4JVZA

Structure of thermosynechococcus elongatus ccml
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
94
structure length
92
Chain Sequence
MKIARVCGTVTSTQKEDTLTGVKFLVLQYLGGEFLPDYEVAADTVGAGQDEWVLVSRGSAARHIINGTDKPIDAAVVAIIDTVSRDNYLLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two new high-resolution crystal structures of carboxysome pentamer proteins reveal high structural conservation of CcmL orthologs among distantly related cyanobacterial species.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Structural protein
molecule keywords Carbon dioxide concentrating mechanism protein
total genus 11
structure length 92
sequence length 94
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4jvzA00
4JW0A 4JVZA 2QW7A 2RCFA 4I7AA 5L37A 2HD3A 2Z9HA 4N8X1 4N8FA
chains in the Genus database with same CATH superfamily
2WFWA 3CC7A 4HEDA 4FF4A 3SE0A 1QVGA 4RGMA 1CK1A 5ELDA 3I4NH 2M00A 4C3JH 4LNQA 3IL8A 1PFMA 3MWYW 4GOPA 2VXWA 3J80i 2CFMA 3ULPA 1STHA 1BBXC 3ONAB 4C3JB 1SSOA 2D0PA 2F0VA 1XNQQ 1H9SB 1F9PA 4C3IB 2KCCA 3HS0C 2NVXB 3QO2A 4CGYB 4PMCA 3HOZH 1PLFA 4RKLA 2KJXA 4A3KH 3VYTA 1A3VA 4LF9L 2R61A 3KDFA 4OO1G 4XIGS 5CYUA 1HQRD 2WB1B 4IOAA 1RJTA 2JA9A 1VQ9A 3F2CA 3J80E 3BZCA 3BYYB 2SEBD 5JEAH 2RDHA 4S3SA 1ML0D 5IGCA 1XNRQ 1A6XA 3A5UA 1EEFD 2GVBA 1X55A 1NE3A 4HR7B 1XXGA 3NBIA 1JE5A 2XRSD 1OO9B 2F4IA 3TN2A 1Q81C 4CBVA 5ELEA 3UDGA 1KHIA 3UE1A 3EQLC 3FPUB 5C3EH 3AFQA 2E5LQ 1J5EL 1N34Q 3A0JA 1Y1VH 4I7ZC 1GUOA 1B44D 1ZYRD 3LX0A 3TP7A 1VQ7A 2VY3A 5KYLA 2EXZA 3SK6A 4BWGB 2DY8A 2B2WA 2DNEA 1RHPA 3EFXD 5CC4A 1YNNC 4DR6L 1UEBA 2IW3A 1Y1WG 1VQKA 1DOLA 3GP7A 4R4OA 5D65A 3PUZA 3KFUA 4I65A 1CTMA 1TVXA 2EJMA 3AQQA 2QEXA 2KEDA 3AB9A 1AH9A 1CA6A 3HOWB 4YWLA 1F2LA 5FLXL 1EWCA 1HUNA 1C7YA 2B3GA 1LT4D 2YTVA 3EBEA 3I4MH 2WAQG 2F0NA 3C1EA 2D0OA 4L5TA 4DAMA 1Y8OB 1X3QA 1N33Q 1GVPA 2RHQB 2F0TA 4K2KA 2HDLA 2F0HA 1QG7A 2PPBC 2HQEA 2Z9HA 4N8X1 4QB4A 2F0EA 2J7ZA 1XTCD 3D0FA 2LXJA 3UI2A 3V2TA 5E3FA 1HA5A 4FXDA 3S24A 1D7QA 2XNAC 4K0KQ 2AMCB 4KHPQ 4HIKA 1XNRL 1BBWA 4B3RQ 4B9WA 1J6QA 5GADC 3CCUA 1HNWQ 1AFPA 4QF4A 2F0GA 3AMUA 4L5RC 2VZAA 2LKVA 4DV4L 5CV8A 3TP8A 1PZID 3U4ZA 3OWFA 5IOCA 2TMPA 2WKDA 3C1FA 2Z6KA 3BYTB 2HQLA 3KJOA 1CT1D 5I9OA 1N8RC 2VQFL 1KDAA 1V8QA 1F2MA 1S5FD 4NKLA 4BY1B 1D5MC 2Y0SG 1G6PA 1YHBA 4XQJA 3TBIB 1Q8KA 3CHBD 3FDTA 2NUCA 2JEAI 1S5CD 4IPDA 2L55A 3KBGA 2GN5A 2IWHA 2SNMA 1A8VA 1VF5C 2VUMB 1EY7A 1LT3D 1DXMA 1GHJA 3DLLA 2LS01 3NELA 4APVA 3S1RH 2Q2TA 3HOXH 1GJXA 5IP7G 4ODGA 1I4XA 2F0PA 3I90A 5JEAG 2K05A 4DV0L 3HOZB 3S2HB 1TWFH 2RCFA 2A6EC 2CCZA 2QKIC 3GTOB 3OTOQ 1MHWC 3QWNA 4M1UB 4FVMA 5EPJA 4TSSA 3R93A 2XWJB 3I4NB 1PFBA 1HH2P 4G4KA 4JI0L 2R7FA 1WI5A 3D4DA 1I4QA 3X3NA 5I9PA 4O42A 2UUBL 4B3SQ 1Q1BA 1LTBD 1FJGL 1EFID 5FLMH 4JYAQ 3L2PA 3OW2A 4DA2A 2A6HC 2F1MA 1MI2A 4P73A 1X3PA 1HHVA 4RHSA 4A3CG 2R7DA 1VQHA 5M5YB 5C4JB 2MNAA 4BBSG 1WCMG 5JPMC 2E8GA 5AFWA 3HEJA 4DNTB 3VR3A 5JPNC 1FVIA 5CV6A 4DV1Q 1KC8C 1OXSC 5DEHA 3CCMA 3R2TA 3TQYA 3PIOA 1FNUA 2O4XA 3M4OB 2ZM6Q 4H13C 4O2DA 3TREA 3GTJB 4X65L 4Q5VA 3S2DB 2WAQE 4A3GB 3M3YH 1PRTB 2G5DA 1V1QA 2VL6A 3MZ5A 4JI7Q 2F3VA 2F4VL 2H1EA 2RSNA 1SDFA 1BDOA 5AJ3Q 1D1KA 3TRZA 3R3OA 3ITPA 1TWCH 1II3A 2UXCQ 1QWYA 1BCPC 2K03A 4Q0FA 1JT8A 1SNMA 4FF3A 4KD4A 1JOQA 3QJYA 1YIJA 4FYDA 4PZ6A 2DN8A 1GKHA 5I6YA 3SK5A 2OF1A 1TWHB 1PH8A 3C3LA 2IX3A 1HR0Q 3RMHA 4YY3L 1F2YA 3F2BA 4I7AA 3S1RB 5IGEA 5C4XG 4AYBG 2WKCA 3RZOH 1B7YB 3NE5B 1C9OA 1B3QA 1BR9A 1U0LA 5DNFA 3CCVA 2L9HA 4RG1A 5C3EG 1XMOL 3VA5A 2Z6BA 3NEMA 1V1PA 3TZUA 3VYRA 3H6MA 3NTKA 3K7AH 3VR2A 3T1HL 2DJFC 5A35A 4LF7L 3TP5A 4QGUA 3ZJYC 1G91A 4F88A 3GV3A 1C4QA 1HZAA 4DNIA 3I91A 3PIPA 1KDCA 2N3SA 3HKSA 3S15B 4RGTA 4UP8A 1OXUA 4A3JB 4R4QA 5IYDG 1LTGD 4H7BA 1X3FA 1I94L 4OIJA 3HOZG 3CU7A 5C4JH 1IL2A 5EBCA 1C8CA 2R7ZH 2ZM6L 1YZ6A 1HR0L 4LJZC 1XMQQ 1HJPA 1N33L 2E2HH 4X62Q 2Z0SA 1ICWA 2BOSA 2K5WA 3KDFB 3HOUH 2JEBI 1V1PB 1E0BA 5IYCG 3Q23A 1IXRA 4BBRB 4RKBA 3BG3A 4ME5A 4A3FH 3OIQA 5TSSA 5IODA 2B2TA 3S1QH 2K1BA 4ZUIA 5EKKA 1FGBD 4CDFC 3D6WA 4F7XA 4QIWE 3BVZA 3F2UA 4MHEA 2BA1A 2F0LA 1X32A 5BN5A 2AWOA 3E0JA 2JA5G 2B2UC 3HOVG 3KLSX 3LWEA 2KUMA 4K2LA 1Y69U 3CXCA 1B9NA 3P75A 4K5WA 1N36L 1ESRA 2JK8A 1EEID 1G2SA 4A3DG 2EE1A 2A1AA 4KLKA 3P1HA 2A74C 3J80L 2ENBA 4IN3A 1K8AC 1L1OA 2R92B 1A62A 3H3VI 2K04A 1SMXA 2KVMA 1D1IA 1PYWD 3HKZB 2F0IA 2NZHA 1VQJA 4POGA 1N34L 4A3EH 4KV6A 1TT2A 3H91A 1NR4A 2QILA 3GDEA 1S40A 2UUCQ 2JA7G 4L8JA 3A55A 1HNZQ 2JYOA 1B3AA 1UE6A 3DM1A 1PYBA 4UDUC 1IBLL 3AU7A 1YVCA 3U4VA 2BH8A 3QIAA 1HZ9A 2KQ3A 1EIGA 2F0UA 1R9TB 3T13A 5C4ZA 2JA7H 3HOWG 5BR8Q 2QGQA 4A3IG 2F0WA 2F52A 3BU2A 3A5ZB 3HKZE 3HZXA 5CMDA 3PF4A 2XIWA 4XYOA 3K8AA 3NP8A 1K0RA 3RD4A 3GTJH 1WTPA 2NTTA 1C48A 2CKZB 2JA8G 4DKAC 4A3LG 1VQOA 5DLQE 4JC0A 3T53B 5IGDA 2XRQD 2J0TD 4LF8L 2VB3X 3GTGH 1LM0A 4QJFA 4ZKCB 4HSPA 5ELBA 1DONA 3G6JB 4DV4Q 1QJOA 1VQIA 4RMFA 1SNCA 1SBBB 5IE8A 1VCIA 1WTWA 4RA8A 5IT9E 1PH3A 4LFBQ 4P2CB 3QG1A 3SDZA 1UNSA 1I3QB 3SHLA 1X65A 4R1JA 1ZEQX 5FLMG 4B9XA 1D8LA 2WP8J 4DV1L 4HIMA 3S1MB 4CKEA 3K80C 2KBNA 4ULLA 4JI2L 4A93G 4TRDA 1Z6HA 4WJ4A 