4JWDA

Crystal structure of the substrate binding domain of e.coli dnak in complex with bovine bac7(15-28)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Identification of DnaK Binding Sites within Bovine and Sheep Bactenecin Bac7.
pubmed rcsb
source organism Escherichia coli
molecule tags Chaperone/antibiotic
total genus 60
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jwdA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jwdA01
4PO2A 4R5GA 3DPOA 4EZRA 3N8EA 3T48A 2V7YA 4WV5A 2QFFA 4JWCA 1DKXA 3DPPA 5E84A 3T49A 4EZZA 4EZSA 4JWEA 4F00A 4R5KA 4R5LA 7HSCA 3D2EA 3DOBA 1DG4A 3H0XA 3DQGA 2KHOA 2WINM 4B9QA 1DKZA 3OHXM 4EZYA 3D2FA 4JWDA 4F01A 4R5IA 4JN4A 4EZWA 3C7NA 4EZQA 4EZOA 3T4AG 3L3OM 4EZUA 1Q5LA 2OP6A 3C7NB 4EZTA 4EZPA 3DPQA 4JNEA 1YUWA 4HYBA 4FL9A 4E81A 3T47A 2BPRA 4EZNA 5TKYA 4EZXA 3T46A 2QXLA 4EZVA 1CKRA 4JWIA 1DKYA 4WV7A 4R5JA 1U00A 3QNJA 4H6IA 1BPRA 4H6HA 4JNFA 4HY9A
chains in the Genus database with same CATH superfamily
3EJQA 2GF4A 1YWMA 3BUPA 2EFKA 2YIAA 1HXKA 2QKWA 4ILHB 4AZBA 3DDGA 4KIKA 4AVMA 1DKXA 3ABHA 2ALWA 3O3MB 1R5EA 2NCZA 1E9VA 2ND1A 4EZQA 4R5JA 1GN9A 1HTYA 2WYHA 4R5GA 3SBTB 2YI9A 2YL6A 2RAJA 4AZ6A 4FZPA 2MI7A 3EJRA 1TQUA 4EZWA 3SBSA 3DDFA 4ILIA 3RV0A 1TQWA 2YIBA 2LXYA 3I04A 1TQTA 1TQSA 3N8EA 3T48A 1MJGA 4JWCA 4JWEA 1JQKA 3DQGA 4B9QA 1QX1A 3BLBA 3C7NB 1Y2OA 4UDYX 3T47A 2BPRA 3HAIA 5TKYA 1OA0A 4EZXA 4MQDA 4NPHA 3GI7A 4AKVA 3HAHA 2OO2A 2OBLA 2F7QA 3D2EA 4F01A 3CVRA 2YL5A 3T4AG 5FLEX 2F1AA 1LQ7A 2GA9D 1UPXA 2ND0A 2Z0NA 3ACOA 4HY9A 1ZWWA 4JL9A 3BVVA 4E3CA 3D4ZA 2X3VA 3LLLA 4I1QA 4AZ7A 3D2FA 3LVTA 4JN4A 2OP6A 2Z0OA 3O3OB 4EZNA 3T46A 1TQVA 3D52A 4EZSA 2F7RA 2RT6A 4IW0A 2F18A 3T49A 2F1BA 3O3NB 4EZZA 1O7DC 4EZYA 1OA1A 4E81A 3CZNA 3D51A 2QXLA 3D4YA 3EJSA 3VKHA 3EJPA 4WPEA 4FM3A 4NSWA 4IWPA 3VEAA 4HR1A 2X3WA 2WINM 2JNKA 1X04A 4DCNC 5C5BB 4EZOA 4EZPA 4JNEA 3B52X 2OZNB 1URUA 2O0I1 1I4LA 4IWQA 2FICA 4UDXX 3DYTA 4PO2A 3DX4A 3QA8A 3RPMA 1SUFA 4AZIA 3L3PA 4DYLA 