4JVZA

Structure of thermosynechococcus elongatus ccml
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
94
structure length
92
Chain Sequence
MKIARVCGTVTSTQKEDTLTGVKFLVLQYLGGEFLPDYEVAADTVGAGQDEWVLVSRGSAARHIINGTDKPIDAAVVAIIDTVSRDNYLLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two new high-resolution crystal structures of carboxysome pentamer proteins reveal high structural conservation of CcmL orthologs among distantly related cyanobacterial species.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Structural protein
molecule keywords Carbon dioxide concentrating mechanism protein
total genus 11
structure length 92
sequence length 94
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4jvzA00
2QW7A 4N8X1 2RCFA 4JW0A 4N8FA 4JVZA 4I7AA 2HD3A 5L37A 2Z9HA
chains in the Genus database with same CATH superfamily
3NBHA 1GUOA 5FJ8H 1Q82C 4C3JH 2YTVA 1YZ6A 3IAYA 1O7IA 2Q8RE 4ZKCB 4ZCKA 1JCKB 4DAVA 1LTRD 2D0PA 4PZ7A 1K83H 1GM5A 4JI0L 3L0OA 1SBBB 2LSSA 2MPMA 1CI3M 2LS01 3C1EA 5KNDA 5D14A 2JEBI 1HZAA 2F0TA 4DUZQ 4ILWA 5IGEA 3MVVA 4XYQA 3S1QB 1KDBA 3S1RH 3GTPH 5M9OA 3WOEA 3R2IA 4LF5Q 3H3VH 4DXGA 1JJGA 2VXWA 2XRQD 2HQEA 4EQPA 5LL6X 2BA0A 2PQEA 4DV4Q 4C3HH 1OXXK 2RDHA 4K0KL 1KL9A 3KK7A 4DR6L 1S5FD 1WTOA 1WFQA 2LXKA 2B2WC 2O2LD 1N34Q 2PZUA 4RG1A 4H13C 2R92H 1SR3A 3S14H 1I4XA 4DFAA 2L12A 2EXDA 3PV0A 3RLFA 5CC4A 4L5SA 3S16B 3JC66 2JA7G 4JI3L 1STGA 2EY5A 4H02A 5JVG3 3I55A 3NK9A 1RIPA 1QE6A 2E2HH 3M4OH 4Z9CB 1Z9FA 3IFDA 2DUDA 4KJNA 2WV6D 1CKMA 4JI3Q 1FGUA 3PO2B 2AMCB 1WTXA 3KBGA 1SYCA 2PMZB 2QDLA 4DAPA 4UY8C 2RHQB 2KEEA 2ZJQA 2SDFA 3S1NB 1PH2A 2B63B 4DR5L 1LTBD 3F8TA 4JCVE 2WB1B 2Q8IB 4AYBG 3U9OA 2L9HA 4F7XA 1SNCA 1L1OC 3K5MA 3KUPA 3OTOQ 4B9WA 1VCIA 4IUVA 5CYUA 2IHEA 1H9RA 4FDBA 1IXRA 4IOCA 1ET9A 3NUCA 5HY6A 1ZEQX 3I90A 4CDFC 1MIUA 2X6GA 1RL2A 3RUZA 4DUZL 5ELDA 5IYDH 1GUNA 1KDCA 1NY4A 2CW0D 3SK5A 1VMCA 3HOVB 4HSPA 3SXHA 5I4DA 3Q22A 2F0LA 2PZWA 2TMPA 3AEVA 2JQOA 3AQQA 3S1NH 4YIJA 2LMCB 5ELNA 4LNQA 2VUMG 2NVYH 4ZRZA 2AWOA 5CMDA 1KLGD 5M3FG 2XNAC 4LUVA 2R6GA 4XXEA 1J5EQ 4JI6Q 1IBKQ 5ELFA 2UU9Q 1WCMB 5J1ZA 2IL8A 2K52A 2K5WA 4L8JA 3A0JA 4HIMA 2N8NA 3NSWA 1WTPA 2QGQA 4WFN3 1VQAA 1L1OA 3SK4A 3G4SA 4POGA 3Q0AA 4IQZA 1L1OB 2ASBA 4L63B 1BCPD 2WB1G 1SMXA 1LACA 3TREA 2PNRC 4DV6L 4GN4B 3F1ZA 2NB0A 1XNRQ 2PPBC 2JXMB 4A93G 3J80E 1L0WA 2BE5C 4IUUA 3C3LA 1ET6A 5C0XI 2NVQH 4G4KA 2BA1A 4OIKA 5KEEA 4V190 4RMFA 4TSSA 3PUYA 1TU2B 3NENA 5K36H 5CV7A 2KHJA 3K7UC 1LABA 1QVFA 4A3MG 4A75A 2F0IA 3PSIA 1M1KC 1S40A 5EPKA 4RWSC 3SHLA 3K8AA 1JICA 1EFWA 3CCQA 4JI2L 2O5IC 2XGTA 4X3KA 2B2VC 4LF7Q 1PH6A 2R7ZH 1VQ8A 4KY7A 4UHVA 1BR9A 2B2TC 3O13A 1QVCA 4RFBA 3VYUA 3DEOA 4WJ3M 4IPDA 1DOKA 1DONA 4BXXH 3RD4A 1VQMA 2JA9A 5C3XA 1HNZQ 2F4IA 4IFDG 1FNVA 3F2UA 2HHHQ 2D62A 4JI0Q 5M5XB 4DPGA 1QZGA 1Z47A 1DOLA 4DV0Q 4A3CH 2F0WA 4CKCA 1BVSA 5FLXL 1U4MA 1SN8A 1SYEA 4H44C 2PYKA 4MZ9A 3L9AX 3HOXG 3IKJA 2BDOA 2K5QA 1PTOF 3ZYYX 5LMNW 2VQFL 1UEAB 3KYHC 5C4HA 1T9HA 2Q2IA 2DN8A 3G6JB 3K57A 2R93B 2HUGA 2F0EA 2A68C 4FNFA 4OO1G 3R93A 2OXPA 1X54A 4F87A 3RR5A 1GHKA 2K75A 1BBWA 1LTSD 2CQAA 2DY7A 4A3IG 1E1OA 4BA2I 1SE4A 1EUJA 3CF5A 4C2MH 3KJOA 2CQOA 3K59A 1JJCB 5IGDA 1RCVD 2A19A 3GTMH 3I4OA 1HQMC 2KHSA 1QWYA 4MHEA 2FMCA 4EQOA 1BOSA 2JP1A 5DLQE 2RHSB 4DA2A 4A3FB 3C2PA 4K5VA 2ID0A 2JEAI 4KKSA 1V1QA 4NXNL 3UDXA 4Y7NH 4DV5L 1P16A 2UXBQ 3ND9A 4H7BA 2XSCA 4FO2A 4IUQA 2MP1A 3L2PA 2Z0SA 1UE7A 4G7ZC 3KLWA 3L3OC 4AIMA 4KHZA 2KOLA 4JV5L 2E2JB 3W3AA 3J7YW 1CFMA 1E2WA 3BVZA 1D5XC 3URYA 2B3GA 2B63H 3GTJB 5IYCG 3KF8A 4IPGA 1Q1BA 1CHQD 1C4QA 3HOYH 5DEHA 5EQ0A 1LTID 2KCMA 3H3VC 2I46A 3S2DB 1TY0A 2Z1CA 4OWWB 2F4VQ 4R4OA 3OHXC 5JPMC 3TS0A 2M00A 1O78A 5C44H 4LF6Q 1XPOA 1D5MC 4HIOA 1HHVA 4HAEA 3S14B 2K5HA 4TRDA 3NELA 4G57A 3GTLB 1IL2A 1TWCH 3J81L 1EZ8A 1VQEA 3WOFA 4BY1H 3J81j 4A3KG 4NXNQ 1KHIA 1XX8A 2B8GA 1L0YB 4BBRH 3VR5A 1DGSA 2EYFA 2JJQA 4A3GB 1V1OA 3PO2H 3W2DA 4HJ7A 1HFNA 1H95A 4HMIA 1KRSA 3TP6A 1U0LA 1VQNA 1STBA 1ILQA 4HN7A 4IO9A 4X64Q 1HR0L 4KHPL 3I2ZA 2UU9L 3S16H 3GP7A 5COYA 2QW7A 5KNBA 1ENAA 4DR7Q 1B3QA 3D6WA 2QEJC 5M5WH 1KIXA 1UWVA 3S24A 2K1BA 4GS3A 1E3PA 2WAQB 4C3HB 1SJHD 2JSOA 3VR6A 2JYOA 1VQFA 1RKNA 2Y0SE 2Z6KC 3S1RB 3GTPB 1BF4A 4WJWA 5IP7H 2KBNA 2HCIA 3DEPA 4A3MH 3J7ZC 1U5KA 1S4ZA 3HOZG 3HOUG 3D4WA 1ICFB 3ULJA 5E7NA 1O80A 3F2DA 4FF3A 1CHPD 1K8MA 4NDXA 5NUCA 4OO1I 3FMCA 3STBC 1XMQQ 1GUSA 1U9RA 4KN4C 2RDGA 3NWSA 1JWSD 1AW7A 1V9PA 4ZKBB 1CZWA 1PYSB 4YCUA 4EQ5A 3M4QA 1MGSA 1MHWC 2IW3A 3E9IA 1JWUD 2ZXPA 3SR1A 2J7ZA 3M7NA 3EBEA 4DXFA 1YEZA 5FJ8G 4QB4A 2XWBB 4IFDJ 3CW2C 3RN5A 1CZGA 1TWHB 3MXNA 4XQQA 3UDFA 3QJYA 1G291 3E0JA 3Q8DA 1TS2A 3T4AC 3NTIA 5FO8B 3T51B 1Y1VG 1TWGB 3HOXH 1B50A 5EPLA 1N36L 3H6MA 1NE3A 3M4YA 5I2XA 3A54A 3CKIB 4K5WA 5C6AA 2EYLA 4OONA 4MTNA 3TEHB 1AZQA 4C3IH 1IZ6A 4HJ9A 1FD7D 2NYZD 4A3FG 1X3GA 2GN5A 3E3XA 3MAQA 4OO1H 4I7ZC 4TKOB 4A3EH 1G8ZD 4B3SL 1HZCA 2IWHA 1CA5A 1GD7A 4JI5L 3BZCA 1MJCA 3DUZA 4A3LG 3K80C 4XT3B 1MKHA 2G9HD 3U9SA 1E2ZA 1ZXTA 1N36Q 1PMRA 1OO9B 1PYWD 2R92B 1SXTA 1J6QA 5IYBG 2A8VA 3L7ZC 2F0GA 3MXGA 3DXJC 3H94A 1O7YA 