4JVZA

Structure of thermosynechococcus elongatus ccml
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
94
structure length
92
Chain Sequence
MKIARVCGTVTSTQKEDTLTGVKFLVLQYLGGEFLPDYEVAADTVGAGQDEWVLVSRGSAARHIINGTDKPIDAAVVAIIDTVSRDNYLLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Two new high-resolution crystal structures of carboxysome pentamer proteins reveal high structural conservation of CcmL orthologs among distantly related cyanobacterial species.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Structural protein
total genus 11
structure length 92
sequence length 94
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4jvzA00
2Z9HA 4I7AA 2RCFA 5L37A 4JW0A 4N8FA 4JVZA 2QW7A 4N8X1 2HD3A
chains in the Genus database with same CATH superfamily
4A3LH 5M5YB 2L11A 4ULLA 1JQYD 3OW2A 2CWPA 2WAQE 1HNZQ 1G2TA 3MFYA 3U4VA 5LMUQ 4HR7B 3GTGH 2IHFA 2L1BA 4LFAL 1XMOL 2FMMA 2ZJQA 2DNCA 4QIWB 1Z47A 2Y0SG 4BY1B 4ALPA 4DV4L 3OIQA 5BR8Q 2HUGA 2HIVA 1ZEQX 2IX0A 2X69A 1N32L 1XMQL 3KDFB 2RCNA 4A3CH 3RD4A 4F87A 2MO0A 2F0LA 4R1JA 4B3SL 4DXGA 4I7ZC 4KTAA 1GHJA 1OXVA 4JBWA 3UDXA 4HJ8A 4DAPA 1HZBA 4JI2L 4JVZA 1SNQA 3TP8A 3PGZA 2ICEC 3K0YA 3S15H 4IFDJ 5GAHC 4LJZC 2QA4A 1KD1C 4Z9CB 3HKZG 1BOSA 1STHA 1CFMA 3ZYYX 2K5NA 1YIJA 4BXXG 4KJNA 4GOPA 1X56A 4KHPQ 2F0OA 4YIJA 2PW5A 5IP9H 2F0VA 1QJOA 3H94A 1XPOA 5IT9E 2KVMA 3J80L 4ZUJA 2CKZB 2NVQB 4JI0Q 1LUZA 3CPWA 1RTNA 3BVMA 3KUPA 1A6XA 1AP0A 1S4ZA 2EY1A 2PZTA 1D5ZC 4BY1G 4LF4Q 4GS3A 3VA7A 2KCNA 3TP6A 1BO0A 3U9OA 4LFBL 3T16A 3OTOQ 3M4OB 1K73C 5BN4A 1EIGA 1R4QB 3DUZA 4Q0FA 1QVCA 2RDFA 4FYDA 4KI0A 4A3GG 2MP1A 3T13A 1IKLA 2B2UA 4RG1A 3R93A 1EIYB 1ONLA 4B3MQ 1UE6A 1NNXA 3KOJA 2KUMA 4CJ2C 3D6CA 2JA8G 1TWAH 4F7XA 4YHHL 1RODA 3CCVA 4N9PA 1SLJA 3NQIA 1PRTB 1EQTA 3N6RA 1E22A 4JI7L 1CKNB 3T1HQ 1S3OA 4DF7A 2VUMH 5IWAQ 1S5DD 3K59A 1UUPA 4V0BA 4AYBE 3SK8A 1HNZL 1JB3A 3CD6A 3H3VH 2AQ2B 1VQ9A 3URYA 3TDQA 3CHBD 2ENBA 2BA0A 2F1MA 2NBFA 4YCVA 4BBRH 4J6HA 3VYSA 4LF9L 1V1PB 3CCRA 3J7AF 4JI8L 1STNA 1P16A 1STAA 1VS0A 4GLAC 1ENAA 1O7LA 1WCMB 3S1RH 2KHIA 1ESRA 1FGBD 4A93H 4OX9L 4RMFA 1B3AA 1GXDC 2EDGA 2B39A 3OWEB 2LXKA 5CGKA 1WD1A 3EVQA 2MNAA 3AU7A 4QF4A 1CI3M 3K81C 2UXCQ 1KNEA 2R7ZH 3O13A 1HNXL 1L2FA 1QWYA 3KYHC 4GKKL 1KRSA 2E2IH 3M7NA 5FLXL 1VQCA 1GM5A 4UP9A 1TY2A 5T1IA 2WP8J 1LT4D 1DOKA 1HFGA 2HD3A 3A74A 1TR5A 1IHZA 4QUFA 3RLFA 2J7ZA 1VQ6A 4DN4M 1MHWC 2DY8A 1BCPB 2EQSA 3GTQH 5EBDA 2D0PA 1PFSA 4A3BG 3OWFA 2AUJD 3A56A 3HOZH 3PUVA 3S1QH 1MKHA 3V96A 4TQUS 3UDIA 3AFQA 3BJUA 5IP7H 2QILA 4JI0L 1SEBD 3NWSA 2AUKA 3VA5A 1QG7A 1Q46A 1JC7A 1OXXK 1PDQA 4AYBB 1ENFA 4F88A 2E2HH 1GJXA 4ZLTF 2PQEA 3KLSA 2F3VA 4TSSA 1Y69U 3PO2H 4FXGC 1TS3A 2XTIA 4X3TA 2A74C 3LGJA 3GQBA 4X65Q 1Y1VH 4A3LG 1I6HH 1I4QA 1GUOA 5FKAC 2PYKA 4A3EH 4B3ML 2L12A 1QUQA 5JJLA 3HS0C 2X6LA 4A3JH 1QVFA 3PIPA 1MBYA 2L5TA 2ZJPA 1GUSA 2E75C 4JG2A 2DY7A 3STBD 3PF5A 3HRZC 3RR5A 2F0IA 2F0MA 4RCOA 2UXDQ 4O42A 1DD2A 1H95A 2WV6D 5IWAL 1VQ5A 1PFNA 2J4XA 4A3CG 4GKJQ 1PFMA 4RHRA 2CFMA 3PUYA 4LF6Q 3CCSA 1V9PA 2B2VC 2JP1A 3KLRA 1TWFH 2BE5D 1IBLL 3HOUB 1FNVA 4DV0Q 4H02A 1VF5C 3FEWX 1K3BC 3NBHB 2Q8RE 2OXPA 3NENA 5JJZA 2GN5A 2H1EA 2OCEA 1EY4A 3KF6B 1B70B 2BDOA 2VUMB 1B44D 4DR2L 1STEA 4IZ8A 4PMBA 2TMPA 1CKMA 4N8X1 4AYBG 4EQNA 1QZGA 2PNHA 1B8AA 1STGA 2RA4A 4C3JH 3NTIA 1NR2A 1G2SA 3I4NH 4BBRB 2F03A 3GD7A 2LY7A 1L1OA 1BBXC 3OMCA 3PV0A 1LACA 5FO8B 1AN8A 4H44C 2HCCA 3MEHA 4KY7A 1SN8A 4DK3C 2DJFC 4UDUC 1S40A 1G291 3TN2A 1PH4A 3X3MA 4QGUA 3DM3A 4A93B 2VB3X 1KRTA 3TBIB 1EQQA 1FNUA 1S5ED 4B9WA 1ET6A 2F0HA 4IPDA 4GZYC 2LFNA 3I56A 1IBKQ 2R7ZB 4A3IH 4CDDC 3HEJA 3FMCA 2A1AA 5ELNA 2R7DA 4KD4A 1WOCA 1KLGD 3TRZA 4IUPA 5AFWA 4YCUA 5CV9A 4LF7L 1XWEA 2PQAB 3TZDA 2VUMG 2E74C 4X65L 5GAGC 1JWMD 3FVQA 2F0GA 2KECA 1BCPF 2BDNA 3HOZB 2NUCA 3S1QB 3OYYA 4G7ZC 4KN7C 3ULPA 4KKTA 4BBRG 4JBMA 1PH2A 1MGSA 1JORA 1XX8A 1PZID 1XJVA 3VR4A 1ET9A 3VR3A 4A4IA 4GNXC 2HIXA 1SYCA 4IPCA 1K8GA 3I70A 3NTHA 1D7QA 4A93G 3ERQA 3FKIH 3G6EA 1DONA 4GKJL 5EPLA 2Z4HA 4J15A 4L5SA 2QEJC 4NMZA 3CMEA 1AW7A 4CKCA 2R7ZG 4DV2L 3I4MB 4QQBX 3ERSX 4X64Q 2NTSA 3HZXA 4HJAA 2OQKA 1TWFB 3G7LA 1YEZA 1AE2A 4DR3Q 3ZJYC 3HOZG 1Q8IA 1DZ1A 3I91A 4ZK9B 2G5DA 2JJQA 4M8AA 1KC8C 3GTLH 5IP7G 1GHKA 1SFOB 2F3IA 5C5MA 2B63H 2UUAQ 2OQ0A 3NELA 4X66Q 3CC7A 1WTVA 4G57A 2NTTA 4JI3Q 2RVLA 4C3IB 3I7FA 5LHY1 1EYAA 5JPNC 1Y1VG 3I4NB 3PIP3 1K3RA 1QB5D 4QY7A 4DUYQ 4RAUC 3D8GA 1U5KA 3GTOH 3UE0A 1HHVA 4MTKA 3T53B 1SYEA 3EFXD 1HCZA 3JAMi 3CRLC 2H5XA 1N36Q 1HTPA 1K83H 1C9OA 2JEAI 5CV6A 1N33Q 2G9HD 3I4MG 3A8IE 4ABNA 4BA2I 5IOCA 4DV6Q 4GNXA 5BN5A 1RKNA 3AFPA 4FO2A 1X55A 4KLKA 5IGDA 3RMHA 2F0JA 1CKOA 3Q8DA 1PXUA 2BCOA 2NZOA 1X3EA 3EROA 3D6WA 4HEDA 2PZUA 3GTKB 2UXBQ 3K7AH 3GP7A 3T56B 2XN9C 4JBJA 1DM0B 1HPCA 2I46A 3M4PA 2OWOA 2KCTA 2Z4IA 5GAEC 3F2UA 4C3JG 4DK1A 2UUBQ 2E76C 4C3IG 1I4PA 1L0WA 4F8MA 2QDBA 1DYQA 3I4NG 1NE3A 4B3TL 1JT8A 3B6YA 4LUVA 2E5LL 1TY0A 5EKLA 2MPMA 1IYVA 1AFPA 3TP7A 3CCQA 1YJNA 2EYFA 2DGYA 1DCZA 3J80c 3HOWH 1M4VA 5I9OA 5JAVA 1ENCA 1PTOH 5M5YH 4JI5L 2A6HD 3FKIB 3TSSA 4PV1C 2CW0C 4DPGA 1EQVA 4HJ9A 2CQAA 