4JVZA

Structure of thermosynechococcus elongatus ccml
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
94
structure length
92
Chain Sequence
b'MKIARVCGTVTSTQKEDTLTGVKFLVLQYLGGEFLPDYEVAADTVGAGQDEWVLVSRGSAARHIINGTDKPIDAAVVAIIDTVSRDNYLLYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein
molecule tags Structural protein
source organism Thermosynechococcus elongatus
publication title Two new high-resolution crystal structures of carboxysome pentamer proteins reveal high structural conservation of CcmL orthologs among distantly related cyanobacterial species.
pubmed doi rcsb
total genus 11
structure length 92
sequence length 94
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4jvzA00
4JW0A 5L37A 2RCFA 4N8X1 2HD3A 2Z9HA 4JVZA 4N8FA 4I7AA 2QW7A
chains in the Genus database with same CATH superfamily
3GTQB 2PI2E 1Q90A 1ENFA 5C3XA 3NENA 1GHKA 1BF4A 1YNXA 1UE1A 4DFAA 5IP9H 2KCMA 1JE4A 2WFWA 2OF1A 3STBC 1MIUA 2A6HC 1W6JA 4A75A 2DJFC 5C5LA 4X66L 1OXXK 2H4OA 2ZTCA 4MHEA 5M5YH 2PI2A 3L2PA 1VF5C 5GAGC 2OWOA 4RGTA 4H0LC 3C1EA 5C0XJ 4BA2I 1BBWA 5C3WA 1I4XA 1JWSD 1I6HH 4LJZC 1WTPA 5K5PA 2SEBD 3E6ZX 2NB0A 1I4HA 1B9NA 4GKKL 3CPWA 3BZKA 1UAPA 2BE5C 2UUBQ 4CBVA 3SVMA 3BZDB 4DR2L 2VNUD 1SBBB 5IGEA 5E4XA 1V8QA 4Y7NH 3RN2A 4XXEA 3VYUA 2IHFA 3UI2A 3S1QB 1CTMA 1LT6D 2IHEA 4BY7H 1M4VA 1YBYA 3PIPA 2F0UA 4DNIA 3NTIA 4DV5Q 4LF8L 2Y0SB 2X69A 1JB7A 4IJLA 3BYYB 1A2TA 5EQ0A 1CT1D 3G48A 1EY0A 5IGBA 1SFOH 2QILA 3MEFA 2B2WC 1WJJA 1LYLA 4ZUJA 2I5HA 1IL2A 3A8IE 4DKAC 2K1BA 2IPKD 4Y7NB 3F2BA 1BQQT 3R8BA 3PIP3 3K0YA 1BNZA 2E2JH 5C44B 2PNRC 4CDDC 3ERSX 3M85A 3E9HA 1KD1C 1QZGA 2RA4A 3J81j 2QF7A 1GM5A 4DV7Q 4MZ9A 1DJRD 1YEZA 2AKWB 3HOZG 3BVZA 3OIQA 3J7A5 3U9SA 2K5NA 2F4VQ 1VS0A 3ONAB 4GNXB 1SNOA 2IY5B 1ZYRC 2F0KA 3PIOA 1PH7A 2K5VA 1HH2P 2M2LA 3QIAA 1WCMH 4G4KA 1JMCA 4CDCC 1O7IA 3CAMA 4C1NI 1HFNA 1HZBA 3RZDH 3M3YB 2VS1A 1SEBD 4A4IA 5KYLA 3MTSA 1X3GA 2CQAA 1TWFH 4FF2A 2Z8LA 4APVA 3PO2B 1QUQA 5J3BA 1PTOC 2RDFA 5HGTA 3PO3H 4WRDA 4OWXB 4RGNA 3P75A 5IP7H 4YY3L 3WOEA 2EYFA 1EUJA 3WDNA 4GZYC 4LF9Q 3RN5A 1RJTA 1WCMB 3VR4A 4CJ2C 1CKNB 2RHQB 1TKWB 4X62L 5AFWA 2DGYA 4E6IA 1KRSA 1S3OA 1X6OA 1PRTB 1EQTA 1G2SA 3W2DA 1PFNA 1TS2A 2BH2A 3DWAA 2KECA 3HOVB 1C8CA 1N34Q 4A3DG 2NTTA 3Q24A 4C1NK 1I6VC 4BA1I 3NQTA 4DV4Q 4FVMA 3PO3B 2DJGC 5HY6A 4KKSA 5IODA 1A15A 3PUXA 4FNFA 4JI7Q 2LXJA 1EWHA 4DU9A 2E5LQ 3T13A 2EXDA 1A63A 4K5WA 4XQJA 1BBUA 1KLUD 5EAYA 3CCSA 1U4RA 3PV0A 1M1KC 2R7DA 3TS2A 4HEDA 1J5EL 2ID0A 3SK5A 2JA5G 1QOHA 4A3KB 4KY7A 3HEJA 1ASYA 1UUPA 1LLRD 2PW5A 3TZUA 1A2UA 2F52A 1PRTD 2EY1A 2WAQB 3NTKA 2QDLA 1OXTA 4K8JA 3GTQH 1GUTA 4JOIC 3NK9A 3ER0A 5IGCA 2MJ8A 4MTNA 4JK1C 2JA5B 1KIXA 2ICIA 2PMZB 2FXQA 4DR2Q 1DCZA 1NMGA 1VCIA 1BDOA 1TR5A 4QY7A 3ND9A 5C5MA 2B2VA 3PGZA 5EJWA 4UP7A 2JA7G 3K6OA 4DV2L 5C4XG 4DK1A 2NUCA 2XIWA 3T4AC 4DV7L 2HIVA 4KKTA 2HDMA 5M5WB 5C4JB 1U5KA 4IFDG 3ULLA 4R4QA 2VXWA 2B8GA 3UDFA 2K01A 5KIXA 3D8GA 4LFAQ 4AIMA 2UUAL 3HOXB 1PH6A 2B63H 1B3QA 3M4QA 4OL7A 2VB2X 4JBWA 4JYAQ 1JOQA 4DV3Q 2A19A 2NYZD 2TMPA 3T56B 1PA6A 1GD7A 1T5EA 2K05A 4YWLA 1II3A 1JOOA 4JI8Q 1X3FA 4R4OA 3F8TA 1WTOA 3K5MA 5GAEC 3K7UC 3QJYA 3QOLA 1Y1WH 2XRQD 3H6MA 5E7NA 2R3ZA 3UDIA 1F9RA 4DR1Q 1EY9A 2ZJPA 5A2QE 4ILWA 3H0GH 4R4TA 4LF4Q 1IYVA 1VQ7A 3RLNA 1LT3D 2A68D 3DLLA 3OIPA 3F2UA 2R7ZH 2L0CA 1VQLA 2JN4A 1UE7A 2QA4A 2LKVA 1K83H 1Y1VH 2MPMA 1CUKA 1HUNA 2XGTA 2RQXA 1PZKD 4DR4L 5FJ8H 3EBEA 2F0DA 1A3VA 1UWVA 3K8AA 3H0GG 4JBKA 1AFPA 3NPPA 2C35B 4UDUC 1WTWA 1MKHA 4UY8C 2WP8J 3STBD 4BS9A 3Q6SA 1Y1WG 1S40A 1HA6A 2RDGA 1L1OC 3JAMi 3MWYW 1JWUD 3JAME 2DNEA 1S5BD 1XWEA 3AYHB 3S17H 1A6XA 1PFBA 3J7YW 1KDCA 2B3GA 1UE6A 1EZ8A 3Q22A 1XYIA 2UXCQ 1MI2A 2SDFA 3G6JB 1EY7A 1X9NA 2JA9A 5LL6S 3T1YQ 5C4XH 1VQ9A 4K0KQ 4DR6L 1FJGL 1GHJA 2V1CC 2Q8RE 4FF1A 1CM9A 1TIID 4OO1G 1Z9FA 2E74C 1B8AA 3MXNA 2L5TA 4K0KL 4JI5L 1I4PA 3S2HB 3KF6A 5IWAL 2MP1A 4IUNA 1I50H 2CHBD 2J4XA 2EOTA 1QNUA 3MVVA 5M9OA 3HOYH 2WB1G 3CW2C 4P75A 3VYTA 2UU9L 5IY0A 4X65Q 2ZJRA 2EJFC 4AH6A 4R8NA 4XQQA 1KDAA 1QNKA 1BXTA 3S14H 3CD6A 3FHWA 3W3AA 1TWGH 2YU9H 3PO2H 1LTLA 3MXUA 2F4VL 1KAWA 1TY0A 4A3MG 1ZYRD 3EJIA 5G3LD 3I4MB 4YHHL 5JJZA 1LTTD 1ILQA 2UXDQ 3HOWG 4IN3A 1XPRA 4JG2A 4A3DH 4L5RC 3Q8DA 1XPUA 4YWKA 2JYOA 4JI3Q 2QDBA 3TRZA 3D0FA 1F9QA 1STNA 5EPLA 1TWCB 3HS0C 1XNQQ 5LMNW 1FGUA 3X3NA 3KJPA 4LFCQ 3CU7A 1BCPC 3DUZA 2TSSA 3CC7A 3CRLC 4ODGA 1PH2A 1U0LA 3S2DH 4FF3A 1KHIA 4I7ZC 5BN3A 4DR3Q 5EGTA 4PQXA 3SE0A 2A8VA 1QVFA 2K28A 1PHJA 3I2ZA 4LF7L 5GAHC 1VMPA 1VQAA 4GLXA 1WTVA 3S1NB 3KUPA 3V2TA 1VF7A 2XTIA 2JA8B 1TWCH 2EJGC 1A62A 1SYBA 2EIFA 2KA7A 2PNHA 3T51B 1HR0W 1UNSA 2WKCA 1EQRA 3SK8A 1XMOQ 2DY7A 1MJEA 2O5JC 2F1MA 4UAIA 1D5MC 1HZ9A 3LNNA 5CBEE 2EY6A 1WD1A 4P72A 1TWHH 4FXDA 2E2HB 3K81C 1PTOF 4JI0Q 2K04A 5IE8A 5C4ZA 5ELFA 4GKJQ 2DN8A 2XNAC 3OW2A 2IX1A 1PRTF 3BDLA 2PZUA 4HJAA 4IFDI 1Z47A 4P2CB 2VUMH 1PH3A 2SNSA 3TP8A 4KHZA 1EY6A 2XN9C 3K7AH 1SNDA 1TU2B 2Q2HA 4A3LG 1GO3E 4LAAA 4BBRH 4NPSA 4CKCA 5M5WH 5GADC 1MGSA 3K7AB 2NVXB 1QG7A 2CH4A 5ELEA 2K14A 4DR3L 3B6YA 2F0FA 2JQOA 3IRBA 1BVSA 1F77A 3T16A 1EFID 4A3EH 4IPDA 