1KAAA 2CVRA 3A8KE 4EQOA 4KHVA 3FRPB 2PI2E 3BVMA 4PQXA 1IHZA 4QL5A 1N9WA 4FDBA 4Y52H 1SXTA 1TY0A 1Z7TA 1PV4A 4AH6A 4DR1Q 5J39A 1WFQA 4CJ0B 1VQGA 5ELOA 1PH4A 1F77A 3J7AV 3BZDB 2EXDA 3GO5A 4DR5Q 3RN5A 3IKJA 3NWSA 4A3BH 1HTLD 2RF4A 1TWCB 3I4OA 3GQBA 1B53A 2R93B 1CI3M 1SE4A 1A2TA 3FKIB 4DAPA 2JA8B 5HGQA 1OXVA 5JJKA 2BDNA 1VMCA 4KY6A 2A68C 5G3LF 3X3MA 2EYFA 1EOTA 3P7JA 1D5XC 2DUDA 3TMEA 2N88A 4DR7Q 2F0OA 4DXFA 4A3IB 2EY6A 2JJQA 2HD3A 3L7ZC 1QZGA 1HZCA 1B2TA 1TS5A 3GTOH 1PZJD 1GUSA 4DAYB 2A69D 1NUCA 2VQEL 1M90C 1EQVA 1QE6A 4X62L 1SJHD 3MFGA 2IT1A 5COYA 4YCWA 2FHTA 2UU9Q 3N52A 2X6LA 5IGBA 2B2YC 2FFKB 4JV5Q 1KDBA 3DWPA 1TQOA 4H44C 2JN4A 1BF4A 4BXXG 3HKZG 3SGIA 3U50C 1STYA 4GLVB 2VNUD 1HQMC 2BA0A 4A3JH 3JC66 1FYCA 3T1HQ 1CM9A 3HFZB 1Y8PB 1HNWL 2ZJRA 2K4KA 1K0SA 1JWSD 4HMJA 2KCNA 5CORA 1XMOQ 2PW7A 2E5LL 1VQNA 1BCPD 1IBML 4K0KL 2HCIA 1IBKQ 1IBKL 2L15A 4C3HB 4OEMB 5M3MG 4A76A 5FJ8H 3CCLA 4YHHQ 1H95A 1SAPA 3OWEB 3DM3A 5FO8B 2BDOA 3I56A 3W3AA 4RHRA 3K5LA 2WINB 4DV2L 4HN7A 4IPGA 4N8FA 2L12A 1W3SA 1JJGA 5A2QL 1TWGB 4P71A 3G6EA 1SYBA 2F3WA 2ICIA 1UAPA 4PNYA 2IJ0A 1XPRA 2QF7A 3OMCA 2F3IA 3W2DA 2UXCL 1H9MA 2WV6D 1AE2A 3VR5A 4JBKA 5JOBA 1DOMA 2XTIA 1JC7A 1NY4A 2OXPA 4DK0A 4KN4C 1LLRD 1Y1VG 4NXML 5DAUA 1CUKA 1EQRA 1JB7A 1MKHA 3SEBA 1IKLA 2Q2UA 4XXEA 4A3MB 1VQCA 1TKWB 2B2WC 4L5QA 1Z9FA 4OO1I 1QVFA 2RA4A 3D3RA 3HOYH 3HOYG 4DR2L 1U4MA 2DJGC 5CBAE 1KABA 2EYPA 4GKJL 1PYSB 5EKLA 1K73C 2Z4IA 2UUCL 2EY1A 5ELCA 2NWGA 1EIHA 3GTQH 1QILA 4GNXB 2BE5C 2CH4W 1GOZA 2CW0C 3PO2B 4L6TB 1CQVA 4WRDA 2OQKA 3IRBA 3GTPB 1VMPA 4WJ3M 1R4QB 1PH2A 2NVYB 3UE0A 3DWQA 3GV6A 4JI4L 2PO4A 2ASBA 4LFCL 3I70A 4MZ9A 4K8JA 3MXGA 2OEOA 2K5DA 1L0XB 2PCFB 1N32Q 2HUGA 4ZLTF 2IX1A 5K5PA 1A63A 2D62A 4IFDI 4KJNA 2JP1A 2PI2A 4GOPC 4IO9A 2E2IB 2RKSA 1BQQT 3LNNA 3FKIH 4NB3A 1PTOD 1EY4A 2E75C 5EGTA 3CD6A 4DV7Q 3S1QB 4FF2A 1L1OB 4C3IG 2AKWB 2B8GA 4GN3B 4GS3A 5IT9c 4C3JG 2HHHQ 4O0AA 2NVXH 1E24A 3R2IA 1K83H 1PHJA 1LTSD 1Q46A 1UUPA 3MEHA 1IBMQ 4RWSC 3H09A 4J6HA 1S72A 2PZUA 1WCMB 1A0IA 2FINB 1B9MA 3KOJA 4LF5Q 3OMGA 3S14B 3SK8A 5F2DA 1E3PA 2K01A 1Q1EA 2B63B 2FMCA 1SEBD 4EGVA 5BR8L 1EU3A 2NBFA 3PV0A 4N9TA 1L0YB 2PZTA 1STAA 2JA6B 2ZXPA 2WACA 3M7NA 1B1ZA 1KRSA 2A19A 4KHZA 2I46A 4B3TQ 4NP5A 1HNZL 3I3CA 3ERSX 4P75A 4A3GG 4KHPL 1VQ6A 2KENA 1UWVA 1DOKA 1EWHA 1EU4A 1U4LA 3HOVH 1U4PA 3CMAA 1HRJA 4RCOA 3T4AC 3J7YW 2NB0A 1RKNA 5BN3A 4DUZL 2B63G 1XMQL 3GTQB 1SE3A 2K5QA 1LYLA 2K5HA 2KHIA 4J8QA 1ASYA 3DWAA 1F9QA 2UXBL 3H3VC 1RTNA 5IYCH 1AE3A 5C0XI 5LMNW 4A3EG 4PZ8A 5J1ZA 4BBSB 1H9JA 3CPWA 3UDFA 2KA7A 3PIP3 3QR8A 2UXBQ 1O7LA 1BBUA 4NXNQ 4X6AH 1G6ZA 3QB3A 3OSOA 3OPOA 4X65Q 2QCPX 4GN4B 2JA6H 2E2JB 2VQEQ 4A93H 1LTAD 4OX9Q 4ZCKA 4LF6Q 2JQOA 5G3LD 1MSHA 1Y8NB 3H0GH 2E2DC 4BBRG 1YJNA 3EJIA 2E2HB 2EOTA 1EZ8A 1XTDA 3PCOB 1SYDA 2A69C 2UUAL 5E4XA 1XWEA 1GD7A 2KCTA 1E2WA 1KNAA 2LFNA 4YHHL 4QQBX 3K0YA 4YWKA 4YY3Q 2AQ3B 1TWFB 2I0QA 4DV5L 1XPUA 3AYHB 2PMZE 2HDMA 1UE1A 2UXDQ 2K6AA 1Y14B 3STBD 2VUMG 4RFBA 2N8NA 4WJWA 5I6WA 5I4DA 1YI2A 3K5NA 1P8LA 5IGGA 2A6HD 3K6OA 5M3FB 1DCZA 2MP1A 3VDYA 4KN7C 3RLFA 2E2IH 2Z8LA 1JR0D 1HZBA 1E22A 3I4LA 1MIUA 3L9AX 1Q7YC 4X3KA 2B2YA 5D14A 1H9KA 3H0GB 3BDLA 1EWIA 1SNPA 3SR1A 5M5YH 4GLXA 3K81C 5C4XB 2HIVA 3KF8A 2ALYB 4UAIA 2KECA 3J81i 1I6HH 4BY7H 1M4VA 4GN5A 4CKBA 1HR0W 4GKKL 2R3ZA 3Q8DA 1YNXA 1PH7A 3S16H 3TS2A 3IFDA 4KI0A 1KTKA 4IOCA 5IP9H 2K50A 1EIYB 4LF8Q 3NENA 4DGZA 2Z6KC 2PNRC 2JXMB 1B8AA 3EN2A 3I4MB 4V0BA 1I3QH 3HOXB 1JWMD 1LO5D 1I4RA 3K57A 1PRTD 1PZKD 4Z9CB 3NBHA 4ILWA 3UDXA 1FD7D 4HSVA 3PUYA 2RBMA 1T5XD 1SYEA 1JOOA 5J3BA 3HOVB 4HJAA 3CC4A 4UPAA 1JICA 4DV5Q 3HOUG 5LL6S 4AIMA 3JAME 4JVZA 4M8AA 2XN9C 2V4DA 1SNOA 2F0KA 2K33A 2K7VA 1PFSA 3PUWA 4DV0Q 1E7ZA 1VDZA 2UUAQ 1O7IA 4HJ5A 2Q2IA 2F0DA 1JQYD 3NSWA 2NVQB 5M3FG 3MXPA 2XSCA 3IFTA 5EPKA 5M5WB 1PFNA 1W6KA 2L0CA 5GAEC 1X3GA 1D5ZC 3ZYYX 4DPGA 1KXLA 1YJ9A 3C46A 2NTSA 2KEEA 4P72A 4TQUS 1RDPD 2C5CA 3Q22A 4HIDA 2B39A 3LGJA 4NXMQ 1YEZA 5GAGC 5HGTA 2A8VA 4LWCA 3NHHA 3PO2H 1A15A 3JAML 1JMCA 2NVTB 2XWBB 2F0MA 3G48A 2JSOA 3CP0A 4A93B 5K36H 1IW7C 3RZDB 3NPPA 2PNHA 2EDGA 2X69A 4IALA 3M7GA 2OCEA 1GUNA 4JI6L 1RD9D 4YCUA 3MC0B 5I2XA 1FR3A 4RH6A 2VW9A 1AN8A 1FNWA 4U673 4UY8C 5FO9B 2OTJA 1AP0A 1HXYD 1WTQA 4AYBE 1EQQA 1SNQA 4P74A 1KNEA 5DM63 3CAMA 3J81j 4DK3C 5EKIA 4N9PA 1AZQA 1G51A 1EOVA 5E4WC 3D6CA 3WOEA 3A8JE 2X6GA 3VA7A 2B63H 1UE5A 3PGZA 5C0XG 4IQZA 1EY5A 2F03A 3DUZA 4LW1A 3VR6A 3Q24A 2QA4A 3E9HA 5FLXc 5FO7B 3T16A 4CJ2C 2M2LA 1YHAA 1Q90A 3D4WA 1F9RA 2MJ8A 3ERQA 3HG9A 3KF6A 4J15A 1L1OC 1Q8IA 5C4XH 3OYYA 2R7ZB 1I5FA 3DEOA 4G7OC 1PRTC 3I4MG 4NW2A 3ULJA 2ICEC 4OWWB 1HCZA 4IJLA 4DF7A 2LSSA 4K5VA 3BZKA 3A54A 2KHJA 4JK1C 1STNA 1EY9A 5KGUA 2SNSA 1YHQA 1SFOB 1IYUA 1EFWA 3M4YA 3U58A 3S1NH 4DV7L 4F8MA 1RF2D 1L2FA 3D31A 4FXGC 1LT5D 3J7ZC 4DUZQ 3BDCA 3KJPA 1VQ4A 1LTID 5C6AA 1VQAA 4JBWA 1KIXA 3IAYA 1J5EQ 2OTLA 1CKNA 2NYZD 3KYHC 3RR5A 2NZOA 5IYBG 2I07B 2PYKA 1DM0B 1J9OA 2MUYA 4K8IA 2CW0D 3GTMB 4GLAC 2I5LX 1AW7A 4OONA 4DU9A 5AJ3L 3K0XA 1G2TA 4J1MA 5ELFA 1PRTF 2DNCA 4DFAA 1CKOA 4L63B 4X3TA 3MVVA 4DK6C 1EL0A 4DR6Q 5C0XH 3F1ZA 