3UE0A 2Q2TA 4LFCQ 3TP5A 4DV7Q 2ZJRA 1Y1WG 4A3BB 3NTKA 1BCPF 2AQ1B 2Z4HA 1PRTC 2NVTH 3OWFA 3K5NA 5HGTA 4B3MQ 4BBSB 2AQ2B 1EY6A 3H15A 3FDTA 4DV7L 2R7ZB 3SK8A 3CCMA 4UPAA 3D4RA 2CH4A 2UXBL 2EXZA 4JI1L 1YNND 4UP7A 4EVOA 4WORA 4OHJA 4R9WA 5C4ZA 2OWOA 2Q2HA 4KY6A 1L0XB 4X62Q 4QQBX 5CR3A 1W3SA 4ALPA 1EU3A 5JVH3 2F0PA 1NMFA 2YU9B 4LFAQ 1SMYD 1G2TA 1TIID 3G48A 5CV9A 1DM0B 3CRLC 1HR0W 1I4QA 1XJVA 1Y69U 4YWMA 4A76A 2FJ2A 2K4KA 2VQEQ 1JWMD 1I50B 3RMHA 3PO3B 4N8X1 2QKIC 1K8GA 5IOCA 2K01A 1JR0D 1SSOA 1QB5D 3MFYA 4Q5VA 1KRTA 4ZQ3A 2KENA 1F2YA 1TWFB 1YHAA 2KHIA 1AE3A 4CJ2C 4IUNA 3P75A 1JOQA 2EYHA 2NZHA 4A3KH 2UXDQ 4HIKA 3J81c 1LTTD 5EGTA 2GVAA 3ULLA 3PO2G 3S2HB 3RN2A 3J7AF 1YNNC 4KD3A 4DAYA 5KRUA 1LM0A 2WINB 2JA5B 5CV8A 1F2MA 3EN2A 3R2TA 2IX1A 2A74C 2IJ0A 4IALA 4QY7A 3I72A 1D8LA 4DR6Q 1I6HB 1Y14B 3VYSA 5C3WA 1EY4A 3UE1A 3U50C 3EIVA 3JAME 1YNXA 1JE5A 3LX0A 3CXCA 3AB9A 4FYDA 1GVPA 1EY8A 3QR8A 4J1MA 1XYIA 2VS1A 5GADC 1A8VA 1TWHH 4B3ML 3QWNA 1SNOA 3EQLC 4NKLA 3HZXA 3M7GA 3PUZA 1YJWA 4DAYB 4RGMA 1AEXA 1WYDA 1EQVA 1A0IA 3HOYB 4RCOA 1I3QB 5FLMG 1PH1A 3ITPA 2VUMB 1PYBA 2R7DA 2Z6BA 5M5YH 4ODGA 1I5FA 3OW2A 3S17B 2PZTA 2R92G 1AH9A 1B70B 3PGZA 3HFZB 4YY3L 1CSQA 4A3GG 2NBFA 4DNTB 5IYDG 5FOBB 2BOSA 3FKIH 1D6EC 2Z4IA 2EOTA 3PIPA 1A6XA 3ERQA 5JPNC 1HJPA 3HKZE 1XNRL 4KV6A 1RDPD 3CCEA 4AYBB 5IWAL 3HOVH 4JOIC 5JEAH 5EKIA 2MO1A 1OTCA 1SYBA 1I94L 5CBEE 2BCOA 4CBVA 4X3UA 2VUMH 1K28A 4K8JA 4GOPC 2K28A 5IGBA 1N33L 3I4NB 2G5DA 2MO0A 3CCJA 2MJ8A 5D3IB 1MJEA 1EEFD 4KKUA 3VYRA 5IIFA 3N6RA 4JBJA 1SMYC 5IGCA 4JI8L 4KI0A 4DR1L 2HIVA 5FKAC 5M5WB 4GN3B 3VA5A 1A3VA 1VQOA 1SE8A 4QIWB 5DAUA 4M1UB 1G51A 2RVLA 4ZUJA 4K6DA 2E75C 3KFUA 1AN8A 4QJFA 1JOOA 1R4QB 5IT9L 4DR3Q 2I0QA 1N33Q 3A8JE 1PFBA 3OPOA 1CA6A 5BN3A 2WKDA 2B2TA 2F0DA 3H0GB 3KDFB 2A6EC 1BNZA 1G91A 3TBIB 4A3EG 1SYGA 2B2VA 3M3YH 1LT4D 4ULLA 3S2HH 1Q8IA 4CJ0B 1VDZA 2R61A 2RKSA 2J0TD 3Q24A 3MXUA 3TN2A 2H4OA 1IHZA 2FHTA 5KIXA 3ULPA 5K36G 4JBMA 3BDLA 4M8AA 4ME5A 2EZVA 3VA7A 2ZTDA 3JAML 4NXMQ 3I8ZA 4P72A 2N88A 5IE8A 2H5XA 3NE5B 1PA6A 2CKZB 1K0RA 5LL6S 2ICEC 3CC7A 1WD0A 3GV3A 4AYBE 2CHBD 4DV1Q 4JBKA 2E2IB 4OEMB 2OQKA 3Q23A 2F0QA 1WTQA 2EY6A 1TQOA 4JI4Q 2Z9HA 3NQIA 4OL7A 4X65Q 2F4VL 4QUCA 1RHPA 2HD3A 1GUGA 4B3RL 5FO9B 3TS2A 4A3JG 2R3ZA 4HJ8A 2LY7A 4N9PA 1OXSC 4J6HA 2SOBA 1Q81C 2H1EA 2N49A 1TS4A 2RSOA 3T13A 2XIWA 1B2TA 1Q8KA 2JA8H 4A3DG 1YVCA 2CWAA 4UP8A 1S5BD 1K8OA 3HP3A 3AYHB 3K0YA 4LF7L 4PG3A 4HTHA 3VDYA 1TWAB 1SEBD 2K03A 5ELBA 3I56A 3K0XA 4A3JB 1EIHA 1A2UA 3PF4A 1PFNA 1EEID 1U4PA 1IKMA 5LMUQ 1FJGQ 3LGJA 1X9NA 2AWNA 1BBXC 1H9JA 3QO2A 2AQ3B 1XNQQ 1PRTF 1QVGA 4DKAC 3T1YL 4ZK9B 1PHJA 3CPFA 4HIDA 3GTGB 1G6ZA 4R4CA 3S17H 1VQGA 4U673 1OXVA 2NZ1D 2JA7B 4A3CG 4IN3A 2DJFC 3A56A 4DAMA 1RJTA 2VW9A 1QNKA 1L2FA 4C56C 2KQ3A 4OELB 1ASYA 4FP5D 2G9DA 4J8QA 4BWGB 1Q86C 4NW2A 4QL5A 4EQNA 1I4RA 1F9QA 2KCNA 4OIJA 4APVA 4JI4L 2KJXA 5JJZA 5AJ3Q 4C2MB 4A4IA 2XWJB 2XN9C 4DV1L 1PZJD 2M2LA 1ONLA 2Y0SB 3A5ZB 3LNNA 3H0GG 1EY0A 5KYIA 1SLJA 2EJFC 3PF5A 4FF2A 3I4NG 4CHTB 2E8GA 1S72A 1FVIA 1IW7D 5M3MG 2N78A 1DYQA 2A5HA 1CTMA 4KKTA 3SVMA 3KJPA 3GTGH 4JG2A 4ZAIA 3P20A 2ZT9C 2EPBA 2I5MX 4C1NI 1EQQA 1X6OA 1VQIA 2K04A 3VR4A 2V1CC 2EY2A 2L15A 2CFMA 1IBLQ 4EGVA 2HDLA 3UDIA 1U4RA 5D65A 3I73A 1JB7A 3H09A 1PH3A 2C35B 5M5XH 3M4OB 1A2TA 1KAWA 2F0FA 1FYCA 1B53A 1SROA 3HOVG 1D2BA 1DZ1A 2UUCQ 3GTOH 2J4XA 2K33A 5BN4A 3UDGA 1SFOH 5CV6A 3U4VA 3V2TA 3CD6A 3HOZB 3V05A 1IYVA 4OX9Q 2KCTA 1R9TH 2D0OA 1A62A 1W6JA 3KBXA 4JI7Q 4HSVA 2GA4B 3RLNA 1IW7C 1G2SA 2EYJA 3FRPB 3PIO3 1FNUA 1F77A 2MUYA 2AUJD 1CQFA 1WJJA 1NAPA 3IL8A 1F2LA 2LKVA 4RGNA 2Q2UA 5IWAQ 3I3CA 1UAPA 1YBYA 3EROA 2K6AA 4HCEA 4KMUC 2K14A 4JW0A 5GQOA 5F2DA 1KDAA 2K50A 5C4JH 1JE4A 2IY5B 3MFGA 2XTIA 3MZ5A 3ND8A 1N34L 3E6ZX 1C7YA 1MSHA 1K83B 4BY1G 3RZOH 1UEBA 2OF1A 2JE6I 3NBIA 5GAEC 1S5CD 1N32Q 3CCUA 1S5DD 4K0KQ 1X65A 3U4ZA 2NTTA 3A8IE 2I07B 4O42A 1B4OA 1YITA 5C5MA 1XNQL 1X32A 1SFOB 5LMNL 4JI7L 1D5ZC 1GKHA 3S15B 3CCRA 4A3IB 4N8FA 4O1NA 2VNUD 1NJIC 2FINB 4GKJL 2HIXA 4JYAL 4LW1A 3OIQA 4UAIA 2B29A 1NMGA 5DNFA 4BY7H 1BO0A 1K3BC 2DNCA 1LT5D 4BBRB 1A3TA 4CDEC 4DR4Q 4LJZC 3RLOA 3JAMi 1E0BA 1KAAA 3KLRA 3CMAA 3MTSA 3QIAA 1XMQL 4HJ5A 2BH8A 1QUQB 2JK8A 1ML0D 2EJGC 1XWEA 3J7A5 4KD4A 2E2JH 4OX9L 1HRJA 1FGBD 2NWGA 2KVMA 3TZUA 2RSNA 3HRZC 2E5LQ 1I4PA 4DV2Q 4ABNA 2ZXRA 3BVGA 2HDMA 4OXPA 3CCLA 1C0AA 1D7QA 2WB1E 4S3SA 5FLXE 3HOUH 1JJ2A 2ZTEA 1KTKA 2K5NA 4C3IG 5C0XH 3S15H 3M4PA 2A6HD 3T56B 4A3FH 3HEJA 3FVQA 4ZYSA 2AUKA 4RH6A 2EYPA 2L0CA 4LF8Q 4WRDA 4R8NA 4X66Q 2X69A 1SNPA 1VMPA 3K5OA 3BZKA 2P5ZX 1LT3D 4JC0A 4LFCL 1EY7A 4ZUIA 3PMFA 2NZOA 4P71A 1PLFA 2Z8LA 3PUWA 4IZ8A 3NPPA 2ZTCA 2A69C 2K5VA 1C8CA 1IKLA 1HR0Q 1UE5A 1EZ6A 1UNSA 2F0KA 5CV4A 4YHHQ 1N32L 1HUMA 3B6YA 2X6LA 3KF8B 4TQUS 1Y8PB 2OTLA 2HHHL 3J81i 1LTAD 2B2YC 3S1QH 1TWFH 3NXWA 4FXKC 1SNDA 2NTSA 4DUYQ 2C9OA 4IUPA 2IHFA 2K05A 4O2DA 4LK1C 3GDEA 1JT8A 2RCFA 1ASZA 5A2QE 2SNSA 4KJOA 3ONAB 5HGQA 1F2ZA 5ELEA 2F03A 2CH4W 4LF6L 2UUBL 1EYCA 5FLMH 3ER0A 2R93H 3PO3G 2FFKB 4PQXA 3W1GA 4CGYB 5EAYA 1UE1A 1VQ6A 3VYTA 4H0LC 4GLXA 5GROA 2Z6KA 1Q12A 5M3MH 