4JC0A 4ME3A 3CCLA 4RKBA 3HOVH 1SROA 3FEWX 4V190 3CRKC 4C2MH 1KL9A 5C4JH 4DUZQ 1U4MA 2NZ1D 1VQOA 1N36Q 3GTJB 2BDOA 3I7FA 2JE6I 5J1ZA 1N34L 3I3CA 3S17B 2IWHA 1DOLA 4HN7A 4A3GB 2R7FA 2UXDL 1CK1A 2VW9A 4YWMA 1WYDA 1K28A 3ULPA 2IX3A 4AYBG 1LTAD 3HOWB 1X3QA 2MFIA 1VQPA 3S1QH 1X54A 2I5MX 2MHVA 5JEAH 1SMYD 4ULLA 2Z0SA 4K6DA 4QGUA 3OPOA 2YTVA 1L0XB 3MAQA 1E0BA 1JB3A 5K36G 4X65L 2KHJA 4DF7A 2B2UA 4DR4Q 2ICEC 3V96A 1STYA 4J15A 3DEPA 4FXGC 1EOVA 1CKMA 4KI0A 1Q3LA 1U4PA 2A68C 1V1QA 2MGSA 4OEMB 3GD7A 2IL8A 5JJKA 3HP3A 5I2XA 5A2QL 2PZTA 3NHHA 3PCOB 2ZM6Q 1VQKA 1L1OB 1NTGA 1TWFB 4KHPQ 3I4MH 2Z6BA 2D62A 2RCNA 1NAPA 3LGJA 4HTHA 3CCUA 4PNYA 3A55A 3I73A 1J6QA 5H1SE 3NUCA 2K5QA 1J9OA 1R9TH 4DV4L 2D5DA 1EU4A 3K59A 4LUVA 1RDPD 1PYBA 4IUQA 2AHOB 1HNXL 3D6CA 4RMFA 1H9SA 4Q5VA 1Q1BA 1QUQB 4BBSB 5GQOA 1F9SA 1EWCA 1HRJA 5FK9C 3FKIH 1PH5A 3NXWA 4LMQD 1WCMG 1B7YB 1CZGA 1I5FA 5CYUA 3JAML 1EYDA 3IFDA 3IFTA 2K32A 4DR5Q 4LF9L 3O13A 1PVOA 1EYAA 3IL8A 1K0RA 3U58A 1I50B 1PTOB 1STEA 4IQZA 4YY3Q 2A5HA 5IWAQ 1PV4A 4WJ3M 1AP0A 1QZHA 1UEAB 1Y69U 2Q8TA 4POGA 4B3RL 4P74A 3HFZB 3K80C 5LMNQ 2VY3A 2KEDA 1EIYB 1IKLA 3H91A 2RCFA 2HHHQ 5C4HA 5AJ3L 5LMNL 3FDTA 2VQEQ 2H1EA 1ICFB 1QVCA 5DLQE 2ZXPA 2A6ED 3NE5B 4GS3A 4B9XA 4LFBQ 3T1YL 1K73C 2EQSA 4A3KG 1KLGD 1A3UA 1DOKA 3GV6A 3F1ZA 1B9MA 3DMUA 2NBFA 1PLFA 3SGIA 5DNFA 2B2TA 1LM0A 3KDFA 5ELBA 5EPKA 4HJ9A 2F0VA 2E75C 3R93A 1G2TA 4Y52H 1IBML 2PQAB 3HOVG 2E2IB 1YIJA 4LWCA 4FXKC 4O1NA 2PW7A 3J81i 2L1BA 2UUCL 4KD4A 5JPNC 4XQNA 2K5WA 3D3RA 3KFUA 1JOKA 5LL6X 3E0JA 3OHXC 5FO8B 1E1TA 2B2TC 4DAVA 4DA2A 5KNBA 5C3EH 5IT9L 4G7HC 4Q0FA 4ZCKA 1K0SA 5HURA 4F88A 4QUCA 1NR4A 3WWVA 4WJ4A 1SE8A 5KGUA 3I4LA 5A35A 1HCZA 4DUYL 1MHWC 2RVLA 2WKDA 3CKIB 2IW3A 2HCCA 4JI5Q 4KY5A 5F2DA 2JA8H 4KTAA 4HJ8A 5CORA 2AQ1B 2KHSA 2R92H 1XMQL 1AN8A 4O42A 5E3FA 4DV3L 3BG3A 3PF4A 5C0XG 3J81L 3GTGB 3QG1A 1IW7C 4RG1A 4QCLA 2OQKA 2KCTA 2R92B 2WIIB 4A3BH 2Z1CA 1I4GA 4YCWA 1V1PA 2PQEA 3RUZA 4JYAL 1JE5A 3K5OA 3KF6B 1SE2A 5IT9c 1E2VA 3OTOQ 1E1OA 3PIO3 2XVSA 2L15A 4XT3B 5EBCA 3C3LA 2Q2IA 2G5DA 4MTKA 1LABA 4PG3A 1L0YB 2A6EC 4DV2Q 3OWEB 3AEVA 3TN2A 2EPBA 2PPBC 1CI3M 4OXPA 1STAA 1SE3A 4MN3A 4A3IG 1YITA 4B3TQ 3H3VH 3EN2A 3I4NB 2F3VA 3MXGA 4KN7C 5K36H 2O4XA 1RHPA 3OMGA 1T9HA 2K33A 5FKAC 1Y1WB 1VQCA 3W1BA 1HTPA 1Q82C 3M4OH 3CP0A 2MQHA 2RHSB 3Q23A 1AZPA 1KTKA 1PTOD 1PYWD 1IBKL 1VQDA 3GTMH 2ZTEA 2R93G 1PH8A 4A3CG 2N49A 1DM0B 4V0BA 3VR6A 2EXZA 4GOPC 5M3MH 3UE0A 4F87A 4KN4C 2NN6G 1SMYC 4BY7B 3TREA 4CJ1B 1S5ED 5CV4A 1KABA 2KEEA 5E1FA 3BDCA 4KY6A 4KKUA 4TSSA 3NBIA 1HFGA 2Z6KC 1K3BC 1K3RA 1DZ1A 1R4QB 3OYYA 4DR5L 2YV5A 5D14A 2JA6G 1P16A 5NUCA 5CV6A 2R7ZB 4FYDA 3PUVA 4A3EB 3MA2B 1TWGB 3TSSA 4A3JH 4B3ML 1VDZA 2YU9B 2QKIC 3BDOA 4PV1C 1CFMA 4MNOA 3HOXH 4QMGA 4I65A 2OEOA 4TRDA 2AUKA 1EQQA 1GVPA 2LY7A 3EA6A 1QJOA 2X6GA 5DM73 4OO1H 1X3PA 1K8MA 4IFDJ 4FDBA 3CQZH 2F0EA 1I3QB 1FNWA 2JA7B 2HQLA 1AE2A 4OIJA 5M3MB 3L7ZC 4BBSH 5BR8Q 3GTOB 5BN4A 1SYEA 2CH4W 1O78A 1E7ZA 3VR3A 3A56A 5DEHA 4FF4A 3BVMA 1H9RA 2R61A 4HIOA 3JC66 4YCVA 3L3OC 4BXXH 5DM63 1DONA 4IPHA 5JJLA 4K14A 4R9WA 5D3IB 1LT4D 4H44C 2E8GA 3EFXD 1DGSA 1XJVA 2EY5A 1YJ9A 3S1RB 3HKZB 4C3HG 4JI2L 4XYOA 3E0EA 3J80c 1B3AA 1F2YA 2PYKA 1B1ZA 4A3IB 2G9DA 4L5TA 1OO9B 1NUCA 3MZ5A 1NJIC 4KK7A 1YNNC 3A8JE 4IPGA 5LHY1 2B63B 2CW0C 1D6EC 3J80L 4CHTB 5JVG3 1N9WA 3DM1A 4GN5A 2KVMA 3K57A 1YNJC 5DAUA 4GN4B 3BVGA 5M3FB 1JJCB 2WB1E 2CCZA 3CC2A 3VR5A 2F0OA 1YHAA 4OHJA 4C3JG 5I6WA 3PF5A 4I7AA 3GTGH 4KHPL 1WTXA 4WFN3 4CKEA 1XMQQ 5JPMC 5BN5A 3S9WA 5KNDA 4S3SA 1RTOA 5CV9A 2B63G 3MHBA 1AZQA 4DN4M 1ASZA 4DR7L 1J5EQ 3NWTA 5CC4A 1YJWA 2B2WA 3PUWA 3QOJA 3U4VA 2F0TA 2Z9HA 1FJGQ 1I4RA 1HR0Q 4EX5A 2UUBL 4RHSA 2E2IH 3C2PA 2WAQE 2RSOA 1PTOH 4GLAC 2K50A 2A73B 1NCVA 1HQMC 3PUYA 4G57A 4L5SA 2JEBI 1WTRA 2EYMA 5M5XB 5IT9E 4HCSA 2OCEA 3BYTB 1IBLL 4XT1B 3HG9A 3UE1A 3ULJA 2KCNA 1V9PA 1WFQA 2F4IA 4K2KA 4AQYL 1JQYD 2EE1A 2NVYH 3GDEA 3IAYA 2VB3X 4QJFA 1PFMA 4B08A 1HNWL 1VQIA 4LK1C 5FLMG 4AYBB 4PZ8A 1IW7D 2EYHA 2JA5H 2KUMA 4J8QA 4DV1L 2A1AA 4CDFC 1B70B 1CA5A 4QL5A 3SR1A 5M3MG 4JI2Q 1XPOA 1E24A 1X3EA 1SAPA 3HGBA 2R93H 3DWQA 4N8FA 1HTLD 3AQQA 3BU2A 1WTHA 1TVXA 4NB3A 4LNQA 4NXNQ 1FL0A 3S16B 1ET6A 4C3JH 4DUZL 3R2IA 1TT2A 4C2MB 5IGFA 4K6LA 2XSCA 4XIGS 1EFWA 3P1HA 1W3SA 2E5LL 1I6HB 1B2TA 5L37A 1V1PB 5KRUA 4RGOS 1FYCA 2EDGA 1SSOA 1Y1VG 1AW7A 1HQRD 2UXCL 1ONLA 4JCVE 1I94L 4CGYB 5IYCG 1X56A 1K83B 2E76C 4ZYSA 2SOBA 1MBYA 4C3HH 4EQ5A 3J80i 4OELB 2NTSA 4DV0Q 2EZVA 1MD2D 3PO3G 1IKMA 5LMUL 1N8RC 3WOFA 2CW0D 2JA8G 1Y1VB 3OSOA 1XMOL 2AWNA 2OTLA 1TY2A 1N32Q 1YNND 2FMMA 4LF6L 3QR8A 4A3GH 1BBXC 4ZAIA 3OTOL 4OX9Q 4WORA 3CF5A 1C7YA 1DOMA 2AQ2B 2F0LA 4QF4A 2VUMB 3E5SA 3S15B 3HOXG 1K9MC 4BBSG 1VQHA 1WTQA 2NVYB 4H7BA 1Y8NB 1LUZA 4HSVA 3GTJH 2NVXH 2L11A 1O7LA 3FPUB 1QVGA 1PFSA 5CGKA 4QIWE 1KAAA 1ENCA 1U9RA 3E3XA 3AFPA 1B53A 3HOZH 4LF4L 2CWPA 1QILA 5HGQA 3J81c 4JV5Q 2FFKB 3DWPA 2C5CA 5D65A 3S24A 5I2YA 3LX0A 4RFBA 4B3SQ 5E4WC 3HKZE 2D0OA 1HUMA 4PMCA 5GROA 4EQNA 4X64L 1P8LA 4QIWB 4DNTB 3MXPA 1S4ZA 2CWAA 2BH8A 3NP8A 4CJ0B 2V4DA 4R4CA 3SEBA 2QW7A 1IYJB 5FOBB 1K8OA 