3CCRA 3PUXA 3CPFA 1UEAB 5D3DA 1CHQD 3CQZB 4IUVA 4LF5L 4DUYL 3HOXG 2DGYA 3W1GA 3KUPA 4JI5Q 2GVAA 4ID6A 1PDQA 2KCMA 1YNND 2H4OA 1I6HB 3L3OC 4OO1H 3N6RA 3D8GA 5JVH3 1NR2A 1QCBD 2NVYH 1R4PB 1MD2D 4DV6L 4KD3A 5LMNL 1ENFA 3W1BA 2ZJPA 4A3BB 3KF8B 4HJ7A 1U4RA 1PH5A 3K5OA 1HNXL 2R92G 5CR3A 2PQEA 2C9OA 4UHVA 1Q82C 3MEFA 3CCEA 1CA5A 2CWPA 3FVQA 2EYHA 5M5WH 1SYGA 1QZHA 4IUPA 3DMUA 4HMIA 4C1NK 3S14H 1HPCA 1WD1A 2MO0A 2Y0SE 1K3RA 1DYQA 4LUOA 4LF4L 3DXJC 4B08A 3MAQA 4C3HG 4FO2A 1XYIA 1JB3A 3MXNA 1RODA 2F4VQ 1PA6A 1OXTA 1IYVA 4DN4M 5KRUA 1S3OA 3PUVA 1GHKA 4JI7L 1EYAA 4L5SA 2LMCB 4A3EB 1TS2A 5EAYA 3OOCA 2DY7A 1WTOA 2JA8H 1LTTD 2YYZA 4DV2Q 4JI4Q 1LT6D 3LWUA 2HIXA 5I2YA 1IBLQ 2L5TA 1SN8A 3TS0A 1KLUD 1TS4A 3FP9A 5JJIA 3J7A5 5KYIA 1D2BA 4DV6Q 1OXXK 3I72A 2SOBA 1VQDA 1TWGH 4H02A 3EVQA 5GAHC 3OHXC 2OWOA 1W6JA 3MXNB 4WFN3 3PMFA 4IPCA 1QUQB 1ENCA 1O78A 4KTAA 3PF5A 1TY2A 4MTNA 5M3MH 4R8NA 3VR4A 3U9SA 1LABA 1V9PA 5CV7A 1Y1WH 4X66Q 4R9WA 1DGSA 3QOJA 2Q8RE 4JI0Q 2FMMA 2RDFA 2UU9L 4OL7A 4IUUA 1TR5A 3GTLB 3M4PA 4K5XA 2VUMH 3O13A 4JI8L 2AHOB 3RUZA 3CCQA 1KL9A 1L0WA 1K9MC 1ZYRC 3BJUA 1F2ZA 3OTOL 3I8ZA 4GKJQ 4XT1B 2L11A 1BKBA 5T1IA 4JBMA 4ZUJA 1QUQA 4CDEC 1ZKOA 4EX5A 4TVAB 3VYSA 3S15H 4A3BG 5IT9L 2NVTH 1SYFA 3TDQA 4A3FG 3M4QA 2K52A 1GUGA 3F8TA 4UP7A 5JVG3 1LUZA 2K5NA 3ND9A 1QB5D 2D5DA 4XQQA 5HY6A 2L4NA 3CC2A 2EJFC 3AEVA 2PQAB 1K3BC 3J81L 1XJVA 4QIWB 4U68A 1FNVA 4KMUC 1D6EC 1ET6A 5GQOA 2Q8TA 4OXPA 3KLWA 1VF7A 4JOIC 2QDLA 5NUCA 1X56A 1JOKA 3S9WA 3KLSA 4NPSA 1A3UA 1X6OA 1EYCA 3CRKC 2MQHA 1SRUA 4CKCA 4IPHA 4NDXA 4XYQA 3SXHA 3K7UC 4JV5L 1CSPA 3PSIA 2F0SA 2N49A 3DEPA 1KQSA 3PO3H 4A3MH 4RGOS 2ZJQA 4LF4Q 2R6GA 2WIIB 2OT2A 1K8GA 4JI2Q 1JJCB 4O1NA 2IY5B 2B8FA 2YU9H 1LACA 1PTOB 4QCLA 3CW2C 1OTCA 3CF5A 3QOLA 3H3VH 3TSSA 1PH6A 2HHHL 3VYUA 2QDBA 4A3GH 2P5ZX 2IHEA 4R4TA 4IFDH 1SYCA 3I2ZA 4LFBL 4ALPA 2XVSA 2RVLA 3JAMi 4DR7L 1DD2A 5CV4A 1MJCA 5IGFA 4DAYA 4IURA 1ILQA 4IUTA 5C44G 1QVCA 1CKMA 3E3XA 3I4NG 1JE4A 1PTOF 4R8IA 4DR3Q 3Q6SA 2YV5A 1PVOA 4QUCA 2ZXOA 1HTPA 3NK9A 1RIPA 1TWHH 3NQTA 5T1GA 2EQSA 3S1NB 2E76C 1EYDA 5JAVA 4HIOA 4A3FB 4LUVA 3JAMc 2LXKA 1N32L 1Q12A 3E5SA 5ISRA 4XQNA 2RCNA 3GTLH 1EIFA 3C2PA 4H0LC 1ICFB 5KNCA 5EJWA 1JORA 2RSOA 4DK1A 2IL8A 3A7LA 5IWAQ 4A3DB 3WWVA 1BCPF 1DJRD 4C3IH 3T1YL 1HNXQ 1GUWA 4BY1G 3UDIA 3M4OH 5C4HA 2G9HD 3WOFA 4UP9A 2IHFA 4JI3Q 3RNUA 3NWTA 1ILPA 3WDNA 5IIFA 2O5JC 3D4RA 2JA5H 5KNDA 4JYAL 4DR2Q 4X3UA 1H9SA 4MN3A 3S17B 4KY7A 3RLOA 3ULLA 1Y1WB 4NMZA 2CQAA 3KBXA 3I55A 1NMFA 4BBSH 3T51B 4YIJA 1T9HA 4JG2A 4FNFA 1STEA 4JPBW 5IWAL 1WOCA 2CHBD 4LAAA 4A3MG 5L37A 1N36Q 3MHBA 3PO3G 4K14A 1VQLA 1SNDA 1T5EA 2SDFA 2F0JA 1SMYC 4DNRB 4DR1L 2G9DA 1XPOA 1E2VA 4OWXB 2ZXRA 4AQYL 3L0OA 4PV1C 4BBRH 3CCJA 4JI1L 5CV5A 1WVLA 1TIID 3HRZC 4LFAQ 2B2TC 5C0XJ 3W5OA 4GKKQ 4A3DH 4X64L 2YU9B 3DHQA 3TP6A 3K5MA 4POFA 4LK1C 4FP5D 3GTPH 2AQ1B 3NQIA 3PQIA 4R4IA 5IP7H 2ES2A 2JA5B 4C56C 2E2JH 5JEAJ 2V1CC 5C3EB 3K58A 1I94Q 2CWAA 4ZRZA 5M3MB 1GM5A 4DV3Q 3G7LA 3HOUB 2B2VC 1BO0A 1WTVA 4OGQC 3HOYB 1Q86C 2GA4B 4WORA 4IUNA 4LF7Q 3J80c 3RZOB 4C2MB 1K83B 4B3RL 5FLXE 1VQBA 5IYDH 5EQ0A 3HP3A 2UXDL 5FOBB 1MBYA 1PXUA 1KLGD 1QOHA 3ND8A 1IL8A 3TEHB 1W2BA 2PQAA 4TKOB 2F0FA 1TU2B 1KRTA 4ZQ3A 2YTXA 3K7AB 5LMUL 1PMRA 3OW7A 4E6IA 2K32A 5M9OA 3E0EA 5JJLA 5EPLA 3J81c 4QY7A 4MIUA 2EVBA 1BUVT 1I4PA 2Z1CA 4HTHA 3SVMA 2KHSA 3GTGB 1WTRA 4K6DA 2RQXA 1E1OA 1U5KA 2O5IC 4KKTA 4XTCS 4OELB 2QEJC 1X3EA 4XDXA 3NTIA 1NAPA 5IYBH 5J22A 1WYDA 2K75A 1IKMA 1R9TH 1EZ6A 4AYBB 3FKIG 2MFIA 4YWMA 4QUFA 3J81E 2Z4HA 4JI8Q 2ID0A 3CQZH 1Z47A 4EVOA 4F87A 2HT1A 4DR5L 2VS1A 2NVQH 2ZTEA 2K5VA 5LL6X 5FJ8G 4DR4L 2CQOA 3BVGA 2BE5D 3I73A 2OQ0A 1SROA 1TWAH 4HCSA 2KOLA 5E7NA 3GTKB 4A3CH 4KJOA 4OWTB 1I6VC 5C3XA 1SR3A 5M5XH 4X3SA 2LY7A 3FEWX 4K6LA 4CDDC 1LV9A 4B3TL 2R92H 4GZYC 5ELNA 3FPPA 5C3WA 1CSQA 1A2UA 1LTLA 1BVSA 2FXQA 1QNUA 1IZ6A 3CCSA 4V190 2D9UA 4EQPA 3BS1A 2MHVA 5GROA 1FGUA 4PMWA 4MTKA 1BOSA 2AUJD 2I5HA 4C3HH 1CKNB 1RL2A 3S17H 1CQFA 4LMQD 4ZYSA 1I50H 3KLRA 2RHSB 1SE8A 1NTGA 2D2CC 3KK7A 4KKSA 4JI1Q 1NJIC 3RLNA 3F2DA 3Q0AA 2Y0SB 2L1BA 4BY7B 3M9BA 3A56A 2F0QA 4QMGA 1ENAA 1I4GA 3CMEA 1AZPA 3SK4A 5CV9A 3RN2A 1STGA 2EYOA 3A74A 4A4IA 1XX8A 3TZDA 4RCNA 1KAWA 4JW0A 1VQPA 1VS0A 4MNOA 3MA2B 3EIVA 1IYJB 1VQFA 3FMCA 1ET9A 1VQEA 3MXUA 4A3KB 4EQNA 4G7HC 4GNXA 1U9RA 1RCVD 2EY2A 3MFYA 1WTXA 1O7ZA 1P16A 4C2MH 4RGNA 1RTOA 2EJGC 2MPMA 1VQ8A 2BCOA 4GOPB 3HGBA 4B3ML 1BNZA 3S2DH 4LF6L 4LFCQ 1ZXTA 3K59A 1V43A 4DUYQ 4ZKBB 4JOIA 1GO3E 2WAQB 4HJ8A 1UE7A 1K28A 3PO3B 1ASZA 4NXNL 2IX0A 3MTSA 5HURA 4DAVA 1PTOH 4KK7A 5FK9C 4BXXH 1NSNS 1DZ1A 1G8ZD 4Y7NH 2N55A 2EYMA 3AFPA 4HAEA 3OIPA 3KF6B 2J4XA 4OHJA 1S4ZA 2R93H 1F9SA 4GNXC 1MGSA 5A2QE 2Q2HA 3GTMH 4A3LH 1NCVA 1CZWA 2UUBQ 4B3SL 4DR4Q 2C35B 1Y1VB 2YTYA 1GUTA 4PMBA 5C5MA 3ER0A 5C5LA 4CDCC 3A8IE 2A5HA 3V96A 2JA7B 1S5ED 2JE6I 2ZTCA 4A3IH 2VQFQ 4A3JG 2NN6H 2B29A 1YNJD 4G57A 4BA2I 1ONLA 3G4SA 2CH4A 2M9VA 4X66L 2A68D 4DR3L 1C0AA 1ESFA 3S16B 5K36G 3S2HH 3ICEA 1SE2A 4IUQA 2MO1A 3H15A 2XGTA 1TWAB 2TSSA 1V1OA 2NZ1D 4HCEA 3A7AB 4BA1I 3E6ZX 3S1MH 5LHY1 2EIFA 4KKUA 4DXGA 