2PO4A 3U58A 3J80c 4L5RC 2L4NA 3SGIA 4P74A 1VQHA 1MSGA 2LFNA 2ZXOA 1TVXA 2ICIA 1NBWA 4JI5Q 3T1HL 4A3GH 1Y1WB 1EQRA 4P2CB 1SJED 1F9SA 1Y1WH 4BY1B 3TRZA 4C3JB 4GN5A 4RAUC 2VB2X 3VR3A 2NVTB 1T5EA 4WJ4A 1Q3LA 1OXTA 4RKBA 4KK7A 1JC7A 4F8MA 3FPUB 1KNEA 4J15A 2A69D 1BCPC 2SNMA 1EY5A 4DR3L 3Q6SA 1HZBA 1MI2A 1DD2A 3X3MA 1STEA 5DM73 1UE6A 1LV9A 3BDOA 2QDBA 1YHBA 4B3RQ 1PH5A 3PIP3 2YV5A 4GOPB 4JV5Q 2L1BA 3GTJH 5BR8Q 3OMCA 1PTOB 2HT1A 1DOMA 5IT9c 2VZAA 1CK1A 4DV0L 1WOCA 2RBMA 1LTGD 1PXUA 4LF8L 3I4MH 3QG1A 4B3TQ 1HXYD 4LF9Q 3CQZH 4BBSH 3DWAA 5FLXc 1GHJA 4DNRB 4F88A 3NP8A 2D5DA 4KHVA 2NVYB 1SNMA 1ENCA 5KNCA 3CCSA 4A3BH 5ISRA 1CKNA 1VQDA 1Y8OB 2F0VA 1TY2A 5ELCA 2RF4A 1H9SA 1B8AA 3JAMc 1LLRD 3GO5A 1STAA 3AU7A 2F0UA 1V43A 1O7ZA 1BUVT 4X3TA 1BBUA 3T1YQ 3MXNB 3BJUA 3I70A 4B3TL 5C4XB 3AFPA 3FKIG 4PZ6A 4V0BA 3H3VI 3HS0C 1XTCD 4BY7G 1BXTA 3CQZB 3J80L 1DJRD 1HPCA 3FEWX 3WDNA 3RZDH 5C3EH 4ID6A 1K73C 1IYJB 2B39A 1YNJC 4KTAA 4R8IA 4HCSA 1I4HA 4U68A 2HQLA 5LMNQ 2OEOA 3C1FA 5J22A 3F2CA 3DWQA 2D2CC 4A3JH 1WI5A 4A3MB 3DM3A 1SE3A 1YJ9A 4RCNA 1EU4A 5G3LD 2F3WA 2F0JA 2BE5D 4MIUA 4R4QA 4A3DH 1SNQA 2JA8B 4XIGS 2E2IH 4YHHL 4QIWE 1Y1VB 2E2HB 1JB3A 3EVQA 4JI1Q 1VQBA 1VQJA 4I7AA 3W1BA 2QCPX 2M9VA 2E74C 2XVSA 4B08A 1CKOA 1TKWB 3KF6A 4K8IA 3TSSA 2EIFA 2DGYA 2EYOA 2UUAQ 5JEAG 4C3HG 2WIIB 4KN7C 1HNXL 1ZKOA 3DHQA 1WCMG 4QCLA 4LWCA 1GXDC 2O4XA 4P73A 4B9XA 4R1JA 4DN4M 4UDUC 2F0MA 3I91A 1PFSA 1E2VA 1YJNA 2JA6H 2JA6B 1VQKA 1PTOC 2UUBQ 3GQBA 4PMCA 1KNAA 3HKZB 1RODA 1QILA 3A74A 2MFIA 4QGUA 1FNWA 1HNWQ 3HKZG 4PV1C 4Y52H 5EJWA 4PNYA 1GO3E 4X65L 5IY0A 4DK0A 1T5XD 2NVQB 5EKLA 1VQ5A 2CW0C 1PH8A 3X3NA 1EYGA 4DNIA 2ATWA 1TS3A 1I50H 3BYTB 1KLUD 1KABA 3K7AH 2NVXH 1S5ED 3M3YB 1SAPA 4IPCA 4RA8A 3CU7A 3H0GH 4A3DB 3M85A 2BH2A 1TT2A 1PH4A 1IYUA 5A35A 5CORA 3I4NH 4CJ1B 2PNHA 4YWKA 1Z7TA 2RDFA 3HOWG 2EQSA 1R4PB 2UXDL 1SRUA 1Z6HA 3OYYA 3HG9A 3A7AB 4GNXC 1K9MC 1X3PA 1VF7A 1SDFA 2KEDA 3A8KE 3MEHA 4GKKQ 4FXDA 3ERSX 3PUVA 2TSSA 1IBMQ 1PFMA 2E76C 2VY3A 3H91A 4XT1B 2PI2A 4YCWA 5E4XA 1MBYA 1XXGA 2EJMA 4O0AA 1HA5A 2A6ED 2K32A 2VQFQ 5C44B 3HOWB 2I5LX 3K6OA 2N55A 1EIFA 5I6WA 5JJKA 4FF4A 4LF5L 1ENFA 5E3FA 3CAMA 3R8BA 2IT1A 1BQQT 5TSSA 4GKKL 3T1HQ 4KHPQ 2NUCA 5BR8L 1JMCA 2YTXA 5E4WC 5I2YA 3ICEA 1X55A 5JEAJ 2FMMA 1W6KA 1KQSA 3E0EA 1STNA 3NQTA 4C3JG 4EX5A 1I4GA 3QB3A 3CP0A 2OTJA 3QOLA 3OWEB 1GUTA 4DR5Q 1LT6D 1A15A 1HFGA 3P1HA 1NCVA 3A5UA 1XMOL 1O7LA 3S9WA 1RD9D 3SEBA 2JA8G 1B9MA 3SDZA 5J39A 5M5YB 3T53B 5C0XJ 1CKNB 5KGUA 1OXUA 1BCPB 1EIGA 1QNUA 1LTLA 1H9KA 4IPHA 4B3SQ 4PZ8A 1I3QH 3PCOB 1KD1C 4L5TA 2DY8A 2O5JC 3CC2A 3GTQB 4GZYC 4NB3A 3T16A 4K6LA 5I9OA 1NTGA 1QJOA 4A3KB 4HEDA 4ME3A 4G7OC 1H9MA 3CPWA 1XMOQ 5T1IA 3BG3A 1AP0A 1I6VC 2R7FA 4GNXA 1BKBA 1IBML 1MD2D 1VQ7A 1QG7A 5I6YA 3LWUA 4POFA 1HTPA 1M8AA 3BZDB 2JA7H 5CBAE 4JPBW 5E1FA 5LMUL 1FJGL 2RQXA 1RTOA 5A2QL 1LYLA 4RGOS 3QOJA 1S3OA 5M3FB 3D8GA 2PQAA 4XDXA 2PCFB 5I9PA 2AHOB 4BXXG 2B8FA 3MA2B 3CHBD 3KF6B 4DV5Q 5C3EG 1AFPA 2QA4A 4GLVB 3AMUA 1XPUA 1G6PA 1N8RC 2ES2A 1F9PA 4A93H 1KC8C 1GJXA 4LFBL 1K3RA 2IX3A 1EOVA 2VB3X 2WACA 3J7AV 4NPSA 1RF2D 3TP7A 2MGSA 3NEMA 4NXML 4A93B 4LMQD 4BS9A 4IJLA 2GVBA 3D0FA 2B2WA 4NMZA 4QUFA 3BU2A 1EIYB 3OW7A 3J80i 4FXGC 1J5EL 4JI6L 2F0NA 3CC4A 1JOKA 4HJAA 1FL0A 1QZHA 4KLKA 5IGFA 1NR2A 3IRBA 1AE2A 3TP8A 1K8AC 3K7AB 2NVXB 2F1MA 5IP9H 2ZM6L 4LF9L 1X3EA 1NSNS 1E1TA 3GTOB 4HR7B 2Q8TA 3EFXD 1QCBD 1W2BA 2VL6A 4JYAQ 3FHWA 3WWVA 1GUWA 4OGQC 4AQYL 1WCMH 4JVZA 2QF7A 4XQJA 4OWXB 5HURA 1B44D 2WAQE 1QOHA 4IFDH 3PUXA 1F9RA 1A63A 1PTOD 4G7HC 1X3QA 5J3BA 5EPJA 4KY5A 2L11A 3MEFA 4AH6A 5C4XG 3CMEA 4GOPA 2EDGA 4CKEA 4IFDI 1HNZL 4JBWA 4DR2L 5AJ3L 5IODA 4JOIA 3OOCA 4DV4L 2BDNA 4HMJA 3S1MB 2EY1A 3R3OA 1TWGH 1XTDA 4PMBA 3KLSA 2QEXA 2CVRA 1VF5C 3BS1A 1HCZA 3AFQA 3C46A 2KA7A 2WFWA 4MTKA 4R4IA 2R93G 4IUTA 1Q90A 4BA1I 1X3FA 2K5DA 2B63G 4DF7A 1PRTD 4R4TA 3CCVA 3NHHA 4C3IB 2NN6H 1M4VA 3GTKH 3HOWH 2JA5G 1D1IA 5H1SE 3NTHA 1EYAA 3W5OA 4XQNA 4IJHA 4UP9A 3HOXB 5JOBA 1EWHA 1PZID 2AKWB 4L5QA 5IGGA 1DXMA 5C0XG 4RGTA 5CGKA 1WVLA 5C3EB 1PH9A 3RZDB 1J8IA 3F2BA 1I94Q 1XPRA 2EE1A 2PW5A 3NWTA 4DK6C 3OIPA 1BDOA 3ZJYC 2R7ZG 5LHY1 4Y7NB 2B2UC 1EYDA 2WP8J 3PIOA 2EYMA 2KCCA 1B9NA 1ZYRC 3GTKB 1TWAH 2L55A 3TMEA 4OWTB 2KECA 1M90C 2F3IA 4E6IA 1GOZA 4CKBA 4L6TB 3OSOA 5GAGC 2V4DA 5L37A 2MNAA 3N52A 3D6CA 1C9OA 3G71A 2PI2E 1HZ9A 3RZOB 4K2LA 4YWLA 2ZJPA 3HOYG 4JI8Q 4DR1Q 5C4JB 2DJGC 3KDFA 1SYFA 2UUCL 1B3AA 4X66L 5ELOA 1HH2P 2DNEA 4C1NK 2HCCA 4CDCC 3KLSX 4Q0FA 3BVMA 4ZLTF 2F0OA 1JORA 4LAAA 3SE0A 5C44G 2A73B 4GLAC 4X6AH 4I65A 2QILA 4DUYL 4GNXB 4LF4Q 1Q7YC 4BBSG 2OT2A 4BY7B 1PVOA 5EBDA 3E9HA 3GV6A 5FK9C 4QF4A 2FXQA 2L5TA 4A3BG 3STBD 3MXPA 5K5PA 3NBHB 4A3IH 4RHSA 4X64L 1YIJA 1VS0A 2K7VA 5AFWA 4BBRG 1WD1A 3PQIA 1TWCB 5CV5A 4DV3L 2UXCL 4RKLA 1R9TB 3GTLH 3S1MH 2N3SA 1H9SB 3HOZH 1D1KA 4AQYQ 1CUKA 1ILPA 1EWIA 3SK6A 1ZYRD 1FR3A 1J9OA 1NR4A 3TDQA 2A1AA 1E7ZA 1B7YB 2IPKD 5T1GA 1LUZA 3GD7A 3V96A 1CQVA 2UUAL 1V1PB 4DR4L 4LUOA 1P8LA 1HUNA 2ALYB 2CCZA 2ZM6Q 3MC0B 2YU9H 2WAQG 4FF1A 2JN4A 4FVMA 1WTWA 1Y8NB 3CRKC 1LO5D 2F0SA 4DV3Q 2UXCQ 3FPPA 3M9BA 