3VEBA 2Z0VA 4G6QA 4M0MA 3DX1A 4AZHA 5C5BA 4HYBA 1SU8A 3OWGA 4WV7A 2ZXQA 4IM3A 3DPOA 2YLAA 3M3WA 1OAOA 2EWFA 3QWEA 4IWOA 4NQIA 3H0XA 3BUDA 2Q13A 2YL8A 2YL9A 1I4TA 1GNTA 3KAWA 3PLTA 1I4DA 3KAVA 4ATMA 4H6HA 4EZRA 2YKTA 2YLLA 4ILGA 3F7WA 2V7YA 4WV5A 5E84A 4R5KA 4WPCA 2KHOA 2PMRA 2FYVA 3Q0KA 1Q5LA 4D8JA 4FL9A 3UITA 3BVWA 1W9MA 1CKRA 3RV1A 4H6IA 1BPRA 2EX3B 3HAJA 3Q84A 1QWUA 4FZSA 4HR1B 1ZYLA 1R34A 1I49A 2EFLA 4JWDA 2F7OA 3ERCC 3BUQA 3B53X 4AZGA 2Z8YA 3BUIA 3ZEDA 1SU6A 4FZOA 2PY6A 1E1DA 3ZEFA 1DG4A 1HWWA 4H8SA 3L3OM 5FIGA 4EZTA 2F7PA 1R33A 2GAFD 1WDZA 3G9GA 2X3XA 2Q12A 3KDRA 4IM0A 3BVTA 3ER8C 2WYIA 3D50A 4AZ5A 3B51X 3CAZA 1QWNA 3CV5A 1DKZA 3DX3A 3FD9A 2X5CA 4EZUA 3DPQA 3ER9B 2RAKA 3CKDA 4EZVA 4JWIA 3I2WA 1DKYA 1SU7A 2V0OA 2ELBA 1U00A 2YIVX 4JNFA 7HSCA 3BVUA 1O7DB 3I39X 3OHXM 2OW7A 4IM2A 4R5IA 3I01A 2D1LA 2RAIA 2C08A 3EJUA 3A98A 3LMFA 1YUWA 4I43A 4BNEA 3DX2A 3BUBA 3BVXA 4JLCA 5KBPA 4AZCB 3EJTA 1GNLA 3SYVA 2QFFA 3DPPA 3DX0A 4F00A 4R5LA 3DOBA 1X03A 2LM0A 1E2UA 2JNSA 2N3KA 3OK8A 2OBMA 3CZSA 3C7NA 2D4CA 2OW6A 1PS3A 3QNIA 2YI8A 3SOGA 4KIKB 4AZCA 3QNJA 3QE6A
chains in the Genus database with same CATH topology
4PO2A 3QA8A 2PY6A 1E1DA 2OBLA 3ZEFA 1SUFA 3D2EA 1DG4A 3VEBA 4G6QA 4M0MA 4F01A 3T4AG 3L3OM 2YIAA 5FIGA 5FLEX 4EZTA 4HYBA 1SU8A 4ILHB 3OWGA 4WV7A 2GA9D 1UPXA 2GAFD 2ND0A 4KIKA 4HY9A 4IM3A 3DPOA 3KDRA 4JL9A 4IM0A 1DKXA 3ER8C 4E3CA 1OAOA 2EWFA 3B51X 4IWOA 3H0XA 3O3MB 1DKZA 3FD9A 3D2FA 2X5CA 4JN4A 2NCZA 1E9VA 2ND1A 4EZUA 4EZQA 2OP6A 3O3OB 3DPQA 3ER9B 4EZNA 1GNTA 3KAWA 3T46A 4EZVA 4JWIA 1DKYA 1SU7A 4R5JA 1U00A 3KAVA 2YIVX 4H6HA 1GN9A 4JNFA 4EZRA 4EZSA 4ILGA 4R5GA 2RT6A 3F7WA 4IW0A 2V7YA 4WV5A 3T49A 3O3NB 5E84A 4EZZA 7HSCA 4R5KA 3SBTB 2YI9A 2KHOA 3I39X 3OHXM 4EZYA 4IM2A 4R5IA 3I01A 4EZWA 3SBSA 1Q5LA 3LMFA 4D8JA 3A98A 1YUWA 4FL9A 4I43A 4ILIA 1OA1A 4E81A 3RV0A 3UITA 1W9MA 2QXLA 1CKRA 3VKHA 4JLCA 2YIBA 3I04A 4FM3A 3RV1A 4H6IA 1BPRA 2EX3B 1GNLA 4IWPA 3N8EA 3T48A 1MJGA 2QFFA 4HR1B 4HR1A 3DPPA 