1B4OA 1YBYA 3PO2G 2WB1G 1K8MA 3NBHB 1O7YA 3BDOA 4OIKA 1JCKB 2N78A 3H0GG 4A75A 1GXDC 2EYLA 4ZAIA 5C44H 1X54A 4PZ7A 4FF1A 5IY0A 1BXTA 3E9IA 1FL0A 2EY5A 2PW5A 4ZK9B 2H5XA 3EA6A 2K28A 1KD1C 1CHPD 2EYJA 1VQ5A 3CRLC 2PZWA 1I50B 1YJWA 1EQTA 2FJ2A 1M1KC 2AUKA 2B2UA 3STBC 4IJHA 4RAUC 1B70B 1PH9A 4OX9L 1YNJC 1I4HA 1SFOH 1WD0A 1MJEA 4JI6Q 3FHWA 1XNQL 1TXYA 2I5MX 4LFAL 2EZVA 1JJ2A 1Q3LA 1SLJA 2ZTDA 2HCCA 2BH2A 4HJ9A 5FKAC 1S5BD 1PTOC 5EBDA 1NMGA 1SJED 4DV3L 4A3KG 2Q8IB 2JA6G 3U9OA 5M5XB 2R7ZG 3I7FA 5KIXA 5M3FH 5JJZA 1IW7D 1EY8A 2EPBA 1MSGA 3NTHA 1B50A 2A6ED 4YCVA 4BY1H 2MGSA 2AQ2B 1M8AA 2RDGA 2K14A 1A3TA 3URYA 3T56B 1LTRD 1WJJA 1O80A 4BY7G 1WTHA 4LUZA 1CFMA 2IPKD 4CJ1B 4X64Q 5DM73 3RZDH 5KEEA 4ME3A 2R93G 5H1SE 4JI5L 4IFDJ 1PH1A 3R8BA 5LMUQ 2PMZB 1EYGA 5D3IB 3T1YQ 3NXWA 1E1TA 1HA6A 2E74C 3M3YB 1EY6A 3PIO3 3GTKH 4AQYQ 1EUJA 1JWUD 3G71A 5CBEE 3H94A 4FXKC 3B6YA 4KY5A 1SMYD 1FJGQ 2NN6G 4Y7NB 3M85A 1G291 1STBA 2AWNA 4PG3A 4BS9A 4LF9Q 4JBJA 1K8OA 3NUCA 5IP9G 1J8IA 4B3MQ 2QW7A 1TS3A 1YITA 1H9RA 1X9NA 3J7AF 4EQ5A 1HFGA 2O2LD 1QNKA 3P20A 1E2ZA 5E1FA 4IFDG 3EROA 4JI3L 4G7ZC 1HFNA 3HOWH 5KNBA 1EY0A 1S5DD 4XT3B 4R4CA 5CGKA 2VB2X 3V05A 2B2VA 4ABNA 1HUMA 2ATWA 3GD7A 5C44B 1CZGA 4IZ8A 3CKIB 4C1NI 1BCPB 4CHTB 4JCVE 1NBWA 2ZT9C 1NNXA 2NN6I 1WCMH 2WB1E 1VQMA 5BN4A 1AEXA 5LMNQ 2A73B
chains in the Genus database with same CATH topology
4JW0A 4JVZA 2QW7A 2RCFA 4I7AA 5L37A 2HD3A 2Z9HA 4N8X1 4N8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JW0 A;  4JVZ A;  2QW7 A;  2RCF A;  4I7A A;  5L37 A;  2HD3 A;  2Z9H A;  4N8X 1;  4N8F A; 
#chains in the Genus database with same CATH topology
 2WFW A;  3CC7 A;  4HED A;  4FF4 A;  3SE0 A;  1QVG A;  4RGM A;  1CK1 A;  5ELD A;  3I4N H;  2M00 A;  4C3J H;  4LNQ A;  3IL8 A;  1PFM A;  3MWY W;  4GOP A;  2VXW A;  3J80 i;  2CFM A;  3ULP A;  1STH A;  1BBX C;  3ONA B;  4C3J B;  1SSO A;  2D0P A;  2F0V A;  1XNQ Q;  1H9S B;  1F9P A;  4C3I B;  2KCC A;  3HS0 C;  2NVX B;  3QO2 A;  4CGY B;  4PMC A;  3HOZ H;  1PLF A;  4RKL A;  2KJX A;  4A3K H;  3VYT A;  1A3V A;  4LF9 L;  2R61 A;  3KDF A;  4OO1 G;  4XIG S;  5CYU A;  1HQR D;  2WB1 B;  4IOA A;  1RJT A;  2JA9 A;  1VQ9 A;  3F2C A;  3J80 E;  3BZC A;  3BYY B;  2SEB D;  5JEA H;  2RDH A;  4S3S A;  1ML0 D;  5IGC A;  1XNR Q;  1A6X A;  3A5U A;  1EEF D;  2GVB A;  1X55 A;  1NE3 A;  4HR7 B;  1XXG A;  3NBI A;  1JE5 A;  2XRS D;  1OO9 B;  2F4I A;  3TN2 A;  1Q81 C;  4CBV A;  5ELE A;  3UDG A;  1KHI A;  3UE1 A;  3EQL C;  3FPU B;  5C3E H;  3AFQ A;  2E5L Q;  1J5E L;  1N34 Q;  3A0J A;  1Y1V H;  4I7Z C;  1GUO A;  1B44 D;  1ZYR D;  3LX0 A;  3TP7 A;  1VQ7 A;  2VY3 A;  5KYL A;  2EXZ A;  3SK6 A;  4BWG B;  2DY8 A;  2B2W A;  2DNE A;  1RHP A;  3EFX D;  5CC4 A;  1YNN C;  4DR6 L;  1UEB A;  2IW3 A;  1Y1W G;  1VQK A;  1DOL A;  3GP7 A;  4R4O A;  5D65 A;  3PUZ A;  3KFU A;  4I65 A;  1CTM A;  1TVX A;  2EJM A;  3AQQ A;  2QEX A;  2KED A;  3AB9 A;  1AH9 A;  1CA6 A;  3HOW B;  4YWL A;  1F2L A;  5FLX L;  1EWC A;  1HUN A;  1C7Y A;  2B3G A;  1LT4 D;  2YTV A;  3EBE A;  3I4M H;  2WAQ G;  2F0N A;  3C1E A;  2D0O A;  4L5T A;  4DAM A;  1Y8O B;  1X3Q A;  1N33 Q;  1GVP A;  2RHQ B;  2F0T A;  4K2K A;  2HDL A;  2F0H A;  1QG7 A;  2PPB C;  2HQE A;  2Z9H A;  4N8X 1;  4QB4 A;  2F0E A;  2J7Z A;  1XTC D;  3D0F A;  2LXJ A;  3UI2 A;  3V2T A;  5E3F A;  1HA5 A;  4FXD A;  3S24 A;  1D7Q A;  2XNA C;  4K0K Q;  2AMC B;  4KHP Q;  4HIK A;  1XNR L;  1BBW A;  4B3R Q;  4B9W A;  1J6Q A;  5GAD C;  3CCU A;  1HNW Q;  1AFP A;  4QF4 A;  2F0G A;  3AMU A;  4L5R C;  2VZA A;  2LKV A;  4DV4 L;  5CV8 A;  3TP8 A;  1PZI D;  3U4Z A;  3OWF A;  5IOC A;  2TMP A;  2WKD A;  3C1F A;  2Z6K A;  3BYT B;  2HQL A;  3KJO A;  1CT1 D;  5I9O A;  1N8R C;  2VQF L;  1KDA A;  1V8Q A;  1F2M A;  1S5F D;  4NKL A;  4BY1 B;  1D5M C;  2Y0S G;  1G6P A;  1YHB A;  4XQJ A;  3TBI B;  1Q8K A;  3CHB D;  3FDT A;  2NUC A;  2JEA I;  1S5C D;  4IPD A;  2L55 A;  3KBG A;  2GN5 A;  2IWH A;  2SNM A;  1A8V A;  1VF5 C;  2VUM B;  1EY7 A;  1LT3 D;  1DXM A;  1GHJ A;  3DLL A;  2LS0 1;  3NEL A;  4APV A;  3S1R H;  2Q2T A;  3HOX H;  1GJX A;  5IP7 G;  4ODG A;  1I4X A;  2F0P A;  3I90 A;  5JEA G;  2K05 A;  4DV0 L;  3HOZ B;  3S2H B;  1TWF H;  2RCF A;  2A6E C;  2CCZ A;  2QKI C;  3GTO B;  3OTO Q;  1MHW C;  3QWN A;  4M1U B;  4FVM A;  5EPJ A;  4TSS A;  3R93 A;  2XWJ B;  3I4N B;  1PFB A;  1HH2 P;  4G4K A;  4JI0 L;  2R7F A;  1WI5 A;  3D4D A;  1I4Q A;  3X3N A;  5I9P A;  4O42 A;  2UUB L;  4B3S Q;  1Q1B A;  1LTB D;  1FJG L;  1EFI D;  5FLM H;  4JYA Q;  3L2P A;  3OW2 A;  4DA2 A;  2A6H C;  2F1M A;  1MI2 A;  4P73 A;  1X3P A;  1HHV A;  4RHS A;  4A3C G;  2R7D A;  1VQH A;  5M5Y B;  5C4J B;  2MNA A;  4BBS G;  1WCM G;  5JPM C;  2E8G A;  5AFW A;  3HEJ A;  4DNT B;  3VR3 A;  5JPN C;  1FVI A;  5CV6 A;  4DV1 Q;  1KC8 C;  1OXS C;  5DEH A;  3CCM A;  3R2T A;  3TQY A;  3PIO A;  1FNU A;  2O4X A;  3M4O B;  2ZM6 Q;  4H13 C;  4O2D A;  3TRE A;  3GTJ B;  4X65 L;  4Q5V A;  3S2D B;  2WAQ E;  4A3G B;  3M3Y H;  1PRT B;  2G5D A;  1V1Q A;  2VL6 A;  3MZ5 A;  4JI7 Q;  2F3V A;  2F4V L;  2H1E A;  2RSN A;  1SDF A;  