3UI2A 5IY0A 2CCZA 4IOAA 4BS9A 4ME5A 2EYMA 1UNSA 3S2DH 4A3IG 2F0FA 1CHQD 4K2LA 4FDBA 1NCVA 1PMRA 2K75A 2I5HA 1PZKD 1U4LA 1SAPA 1D1IA 1B2TA 2XRQD 4X66L 5KYLA 5IYDH 2IPKD 4LFAQ 3UDFA 3W1GA 1XMOQ 5JVH3 3PQIA 4HIMA 2IX1A 2B3GA 1NMFA 4LNQA 3RZDH 3A0JA 5NUCA 3F2BA 5E4XA 1WI5A 1VMCA 4HCSA 3F2DA 4AIMA 3PO3B 4G7OC 1HUMA 1N32Q 1IW7D 4WFN3 1XMQQ 2B63B 4C1NI 1EU3A 4DR1L 1N36L 5C0XH 5D3DA 2NN6H 1N33L 4C3HH 4DXFA 1EZ6A 3G6JB 1CHPD 3FKIG 1WTRA 4DV6L 4JI2Q 2HQLA 2O5IC 3GTOB 3FHWA 5KNCA 4H0LC 1CSQA 3E9IA 3H91A 3U4ZA 1IZ6A 2CQOA 1YNJD 4YY3Q 1KIXA 4DNTB 1K83B 4JPBW 2UXBL 5IYCH 2MO1A 4JK1C 2AKWB 3IL8A 4X3KA 2K52A 2YTYA 4EQ5A 1LLRD 1F2ZA 2K28A 2B2TA 3M3YH 4ZKCB 1G51A 2SEBD 4H13C 2UUBL 5M3MB 2O4XA 1GUTA 4A3DH 2CWAA 1X9NA 5C4ZA 2KJXA 3K57A 1VQ4A 1NSNS 3VYTA 2NVYH 3K7AB 5EJWA 4LFBQ 1TS2A 3SEBA 5KGUA 3CXCA 2AWOA 3I90A 1H9SB 4JCVE 2B63G 3NWTA 1KQSA 2K01A 4OXPA 1KXLA 3MXUA 1YJWA 1FNWA 1A3VA 3SK4A 2A5HA 3QB3A 3L2PA 2VY3A 4FXKC 1VQJA 2RBMA 1BDOA 3KDFA 3CW2C 1Q81C 4DNIA 1LTGD 2GVAA 1K8AC 4N8FA 3MEFA 2OTLA 1WCMH 1RTOA 1PTOB 2B2UC 2A69D 3TS2A 2EE1A 1CZWA 4C2MB 3J80i 1FJGL 1YNXA 3R2TA 5D14A 4EX5A 3MAQA 2MQHA 4OHJA 1O80A 5LL6S 5IE8A 3S2DB 4LF9Q 4JI8Q 4PZ6A 4AQYL 3KBXA 2KHSA 4KHZA 3AEVA 4OX9Q 3NE5B 4DV5Q 4OWXB 4CDFC 1E7ZA 4OIJA 1A0IA 1SSOA 2CH4W 2GVBA 1PVOA 1TKWB 3MHBA 1WTWA 2V1CC 3RZDB 4CBVA 1JMCA 1B4OA 2PW7A 2HT1A 2KEEA 1HNXQ 3F1ZA 4GKKQ 1OTCA 2E8GA 2I5MX 3BU2A 1TWHH 3HFZB 4YY3L 1TQOA 3M4YA 1AZPA 3HOWG 1LABA 4RGOS 1PH6A 3EN2A 3QOLA 4C3HB 1A63A 4KKUA 3RN2A 4YWMA 2KEDA 4O1NA 4JI6Q 5CV4A 4DV3L 1VQDA 1X3GA 3MXNA 4CKEA 5CMDA 3FP9A 4RGMA 2CH4A 4X3SA 1AZQA 2NWGA 5ELCA 2NVXB 4P75A 5FLMH 1YHQA 1I50H 4UY8C 1HJPA 2A68D 2MHVA 2Z9HA 3BDLA 4L5RC 4LFCQ 4G7HC 1PRTD 2A19A 3M3YB 1SYGA 4Y52H 3K5NA 2F0DA 1BF4A 4R9WA 1V1PA 5IYDG 2RDGA 4P72A 4X3UA 4A3DB 3L3OC 3HOUH 1VMPA 2BA1A 2B29A 3H09A 1KDCA 3Q0AA 5A35A 3J7YW 2F4IA 3IFTA 2B8FA 2ZTCA 2A6EC 4JI1L 2RHQB 2NVYB 1FVIA 4GN4B 2F0KA 4QMGA 4DU9A 2D0OA 5JOBA 1X65A 3STBC 4ZKBB 1I5FA 2K5DA 3LNNA 5C0XG 2NN6G 3NXWA 4C3HG 2VL6A 4GOPB 1NMGA 1IBLQ 2EJFC 4K5VA 3G4SA 2BE5C 2AQ1B 4IUUA 3NQTA 3VR6A 1ML0D 2C35B 1GD7A 3Q6SA 5LMNQ 3NBIA 1K9MC 2LXJA 3CCMA 1LV9A 4XT1B 4DR2Q 3NK9A 4G4KA 1PTOF 4PZ7A 2BOSA 4K8IA 5I6YA 4DV5L 5IYCG 3NSWA 4K6DA 2QKIC 1VQGA 1B9NA 2O2LD 3IRBA 1JJ2A 2WINB 1SBBB 2R7FA 1VQKA 4P2CB 1BCPD 1F2YA 2EIFA 4MHEA 5A2QL 4KKSA 3C46A 1FYCA 4A3DG 4RH6A 4HIDA 3D4DA 4JW0A 3QO2A 2JA9A 2PI2E 1SJED 3QWNA 3PIO3 5M5WB 1SE8A 4V190 1AE3A 1L1OC 4TKOB 1HR0W 1IL8A 1A3UA 4JI6L 1CM9A 3CCEA 1ILPA 2YV5A 3JC66 1SE4A 5C3EB 2QGQA 1GUNA 4CHTB 4R8IA 5HGQA 4FF4A 3W5OA 1TWHB 5K36H 3S16H 1LM0A 5C44B 1Q8KA 4K5XA 4Q5VA 4LF7Q 5CYUA 2WIIB 1WCMG 4ZUIA 1NY4A 2WFWA 3T1YQ 4LFCL 2KQ3A 4PNYA 5DM73 4IJHA 1PH7A 1VQFA 1SROA 2E2JH 3HOVB 3I2ZA 3MWYW 4KV6A 2R92B 1JWSD 1EY5A 1MI2A 3EBEA 4R8NA 1YHBA 2AHOB 3OW7A 1G6PA 1VCIA 3DLLA 1A15A 3SGIA 2JA5H 3IAYA 1I50B 2IHEA 2EYLA 3ND8A 2Z1CA 3I4MH 3HKSA 5IYBH 2IJ0A 1B7YB 1VQNA 1I3QH 4XYOA 3RLOA 5FK9C 2QW7A 3S24A 1Q7YC 1YNND 2IL8A 2FINB 2P5ZX 1KDAA 3C3LA 1DOMA 1VQHA 1X54A 2LS01 1LT6D 4DV2Q 5F2DA 3V2TA 1Z9FA 2K14A 1BBUA 1Z7TA 3GDEA 3J80E 4FF3A 5LMNL 1VF7A 2HDMA 2JA6H 2VB2X 3D4RA 4HMIA 4JBKA 2DJGC 3DM1A 4IURA 1PRTF 2ZTEA 1SFOH 2ZXOA 4KY5A 4GN3B 3TREA 4C3IH 1VQOA 5FO9B 1RL2A 3EJIA 4IJLA 4B08A 2L9HA 1QZHA 2WKDA 4APVA 2A8VA 1GOZA 2N88A 1B50A 5JEAH 1EY0A 4XXEA 3JAMc 1A2UA 4K0KL 3OSOA 2PQAA 1QUQB 4CJ0B 3CC2A 5JJIA 4B9XA 4L5QA 4L5TA 5EKIA 4UPAA 3KJPA 5FLMG 4NP5A 4CKBA 4OWWB 3K5OA 1Y8NB 3Q24A 3LX0A 4ZAIA 1C0AA 3EQLC 4NXNL 3SK6A 5TSSA 1H9MA 1UAPA 1WD0A 3KFUA 2RSOA 1EFWA 3H15A 3J7AV 1Y8PB 2FJ2A 1N34Q 3HOUG 2F0NA 3BVGA 3A54A 3CCLA 3J81L 2VZAA 1W2BA 1JB7A 3GTKH 2EXDA 4CDEC 2M9VA 2QF7A 5T1GA 1E1TA 1EY6A 4IQZA 2RQXA 3T1YL 4PG3A 1XYIA 1VQ8A 4XQQA 2SNSA 1HA5A 3SVMA 3C2PA 1I4HA 4IFDH 1UEAB 3DEOA 2Q2UA 4KJOA 4O2DA 4K6LA 4LK1C 5EKKA 3S16B 3FPPA 4QB4A 1VQIA 3K7UC 2F0PA 1OXTA 4FF1A 3WWVA 2LSSA 2F4VL 1UWVA 2I0QA 2J0TD 4RHSA 3D3RA 1K0SA 5KEEA 5I2XA 2ICIA 3NTKA 5IGBA 2R61A 2E2JB 4LWCA 4LF5L 1XPUA 1FR3A 2C9OA 2AMCB 1IL2A 4I7AA 4LUZA 4B3TQ 1TVXA 1W6JA 3CQZH 1I94L 2E5LQ 2F0TA 5I4DA 4FNFA 2JA5B 3VR2A 4IO9A 4JI5Q 4OGQC 2OTJA 1I3QB 1RDPD 1SMYC 2CVRA 1E0BA 1C7YA 2EYJA 4XQJA 1R9TB 1PH5A 3I3CA 3I8ZA 1EYGA 4IUTA 4KY6A 2JQOA 5ELEA 1SE2A 1MSGA 1Q90A 1M90C 1WJJA 1RCVD 3KJOA 4QCLA 4DGZA 1PA6A 3OOCA 1NR4A 1B9MA 3I73A 5E4WC 3MXGA 4C56C 1J5EL 2B2YC 2EY5A 2JA6B 3PO3H 5K36G 2DN8A 4HTHA 1YITA 5AJ3Q 3DWQA 1B1ZA 1JCKB 2NVTB 1DGSA 1II3A 3A55A 2D5DA 4MNOA 2R93H 1DOLA 4K14A 1TWGH 3S1NH 5IGEA 2KA7A 2XWBB 5EBCA 2C5CA 3KF8B 2IW3A 1E2ZA 3UDGA 3HG9A 1CTMA 5D3IB 4P74A 1TT2A 5C3XA 2VQEQ 3NPPA 1N34L 1D5XC 1V43A 1RIPA 1T5EA 1LTID 1KAAA 4X6AH 4MIUA 5H1SE 4DR1Q 2JA5G 1IW7C 1F9QA 1X3FA 3TQYA 2Z6BA 5ELDA 5IYBG 1CZGA 3G48A 2KENA 3HOYB 1F77A 3M4QA 3SK5A 5HURA 3D0FA 2KBNA 4LAAA 5M3MH 3K80C 3U9SA 1ESFA 1EU4A 4C1NK 1WTXA 2ZTDA 4DFAA 1E24A 1VQAA 4RGTA 2F0QA 5EAYA 5M3FH 2K04A 3S14B 2JA6G 4BBSH 3KBGA 2WB1B 1M1KC 2HHHQ 5I2YA 4DK6C 1VQBA 2SOBA 2XGTA 3A7LA 4WRDA 1W6KA 4PMWA 1YI2A 4JOIA 3EIVA 1JOQA 4A3FH 4JI4L 5C6AA 2HCIA 3MVVA 2XVSA 4DUZQ 5JEAG 1BR9A 