1ZYLA 4JWCA 3VEAA 4JWEA 4F00A 4R5LA 3DOBA 1JQKA 3DQGA 2WINM 4B9QA 2LM0A 4JWDA 1E2UA 2JNSA 2N3KA 2OBMA 3C7NB 3C7NA 4EZOA 4EZPA 4JNEA 4UDYX 3T47A 3B52X 3ERCC 2BPRA 5TKYA 1OA0A 4EZXA 3B53X 4MQDA 4NPHA 3GI7A 2YI8A 2Z8YA 3ZEDA 4KIKB 4IWQA 4UDXX 1SU6A 3QNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PO2 A;  4R5G A;  3DPO A;  4EZR A;  3N8E A;  3T48 A;  2V7Y A;  4WV5 A;  2QFF A;  4JWC A;  1DKX A;  3DPP A;  5E84 A;  3T49 A;  4EZZ A;  4EZS A;  4JWE A;  4F00 A;  4R5K A;  4R5L A;  7HSC A;  3D2E A;  3DOB A;  1DG4 A;  3H0X A;  3DQG A;  2KHO A;  2WIN M;  4B9Q A;  1DKZ A;  3OHX M;  4EZY A;  3D2F A;  4JWD A;  4F01 A;  4R5I A;  4JN4 A;  4EZW A;  3C7N A;  4EZQ A;  4EZO A;  3T4A G;  3L3O M;  4EZU A;  1Q5L A;  2OP6 A;  3C7N B;  4EZT A;  4EZP A;  3DPQ A;  4JNE A;  1YUW A;  4HYB A;  4FL9 A;  4E81 A;  3T47 A;  2BPR A;  4EZN A;  5TKY A;  4EZX A;  3T46 A;  2QXL A;  4EZV A;  1CKR A;  4JWI A;  1DKY A;  4WV7 A;  4R5J A;  1U00 A;  3QNJ A;  4H6I A;  1BPR A;  4H6H A;  4JNF A;  4HY9 A; 
#chains in the Genus database with same CATH topology
 3EJQ A;  2GF4 A;  1YWM A;  3BUP A;  2EFK A;  2YIA A;  1HXK A;  2QKW A;  4ILH B;  4AZB A;  3DDG A;  4KIK A;  4AVM A;  1DKX A;  3ABH A;  2ALW A;  3O3M B;  1R5E A;  2NCZ A;  1E9V A;  2ND1 A;  4EZQ A;  4R5J A;  1GN9 A;  1HTY A;  2WYH A;  4R5G A;  3SBT B;  2YI9 A;  2YL6 A;  2RAJ A;  4AZ6 A;  4FZP A;  2MI7 A;  3EJR A;  1TQU A;  4EZW A;  3SBS A;  3DDF A;  4ILI A;  3RV0 A;  1TQW A;  2YIB A;  2LXY A;  3I04 A;  1TQT A;  1TQS A;  3N8E A;  3T48 A;  1MJG A;  4JWC A;  4JWE A;  1JQK A;  3DQG A;  4B9Q A;  1QX1 A;  3BLB A;  3C7N B;  1Y2O A;  4UDY X;  3T47 A;  2BPR A;  3HAI A;  5TKY A;  1OA0 A;  4EZX A;  4MQD A;  4NPH A;  3GI7 A;  4AKV A;  3HAH A;  2OO2 A;  2OBL A;  2F7Q A;  3D2E A;  4F01 A;  3CVR A;  2YL5 A;  3T4A G;  5FLE X;  2F1A A;  1LQ7 A;  2GA9 D;  1UPX A;  2ND0 A;  2Z0N A;  3ACO A;  4HY9 A;  1ZWW A;  4JL9 A;  3BVV A;  4E3C A;  3D4Z A;  2X3V A;  3LLL A;  4I1Q A;  4AZ7 A;  3D2F