1BDO A;  5AJ3 Q;  1D1K A;  3TRZ A;  3R3O A;  3ITP A;  1TWC H;  1II3 A;  2UXC Q;  1QWY A;  1BCP C;  2K03 A;  4Q0F A;  1JT8 A;  1SNM A;  4FF3 A;  4KD4 A;  1JOQ A;  3QJY A;  1YIJ A;  4FYD A;  4PZ6 A;  2DN8 A;  1GKH A;  5I6Y A;  3SK5 A;  2OF1 A;  1TWH B;  1PH8 A;  3C3L A;  2IX3 A;  1HR0 Q;  3RMH A;  4YY3 L;  1F2Y A;  3F2B A;  4I7A A;  3S1R B;  5IGE A;  5C4X G;  4AYB G;  2WKC A;  3RZO H;  1B7Y B;  3NE5 B;  1C9O A;  1B3Q A;  1BR9 A;  1U0L A;  5DNF A;  3CCV A;  2L9H A;  4RG1 A;  5C3E G;  1XMO L;  3VA5 A;  2Z6B A;  3NEM A;  1V1P A;  3TZU A;  3VYR A;  3H6M A;  3NTK A;  3K7A H;  3VR2 A;  3T1H L;  2DJF C;  5A35 A;  4LF7 L;  3TP5 A;  4QGU A;  3ZJY C;  1G91 A;  4F88 A;  3GV3 A;  1C4Q A;  1HZA A;  4DNI A;  3I91 A;  3PIP A;  1KDC A;  2N3S A;  3HKS A;  3S15 B;  4RGT A;  4UP8 A;  1OXU A;  4A3J B;  4R4Q A;  5IYD G;  1LTG D;  4H7B A;  1X3F A;  1I94 L;  4OIJ A;  3HOZ G;  3CU7 A;  5C4J H;  1IL2 A;  5EBC A;  1C8C A;  2R7Z H;  2ZM6 L;  1YZ6 A;  1HR0 L;  4LJZ C;  1XMQ Q;  1HJP A;  1N33 L;  2E2H H;  4X62 Q;  2Z0S A;  1ICW A;  2BOS A;  2K5W A;  3KDF B;  3HOU H;  2JEB I;  1V1P B;  1E0B A;  5IYC G;  3Q23 A;  1IXR A;  4BBR B;  4RKB A;  3BG3 A;  4ME5 A;  4A3F H;  3OIQ A;  5TSS A;  5IOD A;  2B2T A;  3S1Q H;  2K1B A;  4ZUI A;  5EKK A;  1FGB D;  4CDF C;  3D6W A;  4F7X A;  4QIW E;  3BVZ A;  3F2U A;  4MHE A;  2BA1 A;  2F0L A;  1X32 A;  5BN5 A;  2AWO A;  3E0J A;  2JA5 G;  2B2U C;  3HOV G;  3KLS X;  3LWE A;  2KUM A;  4K2L A;  1Y69 U;  3CXC A;  1B9N A;  3P75 A;  4K5W A;  1N36 L;  1ESR A;  2JK8 A;  1EEI D;  1G2S A;  4A3D G;  2EE1 A;  2A1A A;  4KLK A;  3P1H A;  2A74 C;  3J80 L;  2ENB A;  4IN3 A;  1K8A C;  1L1O A;  2R92 B;  1A62 A;  3H3V I;  2K04 A;  1SMX A;  2KVM A;  1D1I A;  1PYW D;  3HKZ B;  2F0I A;  2NZH A;  1VQJ A;  4POG A;  1N34 L;  4A3E H;  4KV6 A;  1TT2 A;  3H91 A;  1NR4 A;  2QIL A;  3GDE A;  1S40 A;  2UUC Q;  2JA7 G;  4L8J A;  3A55 A;  1HNZ Q;  2JYO A;  1B3A A;  1UE6 A;  3DM1 A;  1PYB A;  4UDU C;  1IBL L;  3AU7 A;  1YVC A;  3U4V A;  2BH8 A;  3QIA A;  1HZ9 A;  2KQ3 A;  1EIG A;  2F0U A;  1R9T B;  3T13 A;  5C4Z A;  2JA7 H;  3HOW G;  5BR8 Q;  2QGQ A;  4A3I G;  2F0W A;  2F52 A;  3BU2 A;  3A5Z B;  3HKZ E;  3HZX A;  5CMD A;  3PF4 A;  2XIW A;  4XYO A;  3K8A A;  3NP8 A;  1K0R A;  3RD4 A;  3GTJ H;  1WTP A;  2NTT A;  1C48 A;  2CKZ B;  2JA8 G;  4DKA C;  4A3L G;  1VQO A;  5DLQ E;  4JC0 A;  3T53 B;  5IGD A;  2XRQ D;  2J0T D;  4LF8 L;  2VB3 X;  3GTG H;  1LM0 A;  4QJF A;  4ZKC B;  4HSP A;  5ELB A;  1DON A;  3G6J B;  4DV4 Q;  1QJO A;  1VQI A;  4RMF A;  1SNC A;  1SBB B;  5IE8 A;  1VCI A;  1WTW A;  4RA8 A;  5IT9 E;  1PH3 A;  4LFB Q;  4P2C B;  3QG1 A;  3SDZ A;  1UNS A;  1I3Q B;  3SHL A;  1X65 A;  4R1J A;  1ZEQ X;  5FLM G;  4B9X A;  1D8L A;  2WP8 J;  4DV1 L;  4HIM A;  3S1M B;  4CKE A;  3K80 C;  2KBN A;  4ULL A;  4JI2 L;  4A93 G;  4TRD A;  1Z6H A;  4WJ4 A;  1KAA A;  2CVR A;  3A8K E;  4EQO A;  4KHV A;  3FRP B;  2PI2 E;  3BVM A;  4PQX A;  1IHZ A;  4QL5 A;  1N9W A;  4FDB A;  4Y52 H;  1SXT A;  1TY0 A;  1Z7T A;  1PV4 A;  4AH6 A;  4DR1 Q;  5J39 A;  1WFQ A;  4CJ0 B;  1VQG A;  5ELO A;  1PH4 A;  1F77 A;  3J7A V;  3BZD B;  2EXD A;  3GO5 A;  4DR5 Q;  3RN5 A;  3IKJ A;  3NWS A;  4A3B H;  1HTL D;  2RF4 A;  1TWC B;  3I4O A;  3GQB A;  1B53 A;  2R93 B;  1CI3 M;  1SE4 A;  1A2T A;  3FKI B;  4DAP A;  2JA8 B;  5HGQ A;  1OXV A;  5JJK A;  2BDN A;  1VMC A;  4KY6 A;  2A68 C;  5G3L F;  3X3M A;  2EYF A;  1EOT A;  3P7J A;  1D5X C;  2DUD A;  3TME A;  2N88 A;  4DR7 Q;  2F0O A;  4DXF A;  4A3I B;  2EY6 A;  2JJQ A;  2HD3 A;  3L7Z C;  1QZG A;  1HZC A;  1B2T A;  1TS5 A;  3GTO H;  1PZJ D;  1GUS A;  4DAY B;  2A69 D;  1NUC A;  2VQE L;  1M90 C;  1EQV A;  1QE6 A;  4X62 L;  1SJH D;  3MFG A;  2IT1 A;  5COY A;  4YCW A;  2FHT A;  2UU9 Q;  3N52 A;  2X6L A;  5IGB A;  2B2Y C;  2FFK B;  4JV5 Q;  1KDB A;  3DWP A;  1TQO A;  4H44 C;  2JN4 A;  1BF4 A;  4BXX G;  3HKZ G;  3SGI A;  3U50 C;  1STY A;  4GLV B;  2VNU D;  1HQM C;  2BA0 A;  4A3J H;  3JC6 6;  1FYC A;  3T1H Q;  1CM9 A;  3HFZ B;  1Y8P B;  1HNW L;  2ZJR A;  2K4K A;  1K0S A;  1JWS D;  4HMJ A;  2KCN A;  5COR A;  1XMO Q;  2PW7 A;  2E5L L;  1VQN A;  1BCP D;  1IBM L;  4K0K L;  2HCI A;  1IBK Q;  1IBK L;  2L15 A;  4C3H B;  4OEM B;  5M3M G;  4A76 A;  5FJ8 H;  3CCL A;  4YHH Q;  1H95 A;  1SAP A;  3OWE B;  3DM3 A;  5FO8 B;  2BDO A;  3I56 A;  3W3A A;  4RHR A;  3K5L A;  2WIN B;  4DV2 L;  4HN7 A;  4IPG A;  4N8F A;  2L12 A;  1W3S A;  1JJG A;  5A2Q L;  1TWG B;  4P71 A;  3G6E A;  1SYB A;  2F3W A;  2ICI A;  1UAP A;  4PNY A;  2IJ0 A;  1XPR A;  2QF7 A;  3OMC A;  2F3I A;  3W2D A;  2UXC L;  1H9M A;  2WV6 D;  1AE2 A;  3VR5 A;  4JBK A;  5JOB A;  1DOM A;  2XTI A;  1JC7 A;  1NY4 A;  2OXP A;  4DK0 A;  4KN4 C;  1LLR D;  1Y1V G;  4NXM L;  5DAU A;  1CUK A;  1EQR A;  1JB7 A;  1MKH A;  3SEB A;  1IKL A;  2Q2U A;  4XXE A;  4A3M B;  1VQC A;  1TKW B;  2B2W C;  4L5Q A;  1Z9F A;  4OO1 I;  1QVF A;  2RA4 A;  3D3R A;  3HOY H;  3HOY G;  4DR2 L;  1U4M A;  2DJG C;  5CBA E;  1KAB A;  2EYP A;  4GKJ L;  1PYS B;  5EKL A;  1K73 C;  2Z4I A;  2UUC L;  2EY1 A;  5ELC A;  