4YWLA 1GVPA 2IWHA 4A75A 3M85A 4BY7H 2JN4A 2B2TC 3R2IA 1PYWD 3IKJA 4LF8Q 1HQRD 1SXTA 3OPOA 2B2YA 4C2MH 1D2BA 2L4NA 4HCEA 1LYLA 1T9HA 2ID0A 5L37A 4HIKA 3I72A 1U4PA 3NP8A 1S5FD 4L8JA 4UHVA 3ULLA 4GNXB 2A73B 3CQZB 3QOJA 2AWNA 5M9OA 5C0XI 4K5WA 3IFDA 1SNCA 1Q1EA 2TSSA 5HGTA 2NN6I 2Z0SA 5IODA 3MTSA 5AJ3L 3I55A 3T51B 2A69C 4OO1H 1FJGQ 1SNMA 1Y8OB 4IOCA 1X3QA 4OELB 1EY7A 3S1MB 3E0JA 2RCFA 3I4OA 4CJ1B 1OXUA 1QVGA 3TP5A 1Z6HA 5M5XH 1J9OA 2MFIA 4DR7L 4A3MB 2OF1A 3QG1A 1O78A 4ODGA 4QL5A 1HRJA 4IFDG 2VQEL 4AQYQ 3VR5A 4RKLA 3S9WA 4O0AA 1WTPA 2VXWA 2YTVA 2MUYA 4UP7A 1N8RC 1LTSD 2VW9A 5DNFA 5IGCA 1NAPA 1I6VC 2R93B 3GTMH 1HXYD 5IT9L 1TWGB 1BUVT 3S1NB 1MJEA 4GN5A 3S2HB 1Q1BA 3DEPA 5EPKA 3NEMA 3GTJB 2GA4B 4Y7NB 2SDFA 3GV6A 4A76A 1PFBA 2EYPA 1TS4A 1A3TA 2IT1A 3CP0A 4NXML 2XIWA 3HOXH 2NVXH 5CV8A 1B53A 2Z6KA 5HY6A 5FLXc 1BKBA 4UP8A 3S17H 1XPRA 2K7VA 2EYHA 4JV5L 2HHHL 5FJ8G 2PCFB 1WVLA 4DAYB 4DV3Q 2JE6I 1YHAA 4RA8A 2PMZB 4KHVA 3NHHA 4DUZL 4E6IA 1CT1D 4DR6Q 5M3FB 3RLNA 3PO3G 4LF8L 2K50A 4BBSB 1DXMA 4QUCA 1PTOD 1PRTC 3F2CA 3PIOA 1CQFA 2R93G 1ZYRD 1HQMC 1E1OA 3P1HA 5CV7A 1F9RA 4A3FB 2KCMA 4XIGS 4A3KB 4WJWA 3AQQA 4JI1Q 4BY7B 4IUVA 4DR5L 3PSIA 1VQMA 4NPSA 2ZM6L 1D6EC 1WTHA 2F0WA 3U50C 5IGFA 3QJYA 4JC0A 1SMXA 1OXSC 2XSCA 4CDCC 4JYAL 1O7YA 1ASZA 3HKZB 2XWJB 4LW1A 5M3MG 3J7ZC 1SR3A 5ELBA 1STYA 2QDLA 5GROA 2D2CC 5BN3A 1HR0L 2SNMA 5M5WH 5M3FG 1GKHA 2B2WA 3BG3A 4BBSG 2UUCQ 4ZYSA 3CU7A 5M5XB 2PPBC 4R4CA 2ASBA 1NJIC 2Q8IB 1SDFA 3JAME 1G6ZA 5C3EH 5JPMC 1BCPC 2UU9L 1AEXA 1ICWA 4A3FG 2EY6A 2RF4A 1TWCB 3CAMA 2JA7B 3ULJA 1CQVA 5C44H 4A3KG 1VQPA 2EPBA 4A3GB 4BY7G 1CK1A 4HSVA 1HTLD 4OIKA 3GTMB 4RWSC 1RD9D 1Q82C 1VQ7A 3H0GH 4RCNA 5CR3A 3SDZA 2VQFQ 2JA8B 3U58A 3V05A 1FD7D 3KLSX 2YU9H 3HOVH 2AQ3B 1A62A 1F9PA 4EQOA 2R92H 2B8GA 1CKNA 3DHQA 1LTLA 4DV7L 3HOXB 4DR6L 1EWIA 2D9UA 3H3VI 1IKMA 1U4RA 3S17B 3VYUA 4L6TB 3AMUA 3J81c 4OO1G 3C1EA 5C3WA 3CMAA 4YWKA 2EVBA 2DUDA 3ER0A 3GV3A 3OMGA 1PH3A 2NZ1D 4XQNA 2WAQB 1LTAD 2N49A 3E3XA 1J6QA 1Q3LA 1CUKA 2R6GA 4BA1I 1HA6A 4R4IA 1IBML 2JA7G 3FPUB 1GUWA 2O5JC 3MZ5A 1EWCA 1YNNC 3E9HA 1DJRD 1SYDA 1PH8A 4X62Q 4DR4Q 2MGSA 1VQLA 2K32A 3SR1A 3H3VC 4OEMB 4DKAC 1JICA 2JXMB 4OL7A 1KNAA 4HAEA 5DAUA 3MXNB 1KHIA 3WOEA 5D65A 3R8BA 4WORA 5KNBA 2KOLA 4M1UB 3HOXG 4A3BB 1V1QA 3BDCA 2OEOA 1JOOA 5LMUL 5CBAE 4LMQD 3C1FA 2UUCL 3HGBA 2WKCA 2WACA 2EXZA 2F0SA 5KIXA 4ZQ3A 1F2LA 1L0XB 3J7A5 3NUCA 4K0KQ 5BR8L 3K5MA 3E0EA 2NB0A 5C4XH 4KK7A 4NDXA 5KRUA 1O7IA 1C4QA 2F0EA 4P73A 3D4WA 2WAQG 2HQEA 1EUJA 3QR8A 1JWUD 3K0XA 2F3WA 4H7BA 1EFID 2Q2IA 4TVAB 3GTGB 2E2DC 1RJTA 4TRDA 4NXNQ 4K8JA 2K5HA 1TS5A 4DK0A 2EOTA 3N52A 2VQFL 1JJGA 1QILA 1XNRQ 5C4HA 2BH8A 1IYJB 5J39A 4NB3A 1EY9A 5IIFA 4B3RQ 1W3SA 1E2WA 3W3AA 1F9SA 4HN7A 1V1OA 3RNUA 1S5BD 4KHPL 4KMUC 3H0GB 5J1ZA 3NBHA 2QEXA 2PI2A 1SYFA 2K05A 1GUGA 3M7GA 2YU9B 1JE5A 2JYOA 3S15B 3KF6A 1KAWA 2I5LX 3WOFA 3CCJA 1OO9B 2ALYB 3BS1A 4LF4L 3PF4A 2Q8TA 1EOTA 1T5XD 2F4VQ 1QNKA 3OTOL 3A5UA 3L7ZC 2Q2TA 1VQEA 4K2KA 2RDHA 1Y1WH 2FHTA 3D31A 3SHLA 5KYIA 2K6AA 1ZKOA 2NZHA 1EQRA 1R9TH 1LTTD 4LF5Q 3J81i 1EIFA 3TZUA 2BH2A 1KTKA 4X62L 4J1MA 4DR4L 1EYCA 1HNWQ 2A6ED 1I94Q 1K8OA 3AB9A 5C3EG 1N9WA 1ASYA 2K5WA 1R4PB 3T1HL 1I4XA 5C44G 1QE6A 3BYYB 4U673 1PH1A 2L55A 2NVTH 2IY5B 3P20A 1UE5A 1A2TA 4RGNA 1LT5D 3H0GG 2VNUD 1D8LA 5J3BA 1TWAB 3R3OA 1EEFD 3EA6A 4S3SA 1STBA 3HOVG 4HJ7A 2FFKB 1J5EQ 2EZVA 1JJCB 4AH6A 1XNQQ 2R92G 3PCOB 2DNEA 1SE3A 1KL9A 3TS0A 1D1KA 2VS1A 4DV1Q 2L0CA 5C0XJ 4RFBA 2N55A 2EJGC 3P75A 4RKBA 4IFDI 3LWUA 2N8NA 5IP9G 2K33A 2FXQA 4FF2A 3HOYH 2UXCL 4I65A 3Q23A 1XNRL 3S1RB 5C4XB 4PMCA 1EZ8A 5DLQE 3QIAA 4OWTB 4B3RL 4IALA 1BQQT 3L0OA 4U68A 3CKIB 1K0RA 1EY8A 3KLWA 1CA6A 3S14H 5G3LD 3K5LA 3RN5A 4YCWA 2XNAC 4XTCS 2E2IB 1S72A 5IT9c 2H4OA 4FXDA 1BVSA 2K5QA 1X3PA 2PO4A 1L1OB 5A2QE 1HFNA 5ELFA 5FLXE 3AYHB 3VDYA 2K1BA 4HSPA 3E6ZX 1EIHA 4J8QA 3GTQB 1V8QA 2ZXPA 3PUXA 3Q22A 2R3ZA 2YTXA 1MSHA 4JI4Q 3PMFA 1HNWL 2B2VA 2E2HB 1KLUD 2V4DA 3PO2B 3K6OA 1G8ZD 5C4XG 2UXDL 1Y1VB 1I6HB 5E1FA 2L15A 3I4LA 4QJFA 1Y1WB 3KF8A 4JOIC 4WJ3M 5FJ8H 2A6HC 1I4GA 5IGGA 1WTQA 4DAVA 3X3NA 4FVMA 4A3EB 4LF6L 3GTPH 1Q12A 2ATWA 1NUCA 3S1MH 4DNRB 2FMCA 2WB1E 4DV0L 4XYQA 2N3SA 4NW2A 4A3JB 2KHJA 1UEBA 3OHXC 3RUZA 1HZCA 4A3MH 1L0YB 3ND9A 1YBYA 2RKSA 1GO3E 5E7NA 2M2LA 3M9BA 1KABA 5I9PA 1XNQL 1QNUA 3CCUA 5K5PA 2YYZA 3DWAA 3A8JE 3F8TA 5CV5A 4DV1L 3J81j 1E2VA 1J8IA 3CF5A 5J22A 1I4RA 5ELOA 3LWEA 4R4QA 1MD2D 1SNOA 1A8VA 3VYRA 1CA5A 4DR7Q 3S2HH 3BZKA 3GTJH 4Y7NH 1NBWA 1QCBD 5JVG3 5LMNW 1LTRD 4C3JB 1B3QA 3PO2G 1EOVA 1ZXTA 5DM63 5EQ0A 1S5CD 3BYTB 5FO7B 2Q2HA 3RZOH 1XTDA 2QCPX 1IBKL 1Y1WG 2F52A 4DAMA 3W1BA 4A3EG 1H9KA 1PLFA 1U4MA 4IPGA 4P71A 5FOBB 2CHBD 4A3JG 1X32A 4NXMQ 4ZRZA 3ICEA 3E5SA 1YNJC 4HIOA 3PUWA 4ZCKA 4JV5Q 4UAIA 1PHJA 1FGUA 1M8AA 1LO5D 4A3IB 1MIUA 1SNDA 1PYSB 1TU2B 4XT3B 5E3FA 3ITPA 2JSOA 3FRPB 3G71A 1U9RA 1XXGA 2M00A 4MTNA 2Z6KC 1SJHD 3KK7A 4HJ5A 1PH9A 4A3KH 4OO1I 5CC4A 1WYDA 2N78A 1YZ6A 5G3LF 1X6OA 3PUZA 3J81E 1TIID 1O7ZA 1PTOC 5C4JH 2IX3A 1PV4A 1UE7A 1ZYRC 3CPFA 3HOYG 1P8LA 1G91A 4N9TA 1LT3D 1WFQA 1D5MC 1RHPA 1KDBA 4DR5Q 