3RNUA 3IFTA 3MWYW 4DV2L 1UUPA 3E5SA 2E5LL 2B2YA 4P75A 4JI2Q 3I7FA 3PO3H 1EWCA 5EKKA 5IP7G 5IYCH 4X62L 2CWPA 2ENBA 2OCEA 1EY9A 4LF4L 3S2DH 3I4LA 1Y1VH 2E2DC 1VQLA 1CSPA 4LUZA 3HKSA 4JK1C 4LFBQ 2IX0A 4NP5A 1II3A 1HNXQ 5C5LA 2YYZA 2PW7A 1NNXA 1V8QA 5GAHC 2OQ0A 2RCNA 3BDCA 3I4MG 4XYOA 5JJLA 1CM9A 2LXJA 5IP9G 1PZKD 4QMGA 3EA6A 4DK3C 2F0HA 1YI2A 4MN3A 1RTNA 3D31A 1EOTA 3HGBA 3DM1A 2I5HA 1TXYA 3P7JA 2Y0SG 2YTYA 3GTMB 4GKJQ 1SYDA 4DV6Q 5EBCA 1WTRA 1AZPA 3VR2A 3FKIB 1VQPA 3DMUA 5FO7B 3K81C 1SE2A 2EVBA 3UI2A 1N9WA 2RA4A 5M3FH 4RHRA 2WKCA 1PRTB 2F52A 4XTCS 3G6EA 3GTQH 1B1ZA 1ESRA 5IYBH 1HQRD 1YNJD 3BYYB 3A55A 4IURA 5C4XH 3TQYA 1QUQA 4DK1A 1Q1EA 1WTVA 2B2UA 2MQHA 3OMGA 5DM63 1K0SA 4MNOA 4YCVA 4YY3Q 1PV4A 1HTLD 4N9TA 1ICWA 2A6HC 4TVAB 4DGZA 1TS5A 3HOUB 1EFID 1VQCA 1STYA 2SEBD 1EQTA 1PH7A 5JJIA 4A3EB 5IT9E 1E22A 1NUCA 1KXLA 4K5XA 3K5LA 4DU9A 1IBKL 1YHQA 1U4LA 2F3VA 1STHA 1DCZA 3I4MB 3A7LA 1I6HH 2C5CA 4PMWA 2NN6G 4A3LH 1HA6A 1WTHA 2JA5H 1A3UA 1PDQA 2NN6I 2MHVA 3DWPA 3DLLA 1JQYD 4LFAL 4K14A 1IL8A 1PTOH 1E24A 1ESFA 5G3LF 1X56A 1C48A 3TZDA 3G7LA 1VQ4A 3J81E 2PMZE 2VQEL 5BN5A 1EL0A 4DR2Q 3KOJA 5KYLA 1TR5A 3EJIA 1CT1D 3K58A 3FP9A 2PQAB 3MHBA 1IBLL 5M3MB 1Q46A 5D3DA 4DR7L 2A68D 4IOAA 2D9UA 5JAVA 4K2KA 1VQ9A 3D3RA 4X3SA 2KUMA 4CDDC 1HNWL 3OTOL 3LWEA 1V1PA 2JA6G 3D4DA 2XRSD
chains in the Genus database with same CATH topology
2QW7A 4N8X1 2RCFA 4JW0A 4N8FA 4JVZA 4I7AA 2HD3A 5L37A 2Z9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QW7 A;  4N8X 1;  2RCF A;  4JW0 A;  4N8F A;  4JVZ A;  4I7A A;  2HD3 A;  5L37 A;  2Z9H A; 
#chains in the Genus database with same CATH topology
 3NBH A;  1GUO A;  5FJ8 H;  1Q82 C;  4C3J H;  2YTV A;  1YZ6 A;  3IAY A;  1O7I A;  2Q8R E;  4ZKC B;  4ZCK A;  1JCK B;  4DAV A;  1LTR D;  2D0P A;  4PZ7 A;  1K83 H;  1GM5 A;  4JI0 L;  3L0O A;  1SBB B;  2LSS A;  2MPM A;  1CI3 M;  2LS0 1;  3C1E A;  5KND A;  5D14 A;  2JEB I;  1HZA A;  2F0T A;  4DUZ Q;  4ILW A;  5IGE A;  3MVV A;  4XYQ A;  3S1Q B;  1KDB A;  3S1R H;  3GTP H;  5M9O A;  3WOE A;  3R2I A;  4LF5 Q;  3H3V H;  4DXG A;  1JJG A;  2VXW A;  2XRQ D;  2HQE A;  4EQP A;  5LL6 X;  2BA0 A;  2PQE A;  4DV4 Q;  4C3H H;  1OXX K;  2RDH A;  4K0K L;  1KL9 A;  3KK7 A;  4DR6 L;  1S5F D;  1WTO A;  1WFQ A;  2LXK A;  2B2W C;  2O2L D;  1N34 Q;  2PZU A;  4RG1 A;  4H13 C;  2R92 H;  1SR3 A;  3S14 H;  1I4X A;  4DFA A;  2L12 A;  2EXD A;  3PV0 A;  3RLF A;  5CC4 A;  4L5S A;  3S16 B;  3JC6 6;  2JA7 G;  4JI3 L;  1STG A;  2EY5 A;  4H02 A;  5JVG 3;  3I55 A;  3NK9 A;  1RIP A;  1QE6 A;  2E2H H;  3M4O H;  4Z9C B;  1Z9F A;  3IFD A;  2DUD A;  4KJN A;  2WV6 D;  1CKM A;  4JI3 Q;  1FGU A;  3PO2 B;  2AMC B;  1WTX A;  3KBG A;  1SYC A;  2PMZ B;  2QDL A;  4DAP A;  4UY8 C;  2RHQ B;  2KEE A;  2ZJQ A;  2SDF A;  3S1N B;  1PH2 A;  2B63 B;  4DR5 L;  1LTB D;  3F8T A;  4JCV E;  2WB1 B;  2Q8I B;  4AYB G;  3U9O A;  2L9H A;  4F7X A;  1SNC A;  1L1O C;  3K5M A;  3KUP A;  3OTO Q;  4B9W A;  1VCI A;  4IUV A;  5CYU A;  2IHE A;  1H9R A;  4FDB A;  1IXR A;  4IOC A;  1ET9 A;  3NUC A;  5HY6 A;  1ZEQ X;  3I90 A;  4CDF C;  1MIU A;  2X6G A;  1RL2 A;  3RUZ A;  4DUZ L;  5ELD A;  5IYD H;  1GUN A;  1KDC A;  1NY4 A;  2CW0 D;  3SK5 A;  1VMC A;  3HOV B;  4HSP A;  3SXH A;  5I4D A;  3Q22 A;  2F0L A;  2PZW A;  2TMP A;  3AEV A;  2JQO A;  3AQQ A;  3S1N H;  4YIJ A;  2LMC B;  5ELN A;  4LNQ A;  2VUM G;  2NVY H;  4ZRZ A;  2AWO A;  5CMD A;  1KLG D;  5M3F G;  2XNA C;  4LUV A;  2R6G A;  4XXE A;  1J5E Q;  4JI6 Q;  1IBK Q;  5ELF A;  2UU9 Q;  1WCM B;  5J1Z A;  2IL8 A;  2K52 A;  2K5W A;  4L8J A;  3A0J A;  4HIM A;  2N8N A;  3NSW A;  1WTP A;  2QGQ A;  4WFN 3;  1VQA A;  1L1O A;  3SK4 A;  3G4S A;  4POG A;  3Q0A A;  4IQZ A;  1L1O B;  2ASB A;  4L63 B;  1BCP D;  2WB1 G;  1SMX A;  1LAC A;  3TRE A;  2PNR C;  4DV6 L;  4GN4 B;  3F1Z A;  2NB0 A;  1XNR Q;  2PPB C;  2JXM B;  4A93 G;  3J80 E;  1L0W A;  2BE5 C;  4IUU A;  3C3L A;  1ET6 A;  5C0X I;  2NVQ H;  4G4K A;  2BA1 A;  4OIK A;  5KEE A;  4V19 0;  4RMF A;  4TSS A;  3PUY A;  1TU2 B;  3NEN A;  5K36 H;  5CV7 A;  2KHJ A;  3K7U C;  1LAB A;  1QVF A;  4A3M G;  4A75 A;  2F0I A;  3PSI A;  1M1K C;  1S40 A;  5EPK A;  4RWS C;  3SHL A;  3K8A A;  1JIC A;  1EFW A;  3CCQ A;  4JI2 L;  2O5I C;  2XGT A;  4X3K A;  2B2V C;  4LF7 Q;  1PH6 A;  2R7Z H;  1VQ8 A;  4KY7 A;  4UHV A;  1BR9 A;  2B2T C;  3O13 A;  1QVC A;  4RFB A;  3VYU A;  3DEO A;  4WJ3 M;  4IPD A;  1DOK A;  1DON A;  4BXX H;  3RD4 A;  1VQM A;  2JA9 A;  5C3X A;  1HNZ Q;  2F4I A;  4IFD G;  1FNV A;  3F2U A;  2HHH Q;  2D62 A;  4JI0 Q;  5M5X B;  4DPG A;  1QZG A;  1Z47 A;  1DOL A;  4DV0 Q;  4A3C H;  2F0W A;  4CKC A;  1BVS A;  5FLX L;  1U4M A;  1SN8 A;  1SYE A;  4H44 C;  2PYK A;  4MZ9 A;  3L9A X;  3HOX G;  3IKJ A;  2BDO A;  2K5Q A;  1PTO F;  3ZYY X;  5LMN W;  2VQF L;  1UEA B;  3KYH C;  5C4H A;  1T9H A;  2Q2I A;  2DN8 A;  3G6J B;  3K57 A;  2R93 B;  2HUG A;  2F0E A;  2A68 C;  4FNF A;  4OO1 G;  3R93 A;  2OXP A;  1X54 A;  4F87 A;  3RR5 A;  1GHK A;  2K75 A;  1BBW A;  1LTS D;  2CQA A;  2DY7 A;  4A3I G;  1E1O A;  4BA2 I;  1SE4 A;  1EUJ A;  3CF5 A;  