2NWG A;  1EIH A;  3GTQ H;  1QIL A;  4GNX B;  2BE5 C;  2CH4 W;  1GOZ A;  2CW0 C;  3PO2 B;  4L6T B;  1CQV A;  4WRD A;  2OQK A;  3IRB A;  3GTP B;  1VMP A;  4WJ3 M;  1R4Q B;  1PH2 A;  2NVY B;  3UE0 A;  3DWQ A;  3GV6 A;  4JI4 L;  2PO4 A;  2ASB A;  4LFC L;  3I70 A;  4MZ9 A;  4K8J A;  3MXG A;  2OEO A;  2K5D A;  1L0X B;  2PCF B;  1N32 Q;  2HUG A;  4ZLT F;  2IX1 A;  5K5P A;  1A63 A;  2D62 A;  4IFD I;  4KJN A;  2JP1 A;  2PI2 A;  4GOP C;  4IO9 A;  2E2I B;  2RKS A;  1BQQ T;  3LNN A;  3FKI H;  4NB3 A;  1PTO D;  1EY4 A;  2E75 C;  5EGT A;  3CD6 A;  4DV7 Q;  3S1Q B;  4FF2 A;  1L1O B;  4C3I G;  2AKW B;  2B8G A;  4GN3 B;  4GS3 A;  5IT9 c;  4C3J G;  2HHH Q;  4O0A A;  2NVX H;  1E24 A;  3R2I A;  1K83 H;  1PHJ A;  1LTS D;  1Q46 A;  1UUP A;  3MEH A;  1IBM Q;  4RWS C;  3H09 A;  4J6H A;  1S72 A;  2PZU A;  1WCM B;  1A0I A;  2FIN B;  1B9M A;  3KOJ A;  4LF5 Q;  3OMG A;  3S14 B;  3SK8 A;  5F2D A;  1E3P A;  2K01 A;  1Q1E A;  2B63 B;  2FMC A;  1SEB D;  4EGV A;  5BR8 L;  1EU3 A;  2NBF A;  3PV0 A;  4N9T A;  1L0Y B;  2PZT A;  1STA A;  2JA6 B;  2ZXP A;  2WAC A;  3M7N A;  1B1Z A;  1KRS A;  2A19 A;  4KHZ A;  2I46 A;  4B3T Q;  4NP5 A;  1HNZ L;  3I3C A;  3ERS X;  4P75 A;  4A3G G;  4KHP L;  1VQ6 A;  2KEN A;  1UWV A;  1DOK A;  1EWH A;  1EU4 A;  1U4L A;  3HOV H;  1U4P A;  3CMA A;  1HRJ A;  4RCO A;  3T4A C;  3J7Y W;  2NB0 A;  1RKN A;  5BN3 A;  4DUZ L;  2B63 G;  1XMQ L;  3GTQ B;  1SE3 A;  2K5Q A;  1LYL A;  2K5H A;  2KHI A;  4J8Q A;  1ASY A;  3DWA A;  1F9Q A;  2UXB L;  3H3V C;  1RTN A;  5IYC H;  1AE3 A;  5C0X I;  5LMN W;  4A3E G;  4PZ8 A;  5J1Z A;  4BBS B;  1H9J A;  3CPW A;  3UDF A;  2KA7 A;  3PIP 3;  3QR8 A;  2UXB Q;  1O7L A;  1BBU A;  4NXN Q;  4X6A H;  1G6Z A;  3QB3 A;  3OSO A;  3OPO A;  4X65 Q;  2QCP X;  4GN4 B;  2JA6 H;  2E2J B;  2VQE Q;  4A93 H;  1LTA D;  4OX9 Q;  4ZCK A;  4LF6 Q;  2JQO A;  5G3L D;  1MSH A;  1Y8N B;  3H0G H;  2E2D C;  4BBR G;  1YJN A;  3EJI A;  2E2H B;  2EOT A;  1EZ8 A;  1XTD A;  3PCO B;  1SYD A;  2A69 C;  2UUA L;  5E4X A;  1XWE A;  1GD7 A;  2KCT A;  1E2W A;  1KNA A;  2LFN A;  4YHH L;  4QQB X;  3K0Y A;  4YWK A;  4YY3 Q;  2AQ3 B;  1TWF B;  2I0Q A;  4DV5 L;  1XPU A;  3AYH B;  2PMZ E;  2HDM A;  1UE1 A;  2UXD Q;  2K6A A;  1Y14 B;  3STB D;  2VUM G;  4RFB A;  2N8N A;  4WJW A;  5I6W A;  5I4D A;  1YI2 A;  3K5N A;  1P8L A;  5IGG A;  2A6H D;  3K6O A;  5M3F B;  1DCZ A;  2MP1 A;  3VDY A;  4KN7 C;  3RLF A;  2E2I H;  2Z8L A;  1JR0 D;  1HZB A;  1E22 A;  3I4L A;  1MIU A;  3L9A X;  1Q7Y C;  4X3K A;  2B2Y A;  5D14 A;  1H9K A;  3H0G B;  3BDL A;  1EWI A;  1SNP A;  3SR1 A;  5M5Y H;  4GLX A;  3K81 C;  5C4X B;  2HIV A;  3KF8 A;  2ALY B;  4UAI A;  2KEC A;  3J81 i;  1I6H H;  4BY7 H;  1M4V A;  4GN5 A;  4CKB A;  1HR0 W;  4GKK L;  2R3Z A;  3Q8D A;  1YNX A;  1PH7 A;  3S16 H;  3TS2 A;  3IFD A;  4KI0 A;  1KTK A;  4IOC A;  5IP9 H;  2K50 A;  1EIY B;  4LF8 Q;  3NEN A;  4DGZ A;  2Z6K C;  2PNR C;  2JXM B;  1B8A A;  3EN2 A;  3I4M B;  4V0B A;  1I3Q H;  3HOX B;  1JWM D;  1LO5 D;  1I4R A;  3K57 A;  1PRT D;  1PZK D;  4Z9C B;  3NBH A;  4ILW A;  3UDX A;  1FD7 D;  4HSV A;  3PUY A;  2RBM A;  1T5X D;  1SYE A;  1JOO A;  5J3B A;  3HOV B;  4HJA A;  3CC4 A;  4UPA A;  1JIC A;  4DV5 Q;  3HOU G;  5LL6 S;  4AIM A;  3JAM E;  4JVZ A;  4M8A A;  2XN9 C;  2V4D A;  1SNO A;  2F0K A;  2K33 A;  2K7V A;  1PFS A;  3PUW A;  4DV0 Q;  1E7Z A;  1VDZ A;  2UUA Q;  1O7I A;  4HJ5 A;  2Q2I A;  2F0D A;  1JQY D;  3NSW A;  2NVQ B;  5M3F G;  3MXP A;  2XSC A;  3IFT A;  5EPK A;  5M5W B;  1PFN A;  1W6K A;  2L0C A;  5GAE C;  1X3G A;  1D5Z C;  3ZYY X;  4DPG A;  1KXL A;  1YJ9 A;  3C46 A;  2NTS A;  2KEE A;  4P72 A;  4TQU S;  1RDP D;  2C5C A;  3Q22 A;  4HID A;  2B39 A;  3LGJ A;  4NXM Q;  1YEZ A;  5GAG C;  5HGT A;  2A8V A;  4LWC A;  3NHH A;  3PO2 H;  1A15 A;  3JAM L;  1JMC A;  2NVT B;  2XWB B;  2F0M A;  3G48 A;  2JSO A;  3CP0 A;  4A93 B;  5K36 H;  1IW7 C;  3RZD B;  3NPP A;  2PNH A;  2EDG A;  2X69 A;  4IAL A;  3M7G A;  2OCE A;  1GUN A;  4JI6 L;  1RD9 D;  4YCU A;  3MC0 B;  5I2X A;  1FR3 A;  4RH6 A;  2VW9 A;  1AN8 A;  1FNW A;  4U67 3;  4UY8 C;  5FO9 B;  2OTJ A;  1AP0 A;  1HXY D;  1WTQ A;  4AYB E;  1EQQ A;  1SNQ A;  4P74 A;  1KNE A;  5DM6 3;  3CAM A;  3J81 j;  4DK3 C;  5EKI A;  4N9P A;  1AZQ A;  1G51 A;  1EOV A;  5E4W C;  3D6C A;  3WOE A;  3A8J E;  2X6G A;  3VA7 A;  2B63 H;  1UE5 A;  3PGZ A;  5C0X G;  4IQZ A;  1EY5 A;  2F03 A;  3DUZ A;  4LW1 A;  3VR6 A;  3Q24 A;  2QA4 A;  3E9H A;  5FLX c;  5FO7 B;  3T16 A;  4CJ2 C;  2M2L A;  1YHA A;  1Q90 A;  3D4W A;  1F9R A;  2MJ8 A;  3ERQ A;  3HG9 A;  3KF6 A;  4J15 A;  1L1O C;  1Q8I A;  5C4X H;  3OYY A;  2R7Z B;  1I5F A;  3DEO A;  4G7O C;  1PRT C;  3I4M G;  4NW2 A;  3ULJ A;  2ICE C;  4OWW B;  1HCZ A;  4IJL A;  4DF7 A;  2LSS A;  4K5V A;  3BZK A;  3A54 A;  2KHJ A;  4JK1 C;  1STN A;  1EY9 A;  5KGU A;  2SNS A;  1YHQ A;  1SFO B;  1IYU A;  1EFW A;  3M4Y A;  3U58 A;  3S1N H;  4DV7 L;  4F8M A;  1RF2 D;  1L2F A;  3D31 A;  4FXG C;  1LT5 D;  3J7Z C;  4DUZ Q;  3BDC A;  3KJP A;  1VQ4 A;  1LTI D;  5C6A A;  1VQA A;  4JBW A;  1KIX A;  3IAY A;  1J5E Q;  2OTL