4JWDA

Crystal structure of the substrate binding domain of e.coli dnak in complex with bovine bac7(15-28)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
211
structure length
211
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Identification of DnaK Binding Sites within Bovine and Sheep Bactenecin Bac7.
pubmed rcsb
source organism Escherichia coli
molecule tags Chaperone/antibiotic
total genus 60
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jwdA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jwdA01
2WINM 3D2EA 4HY9A 4EZNA 1DG4A 4JWCA 4JNFA 4JNEA 4EZQA 4F00A 4EZXA 3C7NB 1YUWA 3H0XA 4H6HA 1U00A 2BPRA 4EZRA 3QNJA 4JWDA 4EZWA 3N8EA 2QFFA 4JN4A 3C7NA 4EZZA 1DKXA 2QXLA 4EZPA 4R5IA 3T48A 4EZYA 3DPOA 3T47A 4EZOA 1DKYA 3DPPA 2KHOA 4JWEA 2V7YA 3T46A 1BPRA 1Q5LA 1CKRA 4EZUA 3DOBA 4EZSA 2OP6A 3DPQA 3DQGA 3T49A 4WV7A 4PO2A 4R5LA 4B9QA 4JWIA 4EZTA 3L3OM 4HYBA 1DKZA 4R5KA 5E84A 3D2FA 5TKYA 4E81A 4FL9A 3OHXM 4H6IA 4EZVA 4WV5A 4F01A 7HSCA 4R5GA 3T4AG 4R5JA
chains in the Genus database with same CATH superfamily
4IWPA 3BUPA 3QNJA 2RT6A 1E1DA 3T47A 2ND1A 3B53X 3EJTA 2YL5A 1MJGA 2OW7A 3VEAA 3D52A 5KBPA 1JQKA 2Z0OA 4F01A 3T4AG 1SUFA 3D50A 4I1QA 2F7RA 2ALWA 2YIAA 4ATMA 2GAFD 4DCNC 4D8JA 2OP6A 4ILHB 4AZGA 1TQWA 3BVTA 3I01A 2V0OA 4DYLA 2GF4A 1GN9A 4IM0A 1HXKA 1R5EA 3ZEDA 1X04A 4AZCA 3N8EA 3D4YA 3L3PA 1W9MA 3Q0KA 2EWFA 1BPRA 3HAHA 1CKRA 2RAKA 2OO2A 4KIKA 2D1LA 2NCZA 1QWUA 4EZTA 3EJUA 3DX1A 3UITA 3EJQA 4EZNA 3RV1A 3HAJA 2JNKA 2X3XA 3DDFA 1SU6A 1Y2OA 4AZ5A 3BUDA 2YIBA 3OK8A 5FIGA 3DQGA 3DYTA 4WV7A 3ABHA 3ER8C 2LXYA 1HWWA 4H8SA 1GNTA 1I4DA 3HAIA 3CAZA 4EZOA 1DKYA 1R34A 2OZNB 2YL9A 3QWEA 2EFLA 2YL8A 4HYBA 4E81A 4WV5A 1TQVA 2OBLA 1OA0A 3C7NB 2OBMA 4M0MA 3CZNA 1R33A 3EJPA 3G9GA 5C5BA 4R5KA 2D4CA 1LQ7A 4JNEA 4F00A 3M3WA 1DKXA 1QWNA 3B52X 1I4LA 3CZSA 3DPQA 3KDRA 1TQTA 3O3OB 2QKWA 4H6IA 3VEBA 4HR1B 2WINM 3Q84A 1DG4A 2QFFA 4JN4A 4UDXX 3VKHA 4EZPA 4IM3A 3I2WA 2MI7A 3D51A 3FD9A 3T49A 3BVWA 1OAOA 2F7PA 3KAVA 2X3VA 4R5JA 3LVTA 3CV5A 2X3WA 3BLBA 2ZXQA 2Q12A 1U00A 2YLAA 4E3CA 3BUQA 3PLTA 4ILIA 1HTYA 2X5CA 5FLEX 1ZWWA 2F1AA 4IWQA 1TQSA 4FM3A 4I43A 3OHXM 2YLLA 4AZCB 4IM2A 2JNSA 1YUWA 1ZYLA 4AVMA 2LM0A 3T48A 2V7YA 4KIKB 2F7QA 4EZUA 4EZSA 3A98A 2F7OA 3BVXA 3DDGA 1QX1A 3I04A 7HSCA 2FICA 3O3MB 1TQUA 