4C2M H;  3KJO A;  2CQO A;  3K59 A;  1JJC B;  5IGD A;  1RCV D;  2A19 A;  3GTM H;  3I4O A;  1HQM C;  2KHS A;  1QWY A;  4MHE A;  2FMC A;  4EQO A;  1BOS A;  2JP1 A;  5DLQ E;  2RHS B;  4DA2 A;  4A3F B;  3C2P A;  4K5V A;  2ID0 A;  2JEA I;  4KKS A;  1V1Q A;  4NXN L;  3UDX A;  4Y7N H;  4DV5 L;  1P16 A;  2UXB Q;  3ND9 A;  4H7B A;  2XSC A;  4FO2 A;  4IUQ A;  2MP1 A;  3L2P A;  2Z0S A;  1UE7 A;  4G7Z C;  3KLW A;  3L3O C;  4AIM A;  4KHZ A;  2KOL A;  4JV5 L;  2E2J B;  3W3A A;  3J7Y W;  1CFM A;  1E2W A;  3BVZ A;  1D5X C;  3URY A;  2B3G A;  2B63 H;  3GTJ B;  5IYC G;  3KF8 A;  4IPG A;  1Q1B A;  1CHQ D;  1C4Q A;  3HOY H;  5DEH A;  5EQ0 A;  1LTI D;  2KCM A;  3H3V C;  2I46 A;  3S2D B;  1TY0 A;  2Z1C A;  4OWW B;  2F4V Q;  4R4O A;  3OHX C;  5JPM C;  3TS0 A;  2M00 A;  1O78 A;  5C44 H;  4LF6 Q;  1XPO A;  1D5M C;  4HIO A;  1HHV A;  4HAE A;  3S14 B;  2K5H A;  4TRD A;  3NEL A;  4G57 A;  3GTL B;  1IL2 A;  1TWC H;  3J81 L;  1EZ8 A;  1VQE A;  3WOF A;  4BY1 H;  3J81 j;  4A3K G;  4NXN Q;  1KHI A;  1XX8 A;  2B8G A;  1L0Y B;  4BBR H;  3VR5 A;  1DGS A;  2EYF A;  2JJQ A;  4A3G B;  1V1O A;  3PO2 H;  3W2D A;  4HJ7 A;  1HFN A;  1H95 A;  4HMI A;  1KRS A;  3TP6 A;  1U0L A;  1VQN A;  1STB A;  1ILQ A;  4HN7 A;  4IO9 A;  4X64 Q;  1HR0 L;  4KHP L;  3I2Z A;  2UU9 L;  3S16 H;  3GP7 A;  5COY A;  2QW7 A;  5KNB A;  1ENA A;  4DR7 Q;  1B3Q A;  3D6W A;  2QEJ C;  5M5W H;  1KIX A;  1UWV A;  3S24 A;  2K1B A;  4GS3 A;  1E3P A;  2WAQ B;  4C3H B;  1SJH D;  2JSO A;  3VR6 A;  2JYO A;  1VQF A;  1RKN A;  2Y0S E;  2Z6K C;  3S1R B;  3GTP B;  1BF4 A;  4WJW A;  5IP7 H;  2KBN A;  2HCI A;  3DEP A;  4A3M H;  3J7Z C;  1U5K A;  1S4Z A;  3HOZ G;  3HOU G;  3D4W A;  1ICF B;  3ULJ A;  5E7N A;  1O80 A;  3F2D A;  4FF3 A;  1CHP D;  1K8M A;  4NDX A;  5NUC A;  4OO1 I;  3FMC A;  3STB C;  1XMQ Q;  1GUS A;  1U9R A;  4KN4 C;  2RDG A;  3NWS A;  1JWS D;  1AW7 A;  1V9P A;  4ZKB B;  1CZW A;  1PYS B;  4YCU A;  4EQ5 A;  3M4Q A;  1MGS A;  1MHW C;  2IW3 A;  3E9I A;  1JWU D;  2ZXP A;  3SR1 A;  2J7Z A;  3M7N A;  3EBE A;  4DXF A;  1YEZ A;  5FJ8 G;  4QB4 A;  2XWB B;  4IFD J;  3CW2 C;  3RN5 A;  1CZG A;  1TWH B;  3MXN A;  4XQQ A;  3UDF A;  3QJY A;  1G29 1;  3E0J A;  3Q8D A;  1TS2 A;  3T4A C;  3NTI A;  5FO8 B;  3T51 B;  1Y1V G;  1TWG B;  3HOX H;  1B50 A;  5EPL A;  1N36 L;  3H6M A;  1NE3 A;  3M4Y A;  5I2X A;  3A54 A;  3CKI B;  4K5W A;  5C6A A;  2EYL A;  4OON A;  4MTN A;  3TEH B;  1AZQ A;  4C3I H;  1IZ6 A;  4HJ9 A;  1FD7 D;  2NYZ D;  4A3F G;  1X3G A;  2GN5 A;  3E3X A;  3MAQ A;  4OO1 H;  4I7Z C;  4TKO B;  4A3E H;  1G8Z D;  4B3S L;  1HZC A;  2IWH A;  1CA5 A;  1GD7 A;  4JI5 L;  3BZC A;  1MJC A;  3DUZ A;  4A3L G;  3K80 C;  4XT3 B;  1MKH A;  2G9H D;  3U9S A;  1E2Z A;  1ZXT A;  1N36 Q;  1PMR A;  1OO9 B;  1PYW D;  2R92 B;  1SXT A;  1J6Q A;  5IYB G;  2A8V A;  3L7Z C;  2F0G A;  3MXG A;  3DXJ C;  3H94 A;  1O7Y A;  3UE0 A;  2Q2T A;  4LFC Q;  3TP5 A;  4DV7 Q;  2ZJR A;  1Y1W G;  4A3B B;  3NTK A;  1BCP F;  2AQ1 B;  2Z4H A;  1PRT C;  2NVT H;  3OWF A;  3K5N A;  5HGT A;  4B3M Q;  4BBS B;  2AQ2 B;  1EY6 A;  3H15 A;  3FDT A;  4DV7 L;  2R7Z B;  3SK8 A;  3CCM A;  4UPA A;  3D4R A;  2CH4 A;  2UXB L;  2EXZ A;  4JI1 L;  1YNN D;  4UP7 A;  4EVO A;  4WOR A;  4OHJ A;  4R9W A;  5C4Z A;  2OWO A;  2Q2H A;  4KY6 A;  1L0X B;  4X62 Q;  4QQB X;  5CR3 A;  1W3S A;  4ALP A;  1EU3 A;  5JVH 3;  2F0P A;  1NMF A;  2YU9 B;  4LFA Q;  1SMY D;  1G2T A;  1TII D;  3G48 A;  5CV9 A;  1DM0 B;  3CRL C;  1HR0 W;  1I4Q A;  1XJV A;  1Y69 U;  4YWM A;  4A76 A;  2FJ2 A;  2K4K A;  2VQE Q;  1JWM D;  1I50 B;  3RMH A;  3PO3 B;  4N8X 1;  2QKI C;  1K8G A;  5IOC A;  2K01 A;  1JR0 D;  1SSO A;  1QB5 D;  3MFY A;  4Q5V A;  1KRT A;  4ZQ3 A;  2KEN A;  1F2Y A;  1TWF B;  1YHA A;  2KHI A;  1AE3 A;  4CJ2 C;  4IUN A;  3P75 A;  1JOQ A;  2EYH A;  2NZH A;  4A3K H;  2UXD Q;  4HIK A;  3J81 c;  1LTT D;  5EGT A;  2GVA A;  3ULL A;  3PO2 G;  3S2H B;  3RN2 A;  3J7A F;  1YNN C;  4KD3 A;  4DAY A;  5KRU A;  1LM0 A;  2WIN B;  2JA5 B;  5CV8 A;  1F2M A;  3EN2 A;  3R2T A;  2IX1 A;  2A74 C;  2IJ0 A;  4IAL A;  4QY7 A;  3I72 A;  1D8L A;  4DR6 Q;  1I6H B;  1Y14 B;  3VYS A;  5C3W A;  1EY4 A;  3UE1 A;  3U50 C;  3EIV A;  3JAM E;  1YNX A;  1JE5 A;  3LX0 A;  3CXC A;  3AB9 A;  4FYD A;  1GVP A;  1EY8 A;  3QR8 A;  4J1M A;  1XYI A;  2VS1 A;  5GAD C;  1A8V A;  1TWH H;  4B3M L;  3QWN A;  1SNO A;  3EQL C;  4NKL A;  3HZX A;  3M7G A;  3PUZ A;  1YJW A;  4DAY B;  4RGM A;  1AEX A;  1WYD A;  1EQV A;  1A0I A;  3HOY B;  4RCO A;  1I3Q B;  5FLM G;  1PH1 A;  3ITP A;  2VUM B;  1PYB A;  2R7D A;  2Z6B A;  5M5Y H;  4ODG A;  1I5F A;  3OW2 A;  3S17 B;  2PZT A;  2R92 G;  1AH9 A;  1B70 B;  3PGZ A;  3HFZ B;  4YY3 L;  1CSQ A;  4A3G G;  2NBF A;  4DNT B;  5IYD G;  5FOB B;  2BOS A;  3FKI H;  1D6E C;  2Z4I A;  2EOT A;  3PIP A;  1A6X A;  3ERQ A;  5JPN C;  1HJP A;  3HKZ E;  1XNR L;  4KV6 A;  1RDP D;  3CCE A;  4AYB B;  5IWA L;  3HOV H;  4JOI C;  5JEA H;  5EKI A;  2MO1 A;  1OTC A;  1SYB A;  1I94 L;  5CBE E;  2BCO A;  4CBV A;  4X3U A;  2VUM H;  1K28 A;  4K8J A;  4GOP C;  2K28 A;  5IGB A;  1N33 L;  3I4N B;  