3H3VI 2OQ0A 1HPCA 2F0GA 1CQFA 1PMRA 2KBNA 4HJ5A 4YHHQ 2BOSA 3L9AX 5CBAE 3FMCA 1BKBA 1OXVA 3M4PA 4R8IA 2JP1A 3T1HQ 3G4SA 2NN6H 4GN3B 1Q1EA 2WAQG 3BJUA 3RNUA 1TS5A 1STBA 1ZXTA 5C44H 1EIGA 1I94Q 4A3IH 3CMAA 3G71A 2ASBA 2CVRA 1AH9A 4HIKA 4LF8Q 1GUWA 3FVQA 4LF7Q 1NNXA 2D0PA 2PCFB 2IJ0A 1JJ2A 4XDXA 4DR1L 1Q8KA 3Q0AA 4IZ8A 4A3DB 2EYLA 1EWIA 4JBMA 4JI4Q 4LUOA 4OWTB 4JI8L 3TDQA 4P71A 4AYBE 4B3RQ 3J7ZC 3TP5A 4N8X1 5IP7G 3A7AB 4XYQA 4N9TA 4TKOB 1JICA 2A69C 3I56A 4GLVB 4KJNA 5IOCA 2J7ZA 4YIJA 3MFGA 5JOBA 3HOZB 4GKJL 2QGQA 2F0WA 5IP9G 5ELCA 1PDQA 2KHIA 5C0XH 4DV6Q 1BCPB 1H9MA 2K52A 3GTKB 1TWHB 1PRTC 4ZLTF 3JAMc 3F2CA 2VQFQ 4DK3C 2Y0SE 1CHPD 1YHQA 1XTCD 2SNMA 4DK0A 3A5ZB 1QWYA 1W6KA 1DYQA 3GTLB 3RZOH 1N33Q 3S2HH 3SK6A 2O5IC 5C6AA 4DAMA 3TP7A 3M4YA 1Y14B 2PO4A 4L6TB 4C3IG 1G6PA 4X3UA 5C4XB 4IUVA 3R2TA 2E2HH 2P5ZX 1VQ6A 4DNRB 3GP7A 1T5XD 2CFMA 3S1MH 1F2MA 3CCEA 1O7ZA 5FLXE 2GN5A 1H9SB 3VDYA 1EZ6A 1D2BA 4QQBX 2B2UC 4KJOA 4NMZA 2ZM6L 4Z9CB 1KC8C 2R93B 4NP5A 2RF4A 1CKNA 1IXRA 3K5LA 1FNVA 1NE3A 4CDEC 4NXMQ 2UXBQ 1D7QA 4MIUA 1G51A 4LFAL 3C46A 2ENBA 4K5VA 3BZCA 3C1FA 1GUNA 4KV6A 3HZXA 2YTXA 4A3KH 4RGMA 3TMEA 3A0JA 3FRPB 5ELDA 1QCBD 1SYDA 2QEJC 4IJHA 3GQBA 1HJPA 3G7LA 1IBMQ 1E2ZA 1BR9A 4GOPA 1PH9A 1BUVT 2PQAA 3NBHB 4A3EG 4AQYQ 2RKSA 3HOUB 1HZAA 4L5QA 4DV0L 1HNXQ 4OGQC 5EPJA 5CV7A 4ZKCB 5J22A 1B44D 4HMIA 2JJQA 2A74C 2EY2A 4JW0A 1GUSA 3P7JA 5JVH3 3CCQA 4A3LH 5FO7B 2BCOA 3LWUA 3CQZB 1RIPA 2DNCA 3KK7A 1ICWA 1JCKB 1WVLA 3OWFA 1VQEA 1EOTA 4GNXA 4PMWA 1U4LA 4JOIA 1K8GA 3DM3A 4R4IA 2GA4B 2I5LX 3GTLH 2BA1A 1KQSA 2EYPA 4NDXA 1NR2A 4FO2A 2WACA 1GOZA 3TQYA 1PH1A 1CZWA 3HKSA 4RHRA 3NQIA 4HAEA 4H13C 1R4PB 4A3BB 4B9WA 2JSOA 3DHQA 3RLFA 5IGDA 3I72A 3I4MG 2MNAA 2HT1A 1CHQD 4CKBA 1TWAB 4JI0L 1B4OA 3NEMA 4LF6Q 3GO5A 4K2LA 4PZ6A 4HIDA 1CSQA 1Q46A 2F3WA 2ZT9C 3BS1A 1OXUA 2B8FA 2DUDA 5C0XI 4A93B 3OMCA 4L63B 1D1IA 2AUJD 2NZHA 2ZTDA 2ES2A 3S15H 3TEHB 1XTDA 1CA6A 1C48A 2MUYA 4QUFA 4A3MB 5J39A 1Q8IA 1PZJD 1Q81C 5JEAJ 1WD0A 2N78A 2QCPX 3M4OB 1X32A 4XTCS 4X64Q 2HQEA 5M3FH 1FR3A 3KF8B 1VQJA 3ZJYC 1GXDC 4EGVA 4TQUS 5JEAG 3VR2A 4C3JB 1SJHD 2CQOA 1N36L 2FHTA 5I9PA 2I07B 4RA8A 2HHHL 1W2BA 3DXJC 3TZDA 3I4NG 1RL2A 2K75A 4DR7Q 1ILPA 4UHVA 1JJGA 3FKIB 2HDLA 1NY4A 4JI1L 3ZYYX 1FGBD 1SXTA 3AFQA 3QO2A 4GNXC 1EEID 1I3QH 1L2FA 3EIVA 3ITPA 4IURA 1K8AC 4A93H 4JI3L 3U9OA 4A3FG 1XNQL 3N6RA 3NELA 1VQGA 1EYCA 2PZWA 2CKZB 4OO1I 3KLSA 3HRZC 3HOYG 5IYDG 3HOUG 2K4KA 2UUCQ 1A8VA 1HHVA 2JEAI 2F0NA 4DAYB 5JAVA 1HNZL 3TS0A 1EY5A 1M8AA 1QB5D 1O80A 1S5FD 2B2YC 2HCIA 2LS01 5T1GA 2XRSD 3H3VC 3H15A 2N8NA 1IBLQ 2XWBB 1BO0A 3KLWA 4NXML 1VQ5A 3HOYB 5G3LF 4BBRG 5I4DA 1G291 1MSHA 3QB3A 4X3TA 2B29A 4JV5L 2B2YA 1SLJA 5FLXc 4ZKBB 2UU9Q 3RD4A 1EYGA 1SDFA 4A3GG 1S5DD 2VQEL 3S14B 1AE3A 2N3SA 1ML0D 1XX8A 2NVTH 4K5XA 2VUMG 2E2JB 1VQFA 4X3KA 1RTNA 1SNPA 4POFA 1RKNA 3V05A 3KOJA 2J0TD 4F7XA 1Y8PB 4R1JA 1KNAA 1VMCA 2NWGA 2F3IA 4KLKA 4J1MA 2C9OA 2F03A 2K5HA 1RODA 3RLOA 1Z7TA 1E2WA 2F0SA 2M00A 3SDZA 2H5XA 3I91A 1CSPA 5FJ8G 3L0OA 1SMXA 3TP6A 4JBJA 1VQNA 3T1HL 4LF5L 1CKOA 1DXMA 3D4RA 3CPFA 3GV3A 4A76A 3S16H 1XNRQ 3K58A 3U50C 1OTCA 3CCVA 4ZRZA 5C44G 4BWGB 3F2DA 3CCMA 3I4OA 2ALYB 4JPBW 2KCCA 3I8ZA 2Y0SG 1SJED 3KLRA 2RBMA 4ME5A 1A3TA 1SYCA 4KHVA 1H9KA 4RH6A 4IO9A 3PSIA 4EVOA 4H02A 1NMFA 1PXUA 4DAYA 5EBDA 1S72A 3J7AV 3ICEA 4TVAB 4KD3A 1FD7D 3UDGA 5FLXL 3UDXA 3N52A 1WOCA 3HOWH 2BDNA 4NXNL 3TBIB 5FLMH 1V43A 1EQVA 4U68A 4LFCL 3X3MA 2WV6D 2Q8IB 1SNMA 5KNCA 4A3MH 2I0QA 4EQPA 4ZK9B 1XXGA 3PO2G 2KOLA 2LXKA 2VZAA 4BY1H 4OX9L 1F9PA 4F8MA 3AU7A 2OT2A 5CMDA 2YYZA 3DEOA 1D5XC 3U4ZA 5M5XH 1Q86C 4DV6L 2AQ3B 3J80E 4LF5Q 2Q2TA 2LSSA 2WINB 1ZEQX 5ELNA 3A5UA 1D8LA 2BA0A 1OXSC 2FINB 2EYJA 1SNQA 2KJXA 2Z4HA 3CCRA 2ATWA 1MSGA 1PZID 3RMHA 4BBRB 2B39A 1KXLA 2K5DA 3S1NH 5KYIA 2F0MA 4X3SA 3M3YH 4JVZA 4BY1B 2EYOA 4JI4L 5I6YA 4M8AA 3CMEA 2DY8A 4DV5L 2QEXA 3OOCA 1EL0A 1F2LA 4O2DA 3ERQA 3MXNB 1DD2A 3M7GA 3R3OA 3KBXA 2RDHA 4UPAA 3H94A 5IYCH 4X6AH 1D5ZC 1EEFD 4ZQ3A 1GUGA 3SHLA 4DUYQ 1LTGD 4HMJA 1L0WA 3D4WA 3MC0B 5ISRA 2IT1A 2Z4IA 1SE4A 1LTRD 2UUAQ 1XNRL 1LTID 2RSNA 4PZ7A 4WJWA 4DXFA 4B3TL 1TQOA 1C4QA 3VA7A 3H09A 1KDBA 1O7YA 5LMUQ 4B3MQ 5IGGA 2F0QA 2R7ZG 2F0HA 2ZJQA 4JI6Q 3KF8A 3H0GB 4A3JB 4X62Q 2HD3A 1VQ8A 3GTPH 2F0JA 3AB9A 1LACA 5D3DA 4B3SL 1EY4A 3OW7A 4RAUC 1TWAH 2JXMB 2UXBL 2M9VA 3NBHA 1V1OA 2JK8A 4IFDH 5JJIA 4A3JG 4GOPB 2HIXA 2NVQH 1RD9D 1ZKOA 4C3IB 2JA7H 1SR3A 1ESFA 3P20A 1KNEA 1GJXA 1JC7A 4FP5D 2B2VC 2I46A 4BY1G 4HJ7A 3MEHA 3G6EA 4EQOA 2O2LD 3A8KE 5IYDH 4C56C 3NTHA 5EKKA 4LUZA 4RCOA 4JI7L 2FMCA 2AMCB 4K8IA 3QWNA 4GKKQ 4ALPA 1IHZA 5KEEA 1RCVD 4U673 2FJ2A 1HXYD 2NN6I 3E9IA 3RZDB 2PMZE 3HKZG 3D4DA 3S1RH 2LMCB 1GKHA 2L4NA 4A3CH 2L9HA 1LTSD 5IIFA 5EKLA 2NVQB 3PMFA 4IUUA 1JWMD 3ND8A 4RCNA 3A54A 3W1GA 1YJNA 4BY7G 1GUOA 3KJOA 2D9UA 2E2DC 4DK6C 2D2CC 2X6LA 5FO9B 4HSPA 4ID6A 2LFNA 3NSWA 1HA5A 1SYFA 1B50A 3FP9A 4IUPA 5M3FG 3GTOH 5CV5A 1L1OA 1JORA 4M1UB 3VA5A 1SN8A 1C0AA 1LV9A 5AJ3Q 1BOSA 4IALA 3D6WA 2Q2UA 3AMUA 4DGZA 2IX0A 1S5CD 1ENAA 2GVAA 4G7OC 3SK4A 1MJCA 1TXYA 1IBKQ 2KQ3A 3I55A 2NVTB 1I4QA 5BR8L 3IKJA 1R9TB 3K0XA 2EVBA 1YVCA 3A74A 4KMUC 1CQVA 4O0AA 4NKLA 3S1MB 5CR3A 4BXXG 2GVBA 1H95A 4A3BG 5ELOA 1SNCA 4DPGA 2F0IA 5C3EB 4QB4A 1G6ZA 2F0PA 4IUTA 4RWSC 2VQFL 1NSNS 2K03A 2MO0A 1EU3A 1VQMA 3KDFB 2K7VA 4JI6L 2R92G 3J7AF 1HNZQ 3I90A 1TS3A 1HNWQ 1Q7YC 1ET9A 1IYUA 2JA6B 1A0IA 4YCUA 5C3EG 3J81E 3CCJA 1UE5A 1G8ZD 2BE5D 3MFYA 3EVQA 5COYA 1ESRA 1F2ZA 2L55A 1BCPF 1E22A 3M7NA 1IZ6A 3KYHC 4L8JA 1BCPD 4UP9A 1HR0L 3T53B 1M90C 2ZXOA 2XWJB 3VYRA 4C3HB 1STGA 5M5YB 3HOUH 1Z6HA 2N88A 2Z6KA 3GTKH 1D1KA 4N9PA 5EKIA 2R6GA 3W5OA 1YI2A 1STHA 1H9JA 3EROA 4IOAA 5IYBG 4JI1Q 1QE6A 3URYA 2WB1B 2JA6H 2A69D 1HZCA 2N55A 1VQ4A 1YZ6A 2EJMA 4A3FH 4HR7B 3K5NA 4DR6Q 1Y8OB 4ZUIA 2A6HD 1SRUA 2ZXRA 4LW1A 1SYGA 3PUZA 3GTMB 4NW2A 1J8IA 3CC4A 3I70A 4A93G 1PYSB 1JT8A 3KBGA 1FVIA 1X65A 1YNJD 2AWOA 4G7ZC 1N32L 3GTPB 4DV1Q 1N33L 2KENA 1VQBA 3CHBD 4HCEA 5I9OA 3A7LA 1YHBA 5T1IA 4HIMA 1G91A 2G9HD 2HUGA 2NZOA 3I4NH 1WI5A 1EIHA 3NWSA 4IOCA 3CXCA 3LWEA 2L12A 5CV8A 1EY8A 4A3FB 4PMBA 1PH4A 5IYBH 3SXHA 3RZOB 3PQIA 3EQLC 3KLSX 3M9BA 1X55A 3D31A 1KRTA 1IL8A 1LTBD 4DAPA 1JR0D 2VL6A 2OTJA 4P73A 1LT5D 2OXPA 3FKIG 5TSSA 1SFOB 4ABNA 4LFBL 4X66Q 2YTYA 3FPPA 1C9OA 1FNUA 2MO1A 4C3IH 1RF2D 1LO5D 1NBWA 3S2DB 3RR5A 4OONA 4IPCA 4RKLA 1Q12A 1TS4A 1UEBA 4OIKA 4OWWB 4J6HA 2K6AA 1EIFA 1AEXA 1E3PA 4UP8A 4DXGA 3VYSA
chains in the Genus database with same CATH topology
4JW0A 5L37A 2RCFA 4N8X1 2HD3A 2Z9HA 4JVZA 4N8FA 4I7AA 2QW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JW0 A;  5L37 A;  2RCF A;  4N8X 1;  2HD3 A;  2Z9H A;  4JVZ A;  4N8F A;  4I7A A;  2QW7 A; 
#chains in the Genus database with same CATH topology
 3GTQ B;  2PI2 E;  1Q90 A;  1ENF A;  5C3X A;  3NEN A;  1GHK A;  1BF4 A;  1YNX A;  1UE1 A;  4DFA A;  5IP9 H;  2KCM A;  1JE4 A;  2WFW A;  2OF1 A;  3STB C;  1MIU A;  2A6H C;  1W6J A;  4A75 A;  2DJF C;  5C5L A;  4X66 L;  1OXX K;  2H4O A;  2ZTC A;  4MHE A;  5M5Y H;  2PI2 A;  3L2P A;  1VF5 C;  5GAG C;  2OWO A;  4RGT A;  4H0L C;  3C1E A;  5C0X J;  4BA2 I;  1BBW A;  5C3W A;  1I4X A;  1JWS D;  1I6H H;  4LJZ C;  1WTP A;  5K5P A;  2SEB D;  3E6Z X;  2NB0 A;  1I4H A;  1B9N A;  4GKK L;  3CPW A;  3BZK A;  1UAP A;  2BE5 C;  2UUB Q;  4CBV A;  3SVM A;  3BZD B;  4DR2 L;  2VNU D;  1SBB B;  5IGE A;  5E4X A;  1V8Q A;  4Y7N H;  3RN2 A;  4XXE A;  3VYU A;  2IHF A;  3UI2 A;  3S1Q B;  1CTM A;  1LT6 D;  2IHE A;  4BY7 H;  1M4V A;  1YBY A;  3PIP A;  2F0U A;  4DNI A;  3NTI A;  4DV5 Q;  4LF8 L;  2Y0S B;  2X69 A;  1JB7 A;  4IJL A;  3BYY B;  1A2T A;  5EQ0 A;  1CT1 D;  3G48 A;  1EY0 A;  5IGB A;  1SFO H;  2QIL A;  3MEF A;  2B2W C;  1WJJ A;  1LYL A;  4ZUJ A;  2I5H A;  1IL2 A;  3A8I E;  4DKA C;  2K1B A;  2IPK D;  4Y7N B;  3F2B A;  1BQQ T;  3R8B A;  3PIP 3;  3K0Y A;  1BNZ A;  2E2J H;  5C44 B;  2PNR C;  4CDD C;  3ERS X;  3M85 A;  3E9H A;  1KD1 C;  1QZG A;  2RA4 A;  3J81 j;  2QF7 A;  1GM5 A;  4DV7 Q;  4MZ9 A;  1DJR D;  1YEZ A;  2AKW B;  3HOZ G;  3BVZ A;  3OIQ A;  3J7A 5;  3U9S A;  2K5N A;  2F4V Q;  1VS0 A;  3ONA B;  4GNX B;  1SNO A;  2IY5 B;  1ZYR C;  2F0K A;  3PIO A;  1PH7 A;  2K5V A;  1HH2 P;  2M2L A;  3QIA A;  1WCM H;  4G4K A;  1JMC A;  4CDC C;  1O7I A;  3CAM A;  4C1N I;  1HFN A;  1HZB A;  3RZD H;  3M3Y B;  2VS1 A;  1SEB D;  4A4I A;  5KYL A;  3MTS A;  1X3G A;  2CQA A;  1TWF H;  4FF2 A;  2Z8L A;  4APV A;  3PO2 B;  1QUQ A;  5J3B A;  1PTO C;  2RDF A;  5HGT A;  3PO3 H;  4WRD A;  4OWX B;  4RGN A;  3P75 A;  5IP7 H;  4YY3 L;  3WOE A;  2EYF A;  1EUJ A;  3WDN A;  4GZY C;  4LF9 Q;  3RN5 A;  1RJT A;  1WCM B;  3VR4 A;  4CJ2 C;  1CKN B;  2RHQ B;  1TKW B;  4X62 L;  5AFW A;  2DGY A;  4E6I A;  1KRS A;  1S3O A;  1X6O A;  1PRT B;  1EQT A;  1G2S A;  3W2D A;  1PFN A;  1TS2 A;  2BH2 A;  3DWA A;  2KEC A;  3HOV B;  1C8C A;  1N34 Q;  4A3D G;  2NTT A;  3Q24 A;  4C1N K;  1I6V C;  4BA1 I;  3NQT A;  4DV4 Q;  4FVM A;  3PO3 B;  2DJG C;  5HY6 A;  4KKS A;  5IOD A;  1A15 A;  3PUX A;  4FNF A;  4JI7 Q;  2LXJ A;  1EWH A;  4DU9 A;  2E5L Q;  3T13 A;  2EXD A;  1A63 A;  4K5W A;  4XQJ A;  1BBU A;  1KLU D;  5EAY A;  3CCS A;  1U4R A;  3PV0 A;  1M1K C;  2R7D A;  3TS2 A;  4HED A;  1J5E L;  2ID0 A;  3SK5 A;  2JA5 G;  1QOH A;  4A3K B;  4KY7 A;  3HEJ A;  1ASY A;  1UUP A;  1LLR D;  2PW5 A;  3TZU A;  1A2U A;  2F52 A;  1PRT D;  2EY1 A;  2WAQ B;  3NTK A;  2QDL A;  1OXT A;  4K8J A;  3GTQ H;  1GUT A;  4JOI C;  3NK9 A;  3ER0 A;  5IGC A;  2MJ8 A;  4MTN A;  4JK1 C;  2JA5 B;  1KIX A;  2ICI A;  2PMZ B;  2FXQ A;  4DR2 Q;  1DCZ A;  1NMG A;  1VCI A;  1BDO A;  1TR5 A;  4QY7 A;  3ND9 A;  5C5M A;  2B2V A;  3PGZ A;  5EJW A;  4UP7 A;  2JA7 G;  3K6O A;  4DV2 L;  5C4X G;  4DK1 A;  2NUC A;  2XIW A;  3T4A C;  4DV7 L;  2HIV A;  4KKT A;  2HDM A;  5M5W B;  5C4J B;  1U5K A;  4IFD G;  3ULL A;  4R4Q A;  2VXW A;  2B8G A;  3UDF A;  2K01 A;  5KIX A;  3D8G A;  4LFA Q;  4AIM A;  2UUA L;  3HOX B;  1PH6 A;  2B63 H;  1B3Q A;  3M4Q A;  4OL7 A;  2VB2 X;  4JBW A;  4JYA Q;  1JOQ A;  4DV3 Q;  2A19 A;  2NYZ D;  2TMP A;  3T56 B;  1PA6 A;  1GD7 A;  1T5E A;  2K05 A;  4YWL A;  1II3 A;  1JOO A;  4JI8 Q;  1X3F A;  4R4O A;  3F8T A;  1WTO A;  3K5M A;  5GAE C;  