A;  3LVT A;  4JN4 A;  2OP6 A;  2Z0O A;  3O3O B;  4EZN A;  3T46 A;  1TQV A;  3D52 A;  4EZS A;  2F7R A;  2RT6 A;  4IW0 A;  2F18 A;  3T49 A;  2F1B A;  3O3N B;  4EZZ A;  1O7D C;  4EZY A;  1OA1 A;  4E81 A;  3CZN A;  3D51 A;  2QXL A;  3D4Y A;  3EJS A;  3VKH A;  3EJP A;  4WPE A;  4FM3 A;  4NSW A;  4IWP A;  3VEA A;  4HR1 A;  2X3W A;  2WIN M;  2JNK A;  1X04 A;  4DCN C;  5C5B B;  4EZO A;  4EZP A;  4JNE A;  3B52 X;  2OZN B;  1URU A;  2O0I 1;  1I4L A;  4IWQ A;  2FIC A;  4UDX X;  3DYT A;  4PO2 A;  3DX4 A;  3QA8 A;  3RPM A;  1SUF A;  4AZI A;  3L3P A;  4DYL A;  3VEB A;  2Z0V A;  4G6Q A;  4M0M A;  3DX1 A;  4AZH A;  5C5B A;  4HYB A;  1SU8 A;  3OWG A;  4WV7 A;  2ZXQ A;  4IM3 A;  3DPO A;  2YLA A;  3M3W A;  1OAO A;  2EWF A;  3QWE A;  4IWO A;  4NQI A;  3H0X A;  3BUD A;  2Q13 A;  2YL8 A;  2YL9 A;  1I4T A;  1GNT A;  3KAW A;  3PLT A;  1I4D A;  3KAV A;  4ATM A;  4H6H A;  4EZR A;  2YKT A;  2YLL A;  4ILG A;  3F7W A;  2V7Y A;  4WV5 A;  5E84 A;  4R5K A;  4WPC A;  2KHO A;  2PMR A;  2FYV A;  3Q0K A;  1Q5L A;  4D8J A;  4FL9 A;  3UIT A;  3BVW A;  1W9M A;  1CKR A;  3RV1 A;  4H6I A;  1BPR A;  2EX3 B;  3HAJ A;  3Q84 A;  1QWU A;  4FZS A;  4HR1 B;  1ZYL A;  1R34 A;  1I49 A;  2EFL A;  4JWD A;  2F7O A;  3ERC C;  3BUQ A;  3B53 X;  4AZG A;  2Z8Y A;  3BUI A;  3ZED A;  1SU6 A;  4FZO A;  2PY6 A;  1E1D A;  3ZEF A;  1DG4 A;  1HWW A;  4H8S A;  3L3O M;  5FIG A;  4EZT A;  2F7P A;  1R33 A;  2GAF D;  1WDZ A;  3G9G A;  2X3X A;  2Q12 A;  3KDR A;  4IM0 A;  3BVT A;  3ER8 C;  2WYI A;  3D50 A;  4AZ5 A;  3B51 X;  3CAZ A;  1QWN A;  3CV5 A;  1DKZ A;  3DX3 A;  3FD9 A;  2X5C A;  4EZU A;  3DPQ A;  3ER9 B;  2RAK A;  3CKD A;  4EZV A;  4JWI A;  3I2W A;  1DKY A;  1SU7 A;  2V0O A;  2ELB A;  1U00 A;  2YIV X;  4JNF A;  7HSC A;  3BVU A;  1O7D B;  3I39 X;  3OHX M;  2OW7 A;  4IM2 A;  4R5I A;  3I01 A;  2D1L A;  2RAI A;  2C08 A;  3EJU A;  3A98 A;  3LMF A;  1YUW A;  4I43 A;  4BNE A;  3DX2 A;  3BUB A;  3BVX A;  4JLC A;  5KBP A;  4AZC B;  3EJT A;  1GNL A;  3SYV A;  2QFF A;  3DPP A;  3DX0 A;  4F00 A;  4R5L A;  3DOB A;  1X03 A;  2LM0 A;  1E2U A;  2JNS A;  2N3K A;  3OK8 A;  2OBM A;  3CZS A;  3C7N A;  2D4C A;  2OW6 A;  1PS3 A;  3QNI A;  2YI8 A;  3SOG A;  4KIK B;  4AZC A;  3QNJ A;  3QE6 A; 