2G5D A;  2MO0 A;  3CCJ A;  2MJ8 A;  5D3I B;  1MJE A;  1EEF D;  4KKU A;  3VYR A;  5IIF A;  3N6R A;  4JBJ A;  1SMY C;  5IGC A;  4JI8 L;  4KI0 A;  4DR1 L;  2HIV A;  5FKA C;  5M5W B;  4GN3 B;  3VA5 A;  1A3V A;  1VQO A;  1SE8 A;  4QIW B;  5DAU A;  4M1U B;  1G51 A;  2RVL A;  4ZUJ A;  4K6D A;  2E75 C;  3KFU A;  1AN8 A;  4QJF A;  1JOO A;  1R4Q B;  5IT9 L;  4DR3 Q;  2I0Q A;  1N33 Q;  3A8J E;  1PFB A;  3OPO A;  1CA6 A;  5BN3 A;  2WKD A;  2B2T A;  2F0D A;  3H0G B;  3KDF B;  2A6E C;  1BNZ A;  1G91 A;  3TBI B;  4A3E G;  1SYG A;  2B2V A;  3M3Y H;  1LT4 D;  4ULL A;  3S2H H;  1Q8I A;  4CJ0 B;  1VDZ A;  2R61 A;  2RKS A;  2J0T D;  3Q24 A;  3MXU A;  3TN2 A;  2H4O A;  1IHZ A;  2FHT A;  5KIX A;  3ULP A;  5K36 G;  4JBM A;  3BDL A;  4M8A A;  4ME5 A;  2EZV A;  3VA7 A;  2ZTD A;  3JAM L;  4NXM Q;  3I8Z A;  4P72 A;  2N88 A;  5IE8 A;  2H5X A;  3NE5 B;  1PA6 A;  2CKZ B;  1K0R A;  5LL6 S;  2ICE C;  3CC7 A;  1WD0 A;  3GV3 A;  4AYB E;  2CHB D;  4DV1 Q;  4JBK A;  2E2I B;  4OEM B;  2OQK A;  3Q23 A;  2F0Q A;  1WTQ A;  2EY6 A;  1TQO A;  4JI4 Q;  2Z9H A;  3NQI A;  4OL7 A;  4X65 Q;  2F4V L;  4QUC A;  1RHP A;  2HD3 A;  1GUG A;  4B3R L;  5FO9 B;  3TS2 A;  4A3J G;  2R3Z A;  4HJ8 A;  2LY7 A;  4N9P A;  1OXS C;  4J6H A;  2SOB A;  1Q81 C;  2H1E A;  2N49 A;  1TS4 A;  2RSO A;  3T13 A;  2XIW A;  1B2T A;  1Q8K A;  2JA8 H;  4A3D G;  1YVC A;  2CWA A;  4UP8 A;  1S5B D;  1K8O A;  3HP3 A;  3AYH B;  3K0Y A;  4LF7 L;  4PG3 A;  4HTH A;  3VDY A;  1TWA B;  1SEB D;  2K03 A;  5ELB A;  3I56 A;  3K0X A;  4A3J B;  1EIH A;  1A2U A;  3PF4 A;  1PFN A;  1EEI D;  1U4P A;  1IKM A;  5LMU Q;  1FJG Q;  3LGJ A;  1X9N A;  2AWN A;  1BBX C;  1H9J A;  3QO2 A;  2AQ3 B;  1XNQ Q;  1PRT F;  1QVG A;  4DKA C;  3T1Y L;  4ZK9 B;  1PHJ A;  3CPF A;  4HID A;  3GTG B;  1G6Z A;  4R4C A;  3S17 H;  1VQG A;  4U67 3;  1OXV A;  2NZ1 D;  2JA7 B;  4A3C G;  4IN3 A;  2DJF C;  3A56 A;  4DAM A;  1RJT A;  2VW9 A;  1QNK A;  1L2F A;  4C56 C;  2KQ3 A;  4OEL B;  1ASY A;  4FP5 D;  2G9D A;  4J8Q A;  4BWG B;  1Q86 C;  4NW2 A;  4QL5 A;  4EQN A;  1I4R A;  1F9Q A;  2KCN A;  4OIJ A;  4APV A;  4JI4 L;  2KJX A;  5JJZ A;  5AJ3 Q;  4C2M B;  4A4I A;  2XWJ B;  2XN9 C;  4DV1 L;  1PZJ D;  2M2L A;  1ONL A;  2Y0S B;  3A5Z B;  3LNN A;  3H0G G;  1EY0 A;  5KYI A;  1SLJ A;  2EJF C;  3PF5 A;  4FF2 A;  3I4N G;  4CHT B;  2E8G A;  1S72 A;  1FVI A;  1IW7 D;  5M3M G;  2N78 A;  1DYQ A;  2A5H A;  1CTM A;  4KKT A;  3SVM A;  3KJP A;  3GTG H;  4JG2 A;  4ZAI A;  3P20 A;  2ZT9 C;  2EPB A;  2I5M X;  4C1N I;  1EQQ A;  1X6O A;  1VQI A;  2K04 A;  3VR4 A;  2V1C C;  2EY2 A;  2L15 A;  2CFM A;  1IBL Q;  4EGV A;  2HDL A;  3UDI A;  1U4R A;  5D65 A;  3I73 A;  1JB7 A;  3H09 A;  1PH3 A;  2C35 B;  5M5X H;  3M4O B;  1A2T A;  1KAW A;  2F0F A;  1FYC A;  1B53 A;  1SRO A;  3HOV G;  1D2B A;  1DZ1 A;  2UUC Q;  3GTO H;  2J4X A;  2K33 A;  5BN4 A;  3UDG A;  1SFO H;  5CV6 A;  3U4V A;  3V2T A;  3CD6 A;  3HOZ B;  3V05 A;  1IYV A;  4OX9 Q;  2KCT A;  1R9T H;  2D0O A;  1A62 A;  1W6J A;  3KBX A;  4JI7 Q;  4HSV A;  2GA4 B;  3RLN A;  1IW7 C;  1G2S A;  2EYJ A;  3FRP B;  3PIO 3;  1FNU A;  1F77 A;  2MUY A;  2AUJ D;  1CQF A;  1WJJ A;  1NAP A;  3IL8 A;  1F2L A;  2LKV A;  4RGN A;  2Q2U A;  5IWA Q;  3I3C A;  1UAP A;  1YBY A;  3ERO A;  2K6A A;  4HCE A;  4KMU C;  2K14 A;  4JW0 A;  5GQO A;  5F2D A;  1KDA A;  2K50 A;  5C4J H;  1JE4 A;  2IY5 B;  3MFG A;  2XTI A;  3MZ5 A;  3ND8 A;  1N34 L;  3E6Z X;  1C7Y A;  1MSH A;  1K83 B;  4BY1 G;  3RZO H;  1UEB A;  2OF1 A;  2JE6 I;  3NBI A;  5GAE C;  1S5C D;  1N32 Q;  3CCU A;  1S5D D;  4K0K Q;  1X65 A;  3U4Z A;  2NTT A;  3A8I E;  2I07 B;  4O42 A;  1B4O A;  1YIT A;  5C5M A;  1XNQ L;  1X32 A;  1SFO B;  5LMN L;  4JI7 L;  1D5Z C;  1GKH A;  3S15 B;  3CCR A;  4A3I B;  4N8F A;  4O1N A;  2VNU D;  1NJI C;  2FIN B;  4GKJ L;  2HIX A;  4JYA L;  4LW1 A;  3OIQ A;  4UAI A;  2B29 A;  1NMG A;  5DNF A;  4BY7 H;  1BO0 A;  1K3B C;  2DNC A;  1LT5 D;  4BBR B;  1A3T A;  4CDE C;  4DR4 Q;  4LJZ C;  3RLO A;  3JAM i;  1E0B A;  1KAA A;  3KLR A;  3CMA A;  3MTS A;  3QIA A;  1XMQ L;  4HJ5 A;  2BH8 A;  1QUQ B;  2JK8 A;  1ML0 D;  2EJG C;  1XWE A;  3J7A 5;  4KD4 A;  2E2J H;  4OX9 L;  1HRJ A;  1FGB D;  2NWG A;  2KVM A;  3TZU A;  2RSN A;  3HRZ C;  2E5L Q;  1I4P A;  4DV2 Q;  4ABN A;  2ZXR A;  3BVG A;  2HDM A;  4OXP A;  3CCL A;  1C0A A;  1D7Q A;  2WB1 E;  4S3S A;  5FLX E;  3HOU H;  1JJ2 A;  2ZTE A;  1KTK A;  2K5N A;  4C3I G;  5C0X H;  3S15 H;  3M4P A;  2A6H D;  3T56 B;  4A3F H;  3HEJ A;  3FVQ A;  4ZYS A;  2AUK A;  4RH6 A;  2EYP A;  2L0C A;  4LF8 Q;  4WRD A;  4R8N A;  4X66 Q;  2X69 A;  1SNP A;  1VMP A;  3K5O A;  3BZK A;  2P5Z X;  1LT3 D;  4JC0 A;  4LFC L;  1EY7 A;  4ZUI A;  3PMF A;  2NZO A;  4P71 A;  1PLF A;  2Z8L A;  3PUW A;  4IZ8 A;  3NPP A;  2ZTC A;  2A69 C;  2K5V A;  1C8C A;  1IKL A;  1HR0 Q;  1UE5 A;  1EZ6 A;  1UNS A;  2F0K A;  5CV4 A;  4YHH Q;  1N32 L;  1HUM A;  3B6Y A;  2X6L A;  3KF8 B;  4TQU S;  1Y8P B;  2OTL A;  2HHH L;  3J81 i;  1LTA D;  2B2Y C;  3S1Q H;  1TWF H;  3NXW A;  4FXK C;  1SND A;  2NTS A;  4DUY Q;  2C9O A;  4IUP A;  2IHF A;  2K05 