3K7U C;  3QJY A;  3QOL A;  1Y1W H;  2XRQ D;  3H6M A;  5E7N A;  2R3Z A;  3UDI A;  1F9R A;  4DR1 Q;  1EY9 A;  2ZJP A;  5A2Q E;  4ILW A;  3H0G H;  4R4T A;  4LF4 Q;  1IYV A;  1VQ7 A;  3RLN A;  1LT3 D;  2A68 D;  3DLL A;  3OIP A;  3F2U A;  2R7Z H;  2L0C A;  1VQL A;  2JN4 A;  1UE7 A;  2QA4 A;  2LKV A;  1K83 H;  1Y1V H;  2MPM A;  1CUK A;  1HUN A;  2XGT A;  2RQX A;  1PZK D;  4DR4 L;  5FJ8 H;  3EBE A;  2F0D A;  1A3V A;  1UWV A;  3K8A A;  3H0G G;  4JBK A;  1AFP A;  3NPP A;  2C35 B;  4UDU C;  1WTW A;  1MKH A;  4UY8 C;  2WP8 J;  3STB D;  4BS9 A;  3Q6S A;  1Y1W G;  1S40 A;  1HA6 A;  2RDG A;  1L1O C;  3JAM i;  3MWY W;  1JWU D;  3JAM E;  2DNE A;  1S5B D;  1XWE A;  3AYH B;  3S17 H;  1A6X A;  1PFB A;  3J7Y W;  1KDC A;  2B3G A;  1UE6 A;  1EZ8 A;  3Q22 A;  1XYI A;  2UXC Q;  1MI2 A;  2SDF A;  3G6J B;  1EY7 A;  1X9N A;  2JA9 A;  5LL6 S;  3T1Y Q;  5C4X H;  1VQ9 A;  4K0K Q;  4DR6 L;  1FJG L;  1GHJ A;  2V1C C;  2Q8R E;  4FF1 A;  1CM9 A;  1TII D;  4OO1 G;  1Z9F A;  2E74 C;  1B8A A;  3MXN A;  2L5T A;  4K0K L;  4JI5 L;  1I4P A;  3S2H B;  3KF6 A;  5IWA L;  2MP1 A;  4IUN A;  1I50 H;  2CHB D;  2J4X A;  2EOT A;  1QNU A;  3MVV A;  5M9O A;  3HOY H;  2WB1 G;  3CW2 C;  4P75 A;  3VYT A;  2UU9 L;  5IY0 A;  4X65 Q;  2ZJR A;  2EJF C;  4AH6 A;  4R8N A;  4XQQ A;  1KDA A;  1QNK A;  1BXT A;  3S14 H;  3CD6 A;  3FHW A;  3W3A A;  1TWG H;  2YU9 H;  3PO2 H;  1LTL A;  3MXU A;  2F4V L;  1KAW A;  1TY0 A;  4A3M G;  1ZYR D;  3EJI A;  5G3L D;  3I4M B;  4YHH L;  5JJZ A;  1LTT D;  1ILQ A;  2UXD Q;  3HOW G;  4IN3 A;  1XPR A;  4JG2 A;  4A3D H;  4L5R C;  3Q8D A;  1XPU A;  4YWK A;  2JYO A;  4JI3 Q;  2QDB A;  3TRZ A;  3D0F A;  1F9Q A;  1STN A;  5EPL A;  1TWC B;  3HS0 C;  1XNQ Q;  5LMN W;  1FGU A;  3X3N A;  3KJP A;  4LFC Q;  3CU7 A;  1BCP C;  3DUZ A;  2TSS A;  3CC7 A;  3CRL C;  4ODG A;  1PH2 A;  1U0L A;  3S2D H;  4FF3 A;  1KHI A;  4I7Z C;  5BN3 A;  4DR3 Q;  5EGT A;  4PQX A;  3SE0 A;  2A8V A;  1QVF A;  2K28 A;  1PHJ A;  3I2Z A;  4LF7 L;  5GAH C;  1VMP A;  1VQA A;  4GLX A;  1WTV A;  3S1N B;  3KUP A;  3V2T A;  1VF7 A;  2XTI A;  2JA8 B;  1TWC H;  2EJG C;  1A62 A;  1SYB A;  2EIF A;  2KA7 A;  2PNH A;  3T51 B;  1HR0 W;  1UNS A;  2WKC A;  1EQR A;  3SK8 A;  1XMO Q;  2DY7 A;  1MJE A;  2O5J C;  2F1M A;  4UAI A;  1D5M C;  1HZ9 A;  3LNN A;  5CBE E;  2EY6 A;  1WD1 A;  4P72 A;  1TWH H;  4FXD A;  2E2H B;  3K81 C;  1PTO F;  4JI0 Q;  2K04 A;  5IE8 A;  5C4Z A;  5ELF A;  4GKJ Q;  2DN8 A;  2XNA C;  3OW2 A;  2IX1 A;  1PRT F;  3BDL A;  2PZU A;  4HJA A;  4IFD I;  1Z47 A;  4P2C B;  2VUM H;  1PH3 A;  2SNS A;  3TP8 A;  4KHZ A;  1EY6 A;  2XN9 C;  3K7A H;  1SND A;  1TU2 B;  2Q2H A;  4A3L G;  1GO3 E;  4LAA A;  4BBR H;  4NPS A;  4CKC A;  5M5W H;  5GAD C;  1MGS A;  3K7A B;  2NVX B;  1QG7 A;  2CH4 A;  5ELE A;  2K14 A;  4DR3 L;  3B6Y A;  2F0F A;  2JQO A;  3IRB A;  1BVS A;  1F77 A;  3T16 A;  1EFI D;  4A3E H;  4IPD A;  4JC0 A;  4ME3 A;  3CCL A;  4RKB A;  3HOV H;  1SRO A;  3FEW X;  4V19 0;  3CRK C;  4C2M H;  1KL9 A;  5C4J H;  4DUZ Q;  1U4M A;  2NZ1 D;  1VQO A;  1N36 Q;  3GTJ B;  2BDO A;  3I7F A;  2JE6 I;  5J1Z A;  1N34 L;  3I3C A;  3S17 B;  2IWH A;  1DOL A;  4HN7 A;  4A3G B;  2R7F A;  2UXD L;  1CK1 A;  2VW9 A;  4YWM A;  1WYD A;  1K28 A;  3ULP A;  2IX3 A;  4AYB G;  1LTA D;  3HOW B;  1X3Q A;  2MFI A;  1VQP A;  3S1Q H;  1X54 A;  2I5M X;  2MHV A;  5JEA H;  1SMY D;  4ULL A;  2Z0S A;  4K6D A;  4QGU A;  3OPO A;  2YTV A;  1L0X B;  3MAQ A;  1E0B A;  1JB3 A;  5K36 G;  4X65 L;  2KHJ A;  4DF7 A;  2B2U A;  4DR4 Q;  2ICE C;  3V96 A;  1STY A;  4J15 A;  3DEP A;  4FXG C;  1EOV A;  1CKM A;  4KI0 A;  1Q3L A;  1U4P A;  2A68 C;  1V1Q A;  2MGS A;  4OEM B;  3GD7 A;  2IL8 A;  5JJK A;  3HP3 A;  5I2X A;  5A2Q L;  2PZT A;  3NHH A;  3PCO B;  2ZM6 Q;  1VQK A;  1L1O B;  1NTG A;  1TWF B;  4KHP Q;  3I4M H;  2Z6B A;  2D62 A;  2RCN A;  1NAP A;  3LGJ A;  4HTH A;  3CCU A;  4PNY A;  3A55 A;  3I73 A;  1J6Q A;  5H1S E;  3NUC A;  2K5Q A;  1J9O A;  1R9T H;  4DV4 L;  2D5D A;  1EU4 A;  3K59 A;  4LUV A;  1RDP D;  1PYB A;  4IUQ A;  2AHO B;  1HNX L;  3D6C A;  4RMF A;  1H9S A;  4Q5V A;  1Q1B A;  1QUQ B;  4BBS B;  5GQO A;  1F9S A;  1EWC A;  1HRJ A;  5FK9 C;  3FKI H;  1PH5 A;  3NXW A;  4LMQ D;  1WCM G;  1B7Y B;  1CZG A;  1I5F A;  5CYU A;  3JAM L;  1EYD A;  3IFD A;  3IFT A;  2K32 A;  4DR5 Q;  4LF9 L;  3O13 A;  1PVO A;  1EYA A;  3IL8 A;  1K0R A;  3U58 A;  1I50 B;  1PTO B;  1STE A;  4IQZ A;  4YY3 Q;  2A5H A;  5IWA Q;  1PV4 A;  4WJ3 M;  1AP0 A;  1QZH A;  1UEA B;  1Y69 U;  2Q8T A;  4POG A;  4B3R L;  4P74 A;  3HFZ B;  3K80 C;  5LMN Q;  2VY3 A;  2KED A;  1EIY B;  1IKL A;  3H91 A;  2RCF A;  2HHH Q;  5C4H A;  5AJ3 L;  5LMN L;  3FDT A;  2VQE Q;  2H1E A;  1ICF B;  1QVC A;  5DLQ E;  2ZXP A;  2A6E D;  3NE5 B;  4GS3 A;  4B9X A;  4LFB Q;  3T1Y L;  1K73 C;  2EQS A;  4A3K G;  1KLG D;  1A3U A;  1DOK A;  3GV6 A;  3F1Z A;  1B9M A;  3DMU A;  2NBF A;  1PLF A;  3SGI A;  5DNF A;  2B2T A;  1LM0 A;  3KDF A;  5ELB A;  5EPK A;  4HJ9 A;  2F0V A;  2E75 C;  3R93 A;  1G2T A;  4Y52 H;  1IBM L;  2PQA B;  3HOV G;  2E2I B;  1YIJ A;  4LWC A;  4FXK