  4X66 L;  2K14 A;  4UY8 C;  2EQS A;  1YNX A;  1F9R A;  2ZM6 L;  1DM0 B;  2R61 A;  5C44 B;  1CUK A;  1EQV A;  3KJP A;  2E76 C;  2KEN A;  1SRO A;  4POF A;  2ZXP A;  1JB7 A;  1CSQ A;  1KNA A;  2EPB A;  4XQN A;  1NNX A;  5JVG 3;  1LTS D;  5JEA G;  4IJH A;  3VR5 A;  5C5L A;  2PNH A;  2NVT H;  5KIX A;  3J7Z C;  3PO2 H;  3RUZ A;  1HNX L;  4L5S A;  5K5P A;  1BVS A;  1QWY A;  1UUP A;  3MA2 B;  4UP8 A;  3K7A B;  3WOF A;  4GKK L;  1TY0 A;  4C1N I;  2K75 A;  4JI7 Q;  1PH7 A;  5DLQ E;  2P5Z X;  2F3V A;  3D6C A;  2H1E A;  5IY0 A;  2GA4 B;  3DMU A;  2X6G A;  2VY3 A;  1E1T A;  2AWO A;  4DU9 A;  3PIP A;  2UXD Q;  3CCL A;  2CQA A;  2D0O A;  2JK8 A;  4JI5 Q;  3VYU A;  5BN5 A;  1B9N A;  3HKZ B;  1TWC H;  2KUM A;  2DY8 A;  3HKZ E;  2DNC A;  2ZJQ A;  4A4I A;  4C1N K;  1ONL A;  1HNW Q;  3HOY G;  2WAQ B;  4DV7 Q;  4DR5 L;  2BDO A;  2WAQ E;  5FO9 B;  2NZO A;  3F1Z A;  2F0Q A;  2DUD A;  1I4G A;  1A8V A;  2DNE A;  1IBL L;  5EKK A;  1KRT A;  4GNX C;  4A3M B;  1F77 A;  1MBY A;  4U67 3;  5LL6 X;  3H0G H;  2KED A;  2HQE A;  1EYG A;  1EZ8 A;  2L0C A;  3PUY A;  2A68 D;  2XGT A;  3J7A V;  4GKJ Q;  2XVS A;  1Q1E A;  1WD0 A;  2F0H A;  2L5T A;  4DV2 Q;  5E1F A;  3A7A B;  2BOS A;  4RHR A;  1BBX C;  3STB C;  3GTP H;  1E1O A;  2IW3 A;  2VS1 A;  4ZCK A;  1KDA A;  1SMX A;  3PIO 3;  4X3U A;  3I4M G;  1YJW A;  1EQR A;  2HCC A;  4A3J H;  4LFA L;  2XTI A;  5AJ3 Q;  1KDB A;  1M90 C;  4K8J A;  2VQF Q;  3SK6 A;  2KBN A;  1GVP A;  3K81 C;  2Z8L A;  1M1K C;  2G9D A;  2R6G A;  4ZRZ A;  1KAW A;  3UDG A;  1VQ7 A;  1EL0 A;  3C2P A;  1JC7 A;  2K1B A;  4G4K A;  2RHQ B;  1VQK A;  1A3T A;  5E7N A;  3A54 A;  3L3O C;  3QJY A;  1M8A A;  4K2L A;  4QGU A;  2NB0 A;  4GNX A;  4GLA C;  1HPC A;  1AE2 A;  1TT2 A;  4R8N A;  3PSI A;  2HT1 A;  1E22 A;  4DXG A;  1VQO A;  3GP7 A;  1Z9F A;  1EU4 A;  1PH2 A;  3RNU A;  4IOC A;  5C44 H;  2HHH L;  2LKV A;  4MTK A;  1LM0 A;  3DEO A;  3MC0 B;  5C4Z A;  4KY6 A;  2F1M A;  2PW7 A;  1LYL A;  4MTN A;  3NTI A;  1TKW B;  2NN6 H;  1DOK A;  1JJC B;  3K7A H;  3M4O B;  4DUZ Q;  2R92 B;  2SNS A;  3V05 A;  5I4D A;  3N52 A;  4HN7 A;  2KCM A;  2B2Y A;  2E2I B;  1SR3 A;  2RQX A;  4O1N A;  2BE5 C;  2ZTD A;  5BR8 L;  2IX1 A;  1D8L A;  3HOW G;  2JJQ A;  1DZ1 A;  5E4W C;  3PUV A;  1HZC A;  3CQZ B;  5LL6 S;  4KD4 A;  4AQY L;  3TDQ A;  4IN3 A;  4CGY B;  4LW1 A;  3A5U A;  5K36 G;  1Y1V G;  1PFN A;  1VQI A;  3ULP A;  1V1P B;  3A8J E;  2RBM A;  1PMR A;  1SNQ A;  3TS0 A;  2Z0S A;  1XNR L;  3CCM A;  1ENA A;  4C3J G;  1VQJ A;  3CP0 A;  3UE1 A;  4JI4 L;  2PO4 A;  2VQE Q;  1ILQ A;  4A3L G;  4X64 L;  1KD1 C;  2QW7 A;  2MO1 A;  4IPG A;  4LF6 Q;  1UEA B;  4CBV A;  1OXU A;  1TWH H;  4P72 A;  3BVZ A;  4GOP C;  1MSG A;  1V1P A;  3OOC A;  3QO2 A;  2HDM A;  4GN4 B;  4LF9 L;  1T9H A;  1TWA B;  1N36 L;  1HHV A;  4ZKB B;  1H9J A;  5C4X G;  3KLS A;  4B3R L;  3I73 A;  3M4Q A;  2KCT A;  1UE5 A; 
#chains in the Genus database with same CATH homology
 4N8X 1;  4JVZ A;  2HD3 A;  2Z9H A;  4JW0 A;  2QW7 A;  4I7A A;  2RCF A;  5L37 A;  4N8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...