A;  4O2D A;  4LK1 C;  3GDE A;  1JT8 A;  2RCF A;  1ASZ A;  5A2Q E;  2SNS A;  4KJO A;  3ONA B;  5HGQ A;  1F2Z A;  5ELE A;  2F03 A;  2CH4 W;  4LF6 L;  2UUB L;  1EYC A;  5FLM H;  3ER0 A;  2R93 H;  3PO3 G;  2FFK B;  4PQX A;  3W1G A;  4CGY B;  5EAY A;  1UE1 A;  1VQ6 A;  3VYT A;  4H0L C;  4GLX A;  5GRO A;  2Z6K A;  1Q12 A;  5M3M H;  2PO4 A;  3U58 A;  3J80 c;  4L5R C;  2L4N A;  3SGI A;  4P74 A;  1VQH A;  1MSG A;  2LFN A;  2ZXO A;  1TVX A;  2ICI A;  1NBW A;  4JI5 Q;  3T1H L;  4A3G H;  1Y1W B;  1EQR A;  4P2C B;  1SJE D;  1F9S A;  1Y1W H;  4BY1 B;  3TRZ A;  4C3J B;  4GN5 A;  4RAU C;  2VB2 X;  3VR3 A;  2NVT B;  1T5E A;  4WJ4 A;  1Q3L A;  1OXT A;  4RKB A;  4KK7 A;  1JC7 A;  4F8M A;  3FPU B;  1KNE A;  4J15 A;  2A69 D;  1BCP C;  2SNM A;  1EY5 A;  4DR3 L;  3Q6S A;  1HZB A;  1MI2 A;  1DD2 A;  3X3M A;  1STE A;  5DM7 3;  1UE6 A;  1LV9 A;  3BDO A;  2QDB A;  1YHB A;  4B3R Q;  1PH5 A;  3PIP 3;  2YV5 A;  4GOP B;  4JV5 Q;  2L1B A;  3GTJ H;  5BR8 Q;  3OMC A;  1PTO B;  2HT1 A;  1DOM A;  5IT9 c;  2VZA A;  1CK1 A;  4DV0 L;  1WOC A;  2RBM A;  1LTG D;  1PXU A;  4LF8 L;  3I4M H;  3QG1 A;  4B3T Q;  1HXY D;  4LF9 Q;  3CQZ H;  4BBS H;  3DWA A;  5FLX c;  1GHJ A;  4DNR B;  4F88 A;  3NP8 A;  2D5D A;  4KHV A;  2NVY B;  1SNM A;  1ENC A;  5KNC A;  3CCS A;  4A3B H;  5ISR A;  1CKN A;  1VQD A;  1Y8O B;  2F0V A;  1TY2 A;  5ELC A;  2RF4 A;  1H9S A;  1B8A A;  3JAM c;  1LLR D;  3GO5 A;  1STA A;  3AU7 A;  2F0U A;  1V43 A;  1O7Z A;  1BUV T;  4X3T A;  1BBU A;  3T1Y Q;  3MXN B;  3BJU A;  3I70 A;  4B3T L;  5C4X B;  3AFP A;  3FKI G;  4PZ6 A;  4V0B A;  3H3V I;  3HS0 C;  1XTC D;  4BY7 G;  1BXT A;  3CQZ B;  3J80 L;  1DJR D;  1HPC A;  3FEW X;  3WDN A;  3RZD H;  5C3E H;  4ID6 A;  1K73 C;  1IYJ B;  2B39 A;  1YNJ C;  4KTA A;  4R8I A;  4HCS A;  1I4H A;  4U68 A;  2HQL A;  5LMN Q;  2OEO A;  3C1F A;  5J22 A;  3F2C A;  3DWQ A;  2D2C C;  4A3J H;  1WI5 A;  4A3M B;  3DM3 A;  1SE3 A;  1YJ9 A;  4RCN A;  1EU4 A;  5G3L D;  2F3W A;  2F0J A;  2BE5 D;  4MIU A;  4R4Q A;  4A3D H;  1SNQ A;  2JA8 B;  4XIG S;  2E2I H;  4YHH L;  4QIW E;  1Y1V B;  2E2H B;  1JB3 A;  3EVQ A;  4JI1 Q;  1VQB A;  1VQJ A;  4I7A A;  3W1B A;  2QCP X;  2M9V A;  2E74 C;  2XVS A;  4B08 A;  1CKO A;  1TKW B;  3KF6 A;  4K8I A;  3TSS A;  2EIF A;  2DGY A;  2EYO A;  2UUA Q;  5JEA G;  4C3H G;  2WII B;  4KN7 C;  1HNX L;  1ZKO A;  3DHQ A;  1WCM G;  4QCL A;  4LWC A;  1GXD C;  2O4X A;  4P73 A;  4B9X A;  4R1J A;  4DN4 M;  4UDU C;  2F0M A;  3I91 A;  1PFS A;  1E2V A;  1YJN A;  2JA6 H;  2JA6 B;  1VQK A;  1PTO C;  2UUB Q;  3GQB A;  4PMC A;  1KNA A;  3HKZ B;  1ROD A;  1QIL A;  3A74 A;  2MFI A;  4QGU A;  1FNW A;  1HNW Q;  3HKZ G;  4PV1 C;  4Y52 H;  5EJW A;  4PNY A;  1GO3 E;  4X65 L;  5IY0 A;  4DK0 A;  1T5X D;  2NVQ B;  5EKL A;  1VQ5 A;  2CW0 C;  1PH8 A;  3X3N A;  1EYG A;  4DNI A;  2ATW A;  1TS3 A;  1I50 H;  3BYT B;  1KLU D;  1KAB A;  3K7A H;  2NVX H;  1S5E D;  3M3Y B;  1SAP A;  4IPC A;  4RA8 A;  3CU7 A;  3H0G H;  4A3D B;  3M85 A;  2BH2 A;  1TT2 A;  1PH4 A;  1IYU A;  5A35 A;  5COR A;  3I4N H;  4CJ1 B;  2PNH A;  4YWK A;  1Z7T A;  2RDF A;  3HOW G;  2EQS A;  1R4P B;  2UXD L;  1SRU A;  1Z6H A;  3OYY A;  3HG9 A;  3A7A B;  4GNX C;  1K9M C;  1X3P A;  1VF7 A;  1SDF A;  2KED A;  3A8K E;  3MEH A;  4GKK Q;  4FXD A;  3ERS X;  3PUV A;  2TSS A;  1IBM Q;  1PFM A;  2E76 C;  2VY3 A;  3H91 A;  4XT1 B;  2PI2 A;  4YCW A;  5E4X A;  1MBY A;  1XXG A;  2EJM A;  4O0A A;  1HA5 A;  2A6E D;  2K32 A;  2VQF Q;  5C44 B;  3HOW B;  2I5L X;  3K6O A;  2N55 A;  1EIF A;  5I6W A;  5JJK A;  4FF4 A;  4LF5 L;  1ENF A;  5E3F A;  3CAM A;  3R8B A;  2IT1 A;  1BQQ T;  5TSS A;  4GKK L;  3T1H Q;  4KHP Q;  2NUC A;  5BR8 L;  1JMC A;  2YTX A;  5E4W C;  5I2Y A;  3ICE A;  1X55 A;  5JEA J;  2FMM A;  1W6K A;  1KQS A;  3E0E A;  1STN A;  3NQT A;  4C3J G;  4EX5 A;  1I4G A;  3QB3 A;  3CP0 A;  2OTJ A;  3QOL A;  3OWE B;  1GUT A;  4DR5 Q;  1LT6 D;  1A15 A;  1HFG A;  3P1H A;  1NCV A;  3A5U A;  1XMO L;  1O7L A;  3S9W A;  1RD9 D;  3SEB A;  2JA8 G;  1B9M A;  3SDZ A;  5J39 A;  5M5Y B;  3T53 B;  5C0X J;  1CKN B;  5KGU A;  1OXU A;  1BCP B;  1EIG A;  1QNU A;  1LTL A;  1H9K A;  4IPH A;  4B3S Q;  4PZ8 A;  1I3Q H;  3PCO B;  1KD1 C;  4L5T A;  2DY8 A;  2O5J C;  3CC2 A;  3GTQ B;  4GZY C;  4NB3 A;  3T16 A;  4K6L A;  5I9O A;  1NTG A;  1QJO A;  4A3K B;  4HED A;  4ME3 A;  4G7O C;  1H9M A;  3CPW A;  1XMO Q;  5T1I A;  3BG3 A;  1AP0 A;  1I6V C;  2R7F A;  4GNX A;  1BKB A;  1IBM L;  1MD2 D;  1VQ7 A;  1QG7 A;  5I6Y A;  3LWU A;  4POF A;  1HTP A;  1M8A A;  3BZD B;  2JA7 H;  5CBA E;  4JPB W;  5E1F A;  5LMU L;  1FJG L;  2RQX A;  1RTO A;  5A2Q L;  1LYL A;  4RGO S;  3QOJ A;  1S3O A;  5M3F B;  3D8G A;  2PQA A;  4XDX A;  2PCF B;  5I9P A;  2AHO B;  4BXX G;  2B8F A;  3MA2 B;  3CHB D;  3KF6 B;  4DV5 Q;  5C3E G;  1AFP A;  2QA4 A;  4GLV B;  3AMU A;  1XPU A;  1G6P A;  1N8R C;  2ES2 A;  1F9P A;  4A93 H;  1KC8 C;  1GJX A;  4LFB L;  1K3R A;  2IX3 A;  1EOV A;  2VB3 X;  2WAC A;  3J7A V;  4NPS A;  1RF2 D;  3TP7 A;  2MGS A;  3NEM A;  4NXM L;  4A93 B;  4LMQ D;  4BS9 A;  4IJL A;  2GVB A;  3D0F A;  