C;  4O1N A;  2PW7 A;  3J81 i;  2L1B A;  2UUC L;  4KD4 A;  5JPN C;  4XQN A;  2K5W A;  3D3R A;  3KFU A;  1JOK A;  5LL6 X;  3E0J A;  3OHX C;  5FO8 B;  1E1T A;  2B2T C;  4DAV A;  4DA2 A;  5KNB A;  5C3E H;  5IT9 L;  4G7H C;  4Q0F A;  4ZCK A;  1K0S A;  5HUR A;  4F88 A;  4QUC A;  1NR4 A;  3WWV A;  4WJ4 A;  1SE8 A;  5KGU A;  3I4L A;  5A35 A;  1HCZ A;  4DUY L;  1MHW C;  2RVL A;  2WKD A;  3CKI B;  2IW3 A;  2HCC A;  4JI5 Q;  4KY5 A;  5F2D A;  2JA8 H;  4KTA A;  4HJ8 A;  5COR A;  2AQ1 B;  2KHS A;  2R92 H;  1XMQ L;  1AN8 A;  4O42 A;  5E3F A;  4DV3 L;  3BG3 A;  3PF4 A;  5C0X G;  3J81 L;  3GTG B;  3QG1 A;  1IW7 C;  4RG1 A;  4QCL A;  2OQK A;  2KCT A;  2R92 B;  2WII B;  4A3B H;  2Z1C A;  1I4G A;  4YCW A;  1V1P A;  2PQE A;  3RUZ A;  4JYA L;  1JE5 A;  3K5O A;  3KF6 B;  1SE2 A;  5IT9 c;  1E2V A;  3OTO Q;  1E1O A;  3PIO 3;  2XVS A;  2L15 A;  4XT3 B;  5EBC A;  3C3L A;  2Q2I A;  2G5D A;  4MTK A;  1LAB A;  4PG3 A;  1L0Y B;  2A6E C;  4DV2 Q;  3OWE B;  3AEV A;  3TN2 A;  2EPB A;  2PPB C;  1CI3 M;  4OXP A;  1STA A;  1SE3 A;  4MN3 A;  4A3I G;  1YIT A;  4B3T Q;  3H3V H;  3EN2 A;  3I4N B;  2F3V A;  3MXG A;  4KN7 C;  5K36 H;  2O4X A;  1RHP A;  3OMG A;  1T9H A;  2K33 A;  5FKA C;  1Y1W B;  1VQC A;  3W1B A;  1HTP A;  1Q82 C;  3M4O H;  3CP0 A;  2MQH A;  2RHS B;  3Q23 A;  1AZP A;  1KTK A;  1PTO D;  1PYW D;  1IBK L;  1VQD A;  3GTM H;  2ZTE A;  2R93 G;  1PH8 A;  4A3C G;  2N49 A;  1DM0 B;  4V0B A;  3VR6 A;  2EXZ A;  4GOP C;  5M3M H;  3UE0 A;  4F87 A;  4KN4 C;  2NN6 G;  1SMY C;  4BY7 B;  3TRE A;  4CJ1 B;  1S5E D;  5CV4 A;  1KAB A;  2KEE A;  5E1F A;  3BDC A;  4KY6 A;  4KKU A;  4TSS A;  3NBI A;  1HFG A;  2Z6K C;  1K3B C;  1K3R A;  1DZ1 A;  1R4Q B;  3OYY A;  4DR5 L;  2YV5 A;  5D14 A;  2JA6 G;  1P16 A;  5NUC A;  5CV6 A;  2R7Z B;  4FYD A;  3PUV A;  4A3E B;  3MA2 B;  1TWG B;  3TSS A;  4A3J H;  4B3M L;  1VDZ A;  2YU9 B;  2QKI C;  3BDO A;  4PV1 C;  1CFM A;  4MNO A;  3HOX H;  4QMG A;  4I65 A;  2OEO A;  4TRD A;  2AUK A;  1EQQ A;  1GVP A;  2LY7 A;  3EA6 A;  1QJO A;  2X6G A;  5DM7 3;  4OO1 H;  1X3P A;  1K8M A;  4IFD J;  4FDB A;  3CQZ H;  2F0E A;  1I3Q B;  1FNW A;  2JA7 B;  2HQL A;  1AE2 A;  4OIJ A;  5M3M B;  3L7Z C;  4BBS H;  5BR8 Q;  3GTO B;  5BN4 A;  1SYE A;  2CH4 W;  1O78 A;  1E7Z A;  3VR3 A;  3A56 A;  5DEH A;  4FF4 A;  3BVM A;  1H9R A;  2R61 A;  4HIO A;  3JC6 6;  4YCV A;  3L3O C;  4BXX H;  5DM6 3;  1DON A;  4IPH A;  5JJL A;  4K14 A;  4R9W A;  5D3I B;  1LT4 D;  4H44 C;  2E8G A;  3EFX D;  1DGS A;  1XJV A;  2EY5 A;  1YJ9 A;  3S1R B;  3HKZ B;  4C3H G;  4JI2 L;  4XYO A;  3E0E A;  3J80 c;  1B3A A;  1F2Y A;  2PYK A;  1B1Z A;  4A3I B;  2G9D A;  4L5T A;  1OO9 B;  1NUC A;  3MZ5 A;  1NJI C;  4KK7 A;  1YNN C;  3A8J E;  4IPG A;  5LHY 1;  2B63 B;  2CW0 C;  1D6E C;  3J80 L;  4CHT B;  5JVG 3;  1N9W A;  3DM1 A;  4GN5 A;  2KVM A;  3K57 A;  1YNJ C;  5DAU A;  4GN4 B;  3BVG A;  5M3F B;  1JJC B;  2WB1 E;  2CCZ A;  3CC2 A;  3VR5 A;  2F0O A;  1YHA A;  4OHJ A;  4C3J G;  5I6W A;  3PF5 A;  4I7A A;  3GTG H;  4KHP L;  1WTX A;  4WFN 3;  4CKE A;  1XMQ Q;  5JPM C;  5BN5 A;  3S9W A;  5KND A;  4S3S A;  1RTO A;  5CV9 A;  2B63 G;  3MHB A;  1AZQ A;  4DN4 M;  1ASZ A;  4DR7 L;  1J5E Q;  3NWT A;  5CC4 A;  1YJW A;  2B2W A;  3PUW A;  3QOJ A;  3U4V A;  2F0T A;  2Z9H A;  1FJG Q;  1I4R A;  1HR0 Q;  4EX5 A;  2UUB L;  4RHS A;  2E2I H;  3C2P A;  2WAQ E;  2RSO A;  1PTO H;  4GLA C;  2K50 A;  2A73 B;  1NCV A;  1HQM C;  3PUY A;  4G57 A;  4L5S A;  2JEB I;  1WTR A;  2EYM A;  5M5X B;  5IT9 E;  4HCS A;  2OCE A;  3BYT B;  1IBL L;  4XT1 B;  3HG9 A;  3UE1 A;  3ULJ A;  2KCN A;  1V9P A;  1WFQ A;  2F4I A;  4K2K A;  4AQY L;  1JQY D;  2EE1 A;  2NVY H;  3GDE A;  3IAY A;  2VB3 X;  4QJF A;  1PFM A;  4B08 A;  1HNW L;  1VQI A;  4LK1 C;  5FLM G;  4AYB B;  4PZ8 A;  1IW7 D;  2EYH A;  2JA5 H;  2KUM A;  4J8Q A;  4DV1 L;  2A1A A;  4CDF C;  1B70 B;  1CA5 A;  4QL5 A;  3SR1 A;  5M3M G;  4JI2 Q;  1XPO A;  1E24 A;  1X3E A;  1SAP A;  3HGB A;  2R93 H;  3DWQ A;  4N8F A;  1HTL D;  3AQQ A;  3BU2 A;  1WTH A;  1TVX A;  4NB3 A;  4LNQ A;  4NXN Q;  1FL0 A;  3S16 B;  1ET6 A;  4C3J H;  4DUZ L;  3R2I A;  1TT2 A;  4C2M B;  5IGF A;  4K6L A;  2XSC A;  4XIG S;  1EFW A;  3P1H A;  1W3S A;  2E5L L;  1I6H B;  1B2T A;  5L37 A;  1V1P B;  5KRU A;  4RGO S;  1FYC A;  2EDG A;  1SSO A;  1Y1V G;  1AW7 A;  1HQR D;  2UXC L;  1ONL A;  4JCV E;  1I94 L;  4CGY B;  5IYC G;  1X56 A;  1K83 B;  2E76 C;  4ZYS A;  2SOB A;  1MBY A;  4C3H H;  4EQ5 A;  3J80 i;  4OEL B;  2NTS A;  4DV0 Q;  2EZV A;  1MD2 D;  3PO3 G;  1IKM A;  5LMU L;  1N8R C;  3WOF A;  2CW0 D;  2JA8 G;  1Y1V B;  3OSO A;  1XMO L;  2AWN A;  2OTL A;  1TY2 A;  1N32 Q;  1YNN D;  2FMM A;  4LF6 L;  3QR8 A;  4A3G H;  1BBX C;  4ZAI A;  3OTO L;  4OX9 Q;  4WOR A;  3CF5 A;  1C7Y A;  1DOM A;  2AQ2 B;  2F0L A;  4QF4 A;  2VUM B;  3E5S A;  3S15 B;  3HOX G;  1K9M C;  4BBS G;  1VQH A;  1WTQ A;  2NVY B;  4H7B A;  1Y8N B;  1LUZ A;  4HSV A;  3GTJ H;  2NVX H;  2L11 A;  1O7L A;  3FPU B;  1QVG A;  1PFS A;  5CGK A;  4QIW E;  1KAA A;  1ENC A;  1U9R A;  3E3X A;  3AFP A;  1B53 A;  3HOZ H;  4LF4 L;  