1ICFB 4IPHA 1PYBA 1HZAA 1QOHA 1SMYD 4BXXH 2ZM6Q 2PMZE 1BBWA 3A8KE 4X64L 5KNDA 3UE1A 3DMUA 3MC0B 4HMJA 5CORA 5I6WA 3JAML 3GTPB 3MXPA 2KCCA 2WB1G 1ILQA 5GADC 4JYAQ 4BWGB 2I07B 4KN4C 3DWPA 2RSNA 1EWHA 2Y0SE 4DR3L 2EJMA 5COYA 4BY1H 1WTOA 1JOKA 4IUNA 1BNZA 1TWCH 2JA7H 5JJKA 4L63B 2UUAL 1EYDA 4DA2A 4A3GH 1HR0Q 4JI3L 2X6GA 1EL0A 5C5LA 4DAYA 4ILWA 2MJ8A 2ES2A 4XDXA 1C8CA 2D62A 2JA8H 4DUYL 4DV4Q 4EGVA 2LMCB 2UU9Q 1YJ9A 3WDNA 3GTLB 4ME3A 1YVCA 3MA2B 2JK8A 3SXHA 3CRKC 4R4OA 1H9SA 2B2WC 4FP5D 1LTBD 1BXTA 4CGYB 1E3PA 1MJCA 1EEID 3HKZE 4B3SQ 1SNPA 4GLXA 4POFA 3SE0A 1CSPA 1K28A 3RZOB 1FL0A 5ISRA 1IXRA 4POGA 1HZ9A 4EQPA 3K8AA 4EVOA 3H6MA 4MN3A 1H9JA 2Z8LA 2XRSD 1K8MA 4MZ9A 2ZJRA 1PZJD 3BVZA 3GO5A 5GQOA 3TMEA 2NVQH 4A3MG 4DV7Q 2OT2A 4QIWE 2PNRC 4WJ4A 1U0LA 4OONA 2G9DA 2JEBI 3P7JA 5DEHA 3MFGA 1UE1A 3L9AX 3HP3A 1Y14B 4ID6A 3M4OH 2NYZD 1RF2D 2PZWA 1JR0D 2A68C 3A7AB 3BZDB 3CC4A 2Y0SB 4IN3A 4PZ8A 5CBEE 2EY2A 3FDTA 1IYUA 3T4AC 3OIPA 1F2MA 3DXJC 1VDZA 2K4KA 3TEHB 5LL6X 1TXYA 1XTCD 1AH9A 4GOPC 4KD3A 4NKLA 3K58A 1NTGA 1SYBA 2K5VA 1SRUA 3W2DA 1JE4A 1IBMQ 4PQXA 2CW0D 4A3BH 2F0UA 3BDOA 4IUQA 5C4JB 2EYOA 4R4TA 1C48A 4GLVB 2K03A 2ZT9C 5EPJA 3BZCA 3A5ZB 1HH2P 4LUOA 2LKVA 4YHHQ 1Q86C 2HDLA 5JEAJ 3HOWB 3ONAB 2RHSB 1H9RA 2ZXRA 5EGTA 1HUNA 4JI7Q
chains in the Genus database with same CATH topology
2Z9HA 4I7AA 2RCFA 5L37A 4JW0A 4N8FA 4JVZA 2QW7A 4N8X1 2HD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z9H A;  4I7A A;  2RCF A;  5L37 A;  4JW0 A;  4N8F A;  4JVZ A;  2QW7 A;  4N8X 1;  2HD3 A; 
#chains in the Genus database with same CATH topology
 4A3L H;  5M5Y B;  2L11 A;  4ULL A;  1JQY D;  3OW2 A;  2CWP A;  2WAQ E;  1HNZ Q;  1G2T A;  3MFY A;  3U4V A;  5LMU Q;  4HR7 B;  3GTG H;  2IHF A;  2L1B A;  4LFA L;  1XMO L;  2FMM A;  2ZJQ A;  2DNC A;  4QIW B;  1Z47 A;  2Y0S G;  4BY1 B;  4ALP A;  4DV4 L;  3OIQ A;  5BR8 Q;  2HUG A;  2HIV A;  1ZEQ X;  2IX0 A;  2X69 A;  1N32 L;  1XMQ L;  3KDF B;  2RCN A;  4A3C H;  3RD4 A;  4F87 A;  2MO0 A;  2F0L A;  4R1J A;  4B3S L;  4DXG A;  4I7Z C;  4KTA A;  1GHJ A;  1OXV A;  4JBW A;  3UDX A;  4HJ8 A;  4DAP A;  1HZB A;  4JI2 L;  4JVZ A;  1SNQ A;  3TP8 A;  3PGZ A;  2ICE C;  3K0Y A;  3S15 H;  4IFD J;  5GAH C;  4LJZ C;  2QA4 A;  1KD1 C;  4Z9C B;  3HKZ G;  1BOS A;  1STH A;  1CFM A;  3ZYY X;  2K5N A;  1YIJ A;  4BXX G;  4KJN A;  4GOP A;  1X56 A;  4KHP Q;  2F0O A;  4YIJ A;  2PW5 A;  5IP9 H;  2F0V A;  1QJO A;  3H94 A;  1XPO A;  5IT9 E;  2KVM A;  3J80 L;  4ZUJ A;  2CKZ B;  2NVQ B;  4JI0 Q;  1LUZ A;  3CPW A;  1RTN A;  3BVM A;  3KUP A;  1A6X A;  1AP0 A;  1S4Z A;  2EY1 A;  2PZT A;  1D5Z C;  4BY1 G;  4LF4 Q;  4GS3 A;  3VA7 A;  2KCN A;  3TP6 A;  1BO0 A;  3U9O A;  4LFB L;  3T16 A;  3OTO Q;  3M4O B;  1K73 C;  5BN4 A;  1EIG A;  1R4Q B;  3DUZ A;  4Q0F A;  1QVC A;  2RDF A;  4FYD A;  4KI0 A;  4A3G G;  2MP1 A;  3T13 A;  1IKL A;  2B2U A;  4RG1 A;  3R93 A;  1EIY B;  1ONL A;  4B3M Q;  1UE6 A;  1NNX A;  3KOJ A;  2KUM A;  4CJ2 C;  3D6C A;  2JA8 G;  1TWA H;  4F7X A;  4YHH L;  1ROD A;  3CCV A;  4N9P A;  1SLJ A;  3NQI A;  1PRT B;  1EQT A;  3N6R A;  1E22 A;  4JI7 L;  1CKN B;  3T1H Q;  1S3O A;  4DF7 A;  2VUM H;  5IWA Q;  1S5D D;  3K59 A;  1UUP A;  4V0B A;  4AYB E;  3SK8 A;  1HNZ L;  1JB3 A;  3CD6 A;  3H3V H;  2AQ2 B;  1VQ9 A;  3URY A;  3TDQ A;  3CHB D;  2ENB A;  2BA0 A;  2F1M A;  2NBF A;  4YCV A;  4BBR H;  4J6H A;  3VYS A;  4LF9 L;  1V1P B;  3CCR A;  3J7A F;  4JI8 L;  1STN A;  1P16 A;  1STA A;  1VS0 A;  4GLA C;  1ENA A;  1O7L A;  1WCM B;  3S1R H;  2KHI A;  1ESR A;  1FGB D;  4A93 H;  4OX9 L;  4RMF A;  1B3A A;  1GXD C;  2EDG A;  2B39 A;  3OWE B;  2LXK A;  5CGK A;  1WD1 A;  3EVQ A;  2MNA A;  3AU7 A;  4QF4 A;  1CI3 M;  3K81 C;  2UXC Q;  1KNE A;  2R7Z H;  3O13 A;  1HNX L;  1L2F A;  1QWY A;  3KYH C;  4GKK L;  1KRS A;  2E2I H;  3M7N A;  5FLX L;  1VQC A;  1GM5 A;  4UP9 A;  1TY2 A;  5T1I A;  2WP8 J;  1LT4 D;  1DOK A;  1HFG A;  2HD3 A;  3A74 A;  1TR5 A;  1IHZ A;  4QUF A;  3RLF A;  2J7Z A;  1VQ6 A;  4DN4 M;  1MHW C;  2DY8 A;  1BCP B;  2EQS A;  3GTQ H;  5EBD A;  2D0P A;  1PFS A;  4A3B G;  3OWF A;  2AUJ D;  3A56 A;  3HOZ H;  3PUV A;  3S1Q H;  1MKH A;  3V96 A;  4TQU S;  3UDI A;  3AFQ A;  3BJU A;  5IP7 H;  2QIL A;  4JI0 L;  1SEB D;  3NWS A;  2AUK A;  3VA5 A;  1QG7 A;  1Q46 A;  1JC7 A;  1OXX K;  1PDQ A;  4AYB B;  1ENF A;  4F88 A;  2E2H H;  1GJX A;  4ZLT F;  2PQE A;  3KLS A;  2F3V A;  4TSS A;  1Y69 U;  3PO2 H;  4FXG C;  1TS3 A;  2XTI A;  4X3T A;  2A74 C;  3LGJ A;  3GQB A;  4X65 Q;  1Y1V H;  4A3L G;  1I6H H;  1I4Q A;  1GUO A;  5FKA C;  2PYK A;  4A3E H;  4B3M L;  2L12 A;  1QUQ A;  5JJL A;  3HS0 C;  2X6L A;  4A3J H;  1QVF A;  3PIP A;  1MBY A;  2L5T A;  2ZJP A;  1GUS A;  2E75 C;  4JG2 A;  2DY7 A;  3STB D;  3PF5 A;  3HRZ C;  3RR5 A;  2F0I A;  2F0M A;  4RCO A;  2UXD Q;  4O42 A;  1DD2 A;  1H95 A;  2WV6 D;  5IWA L;  1VQ5 A;  1PFN A;  2J4X A;  4A3C G;  4GKJ Q;  1PFM A;  4RHR A;  2CFM A;  3PUY A;  4LF6 Q;  3CCS A;  1V9P A;  2B2V C;  2JP1 A;  3KLR A;  1TWF H;  2BE5 D;  1IBL L;  3HOU B;  1FNV A;  4DV0 Q;  4H02 A;  1VF5 C;  3FEW X;  