A;  1CKN A;  2NYZ D;  3KYH C;  3RR5 A;  2NZO A;  5IYB G;  2I07 B;  2PYK A;  1DM0 B;  1J9O A;  2MUY A;  4K8I A;  2CW0 D;  3GTM B;  4GLA C;  2I5L X;  1AW7 A;  4OON A;  4DU9 A;  5AJ3 L;  3K0X A;  1G2T A;  4J1M A;  5ELF A;  1PRT F;  2DNC A;  4DFA A;  1CKO A;  4L63 B;  4X3T A;  3MVV A;  4DK6 C;  1EL0 A;  4DR6 Q;  5C0X H;  3F1Z A;  3CCR A;  3PUX A;  3CPF A;  1UEA B;  5D3D A;  1CHQ D;  3CQZ B;  4IUV A;  4LF5 L;  4DUY L;  3HOX G;  2DGY A;  3W1G A;  3KUP A;  4JI5 Q;  2GVA A;  4ID6 A;  1PDQ A;  2KCM A;  1YNN D;  2H4O A;  1I6H B;  3L3O C;  4OO1 H;  3N6R A;  3D8G A;  5JVH 3;  1NR2 A;  1QCB D;  2NVY H;  1R4P B;  1MD2 D;  4DV6 L;  4KD3 A;  5LMN L;  1ENF A;  3W1B A;  2ZJP A;  4A3B B;  3KF8 B;  4HJ7 A;  1U4R A;  1PH5 A;  3K5O A;  1HNX L;  2R92 G;  5CR3 A;  2PQE A;  2C9O A;  4UHV A;  1Q82 C;  3MEF A;  3CCE A;  1CA5 A;  2CWP A;  3FVQ A;  2EYH A;  5M5W H;  1SYG A;  1QZH A;  4IUP A;  3DMU A;  4HMI A;  4C1N K;  3S14 H;  1HPC A;  1WD1 A;  2MO0 A;  2Y0S E;  1K3R A;  1DYQ A;  4LUO A;  4LF4 L;  3DXJ C;  4B08 A;  3MAQ A;  4C3H G;  4FO2 A;  1XYI A;  1JB3 A;  3MXN A;  1ROD A;  2F4V Q;  1PA6 A;  1OXT A;  1IYV A;  4DN4 M;  5KRU A;  1S3O A;  3PUV A;  1GHK A;  4JI7 L;  1EYA A;  4L5S A;  2LMC B;  4A3E B;  1TS2 A;  5EAY A;  3OOC A;  2DY7 A;  1WTO A;  2JA8 H;  1LTT D;  2YYZ A;  4DV2 Q;  4JI4 Q;  1LT6 D;  3LWU A;  2HIX A;  5I2Y A;  1IBL Q;  2L5T A;  1SN8 A;  3TS0 A;  1KLU D;  1TS4 A;  3FP9 A;  5JJI A;  3J7A 5;  5KYI A;  1D2B A;  4DV6 Q;  1OXX K;  3I72 A;  2SOB A;  1VQD A;  1TWG H;  4H02 A;  3EVQ A;  5GAH C;  3OHX C;  2OWO A;  1W6J A;  3MXN B;  4WFN 3;  3PMF A;  4IPC A;  1QUQ B;  1ENC A;  1O78 A;  4KTA A;  3PF5 A;  1TY2 A;  4MTN A;  5M3M H;  4R8N A;  3VR4 A;  3U9S A;  1LAB A;  1V9P A;  5CV7 A;  1Y1W H;  4X66 Q;  4R9W A;  1DGS A;  3QOJ A;  2Q8R E;  4JI0 Q;  2FMM A;  2RDF A;  2UU9 L;  4OL7 A;  4IUU A;  1TR5 A;  3GTL B;  3M4P A;  4K5X A;  2VUM H;  3O13 A;  4JI8 L;  2AHO B;  3RUZ A;  3CCQ A;  1KL9 A;  1L0W A;  1K9M C;  1ZYR C;  3BJU A;  1F2Z A;  3OTO L;  3I8Z A;  4GKJ Q;  4XT1 B;  2L11 A;  1BKB A;  5T1I A;  4JBM A;  4ZUJ A;  1QUQ A;  4CDE C;  1ZKO A;  4EX5 A;  4TVA B;  3VYS A;  3S15 H;  4A3B G;  5IT9 L;  2NVT H;  1SYF A;  3TDQ A;  4A3F G;  3M4Q A;  2K52 A;  1GUG A;  3F8T A;  4UP7 A;  5JVG 3;  1LUZ A;  2K5N A;  3ND9 A;  1QB5 D;  2D5D A;  4XQQ A;  5HY6 A;  2L4N A;  3CC2 A;  2EJF C;  3AEV A;  2PQA B;  1K3B C;  3J81 L;  1XJV A;  4QIW B;  4U68 A;  1FNV A;  4KMU C;  1D6E C;  1ET6 A;  5GQO A;  2Q8T A;  4OXP A;  3KLW A;  1VF7 A;  4JOI C;  2QDL A;  5NUC A;  1X56 A;  1JOK A;  3S9W A;  3KLS A;  4NPS A;  1A3U A;  1X6O A;  1EYC A;  3CRK C;  2MQH A;  1SRU A;  4CKC A;  4IPH A;  4NDX A;  4XYQ A;  3SXH A;  3K7U C;  4JV5 L;  1CSP A;  3PSI A;  2F0S A;  2N49 A;  3DEP A;  1KQS A;  3PO3 H;  4A3M H;  4RGO S;  2ZJQ A;  4LF4 Q;  2R6G A;  2WII B;  2OT2 A;  1K8G A;  4JI2 Q;  1JJC B;  4O1N A;  2IY5 B;  2B8F A;  2YU9 H;  1LAC A;  1PTO B;  4QCL A;  3CW2 C;  1OTC A;  3CF5 A;  3QOL A;  3H3V H;  3TSS A;  1PH6 A;  2HHH L;  3VYU A;  2QDB A;  4A3G H;  2P5Z X;  2IHE A;  4R4T A;  4IFD H;  1SYC A;  3I2Z A;  4LFB L;  4ALP A;  2XVS A;  2RVL A;  3JAM i;  4DR7 L;  1DD2 A;  5CV4 A;  1MJC A;  5IGF A;  4DAY A;  4IUR A;  1ILQ A;  4IUT A;  5C44 G;  1QVC A;  1CKM A;  3E3X A;  3I4N G;  1JE4 A;  1PTO F;  4R8I A;  4DR3 Q;  3Q6S A;  2YV5 A;  1PVO A;  4QUC A;  2ZXO A;  1HTP A;  3NK9 A;  1RIP A;  1TWH H;  3NQT A;  5T1G A;  2EQS A;  3S1N B;  2E76 C;  1EYD A;  5JAV A;  4HIO A;  4A3F B;  4LUV A;  3JAM c;  2LXK A;  1N32 L;  1Q12 A;  3E5S A;  5ISR A;  4XQN A;  2RCN A;  3GTL H;  1EIF A;  3C2P A;  4H0L C;  1ICF B;  5KNC A;  5EJW A;  1JOR A;  2RSO A;  4DK1 A;  2IL8 A;  3A7L A;  5IWA Q;  4A3D B;  3WWV A;  1BCP F;  1DJR D;  4C3I H;  3T1Y L;  1HNX Q;  1GUW A;  4BY1 G;  3UDI A;  3M4O H;  5C4H A;  2G9H D;  3WOF A;  4UP9 A;  2IHF A;  4JI3 Q;  3RNU A;  3NWT A;  1ILP A;  3WDN A;  5IIF A;  2O5J C;  3D4R A;  2JA5 H;  5KND A;  4JYA L;  4DR2 Q;  4X3U A;  1H9S A;  4MN3 A;  3S17 B;  4KY7 A;  3RLO A;  3ULL A;  1Y1W B;  4NMZ A;  2CQA A;  3KBX A;  3I55 A;  1NMF A;  4BBS H;  3T51 B;  4YIJ A;  1T9H A;  4JG2 A;  4FNF A;  1STE A;  4JPB W;  5IWA L;  1WOC A;  2CHB D;  4LAA A;  4A3M G;  5L37 A;  1N36 Q;  3MHB A;  3PO3 G;  4K14 A;  1VQL A;  1SND A;  1T5E A;  2SDF A;  2F0J A;  1SMY C;  4DNR B;  4DR1 L;  2G9D A;  1XPO A;  1E2V A;  4OWX B;  2ZXR A;  4AQY L;  3L0O A;  4PV1 C;  4BBR H;  3CCJ A;  4JI1 L;  5CV5 A;  1WVL A;  1TII D;  3HRZ C;  4LFA Q;  2B2T C;  5C0X J;  3W5O A;  4GKK Q;  4A3D H;  4X64 L;  2YU9 B;  3DHQ A;  3TP6 A;  3K5M A;  4POF A;  4LK1 C;  4FP5 D;  3GTP H;  2AQ1 B;  3NQI A;  3PQI A;  4R4I A;  5IP7 H;  2ES2 A;  2JA5 B;  4C56 C;  2E2J H;  5JEA J;  2V1C C;  5C3E B;  3K58 A;  1I94 Q;  2CWA A;  4ZRZ A;  5M3M B;  1GM5 A;  4DV3 Q;  3G7L A;  3HOU B;  2B2V C;  1BO0 A;  1WTV A;  4OGQ C;  3HOY B;  1Q86 C;  2GA4 B;  4WOR A;  4IUN A;  4LF7 Q;  3J80 c;  3RZO B;  4C2M B;  1K83 B;  4B3R L;  5FLX E;  1VQB A;  5IYD H;  5EQ0 A;  3HP3 A;  2UXD L;  5FOB B;  1MBY A;  1PXU A;  1KLG D;  1QOH A;  3ND8 A;  