4MQDA 3BVUA 4EZWA 2YI8A 1YWMA 3DX2A 3SYVA 4WPEA 3DOBA 3RPMA 4AZHA 2RAJA 4NSWA 2F1BA 3EJRA 2PY6A 2PMRA 1SU8A 2N3KA 3D2EA 3F7WA 4HR1A 4JNFA 2WYIA 2QXLA 3B51X 3LMFA 3ERCC 1UPXA 2O0I1 3QA8A 4NQIA 3DX3A 4BNEA 4PO2A 2Z0VA 4R5LA 1O7DB 3CKDA 4FZPA 1GNLA 5TKYA 4EZVA 3SOGA 2EX3B 3EJSA 4UDYX 4ILGA 3SBTB 4EZRA 4AZIA 2YI9A 4R5IA 3DPOA 2C08A 3DPPA 5C5BB 2KHOA 3T46A 1Q5LA 3QNIA 4FZOA 1I4TA 4AZBA 4AZ6A 4B9QA 3ACOA 5E84A 4G6QA 4R5GA 4AKVA 4EZQA 3BUIA 2OW6A 4IW0A 3KAWA 4JWCA 3ER9B 3LLLA 3H0XA 4H6HA 3QE6A 3OWGA 2Z8YA 3I39X 4JWIA 3ZEFA 3DX0A 3O3NB 3SBSA 4IWOA 1E2UA 2RAIA 4HY9A 2YIVX 2BPRA 1PS3A 4JWDA 1O7DC 4EZZA 3C7NA 4JL9A 4EZYA 1URUA 3CVRA 2FYVA 2ND0A 2WYHA 2ELBA 3L3OM 1SU7A 4WPCA 2F18A 4NPHA 2YL6A 1I49A 3GI7A 4AZ7A 3BVVA 4FZSA 3DX4A 2YKTA 4JWEA 1X03A 3D4ZA 3BUBA 1OA1A 2EFKA 2Q13A 4JLCA 1E9VA 2GA9D 1DKZA 4FL9A 2Z0NA 3D2FA 3RV0A 4EZXA 1WDZA
chains in the Genus database with same CATH topology
4IWPA 4ILGA 4UDYX 3SBTB 1U00A 4EZRA 3QNJA 2RT6A 1E1DA 2YI9A 4R5IA 3DPOA 3T47A 4EZOA 2ND1A 1DKYA 3B53X 3DPPA 2KHOA 4E3CA 3T46A 1Q5LA 4ILIA 1MJGA 3VEAA 5FLEX 2X5CA 4B9QA 4IWQA 4HYBA 4FM3A 4E81A 5E84A 4G6QA 1JQKA 4I43A 3OHXM 4WV5A 4F01A 4R5GA 3T4AG 4EZQA 1SUFA 2OBLA 4IW0A 4IM2A 1OA0A 3KAWA 4JWCA 3ER9B 3C7NB 3H0XA 2JNSA 2OBMA 1YUWA 4H6HA 4M0MA 1ZYLA 2LM0A 2YIAA 3T48A 2GAFD 4D8JA 3OWGA 2V7YA 4KIKB 4R5JA 4EZUA 4EZSA 2OP6A 3A98A 2Z8YA 3I39X 4ILHB 4JWIA 4R5KA 3ZEFA 3O3NB 3I04A 3SBSA 7HSCA 4IWOA 3O3MB 3I01A 1E2UA 4HY9A 1GN9A 4IM0A 4MQDA 4JNEA 2YIVX 4F00A 3ZEDA 2BPRA 4JWDA 3N8EA 4EZWA 4EZZA 3C7NA 1DKXA 4JL9A 4EZYA 3B52X 1W9MA 2YI8A 2EWFA 1BPRA 2ND0A 1CKRA 3DOBA 3DPQA 3KDRA 4KIKA 2NCZA 4EZTA 3L3OM 3O3OB 2PY6A 4H6IA 3VEBA 3UITA 4HR1B 1SU8A 2WINM 1SU7A 2N3KA 3D2EA 4EZNA 3F7WA 1DG4A 3RV1A 4HR1A 4JNFA 4NPHA 2QFFA 4JN4A 4UDXX 2QXLA 3VKHA 4EZPA 1SU6A 3B51X 3GI7A 3LMFA 4IM3A 4JWEA 3ERCC 1UPXA 3QA8A 2YIBA 1OA1A 3FD9A 5FIGA 3DQGA 3T49A 4WV7A 4PO2A 4R5LA 4JLCA 1E9VA 3ER8C 2GA9D 1DKZA 1GNLA 4FL9A 3D2FA 5TKYA 3RV0A 1OAOA 4EZVA 3KAVA 4EZXA 1GNTA 2EX3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WIN M;  3D2E A;  4HY9 A;  4EZN A;  1DG4 A;  4JWC A;  4JNF A;  4JNE A;  4EZQ A;  4F00 A;  4EZX A;  3C7N B;  1YUW A;  3H0X A;  4H6H A;  1U00 A;  2BPR A;  4EZR A;  3QNJ A;  4JWD A;  4EZW A;  3N8E A;  2QFF A;  4JN4 A;  3C7N A;  4EZZ A;  1DKX