1K3B C;  3NBH B;  2Q8R E;  2OXP A;  3NEN A;  5JJZ A;  2GN5 A;  2H1E A;  2OCE A;  1EY4 A;  3KF6 B;  1B70 B;  2BDO A;  2VUM B;  1B44 D;  4DR2 L;  1STE A;  4IZ8 A;  4PMB A;  2TMP A;  1CKM A;  4N8X 1;  4AYB G;  4EQN A;  1QZG A;  2PNH A;  1B8A A;  1STG A;  2RA4 A;  4C3J H;  3NTI A;  1NR2 A;  1G2S A;  3I4N H;  4BBR B;  2F03 A;  3GD7 A;  2LY7 A;  1L1O A;  1BBX C;  3OMC A;  3PV0 A;  1LAC A;  5FO8 B;  1AN8 A;  4H44 C;  2HCC A;  3MEH A;  4KY7 A;  1SN8 A;  4DK3 C;  2DJF C;  4UDU C;  1S40 A;  1G29 1;  3TN2 A;  1PH4 A;  3X3M A;  4QGU A;  3DM3 A;  4A93 B;  2VB3 X;  1KRT A;  3TBI B;  1EQQ A;  1FNU A;  1S5E D;  4B9W A;  1ET6 A;  2F0H A;  4IPD A;  4GZY C;  2LFN A;  3I56 A;  1IBK Q;  2R7Z B;  4A3I H;  4CDD C;  3HEJ A;  3FMC A;  2A1A A;  5ELN A;  2R7D A;  4KD4 A;  1WOC A;  1KLG D;  3TRZ A;  4IUP A;  5AFW A;  4YCU A;  5CV9 A;  4LF7 L;  1XWE A;  2PQA B;  3TZD A;  2VUM G;  2E74 C;  4X65 L;  5GAG C;  1JWM D;  3FVQ A;  2F0G A;  2KEC A;  1BCP F;  2BDN A;  3HOZ B;  2NUC A;  3S1Q B;  3OYY A;  4G7Z C;  4KN7 C;  3ULP A;  4KKT A;  4BBR G;  4JBM A;  1PH2 A;  1MGS A;  1JOR A;  1XX8 A;  1PZI D;  1XJV A;  3VR4 A;  1ET9 A;  3VR3 A;  4A4I A;  4GNX C;  2HIX A;  1SYC A;  4IPC A;  1K8G A;  3I70 A;  3NTH A;  1D7Q A;  4A93 G;  3ERQ A;  3FKI H;  3G6E A;  1DON A;  4GKJ L;  5EPL A;  2Z4H A;  4J15 A;  4L5S A;  2QEJ C;  4NMZ A;  3CME A;  1AW7 A;  4CKC A;  2R7Z G;  4DV2 L;  3I4M B;  4QQB X;  3ERS X;  4X64 Q;  2NTS A;  3HZX A;  4HJA A;  2OQK A;  1TWF B;  3G7L A;  1YEZ A;  1AE2 A;  4DR3 Q;  3ZJY C;  3HOZ G;  1Q8I A;  1DZ1 A;  3I91 A;  4ZK9 B;  2G5D A;  2JJQ A;  4M8A A;  1KC8 C;  3GTL H;  5IP7 G;  1GHK A;  1SFO B;  2F3I A;  5C5M A;  2B63 H;  2UUA Q;  2OQ0 A;  3NEL A;  4X66 Q;  3CC7 A;  1WTV A;  4G57 A;  2NTT A;  4JI3 Q;  2RVL A;  4C3I B;  3I7F A;  5LHY 1;  1EYA A;  5JPN C;  1Y1V G;  3I4N B;  3PIP 3;  1K3R A;  1QB5 D;  4QY7 A;  4DUY Q;  4RAU C;  3D8G A;  1U5K A;  3GTO H;  3UE0 A;  1HHV A;  4MTK A;  3T53 B;  1SYE A;  3EFX D;  1HCZ A;  3JAM i;  3CRL C;  2H5X A;  1N36 Q;  1HTP A;  1K83 H;  1C9O A;  2JEA I;  5CV6 A;  1N33 Q;  2G9H D;  3I4M G;  3A8I E;  4ABN A;  4BA2 I;  5IOC A;  4DV6 Q;  4GNX A;  5BN5 A;  1RKN A;  3AFP A;  4FO2 A;  1X55 A;  4KLK A;  5IGD A;  3RMH A;  2F0J A;  1CKO A;  3Q8D A;  1PXU A;  2BCO A;  2NZO A;  1X3E A;  3ERO A;  3D6W A;  4HED A;  2PZU A;  3GTK B;  2UXB Q;  3K7A H;  3GP7 A;  3T56 B;  2XN9 C;  4JBJ A;  1DM0 B;  1HPC A;  2I46 A;  3M4P A;  2OWO A;  2KCT A;  2Z4I A;  5GAE C;  3F2U A;  4C3J G;  4DK1 A;  2UUB Q;  2E76 C;  4C3I G;  1I4P A;  1L0W A;  4F8M A;  2QDB A;  1DYQ A;  3I4N G;  1NE3 A;  4B3T L;  1JT8 A;  3B6Y A;  4LUV A;  2E5L L;  1TY0 A;  5EKL A;  2MPM A;  1IYV A;  1AFP A;  3TP7 A;  3CCQ A;  1YJN A;  2EYF A;  2DGY A;  1DCZ A;  3J80 c;  3HOW H;  1M4V A;  5I9O A;  5JAV A;  1ENC A;  1PTO H;  5M5Y H;  4JI5 L;  2A6H D;  3FKI B;  3TSS A;  4PV1 C;  2CW0 C;  4DPG A;  1EQV A;  4HJ9 A;  2CQA A;  3UI2 A;  5IY0 A;  2CCZ A;  4IOA A;  4BS9 A;  4ME5 A;  2EYM A;  1UNS A;  3S2D H;  4A3I G;  2F0F A;  1CHQ D;  4K2L A;  4FDB A;  1NCV A;  1PMR A;  2K75 A;  2I5H A;  1PZK D;  1U4L A;  1SAP A;  1D1I A;  1B2T A;  2XRQ D;  4X66 L;  5KYL A;  5IYD H;  2IPK D;  4LFA Q;  3UDF A;  3W1G A;  1XMO Q;  5JVH 3;  3PQI A;  4HIM A;  2IX1 A;  2B3G A;  1NMF A;  4LNQ A;  3RZD H;  3A0J A;  5NUC A;  3F2B A;  5E4X A;  1WI5 A;  1VMC A;  4HCS A;  3F2D A;  4AIM A;  3PO3 B;  4G7O C;  1HUM A;  1N32 Q;  1IW7 D;  4WFN 3;  1XMQ Q;  2B63 B;  4C1N I;  1EU3 A;  4DR1 L;  1N36 L;  5C0X H;  5D3D A;  2NN6 H;  1N33 L;  4C3H H;  4DXF A;  1EZ6 A;  3G6J B;  1CHP D;  3FKI G;  1WTR A;  4DV6 L;  4JI2 Q;  2HQL A;  2O5I C;  3GTO B;  3FHW A;  5KNC A;  4H0L C;  1CSQ A;  3E9I A;  3H91 A;  3U4Z A;  1IZ6 A;  2CQO A;  1YNJ D;  4YY3 Q;  1KIX A;  4DNT B;  1K83 B;  4JPB W;  2UXB L;  5IYC H;  2MO1 A;  4JK1 C;  2AKW B;  3IL8 A;  4X3K A;  2K52 A;  2YTY A;  4EQ5 A;  1LLR D;  1F2Z A;  2K28 A;  2B2T A;  3M3Y H;  4ZKC B;  1G51 A;  2SEB D;  4H13 C;  2UUB L;  5M3M B;  2O4X A;  1GUT A;  4A3D H;  2CWA A;  1X9N A;  5C4Z A;  2KJX A;  3K57 A;  1VQ4 A;  1NSN S;  3VYT A;  2NVY H;  3K7A B;  5EJW A;  4LFB Q;  1TS2 A;  3SEB A;  5KGU A;  3CXC A;  2AWO A;  3I90 A;  1H9S B;  4JCV E;  2B63 G;  3NWT A;  1KQS A;  2K01 A;  4OXP A;  1KXL A;  3MXU A;  1YJW A;  1FNW A;  1A3V A;  3SK4 A;  2A5H A;  3QB3 A;  3L2P A;  2VY3 A;  4FXK C;  1VQJ A;  2RBM A;  1BDO A;  3KDF A;  3CW2 C;  1Q81 C;  4DNI A;  1LTG D;  2GVA A;  1K8A C;  4N8F A;  3MEF A;  2OTL A;  1WCM H;  1RTO A;  1PTO B;  2B2U C;  2A69 D;  3TS2 A;  2EE1 A;  1CZW A;  4C2M B;  3J80 i;  1FJG L;  1YNX A;  3R2T A;  5D14 A;  4EX5 A;  3MAQ A;  2MQH A;  4OHJ A;  1O80 A;  5LL6 S;  5IE8 A;  3S2D B;  4LF9 Q;  4JI8 Q;  4PZ6 A;  4AQY L;  3KBX A;  2KHS A;  4KHZ A;  3AEV A;  4OX9 Q;  3NE5 B;  4DV5 Q;  4OWX B;  4CDF C;  1E7Z A;  4OIJ A;  1A0I A;  1SSO A;  2CH4 W;  2GVB A;  1PVO A;  1TKW B;  3MHB A;  1WTW A;  2V1C C;  3RZD B;  4CBV A;  1JMC A;  1B4O A;  2PW7 A;  2HT1 A;  2KEE A;  1HNX Q;  3F1Z A;  4GKK Q;  1OTC A;  2E8G A;  2I5M X;  3BU2 A;  1TWH H;  3HFZ B;  4YY3 L;  1TQO A;  3M4Y A;  1AZP A;  3HOW G;  1LAB A;  4RGO S;  1PH6 A;  3EN2 A;  3QOL A;  4C3H B;  1A63 A;  4KKU A;  3RN2 A;  4YWM A;  2KED A;  4O1N A;  4JI6 Q;  5CV4 A;  4DV3 L;  1VQD A;  1X3G A;  3MXN A;  4CKE A;  5CMD A;  3FP9 A;  4RGM A;  2CH4 A;  4X3S A;  1AZQ A;  2NWG A;  5ELC A;  2NVX B;  4P75 A;  5FLM H;  1YHQ A;  1I50 H;  4UY8 C;  1HJP A;  2A68 D;  2MHV A;  2Z9H A;  3BDL A;  4L5R C;  4LFC Q;  4G7H C;  1PRT D;  2A19 A;  3M3Y B;  1SYG A;  4Y52 H;  3K5N A;  2F0D A;  1BF4 A;  4R9W A;  1V1P A;  5IYD G;  2RDG A;  4P72 A;  4X3U A;  4A3D B;  3L3O C;  3HOU H;  1VMP A;  2BA1 A;  2B29 A;  3H09 A;  1KDC A;  3Q0A A;  5A35 A;  3J7Y W;  2F4I A;  3IFT A;  2B8F A;  2ZTC A;  2A6E C;  4JI1 L;  2RHQ B;  2NVY B;  1FVI A;  4GN4 B;  2F0K A;  4QMG A;  4DU9 A;  2D0O A;  5JOB A;  1X65 A;  3STB C;  4ZKB B;  1I5F A;  2K5D A;  3LNN A;  5C0X G;  2NN6 G;  3NXW A;  4C3H G;  2VL6 A;  4GOP B;  1NMG A;  1IBL Q;  2EJF C;  4K5V A;  3G4S A;  2BE5 C;  2AQ1 B;  4IUU A;  3NQT A;  3VR6 A;  1ML0 D;  2C35 B;  1GD7 A;  3Q6S A;  5LMN Q;  3NBI A;  1K9M C;  2LXJ A;  3CCM A;  1LV9 A;  4XT1 B;  4DR2 Q;  3NK9 A;  4G4K A;  1PTO F;  4PZ7 A;  2BOS A;  4K8I A;  5I6Y A;  4DV5 L;  5IYC G;  3NSW A;  4K6D A;  2QKI C;  1VQG A;  1B9N A;  2O2L D;  3IRB A;  1JJ2 A;  2WIN B;  1SBB B;  2R7F A;  1VQK A;  4P2C B;  1BCP D;  1F2Y A;  2EIF A;  4MHE A;  5A2Q L;  4KKS A;  3C46 A;  1FYC A;  4A3D G;  4RH6 A;  4HID A;  3D4D A;  4JW0 A;  3QO2 A;  2JA9 A;  2PI2 E;  1SJE D;  3QWN A;  3PIO 3;  5M5W B;  1SE8 A;  4V19 0;  1AE3 A;  1L1O C;  4TKO B;  1HR0 W;  1IL8 A;  1A3U A;  4JI6 L;  1CM9 A;  3CCE A;  1ILP A;  2YV5 A;  3JC6 6;  1SE4 A;  5C3E B;  2QGQ A;  1GUN A;  4CHT B;  4R8I A;  5HGQ A;  4FF4 A;  3W5O A;  1TWH B;  5K36 H;  3S16 H;  1LM0 A;  5C44 B;  1Q8K A;  4K5X A;  4Q5V A;  4LF7 Q;  5CYU A;  2WII B;  1WCM G;  4ZUI A;  1NY4 A;  2WFW A;  3T1Y Q;  4LFC L;  2KQ3 A;  4PNY A;  5DM7 3;  4IJH A;  1PH7 A;  1VQF A;  1SRO A;  2E2J H;  3HOV B;  3I2Z A;  3MWY W;  4KV6 A;  2R92 B;  1JWS D;  1EY5 A;  1MI2 A;  3EBE A;  4R8N A;  1YHB A;  2AHO B;  3OW7 A;  1G6P A;  1VCI A;  3DLL A;  1A15 A;  3SGI A;  2JA5 H;  3IAY A;  1I50 B;  2IHE A;  2EYL A;  3ND8 A;  2Z1C A;  3I4M H;  3HKS A;  5IYB H;  2IJ0 A;  1B7Y B;  1VQN A;  1I3Q H;  4XYO A;  3RLO A;  5FK9 C;  2QW7 A;  3S24 A;  1Q7Y C;  1YNN D;  2IL8 A;  2FIN B;  2P5Z X;  1KDA A;  3C3L A;  1DOM A;  1VQH A;  1X54 A;  2LS0 1;  1LT6 D;  4DV2 Q;  5F2D A;  3V2T A;  1Z9F A;  2K14 A;  1BBU A;  1Z7T A;  3GDE A;  3J80 E;  4FF3 A;  5LMN L;  1VF7 A;  2HDM A;  2JA6 H;  2VB2 X;  3D4R A;  4HMI A;  4JBK A;  2DJG C;  3DM1 A;  4IUR A;  1PRT F;  2ZTE A;  1SFO H;  2ZXO A;  4KY5 A;  4GN3 B;  3TRE A;  4C3I H;  1VQO A;  5FO9 B;  1RL2 A;  3EJI A;  4IJL A;  4B08 A;  2L9H A;  1QZH A;  2WKD A;  4APV A;  2A8V A;  1GOZ A;  2N88 A;  1B50 A;  5JEA H;  1EY0 A;  4XXE A;  3JAM c;  1A2U A;  4K0K L;  3OSO A;  2PQA A;  1QUQ B;  4CJ0 B;  3CC2 A;  5JJI A;  4B9X A;  4L5Q A;  4L5T A;  5EKI A;  4UPA A;  3KJP A;  5FLM G;  4NP5 A;  4CKB A;  4OWW B;  3K5O A;  1Y8N B;  3Q24 A;  3LX0 A;  4ZAI A;  1C0A A;  3EQL C;  4NXN L;  3SK6 A;  5TSS A;  1H9M A;  1UAP A;  1WD0 A;  3KFU A;  2RSO A;  1EFW A;  3H15 A;  3J7A V;  1Y8P B;  2FJ2 A;  1N34 Q;  3HOU G;  2F0N A;  3BVG A;  3A54 A;  3CCL A;  3J81 L;  2VZA A;  1W2B A;  1JB7 A;  3GTK H;  2EXD A;  4CDE C;  2M9V A;  2QF7 A;  5T1G A;  1E1T A;  1EY6 A;  4IQZ A;  2RQX A;  3T1Y L;  4PG3 A;  1XYI A;  1VQ8 A;  4XQQ A;  2SNS A;  1HA5 A;  3SVM A;  3C2P A;  1I4H A;  4IFD H;  1UEA B;  3DEO A;  2Q2U A;  4KJO A;  4O2D A;  4K6L A;  4LK1 C;  5EKK A;  3S16 B;  3FPP A;  4QB4 A;  1VQI A;  3K7U C;  2F0P A;  1OXT A;  4FF1 A;  3WWV A;  2LSS A;  2F4V L;  1UWV A;  2I0Q A;  2J0T D;  4RHS A;  3D3R A;  1K0S A;  5KEE A;  5I2X A;  2ICI A;  3NTK A;  5IGB A;  2R61 A;  2E2J B;  4LWC A;  4LF5 L;  1XPU A;  1FR3 A;  2C9O A;  2AMC B;  1IL2 A;  4I7A A;  4LUZ A;  4B3T Q;  1TVX A;  1W6J A;  3CQZ H;  1I94 L;  2E5L Q;  2F0T A;  5I4D A;  4FNF A;  2JA5 B;  3VR2 A;  4IO9 A;  4JI5 Q;  4OGQ C;  2OTJ A;  1I3Q B;  1RDP D;  1SMY C;  2CVR A;  1E0B A;  1C7Y A;  2EYJ A;  4XQJ A;  1R9T B;  1PH5 A;  3I3C A;  3I8Z A;  1EYG A;  4IUT A;  4KY6 A;  2JQO A;  5ELE A;  1SE2 A;  1MSG A;  1Q90 A;  1M90 C;  1WJJ A;  1RCV D;  3KJO A;  4QCL A;  4DGZ A;  1PA6 A;  3OOC A;  1NR4 A;  1B9M A;  3I73 A;  5E4W C;  3MXG A;  4C56 C;  1J5E L;  2B2Y C;  2EY5 A;  2JA6 B;  3PO3 H;  5K36 G;  2DN8 A;  4HTH A;  1YIT A;  5AJ3 Q;  3DWQ A;  1B1Z A;  1JCK B;  2NVT B;  1DGS A;  1II3 A;  3A55 A;  2D5D A;  4MNO A;  2R93 H;  1DOL A;  4K14 A;  1TWG H;  3S1N H;  5IGE A;  2KA7 A;  2XWB B;  5EBC A;  2C5C A;  3KF8 B;  2IW3 A;  1E2Z A;  3UDG A;  3HG9 A;  1CTM A;  5D3I B;  4P74 A;  1TT2 A;  5C3X A;  2VQE Q;  3NPP A;  1N34 L;  1D5X C;  1V43 A;  1RIP A;  1T5E A;  1LTI D;  1KAA A;  4X6A H;  4MIU A;  5H1S E;  4DR1 Q;  2JA5 G;  1IW7 C;  1F9Q A;  1X3F A;  3TQY A;  2Z6B A;  5ELD A;  5IYB G;  1CZG A;  3G48 A;  2KEN A;  3HOY B;  1F77 A;  3M4Q A;  3SK5 A;  5HUR A;  3D0F A;  2KBN A;  4LAA A;  5M3M H;  3K80 C;  