#chains in the Genus database with same CATH homology
 4PO2 A;  3QA8 A;  2PY6 A;  1E1D A;  2OBL A;  3ZEF A;  1SUF A;  3D2E A;  1DG4 A;  3VEB A;  4G6Q A;  4M0M A;  4F01 A;  3T4A G;  3L3O M;  2YIA A;  5FIG A;  5FLE X;  4EZT A;  4HYB A;  1SU8 A;  4ILH B;  3OWG A;  4WV7 A;  2GA9 D;  1UPX A;  2GAF D;  2ND0 A;  4KIK A;  4HY9 A;  4IM3 A;  3DPO A;  3KDR A;  4JL9 A;  4IM0 A;  1DKX A;  3ER8 C;  4E3C A;  1OAO A;  2EWF A;  3B51 X;  4IWO A;  3H0X A;  3O3M B;  1DKZ A;  3FD9 A;  3D2F A;  2X5C A;  4JN4 A;  2NCZ A;  1E9V A;  2ND1 A;  4EZU A;  4EZQ A;  2OP6 A;  3O3O B;  3DPQ A;  3ER9 B;  4EZN A;  1GNT A;  3KAW A;  3T46 A;  4EZV A;  4JWI A;  1DKY A;  1SU7 A;  4R5J A;  1U00 A;  3KAV A;  2YIV X;  4H6H A;  1GN9 A;  4JNF A;  4EZR A;  4EZS A;  4ILG A;  4R5G A;  2RT6 A;  3F7W A;  4IW0 A;  2V7Y A;  4WV5 A;  3T49 A;  3O3N B;  5E84 A;  4EZZ A;  7HSC A;  4R5K A;  3SBT B;  2YI9 A;  2KHO A;  3I39 X;  3OHX M;  4EZY A;  4IM2 A;  4R5I A;  3I01 A;  4EZW A;  3SBS A;  1Q5L A;  3LMF A;  4D8J A;  3A98 A;  1YUW A;  4FL9 A;  4I43 A;  4ILI A;  1OA1 A;  4E81 A;  3RV0 A;  3UIT A;  1W9M A;  2QXL A;  1CKR A;  3VKH A;  4JLC A;  2YIB A;  3I04 A;  4FM3 A;  3RV1 A;  4H6I A;  1BPR A;  2EX3 B;  1GNL A;  4IWP A;  3N8E A;  3T48 A;  1MJG A;  2QFF A;  4HR1 B;  4HR1 A;  3DPP A;  1ZYL A;  4JWC A;  3VEA A;  4JWE A;  4F00 A;  4R5L A;  3DOB A;  1JQK A;  3DQG A;  2WIN M;  4B9Q A;  2LM0 A;  4JWD A;  1E2U A;  2JNS A;  2N3K A;  2OBM A;  3C7N B;  3C7N A;  4EZO A;  4EZP A;  4JNE A;  4UDY X;  3T47 A;  3B52 X;  3ERC C;  2BPR A;  5TKY A;  1OA0 A;  4EZX A;  3B53 X;  4MQD A;  4NPH A;  3GI7 A;  2YI8 A;  2Z8Y A;  3ZED A;  4KIK B;  4IWQ A;  4UDX X;  1SU6 A;  3QNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...