1IL8 A;  3TEH B;  1W2B A;  2PQA A;  4TKO B;  2F0F A;  1TU2 B;  1KRT A;  4ZQ3 A;  2YTX A;  3K7A B;  5LMU L;  1PMR A;  3OW7 A;  4E6I A;  2K32 A;  5M9O A;  3E0E A;  5JJL A;  5EPL A;  3J81 c;  4QY7 A;  4MIU A;  2EVB A;  1BUV T;  1I4P A;  2Z1C A;  4HTH A;  3SVM A;  2KHS A;  3GTG B;  1WTR A;  4K6D A;  2RQX A;  1E1O A;  1U5K A;  2O5I C;  4KKT A;  4XTC S;  4OEL B;  2QEJ C;  1X3E A;  4XDX A;  3NTI A;  1NAP A;  5IYB H;  5J22 A;  1WYD A;  2K75 A;  1IKM A;  1R9T H;  1EZ6 A;  4AYB B;  3FKI G;  2MFI A;  4YWM A;  4QUF A;  3J81 E;  2Z4H A;  4JI8 Q;  2ID0 A;  3CQZ H;  1Z47 A;  4EVO A;  4F87 A;  2HT1 A;  4DR5 L;  2VS1 A;  2NVQ H;  2ZTE A;  2K5V A;  5LL6 X;  5FJ8 G;  4DR4 L;  2CQO A;  3BVG A;  2BE5 D;  3I73 A;  2OQ0 A;  1SRO A;  1TWA H;  4HCS A;  2KOL A;  5E7N A;  3GTK B;  4A3C H;  4KJO A;  4OWT B;  1I6V C;  5C3X A;  1SR3 A;  5M5X H;  4X3S A;  2LY7 A;  3FEW X;  4K6L A;  4CDD C;  1LV9 A;  4B3T L;  2R92 H;  4GZY C;  5ELN A;  3FPP A;  5C3W A;  1CSQ A;  1A2U A;  1LTL A;  1BVS A;  2FXQ A;  1QNU A;  1IZ6 A;  3CCS A;  4V19 0;  2D9U A;  4EQP A;  3BS1 A;  2MHV A;  5GRO A;  1FGU A;  4PMW A;  4MTK A;  1BOS A;  2AUJ D;  2I5H A;  4C3H H;  1CKN B;  1RL2 A;  3S17 H;  1CQF A;  4LMQ D;  4ZYS A;  1I50 H;  3KLR A;  2RHS B;  1SE8 A;  1NTG A;  2D2C C;  3KK7 A;  4KKS A;  4JI1 Q;  1NJI C;  3RLN A;  3F2D A;  3Q0A A;  2Y0S B;  2L1B A;  4BY7 B;  3M9B A;  3A56 A;  2F0Q A;  4QMG A;  1ENA A;  1I4G A;  3CME A;  1AZP A;  3SK4 A;  5CV9 A;  3RN2 A;  1STG A;  2EYO A;  3A74 A;  4A4I A;  1XX8 A;  3TZD A;  4RCN A;  1KAW A;  4JW0 A;  1VQP A;  1VS0 A;  4MNO A;  3MA2 B;  3EIV A;  1IYJ B;  1VQF A;  3FMC A;  1ET9 A;  1VQE A;  3MXU A;  4A3K B;  4EQN A;  4G7H C;  4GNX A;  1U9R A;  1RCV D;  2EY2 A;  3MFY A;  1WTX A;  1O7Z A;  1P16 A;  4C2M H;  4RGN A;  1RTO A;  2EJG C;  2MPM A;  1VQ8 A;  2BCO A;  4GOP B;  3HGB A;  4B3M L;  1BNZ A;  3S2D H;  4LF6 L;  4LFC Q;  1ZXT A;  3K59 A;  1V43 A;  4DUY Q;  4ZKB B;  4JOI A;  1GO3 E;  2WAQ B;  4HJ8 A;  1UE7 A;  1K28 A;  3PO3 B;  1ASZ A;  4NXN L;  2IX0 A;  3MTS A;  5HUR A;  4DAV A;  1PTO H;  4KK7 A;  5FK9 C;  4BXX H;  1NSN S;  1DZ1 A;  1G8Z D;  4Y7N H;  2N55 A;  2EYM A;  3AFP A;  4HAE A;  3OIP A;  3KF6 B;  2J4X A;  4OHJ A;  1S4Z A;  2R93 H;  1F9S A;  4GNX C;  1MGS A;  5A2Q E;  2Q2H A;  3GTM H;  4A3L H;  1NCV A;  1CZW A;  2UUB Q;  4B3S L;  4DR4 Q;  2C35 B;  1Y1V B;  2YTY A;  1GUT A;  4PMB A;  5C5M A;  3ER0 A;  5C5L A;  4CDC C;  3A8I E;  2A5H A;  3V96 A;  2JA7 B;  1S5E D;  2JE6 I;  2ZTC A;  4A3I H;  2VQF Q;  4A3J G;  2NN6 H;  2B29 A;  1YNJ D;  4G57 A;  4BA2 I;  1ONL A;  3G4S A;  2CH4 A;  2M9V A;  4X66 L;  2A68 D;  4DR3 L;  1C0A A;  1ESF A;  3S16 B;  5K36 G;  3S2H H;  3ICE A;  1SE2 A;  4IUQ A;  2MO1 A;  3H15 A;  2XGT A;  1TWA B;  2TSS A;  1V1O A;  2NZ1 D;  4HCE A;  3A7A B;  4BA1 I;  3E6Z X;  3S1M H;  5LHY 1;  2EIF A;  4KKU A;  4DXG A;  1B4O A;  1YBY A;  3PO2 G;  2WB1 G;  1K8M A;  3NBH B;  1O7Y A;  3BDO A;  4OIK A;  1JCK B;  2N78 A;  3H0G G;  4A75 A;  1GXD C;  2EYL A;  4ZAI A;  5C44 H;  1X54 A;  4PZ7 A;  4FF1 A;  5IY0 A;  1BXT A;  3E9I A;  1FL0 A;  2EY5 A;  2PW5 A;  4ZK9 B;  2H5X A;  3EA6 A;  2K28 A;  1KD1 C;  1CHP D;  2EYJ A;  1VQ5 A;  3CRL C;  2PZW A;  1I50 B;  1YJW A;  1EQT A;  2FJ2 A;  1M1K C;  2AUK A;  2B2U A;  3STB C;  4IJH A;  4RAU C;  1B70 B;  1PH9 A;  4OX9 L;  1YNJ C;  1I4H A;  1SFO H;  1WD0 A;  1MJE A;  4JI6 Q;  3FHW A;  1XNQ L;  1TXY A;  2I5M X;  4LFA L;  2EZV A;  1JJ2 A;  1Q3L A;  1SLJ A;  2ZTD A;  2HCC A;  2BH2 A;  4HJ9 A;  5FKA C;  1S5B D;  1PTO C;  5EBD A;  1NMG A;  1SJE D;  4DV3 L;  4A3K G;  2Q8I B;  2JA6 G;  3U9O A;  5M5X B;  2R7Z G;  3I7F A;  5KIX A;  5M3F H;  5JJZ A;  1IW7 D;  1EY8 A;  2EPB A;  1MSG A;  3NTH A;  1B50 A;  2A6E D;  4YCV A;  4BY1 H;  2MGS A;  2AQ2 B;  1M8A A;  2RDG A;  2K14 A;  1A3T A;  3URY A;  3T56 B;  1LTR D;  1WJJ A;  1O80 A;  4BY7 G;  1WTH A;  4LUZ A;  1CFM A;  2IPK D;  4CJ1 B;  4X64 Q;  5DM7 3;  3RZD H;  5KEE A;  4ME3 A;  2R93 G;  5H1S E;  4JI5 L;  4IFD J;  1PH1 A;  3R8B A;  5LMU Q;  2PMZ B;  1EYG A;  5D3I B;  3T1Y Q;  3NXW A;  1E1T A;  1HA6 A;  2E74 C;  3M3Y B;  1EY6 A;  3PIO 3;  3GTK H;  4AQY Q;  1EUJ A;  1JWU D;  3G71 A;  5CBE E;  3H94 A;  4FXK C;  3B6Y A;  4KY5 A;  1SMY D;  1FJG Q;  2NN6 G;  4Y7N B;  3M85 A;  1G29 1;  1STB A;  2AWN A;  4PG3 A;  4BS9 A;  4LF9 Q;  4JBJ A;  1K8O A;  3NUC A;  5IP9 G;  1J8I A;  4B3M Q;  2QW7 A;  1TS3 A;  1YIT A;  1H9R A;  1X9N A;  3J7A F;  4EQ5 A;  1HFG A;  2O2L D;  1QNK A;  3P20 A;  1E2Z A;  5E1F A;  4IFD G;  3ERO A;  4JI3 L;  4G7Z C;  1HFN A;  3HOW H;  5KNB A;  1EY0 A;  1S5D D;  4XT3 B;  4R4C A;  5CGK A;  2VB2 X;  3V05 A;  2B2V A;  4ABN A;  1HUM A;  2ATW A;  3GD7 A;  5C44 B;  1CZG A;  4IZ8 A;  3CKI B;  4C1N I;  1BCP B;  4CHT B;  4JCV E;  1NBW A;  2ZT9 C;  1NNX A;  2NN6 I;  1WCM H;  2WB1 E;  1VQM A;  5BN4 A;  1AEX A;  5LMN Q;  2A73 B; 
#chains in the Genus database with same CATH homology
 4JW0 A;  4JVZ A;  2QW7 A;  2RCF A;  4I7A A;  5L37 A;  2HD3 A;  2Z9H A;  4N8X 1;  4N8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...