3U9S A;  1ESF A;  1EU4 A;  4C1N K;  1WTX A;  2ZTD A;  4DFA A;  1E24 A;  1VQA A;  4RGT A;  2F0Q A;  5EAY A;  5M3F H;  2K04 A;  3S14 B;  2JA6 G;  4BBS H;  3KBG A;  2WB1 B;  1M1K C;  2HHH Q;  5I2Y A;  4DK6 C;  1VQB A;  2SOB A;  2XGT A;  3A7L A;  4WRD A;  1W6K A;  4PMW A;  1YI2 A;  4JOI A;  3EIV A;  1JOQ A;  4A3F H;  4JI4 L;  5C6A A;  2HCI A;  3MVV A;  2XVS A;  4DUZ Q;  5JEA G;  1BR9 A;  4YWL A;  1GVP A;  2IWH A;  4A75 A;  3M85 A;  4BY7 H;  2JN4 A;  2B2T C;  3R2I A;  1PYW D;  3IKJ A;  4LF8 Q;  1HQR D;  1SXT A;  3OPO A;  2B2Y A;  4C2M H;  1D2B A;  2L4N A;  4HCE A;  1LYL A;  1T9H A;  2ID0 A;  5L37 A;  4HIK A;  3I72 A;  1U4P A;  3NP8 A;  1S5F D;  4L8J A;  4UHV A;  3ULL A;  4GNX B;  2A73 B;  3CQZ B;  3QOJ A;  2AWN A;  5M9O A;  5C0X I;  4K5W A;  3IFD A;  1SNC A;  1Q1E A;  2TSS A;  5HGT A;  2NN6 I;  2Z0S A;  5IOD A;  3MTS A;  5AJ3 L;  3I55 A;  3T51 B;  2A69 C;  4OO1 H;  1FJG Q;  1SNM A;  1Y8O B;  4IOC A;  1X3Q A;  4OEL B;  1EY7 A;  3S1M B;  3E0J A;  2RCF A;  3I4O A;  4CJ1 B;  1OXU A;  1QVG A;  3TP5 A;  1Z6H A;  5M5X H;  1J9O A;  2MFI A;  4DR7 L;  4A3M B;  2OF1 A;  3QG1 A;  1O78 A;  4ODG A;  4QL5 A;  1HRJ A;  4IFD G;  2VQE L;  4AQY Q;  3VR5 A;  4RKL A;  3S9W A;  4O0A A;  1WTP A;  2VXW A;  2YTV A;  2MUY A;  4UP7 A;  1N8R C;  1LTS D;  2VW9 A;  5DNF A;  5IGC A;  1NAP A;  1I6V C;  2R93 B;  3GTM H;  1HXY D;  5IT9 L;  1TWG B;  1BUV T;  3S1N B;  1MJE A;  4GN5 A;  3S2H B;  1Q1B A;  3DEP A;  5EPK A;  3NEM A;  3GTJ B;  2GA4 B;  4Y7N B;  2SDF A;  3GV6 A;  4A76 A;  1PFB A;  2EYP A;  1TS4 A;  1A3T A;  2IT1 A;  3CP0 A;  4NXM L;  2XIW A;  3HOX H;  2NVX H;  5CV8 A;  1B53 A;  2Z6K A;  5HY6 A;  5FLX c;  1BKB A;  4UP8 A;  3S17 H;  1XPR A;  2K7V A;  2EYH A;  4JV5 L;  2HHH L;  5FJ8 G;  2PCF B;  1WVL A;  4DAY B;  4DV3 Q;  2JE6 I;  1YHA A;  4RA8 A;  2PMZ B;  4KHV A;  3NHH A;  4DUZ L;  4E6I A;  1CT1 D;  4DR6 Q;  5M3F B;  3RLN A;  3PO3 G;  4LF8 L;  2K50 A;  4BBS B;  1DXM A;  4QUC A;  1PTO D;  1PRT C;  3F2C A;  3PIO A;  1CQF A;  2R93 G;  1ZYR D;  1HQM C;  1E1O A;  3P1H A;  5CV7 A;  1F9R A;  4A3F B;  2KCM A;  4XIG S;  4A3K B;  4WJW A;  3AQQ A;  4JI1 Q;  4BY7 B;  4IUV A;  4DR5 L;  3PSI A;  1VQM A;  4NPS A;  2ZM6 L;  1D6E C;  1WTH A;  2F0W A;  3U50 C;  5IGF A;  3QJY A;  4JC0 A;  1SMX A;  1OXS C;  2XSC A;  4CDC C;  4JYA L;  1O7Y A;  1ASZ A;  3HKZ B;  2XWJ B;  4LW1 A;  5M3M G;  3J7Z C;  1SR3 A;  5ELB A;  1STY A;  2QDL A;  5GRO A;  2D2C C;  5BN3 A;  1HR0 L;  2SNM A;  5M5W H;  5M3F G;  1GKH A;  2B2W A;  3BG3 A;  4BBS G;  2UUC Q;  4ZYS A;  3CU7 A;  5M5X B;  2PPB C;  4R4C A;  2ASB A;  1NJI C;  2Q8I B;  1SDF A;  3JAM E;  1G6Z A;  5C3E H;  5JPM C;  1BCP C;  2UU9 L;  1AEX A;  1ICW A;  4A3F G;  2EY6 A;  2RF4 A;  1TWC B;  3CAM A;  2JA7 B;  3ULJ A;  1CQV A;  5C44 H;  4A3K G;  1VQP A;  2EPB A;  4A3G B;  4BY7 G;  1CK1 A;  4HSV A;  1HTL D;  4OIK A;  3GTM B;  4RWS C;  1RD9 D;  1Q82 C;  1VQ7 A;  3H0G H;  4RCN A;  5CR3 A;  3SDZ A;  2VQF Q;  2JA8 B;  3U58 A;  3V05 A;  1FD7 D;  3KLS X;  2YU9 H;  3HOV H;  2AQ3 B;  1A62 A;  1F9P A;  4EQO A;  2R92 H;  2B8G A;  1CKN A;  3DHQ A;  1LTL A;  4DV7 L;  3HOX B;  4DR6 L;  1EWI A;  2D9U A;  3H3V I;  1IKM A;  1U4R A;  3S17 B;  3VYU A;  4L6T B;  3AMU A;  3J81 c;  4OO1 G;  3C1E A;  5C3W A;  3CMA A;  4YWK A;  2EVB A;  2DUD A;  3ER0 A;  3GV3 A;  3OMG A;  1PH3 A;  2NZ1 D;  4XQN A;  2WAQ B;  1LTA D;  2N49 A;  3E3X A;  1J6Q A;  1Q3L A;  1CUK A;  2R6G A;  4BA1 I;  1HA6 A;  4R4I A;  1IBM L;  2JA7 G;  3FPU B;  1GUW A;  2O5J C;  3MZ5 A;  1EWC A;  1YNN C;  3E9H A;  1DJR D;  1SYD A;  1PH8 A;  4X62 Q;  4DR4 Q;  2MGS A;  1VQL A;  2K32 A;  3SR1 A;  3H3V C;  4OEM B;  4DKA C;  1JIC A;  2JXM B;  4OL7 A;  1KNA A;  4HAE A;  5DAU A;  3MXN B;  1KHI A;  3WOE A;  5D65 A;  3R8B A;  4WOR A;  5KNB A;  2KOL A;  4M1U B;  3HOX G;  4A3B B;  1V1Q A;  3BDC A;  2OEO A;  1JOO A;  5LMU L;  5CBA E;  4LMQ D;  3C1F A;  2UUC L;  3HGB A;  2WKC A;  2WAC A;  2EXZ A;  2F0S A;  5KIX A;  4ZQ3 A;  1F2L A;  1L0X B;  3J7A 5;  3NUC A;  4K0K Q;  5BR8 L;  3K5M A;  3E0E A;  2NB0 A;  5C4X H;  4KK7 A;  4NDX A;  5KRU A;  1O7I A;  1C4Q A;  2F0E A;  4P73 A;  3D4W A;  2WAQ G;  2HQE A;  1EUJ A;  3QR8 A;  1JWU D;  3K0X A;  2F3W A;  4H7B A;  1EFI D;  2Q2I A;  4TVA B;  3GTG B;  2E2D C;  1RJT A;  4TRD A;  4NXN Q;  4K8J A;  2K5H A;  1TS5 A;  4DK0 A;  2EOT A;  3N52 A;  2VQF L;  1JJG A;  1QIL A;  1XNR Q;  5C4H A;  2BH8 A;  1IYJ B;  5J39 A;  4NB3 A;  1EY9 A;  5IIF A;  4B3R Q;  1W3S A;  1E2W A;  3W3A A;  1F9S A;  4HN7 A;  1V1O A;  3RNU A;  1S5B D;  4KHP L;  4KMU C;  3H0G B;  5J1Z A;  3NBH A;  2QEX A;  2PI2 A;  1SYF A;  2K05 A;  1GUG A;  3M7G A;  2YU9 B;  1JE5 A;  2JYO A;  3S15 B;  3KF6 A;  1KAW A;  2I5L X;  3WOF A;  3CCJ A;  1OO9 B;  2ALY B;  3BS1 A;  4LF4 L;  3PF4 A;  2Q8T A;  1EOT A;  1T5X D;  2F4V Q;  1QNK A;  3OTO L;  3A5U A;  3L7Z C;  2Q2T A;  1VQE A;  4K2K A;  2RDH A;  1Y1W H;  2FHT A;  3D31 A;  3SHL A;  5KYI A;  2K6A A;  1ZKO A;  2NZH A;  1EQR A;  1R9T H;  1LTT D;  4LF5 Q;  3J81 i;  1EIF A;  3TZU A;  2BH2 A;  1KTK A;  4X62 L;  4J1M A;  4DR4 L;  