2CWP A;  1QIL A;  5HGQ A;  3J81 c;  4JV5 Q;  2FFK B;  3DWP A;  2C5C A;  5D65 A;  3S24 A;  5I2Y A;  3LX0 A;  4RFB A;  4B3S Q;  5E4W C;  3HKZ E;  2D0O A;  1HUM A;  4PMC A;  5GRO A;  4EQN A;  4X64 L;  1P8L A;  4QIW B;  4DNT B;  3MXP A;  1S4Z A;  2CWA A;  2BH8 A;  3NP8 A;  4CJ0 B;  2V4D A;  4R4C A;  3SEB A;  2QW7 A;  1IYJ B;  5FOB B;  1K8O A;  3H3V I;  2OQ0 A;  1HPC A;  2F0G A;  1CQF A;  1PMR A;  2KBN A;  4HJ5 A;  4YHH Q;  2BOS A;  3L9A X;  5CBA E;  3FMC A;  1BKB A;  1OXV A;  3M4P A;  4R8I A;  2JP1 A;  3T1H Q;  3G4S A;  2NN6 H;  4GN3 B;  1Q1E A;  2WAQ G;  3BJU A;  3RNU A;  1TS5 A;  1STB A;  1ZXT A;  5C44 H;  1EIG A;  1I94 Q;  4A3I H;  3CMA A;  3G71 A;  2ASB A;  2CVR A;  1AH9 A;  4HIK A;  4LF8 Q;  1GUW A;  3FVQ A;  4LF7 Q;  1NNX A;  2D0P A;  2PCF B;  2IJ0 A;  1JJ2 A;  4XDX A;  4DR1 L;  1Q8K A;  3Q0A A;  4IZ8 A;  4A3D B;  2EYL A;  1EWI A;  4JBM A;  4JI4 Q;  4LUO A;  4OWT B;  4JI8 L;  3TDQ A;  4P71 A;  4AYB E;  4B3R Q;  3J7Z C;  3TP5 A;  4N8X 1;  5IP7 G;  3A7A B;  4XYQ A;  4N9T A;  4TKO B;  1JIC A;  2A69 C;  3I56 A;  4GLV B;  4KJN A;  5IOC A;  2J7Z A;  4YIJ A;  3MFG A;  5JOB A;  3HOZ B;  4GKJ L;  2QGQ A;  2F0W A;  5IP9 G;  5ELC A;  1PDQ A;  2KHI A;  5C0X H;  4DV6 Q;  1BCP B;  1H9M A;  2K52 A;  3GTK B;  1TWH B;  1PRT C;  4ZLT F;  3JAM c;  3F2C A;  2VQF Q;  4DK3 C;  2Y0S E;  1CHP D;  1YHQ A;  1XTC D;  2SNM A;  4DK0 A;  3A5Z B;  1QWY A;  1W6K A;  1DYQ A;  3GTL B;  3RZO H;  1N33 Q;  3S2H H;  3SK6 A;  2O5I C;  5C6A A;  4DAM A;  3TP7 A;  3M4Y A;  1Y14 B;  2PO4 A;  4L6T B;  4C3I G;  1G6P A;  4X3U A;  5C4X B;  4IUV A;  3R2T A;  2E2H H;  2P5Z X;  1VQ6 A;  4DNR B;  3GP7 A;  1T5X D;  2CFM A;  3S1M H;  1F2M A;  3CCE A;  1O7Z A;  5FLX E;  2GN5 A;  1H9S B;  3VDY A;  1EZ6 A;  1D2B A;  4QQB X;  2B2U C;  4KJO A;  4NMZ A;  2ZM6 L;  4Z9C B;  1KC8 C;  2R93 B;  4NP5 A;  2RF4 A;  1CKN A;  1IXR A;  3K5L A;  1FNV A;  1NE3 A;  4CDE C;  4NXM Q;  2UXB Q;  1D7Q A;  4MIU A;  1G51 A;  4LFA L;  3C46 A;  2ENB A;  4K5V A;  3BZC A;  3C1F A;  1GUN A;  4KV6 A;  3HZX A;  2YTX A;  4A3K H;  4RGM A;  3TME A;  3A0J A;  3FRP B;  5ELD A;  1QCB D;  1SYD A;  2QEJ C;  4IJH A;  3GQB A;  1HJP A;  3G7L A;  1IBM Q;  1E2Z A;  1BR9 A;  4GOP A;  1PH9 A;  1BUV T;  2PQA A;  3NBH B;  4A3E G;  4AQY Q;  2RKS A;  3HOU B;  1HZA A;  4L5Q A;  4DV0 L;  1HNX Q;  4OGQ C;  5EPJ A;  5CV7 A;  4ZKC B;  5J22 A;  1B44 D;  4HMI A;  2JJQ A;  2A74 C;  2EY2 A;  4JW0 A;  1GUS A;  3P7J A;  5JVH 3;  3CCQ A;  4A3L H;  5FO7 B;  2BCO A;  3LWU A;  3CQZ B;  1RIP A;  2DNC A;  3KK7 A;  1ICW A;  1JCK B;  1WVL A;  3OWF A;  1VQE A;  1EOT A;  4GNX A;  4PMW A;  1U4L A;  4JOI A;  1K8G A;  3DM3 A;  4R4I A;  2GA4 B;  2I5L X;  3GTL H;  2BA1 A;  1KQS A;  2EYP A;  4NDX A;  1NR2 A;  4FO2 A;  2WAC A;  1GOZ A;  3TQY A;  1PH1 A;  1CZW A;  3HKS A;  4RHR A;  3NQI A;  4HAE A;  4H13 C;  1R4P B;  4A3B B;  4B9W A;  2JSO A;  3DHQ A;  3RLF A;  5IGD A;  3I72 A;  3I4M G;  2MNA A;  2HT1 A;  1CHQ D;  4CKB A;  1TWA B;  4JI0 L;  1B4O A;  3NEM A;  4LF6 Q;  3GO5 A;  4K2L A;  4PZ6 A;  4HID A;  1CSQ A;  1Q46 A;  2F3W A;  2ZT9 C;  3BS1 A;  1OXU A;  2B8F A;  2DUD A;  5C0X I;  4A93 B;  3OMC A;  4L63 B;  1D1I A;  2AUJ D;  2NZH A;  2ZTD A;  2ES2 A;  3S15 H;  3TEH B;  1XTD A;  1CA6 A;  1C48 A;  2MUY A;  4QUF A;  4A3M B;  5J39 A;  1Q8I A;  1PZJ D;  1Q81 C;  5JEA J;  1WD0 A;  2N78 A;  2QCP X;  3M4O B;  1X32 A;  4XTC S;  4X64 Q;  2HQE A;  5M3F H;  1FR3 A;  3KF8 B;  1VQJ A;  3ZJY C;  1GXD C;  4EGV A;  4TQU S;  5JEA G;  3VR2 A;  4C3J B;  1SJH D;  2CQO A;  1N36 L;  2FHT A;  5I9P A;  2I07 B;  4RA8 A;  2HHH L;  1W2B A;  3DXJ C;  3TZD A;  3I4N G;  1RL2 A;  2K75 A;  4DR7 Q;  1ILP A;  4UHV A;  1JJG A;  3FKI B;  2HDL A;  1NY4 A;  4JI1 L;  3ZYY X;  1FGB D;  1SXT A;  3AFQ A;  3QO2 A;  4GNX C;  1EEI D;  1I3Q H;  1L2F A;  3EIV A;  3ITP A;  4IUR A;  1K8A C;  4A93 H;  4JI3 L;  3U9O A;  4A3F G;  1XNQ L;  3N6R A;  3NEL A;  1VQG A;  1EYC A;  2PZW A;  2CKZ B;  4OO1 I;  3KLS A;  3HRZ C;  3HOY G;  5IYD G;  3HOU G;  2K4K A;  2UUC Q;  1A8V A;  1HHV A;  2JEA I;  2F0N A;  4DAY B;  5JAV A;  1HNZ L;  3TS0 A;  1EY5 A;  1M8A A;  1QB5 D;  1O80 A;  1S5F D;  2B2Y C;  2HCI A;  2LS0 1;  5T1G A;  2XRS D;  3H3V C;  3H15 A;  2N8N A;  1IBL Q;  2XWB B;  1BO0 A;  3KLW A;  4NXM L;  1VQ5 A;  3HOY B;  5G3L F;  4BBR G;  5I4D A;  1G29 1;  1MSH A;  3QB3 A;  4X3T A;  2B29 A;  4JV5 L;  2B2Y A;  1SLJ A;  5FLX c;  4ZKB B;  2UU9 Q;  3RD4 A;  1EYG A;  1SDF A;  4A3G G;  1S5D D;  2VQE L;  3S14 B;  1AE3 A;  2N3S A;  1ML0 D;  1XX8 A;  2NVT H;  4K5X A;  2VUM G;  2E2J B;  1VQF A;  4X3K A;  1RTN A;  1SNP A;  4POF A;  1RKN A;  3V05 A;  3KOJ A;  2J0T D;  4F7X A;  1Y8P B;  4R1J A;  1KNA A;  1VMC A;  2NWG A;  2F3I A;  4KLK A;  4J1M A;  2C9O A;  2F03 A;  2K5H A;  1ROD A;  3RLO A;  1Z7T A;  1E2W A;  2F0S A;  2M00 A;  3SDZ A;  2H5X A;  3I91 A;  1CSP A;  5FJ8 G;  3L0O A;  1SMX A;  3TP6 A;  4JBJ A;  1VQN A;  3T1H L;  4LF5 L;  1CKO A;  1DXM A;  3D4R A;  3CPF A;  3GV3 A;  4A76 A;  3S16 H;  1XNR Q;  3K58 A;  3U50 C;  1OTC A;  3CCV A;  4ZRZ A;  5C44 G;  4BWG B;  