2B2W A;  4NMZ A;  4QUF A;  3BU2 A;  1EIY B;  3OW7 A;  3J80 i;  4FXG C;  1J5E L;  4JI6 L;  2F0N A;  3CC4 A;  1JOK A;  4HJA A;  1FL0 A;  1QZH A;  4KLK A;  5IGF A;  1NR2 A;  3IRB A;  1AE2 A;  3TP8 A;  1K8A C;  3K7A B;  2NVX B;  2F1M A;  5IP9 H;  2ZM6 L;  4LF9 L;  1X3E A;  1NSN S;  1E1T A;  3GTO B;  4HR7 B;  2Q8T A;  3EFX D;  1QCB D;  1W2B A;  2VL6 A;  4JYA Q;  3FHW A;  3WWV A;  1GUW A;  4OGQ C;  4AQY L;  1WCM H;  4JVZ A;  2QF7 A;  4XQJ A;  4OWX B;  5HUR A;  1B44 D;  2WAQ E;  1QOH A;  4IFD H;  3PUX A;  1F9R A;  1A63 A;  1PTO D;  4G7H C;  1X3Q A;  5J3B A;  5EPJ A;  4KY5 A;  2L11 A;  3MEF A;  4AH6 A;  5C4X G;  3CME A;  4GOP A;  2EDG A;  4CKE A;  4IFD I;  1HNZ L;  4JBW A;  4DR2 L;  5AJ3 L;  5IOD A;  4JOI A;  3OOC A;  4DV4 L;  2BDN A;  4HMJ A;  3S1M B;  2EY1 A;  3R3O A;  1TWG H;  1XTD A;  4PMB A;  3KLS A;  2QEX A;  2CVR A;  1VF5 C;  3BS1 A;  1HCZ A;  3AFQ A;  3C46 A;  2KA7 A;  2WFW A;  4MTK A;  4R4I A;  2R93 G;  4IUT A;  1Q90 A;  4BA1 I;  1X3F A;  2K5D A;  2B63 G;  4DF7 A;  1PRT D;  4R4T A;  3CCV A;  3NHH A;  4C3I B;  2NN6 H;  1M4V A;  3GTK H;  3HOW H;  2JA5 G;  1D1I A;  5H1S E;  3NTH A;  1EYA A;  3W5O A;  4XQN A;  4IJH A;  4UP9 A;  3HOX B;  5JOB A;  1EWH A;  1PZI D;  2AKW B;  4L5Q A;  5IGG A;  1DXM A;  5C0X G;  4RGT A;  5CGK A;  1WVL A;  5C3E B;  1PH9 A;  3RZD B;  1J8I A;  3F2B A;  1I94 Q;  1XPR A;  2EE1 A;  2PW5 A;  3NWT A;  4DK6 C;  3OIP A;  1BDO A;  3ZJY C;  2R7Z G;  5LHY 1;  4Y7N B;  2B2U C;  1EYD A;  2WP8 J;  3PIO A;  2EYM A;  2KCC A;  1B9N A;  1ZYR C;  3GTK B;  1TWA H;  2L55 A;  3TME A;  4OWT B;  2KEC A;  1M90 C;  2F3I A;  4E6I A;  1GOZ A;  4CKB A;  4L6T B;  3OSO A;  5GAG C;  2V4D A;  5L37 A;  2MNA A;  3N52 A;  3D6C A;  1C9O A;  3G71 A;  2PI2 E;  1HZ9 A;  3RZO B;  4K2L A;  4YWL A;  2ZJP A;  3HOY G;  4JI8 Q;  4DR1 Q;  5C4J B;  2DJG C;  3KDF A;  1SYF A;  2UUC L;  1B3A A;  4X66 L;  5ELO A;  1HH2 P;  2DNE A;  4C1N K;  2HCC A;  4CDC C;  3KLS X;  4Q0F A;  3BVM A;  4ZLT F;  2F0O A;  1JOR A;  4LAA A;  3SE0 A;  5C44 G;  2A73 B;  4GLA C;  4X6A H;  4I65 A;  2QIL A;  4DUY L;  4GNX B;  4LF4 Q;  1Q7Y C;  4BBS G;  2OT2 A;  4BY7 B;  1PVO A;  5EBD A;  3E9H A;  3GV6 A;  5FK9 C;  4QF4 A;  2FXQ A;  2L5T A;  4A3B G;  3STB D;  3MXP A;  5K5P A;  3NBH B;  4A3I H;  4RHS A;  4X64 L;  1YIJ A;  1VS0 A;  2K7V A;  5AFW A;  4BBR G;  1WD1 A;  3PQI A;  1TWC B;  5CV5 A;  4DV3 L;  2UXC L;  4RKL A;  1R9T B;  3GTL H;  3S1M H;  2N3S A;  1H9S B;  3HOZ H;  1D1K A;  4AQY Q;  1CUK A;  1ILP A;  1EWI A;  3SK6 A;  1ZYR D;  1FR3 A;  1J9O A;  1NR4 A;  3TDQ A;  2A1A A;  1E7Z A;  1B7Y B;  2IPK D;  5T1G A;  1LUZ A;  3GD7 A;  3V96 A;  1CQV A;  2UUA L;  1V1P B;  4DR4 L;  4LUO A;  1P8L A;  1HUN A;  2ALY B;  2CCZ A;  2ZM6 Q;  3MC0 B;  2YU9 H;  2WAQ G;  4FF1 A;  2JN4 A;  4FVM A;  1WTW A;  1Y8N B;  3CRK C;  1LO5 D;  2F0S A;  4DV3 Q;  2UXC Q;  3FPP A;  3M9B A;  3RNU A;  3IFT A;  3MWY W;  4DV2 L;  1UUP A;  3E5S A;  2E5L L;  2B2Y A;  4P75 A;  4JI2 Q;  3I7F A;  3PO3 H;  1EWC A;  5EKK A;  5IP7 G;  5IYC H;  4X62 L;  2CWP A;  2ENB A;  2OCE A;  1EY9 A;  4LF4 L;  3S2D H;  3I4L A;  1Y1V H;  2E2D C;  1VQL A;  1CSP A;  4LUZ A;  3HKS A;  4JK1 C;  4LFB Q;  2IX0 A;  4NP5 A;  1II3 A;  1HNX Q;  5C5L A;  2YYZ A;  2PW7 A;  1NNX A;  1V8Q A;  5GAH C;  2OQ0 A;  2RCN A;  3BDC A;  3I4M G;  4XYO A;  5JJL A;  1CM9 A;  2LXJ A;  5IP9 G;  1PZK D;  4QMG A;  3EA6 A;  4DK3 C;  2F0H A;  1YI2 A;  4MN3 A;  1RTN A;  3D31 A;  1EOT A;  3HGB A;  3DM1 A;  2I5H A;  1TXY A;  3P7J A;  2Y0S G;  2YTY A;  3GTM B;  4GKJ Q;  1SYD A;  4DV6 Q;  5EBC A;  1WTR A;  1AZP A;  3VR2 A;  3FKI B;  1VQP A;  3DMU A;  5FO7 B;  3K81 C;  1SE2 A;  2EVB A;  3UI2 A;  1N9W A;  2RA4 A;  5M3F H;  4RHR A;  2WKC A;  1PRT B;  2F52 A;  4XTC S;  3G6E A;  3GTQ H;  1B1Z A;  1ESR A;  5IYB H;  1HQR D;  1YNJ D;  3BYY B;  3A55 A;  4IUR A;  5C4X H;  3TQY A;  1QUQ A;  4DK1 A;  1Q1E A;  1WTV A;  2B2U A;  2MQH A;  3OMG A;  5DM6 3;  1K0S A;  4MNO A;  4YCV A;  4YY3 Q;  1PV4 A;  1HTL D;  4N9T A;  1ICW A;  2A6H C;  4TVA B;  4DGZ A;  1TS5 A;  3HOU B;  1EFI D;  1VQC A;  1STY A;  2SEB D;  1EQT A;  1PH7 A;  5JJI A;  4A3E B;  5IT9 E;  1E22 A;  1NUC A;  1KXL A;  4K5X A;  3K5L A;  4DU9 A;  1IBK L;  1YHQ A;  1U4L A;  2F3V A;  1STH A;  1DCZ A;  3I4M B;  3A7L A;  1I6H H;  2C5C A;  4PMW A;  2NN6 G;  4A3L H;  1HA6 A;  1WTH A;  2JA5 H;  1A3U A;  1PDQ A;  2NN6 I;  2MHV A;  3DWP A;  3DLL A;  1JQY D;  4LFA L;  4K14 A;  1IL8 A;  1PTO H;  1E24 A;  1ESF A;  5G3L F;  1X56 A;  1C48 A;  3TZD A;  3G7L A;  1VQ4 A;  3J81 E;  2PMZ E;  2VQE L;  5BN5 A;  1EL0 A;  4DR2 Q;  3KOJ A;  5KYL A;  1TR5 A;  3EJI A;  1CT1 D;  3K58 A;  3FP9 A;  2PQA B;  3MHB A;  1IBL L;  5M3M B;  1Q46 A;  5D3D A;  4DR7 L;  2A68 D;  4IOA A;  2D9U A;  5JAV A;  4K2K A;  1VQ9 A;  3D3R A;  4X3S A;  2KUM A;  4CDD C;  1HNW L;  3OTO L;  3LWE A;  1V1P A;  2JA6 G;  3D4D A;  2XRS D; 
#chains in the Genus database with same CATH homology
 2QW7 A;  4N8X 1;  2RCF A;  4JW0 A;  4N8F A;  4JVZ A;  4I7A A;  2HD3 A;  5L37 A;  2Z9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...