1EYC A;  1HNW Q;  2A6E D;  1I94 Q;  1K8O A;  3AB9 A;  5C3E G;  1N9W A;  1ASY A;  2K5W A;  1R4P B;  3T1H L;  1I4X A;  5C44 G;  1QE6 A;  3BYY B;  4U67 3;  1PH1 A;  2L55 A;  2NVT H;  2IY5 B;  3P20 A;  1UE5 A;  1A2T A;  4RGN A;  1LT5 D;  3H0G G;  2VNU D;  1D8L A;  5J3B A;  1TWA B;  3R3O A;  1EEF D;  3EA6 A;  4S3S A;  1STB A;  3HOV G;  4HJ7 A;  2FFK B;  1J5E Q;  2EZV A;  1JJC B;  4AH6 A;  1XNQ Q;  2R92 G;  3PCO B;  2DNE A;  1SE3 A;  1KL9 A;  3TS0 A;  1D1K A;  2VS1 A;  4DV1 Q;  2L0C A;  5C0X J;  4RFB A;  2N55 A;  2EJG C;  3P75 A;  4RKB A;  4IFD I;  3LWU A;  2N8N A;  5IP9 G;  2K33 A;  2FXQ A;  4FF2 A;  3HOY H;  2UXC L;  4I65 A;  3Q23 A;  1XNR L;  3S1R B;  5C4X B;  4PMC A;  1EZ8 A;  5DLQ E;  3QIA A;  4OWT B;  4B3R L;  4IAL A;  1BQQ T;  3L0O A;  4U68 A;  3CKI B;  1K0R A;  1EY8 A;  3KLW A;  1CA6 A;  3S14 H;  5G3L D;  3K5L A;  3RN5 A;  4YCW A;  2XNA C;  4XTC S;  2E2I B;  1S72 A;  5IT9 c;  2H4O A;  4FXD A;  1BVS A;  2K5Q A;  1X3P A;  2PO4 A;  1L1O B;  5A2Q E;  1HFN A;  5ELF A;  5FLX E;  3AYH B;  3VDY A;  2K1B A;  4HSP A;  3E6Z X;  1EIH A;  4J8Q A;  3GTQ B;  1V8Q A;  2ZXP A;  3PUX A;  3Q22 A;  2R3Z A;  2YTX A;  1MSH A;  4JI4 Q;  3PMF A;  1HNW L;  2B2V A;  2E2H B;  1KLU D;  2V4D A;  3PO2 B;  3K6O A;  1G8Z D;  5C4X G;  2UXD L;  1Y1V B;  1I6H B;  5E1F A;  2L15 A;  3I4L A;  4QJF A;  1Y1W B;  3KF8 A;  4JOI C;  4WJ3 M;  5FJ8 H;  2A6H C;  1I4G A;  5IGG A;  1WTQ A;  4DAV A;  3X3N A;  4FVM A;  4A3E B;  4LF6 L;  3GTP H;  1Q12 A;  2ATW A;  1NUC A;  3S1M H;  4DNR B;  2FMC A;  2WB1 E;  4DV0 L;  4XYQ A;  2N3S A;  4NW2 A;  4A3J B;  2KHJ A;  1UEB A;  3OHX C;  3RUZ A;  1HZC A;  4A3M H;  1L0Y B;  3ND9 A;  1YBY A;  2RKS A;  1GO3 E;  5E7N A;  2M2L A;  3M9B A;  1KAB A;  5I9P A;  1XNQ L;  1QNU A;  3CCU A;  5K5P A;  2YYZ A;  3DWA A;  3A8J E;  3F8T A;  5CV5 A;  4DV1 L;  3J81 j;  1E2V A;  1J8I A;  3CF5 A;  5J22 A;  1I4R A;  5ELO A;  3LWE A;  4R4Q A;  1MD2 D;  1SNO A;  1A8V A;  3VYR A;  1CA5 A;  4DR7 Q;  3S2H H;  3BZK A;  3GTJ H;  4Y7N H;  1NBW A;  1QCB D;  5JVG 3;  5LMN W;  1LTR D;  4C3J B;  1B3Q A;  3PO2 G;  1EOV A;  1ZXT A;  5DM6 3;  5EQ0 A;  1S5C D;  3BYT B;  5FO7 B;  2Q2H A;  3RZO H;  1XTD A;  2QCP X;  1IBK L;  1Y1W G;  2F52 A;  4DAM A;  3W1B A;  4A3E G;  1H9K A;  1PLF A;  1U4M A;  4IPG A;  4P71 A;  5FOB B;  2CHB D;  4A3J G;  1X32 A;  4NXM Q;  4ZRZ A;  3ICE A;  3E5S A;  1YNJ C;  4HIO A;  3PUW A;  4ZCK A;  4JV5 Q;  4UAI A;  1PHJ A;  1FGU A;  1M8A A;  1LO5 D;  4A3I B;  1MIU A;  1SND A;  1PYS B;  1TU2 B;  4XT3 B;  5E3F A;  3ITP A;  2JSO A;  3FRP B;  3G71 A;  1U9R A;  1XXG A;  2M00 A;  4MTN A;  2Z6K C;  1SJH D;  3KK7 A;  4HJ5 A;  1PH9 A;  4A3K H;  4OO1 I;  5CC4 A;  1WYD A;  2N78 A;  1YZ6 A;  5G3L F;  1X6O A;  3PUZ A;  3J81 E;  1TII D;  1O7Z A;  1PTO C;  5C4J H;  2IX3 A;  1PV4 A;  1UE7 A;  1ZYR C;  3CPF A;  3HOY G;  1P8L A;  1G91 A;  4N9T A;  1LT3 D;  1WFQ A;  1D5M C;  1RHP A;  1KDB A;  4DR5 Q;  1ICF B;  4IPH A;  1PYB A;  1HZA A;  1QOH A;  1SMY D;  4BXX H;  2ZM6 Q;  2PMZ E;  1BBW A;  3A8K E;  4X64 L;  5KND A;  3UE1 A;  3DMU A;  3MC0 B;  4HMJ A;  5COR A;  5I6W A;  3JAM L;  3GTP B;  3MXP A;  2KCC A;  2WB1 G;  1ILQ A;  5GAD C;  4JYA Q;  4BWG B;  2I07 B;  4KN4 C;  3DWP A;  2RSN A;  1EWH A;  2Y0S E;  4DR3 L;  2EJM A;  5COY A;  4BY1 H;  1WTO A;  1JOK A;  4IUN A;  1BNZ A;  1TWC H;  2JA7 H;  5JJK A;  4L63 B;  2UUA L;  1EYD A;  4DA2 A;  4A3G H;  1HR0 Q;  4JI3 L;  2X6G A;  1EL0 A;  5C5L A;  4DAY A;  4ILW A;  2MJ8 A;  2ES2 A;  4XDX A;  1C8C A;  2D62 A;  2JA8 H;  4DUY L;  4DV4 Q;  4EGV A;  2LMC B;  2UU9 Q;  1YJ9 A;  3WDN A;  3GTL B;  4ME3 A;  1YVC A;  3MA2 B;  2JK8 A;  3SXH A;  3CRK C;  4R4O A;  1H9S A;  2B2W C;  4FP5 D;  1LTB D;  1BXT A;  4CGY B;  1E3P A;  1MJC A;  1EEI D;  3HKZ E;  4B3S Q;  1SNP A;  4GLX A;  4POF A;  3SE0 A;  1CSP A;  1K28 A;  3RZO B;  1FL0 A;  5ISR A;  1IXR A;  4POG A;  1HZ9 A;  4EQP A;  3K8A A;  4EVO A;  3H6M A;  4MN3 A;  1H9J A;  2Z8L A;  2XRS D;  1K8M A;  4MZ9 A;  2ZJR A;  1PZJ D;  3BVZ A;  3GO5 A;  5GQO A;  3TME A;  2NVQ H;  4A3M G;  4DV7 Q;  2OT2 A;  4QIW E;  2PNR C;  4WJ4 A;  1U0L A;  4OON A;  2G9D A;  2JEB I;  3P7J A;  5DEH A;  3MFG A;  1UE1 A;  3L9A X;  3HP3 A;  1Y14 B;  4ID6 A;  3M4O H;  2NYZ D;  1RF2 D;  2PZW A;  1JR0 D;  2A68 C;  3A7A B;  3BZD B;  3CC4 A;  2Y0S B;  4IN3 A;  4PZ8 A;  5CBE E;  2EY2 A;  3FDT A;  1IYU A;  3T4A C;  3OIP A;  1F2M A;  3DXJ C;  1VDZ A;  2K4K A;  3TEH B;  5LL6 X;  1TXY A;  1XTC D;  1AH9 A;  4GOP C;  4KD3 A;  4NKL A;  3K58 A;  1NTG A;  1SYB A;  2K5V A;  1SRU A;  3W2D A;  1JE4 A;  1IBM Q;  4PQX A;  2CW0 D;  4A3B H;  2F0U A;  3BDO A;  4IUQ A;  5C4J B;  2EYO A;  4R4T A;  1C48 A;  4GLV B;  2K03 A;  2ZT9 C;  5EPJ A;  3BZC A;  3A5Z B;  1HH2 P;  4LUO A;  2LKV A;  4YHH Q;  1Q86 C;  2HDL A;  5JEA J;  3HOW B;  3ONA B;  2RHS B;  1H9R A;  2ZXR A;  5EGT A;  1HUN A;  4JI7 Q; 
#chains in the Genus database with same CATH homology
 2Z9H A;  4I7A A;  2RCF A;  5L37 A;  4JW0 A;  4N8F A;  4JVZ A;  2QW7 A;  4N8X 1;  2HD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...