3F2D A;  3CCM A;  3I4O A;  2ALY B;  4JPB W;  2KCC A;  3I8Z A;  2Y0S G;  1SJE D;  3KLR A;  2RBM A;  4ME5 A;  1A3T A;  1SYC A;  4KHV A;  1H9K A;  4RH6 A;  4IO9 A;  3PSI A;  4EVO A;  4H02 A;  1NMF A;  1PXU A;  4DAY A;  5EBD A;  1S72 A;  3J7A V;  3ICE A;  4TVA B;  4KD3 A;  1FD7 D;  3UDG A;  5FLX L;  3UDX A;  3N52 A;  1WOC A;  3HOW H;  2BDN A;  4NXN L;  3TBI B;  5FLM H;  1V43 A;  1EQV A;  4U68 A;  4LFC L;  3X3M A;  2WV6 D;  2Q8I B;  1SNM A;  5KNC A;  4A3M H;  2I0Q A;  4EQP A;  4ZK9 B;  1XXG A;  3PO2 G;  2KOL A;  2LXK A;  2VZA A;  4BY1 H;  4OX9 L;  1F9P A;  4F8M A;  3AU7 A;  2OT2 A;  5CMD A;  2YYZ A;  3DEO A;  1D5X C;  3U4Z A;  5M5X H;  1Q86 C;  4DV6 L;  2AQ3 B;  3J80 E;  4LF5 Q;  2Q2T A;  2LSS A;  2WIN B;  1ZEQ X;  5ELN A;  3A5U A;  1D8L A;  2BA0 A;  1OXS C;  2FIN B;  2EYJ A;  1SNQ A;  2KJX A;  2Z4H A;  3CCR A;  2ATW A;  1MSG A;  1PZI D;  3RMH A;  4BBR B;  2B39 A;  1KXL A;  2K5D A;  3S1N H;  5KYI A;  2F0M A;  4X3S A;  3M3Y H;  4JVZ A;  4BY1 B;  2EYO A;  4JI4 L;  5I6Y A;  4M8A A;  3CME A;  2DY8 A;  4DV5 L;  2QEX A;  3OOC A;  1EL0 A;  1F2L A;  4O2D A;  3ERQ A;  3MXN B;  1DD2 A;  3M7G A;  3R3O A;  3KBX A;  2RDH A;  4UPA A;  3H94 A;  5IYC H;  4X6A H;  1D5Z C;  1EEF D;  4ZQ3 A;  1GUG A;  3SHL A;  4DUY Q;  1LTG D;  4HMJ A;  1L0W A;  3D4W A;  3MC0 B;  5ISR A;  2IT1 A;  2Z4I A;  1SE4 A;  1LTR D;  2UUA Q;  1XNR L;  1LTI D;  2RSN A;  4PZ7 A;  4WJW A;  4DXF A;  4B3T L;  1TQO A;  1C4Q A;  3VA7 A;  3H09 A;  1KDB A;  1O7Y A;  5LMU Q;  4B3M Q;  5IGG A;  2F0Q A;  2R7Z G;  2F0H A;  2ZJQ A;  4JI6 Q;  3KF8 A;  3H0G B;  4A3J B;  4X62 Q;  2HD3 A;  1VQ8 A;  3GTP H;  2F0J A;  3AB9 A;  1LAC A;  5D3D A;  4B3S L;  1EY4 A;  3OW7 A;  4RAU C;  1TWA H;  2JXM B;  2UXB L;  2M9V A;  3NBH A;  1V1O A;  2JK8 A;  4IFD H;  5JJI A;  4A3J G;  4GOP B;  2HIX A;  2NVQ H;  1RD9 D;  1ZKO A;  4C3I B;  2JA7 H;  1SR3 A;  1ESF A;  3P20 A;  1KNE A;  1GJX A;  1JC7 A;  4FP5 D;  2B2V C;  2I46 A;  4BY1 G;  4HJ7 A;  3MEH A;  3G6E A;  4EQO A;  2O2L D;  3A8K E;  5IYD H;  4C56 C;  3NTH A;  5EKK A;  4LUZ A;  4RCO A;  4JI7 L;  2FMC A;  2AMC B;  4K8I A;  3QWN A;  4GKK Q;  4ALP A;  1IHZ A;  5KEE A;  1RCV D;  4U67 3;  2FJ2 A;  1HXY D;  2NN6 I;  3E9I A;  3RZD B;  2PMZ E;  3HKZ G;  3D4D A;  3S1R H;  2LMC B;  1GKH A;  2L4N A;  4A3C H;  2L9H A;  1LTS D;  5IIF A;  5EKL A;  2NVQ B;  3PMF A;  4IUU A;  1JWM D;  3ND8 A;  4RCN A;  3A54 A;  3W1G A;  1YJN A;  4BY7 G;  1GUO A;  3KJO A;  2D9U A;  2E2D C;  4DK6 C;  2D2C C;  2X6L A;  5FO9 B;  4HSP A;  4ID6 A;  2LFN A;  3NSW A;  1HA5 A;  1SYF A;  1B50 A;  3FP9 A;  4IUP A;  5M3F G;  3GTO H;  5CV5 A;  1L1O A;  1JOR A;  4M1U B;  3VA5 A;  1SN8 A;  1C0A A;  1LV9 A;  5AJ3 Q;  1BOS A;  4IAL A;  3D6W A;  2Q2U A;  3AMU A;  4DGZ A;  2IX0 A;  1S5C D;  1ENA A;  2GVA A;  4G7O C;  3SK4 A;  1MJC A;  1TXY A;  1IBK Q;  2KQ3 A;  3I55 A;  2NVT B;  1I4Q A;  5BR8 L;  3IKJ A;  1R9T B;  3K0X A;  2EVB A;  1YVC A;  3A74 A;  4KMU C;  1CQV A;  4O0A A;  4NKL A;  3S1M B;  5CR3 A;  4BXX G;  2GVB A;  1H95 A;  4A3B G;  5ELO A;  1SNC A;  4DPG A;  2F0I A;  5C3E B;  4QB4 A;  1G6Z A;  2F0P A;  4IUT A;  4RWS C;  2VQF L;  1NSN S;  2K03 A;  2MO0 A;  1EU3 A;  1VQM A;  3KDF B;  2K7V A;  4JI6 L;  2R92 G;  3J7A F;  1HNZ Q;  3I90 A;  1TS3 A;  1HNW Q;  1Q7Y C;  1ET9 A;  1IYU A;  2JA6 B;  1A0I A;  4YCU A;  5C3E G;  3J81 E;  3CCJ A;  1UE5 A;  1G8Z D;  2BE5 D;  3MFY A;  3EVQ A;  5COY A;  1ESR A;  1F2Z A;  2L55 A;  1BCP F;  1E22 A;  3M7N A;  1IZ6 A;  3KYH C;  4L8J A;  1BCP D;  4UP9 A;  1HR0 L;  3T53 B;  1M90 C;  2ZXO A;  2XWJ B;  3VYR A;  4C3H B;  1STG A;  5M5Y B;  3HOU H;  1Z6H A;  2N88 A;  2Z6K A;  3GTK H;  1D1K A;  4N9P A;  5EKI A;  2R6G A;  3W5O A;  1YI2 A;  1STH A;  1H9J A;  3ERO A;  4IOA A;  5IYB G;  4JI1 Q;  1QE6 A;  3URY A;  2WB1 B;  2JA6 H;  2A69 D;  1HZC A;  2N55 A;  1VQ4 A;  1YZ6 A;  2EJM A;  4A3F H;  4HR7 B;  3K5N A;  4DR6 Q;  1Y8O B;  4ZUI A;  2A6H D;  1SRU A;  2ZXR A;  4LW1 A;  1SYG A;  3PUZ A;  3GTM B;  4NW2 A;  1J8I A;  3CC4 A;  3I70 A;  4A93 G;  1PYS B;  1JT8 A;  3KBG A;  1FVI A;  1X65 A;  1YNJ D;  2AWO A;  4G7Z C;  1N32 L;  3GTP B;  4DV1 Q;  1N33 L;  2KEN A;  1VQB A;  3CHB D;  4HCE A;  5I9O A;  3A7L A;  1YHB A;  5T1I A;  4HIM A;  1G91 A;  2G9H D;  2HUG A;  2NZO A;  3I4N H;  1WI5 A;  1EIH A;  3NWS A;  4IOC A;  3CXC A;  3LWE A;  2L12 A;  5CV8 A;  1EY8 A;  4A3F B;  4PMB A;  1PH4 A;  5IYB H;  3SXH A;  3RZO B;  3PQI A;  3EQL C;  3KLS X;  3M9B A;  1X55 A;  3D31 A;  1KRT A;  1IL8 A;  1LTB D;  4DAP A;  1JR0 D;  2VL6 A;  2OTJ A;  4P73 A;  1LT5 D;  2OXP A;  3FKI G;  5TSS A;  1SFO B;  4ABN A;  4LFB L;  4X66 Q;  2YTY A;  3FPP A;  1C9O A;  1FNU A;  2MO1 A;  4C3I H;  1RF2 D;  1LO5 D;  1NBW A;  3S2D B;  3RR5 A;  4OON A;  4IPC A;  4RKL A;  1Q12 A;  1TS4 A;  1UEB A;  4OIK A;  4OWW B;  4J6H A;  2K6A A;  1EIF A;  1AEX A;  1E3P A;  4UP8 A;  4DXG A;  3VYS A; 
#chains in the Genus database with same CATH homology
 4JW0 A;  5L37 A;  2RCF A;  4N8X 1;  2HD3 A;  2Z9H A;  4JVZ A;  4N8F A;  4I7A A;  2QW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...