A;  2QXL A;  4EZP A;  4R5I A;  3T48 A;  4EZY A;  3DPO A;  3T47 A;  4EZO A;  1DKY A;  3DPP A;  2KHO A;  4JWE A;  2V7Y A;  3T46 A;  1BPR A;  1Q5L A;  1CKR A;  4EZU A;  3DOB A;  4EZS A;  2OP6 A;  3DPQ A;  3DQG A;  3T49 A;  4WV7 A;  4PO2 A;  4R5L A;  4B9Q A;  4JWI A;  4EZT A;  3L3O M;  4HYB A;  1DKZ A;  4R5K A;  5E84 A;  3D2F A;  5TKY A;  4E81 A;  4FL9 A;  3OHX M;  4H6I A;  4EZV A;  4WV5 A;  4F01 A;  7HSC A;  4R5G A;  3T4A G;  4R5J A; 
#chains in the Genus database with same CATH topology
 4IWP A;  3BUP A;  3QNJ A;  2RT6 A;  1E1D A;  3T47 A;  2ND1 A;  3B53 X;  3EJT A;  2YL5 A;  1MJG A;  2OW7 A;  3VEA A;  3D52 A;  5KBP A;  1JQK A;  2Z0O A;  4F01 A;  3T4A G;  1SUF A;  3D50 A;  4I1Q A;  2F7R A;  2ALW A;  2YIA A;  4ATM A;  2GAF D;  4DCN C;  4D8J A;  2OP6 A;  4ILH B;  4AZG A;  1TQW A;  3BVT A;  3I01 A;  2V0O A;  4DYL A;  2GF4 A;  1GN9 A;  4IM0 A;  1HXK A;  1R5E A;  3ZED A;  1X04 A;  4AZC A;  3N8E A;  3D4Y A;  3L3P A;  1W9M A;  3Q0K A;  2EWF A;  1BPR A;  3HAH A;  1CKR A;  2RAK A;  2OO2 A;  4KIK A;  2D1L A;  2NCZ A;  1QWU A;  4EZT A;  3EJU A;  3DX1 A;  3UIT A;  3EJQ A;  4EZN A;  3RV1 A;  3HAJ A;  2JNK A;  2X3X A;  3DDF A;  1SU6 A;  1Y2O A;  4AZ5 A;  3BUD A;  2YIB A;  3OK8 A;  5FIG A;  3DQG A;  3DYT A;  4WV7 A;  3ABH A;  3ER8 C;  2LXY A;  1HWW A;  4H8S A;  1GNT A;  1I4D A;  3HAI A;  3CAZ A;  4EZO A;  1DKY A;  1R34 A;  2OZN B;  2YL9 A;  3QWE A;  2EFL A;  2YL8 A;  4HYB A;  4E81 A;  4WV5 A;  1TQV A;  2OBL A;  1OA0 A;  3C7N B;  2OBM A;  4M0M A;  3CZN A;  1R33 A;  3EJP A;  3G9G A;  5C5B A;  4R5K A;  2D4C A;  1LQ7 A;  4JNE A;  4F00 A;  3M3W A;  1DKX A;  1QWN A;  3B52 X;  1I4L A;  3CZS A;  3DPQ A;  3KDR A;  1TQT A;  3O3O B;  2QKW A;  4H6I A;  3VEB A;  4HR1 B;  2WIN M;  3Q84 A;  1DG4 A;  2QFF A;  4JN4 A;  4UDX X;  3VKH A;  4EZP A;  4IM3 A;  3I2W A;  2MI7 A;  3D51 A;  3FD9 A;  3T49 A;  3BVW A;  1OAO A;  2F7P A;  3KAV A;  2X3V A;  4R5J A;  3LVT A;  3CV5 A;  2X3W A;  3BLB A;  2ZXQ A;  2Q12 A;  1U00 A;  2YLA A;  4E3C A;  3BUQ A;  3PLT A;  4ILI A;  1HTY A;  2X5C A;  5FLE X;  1ZWW A;  2F1A A;  4IWQ A;  1TQS A;  4FM3 A;  4I43 A;  3OHX M;  2YLL A;  4AZC B;  4IM2 A;  2JNS A;  1YUW A;  1ZYL A;  4AVM A;  2LM0 A;  3T48 A;  2V7Y A;  4KIK B;  2F7Q A;  4EZU A;  4EZS A;  3A98 A;  2F7O A;  3BVX A;  3DDG A;  1QX1 A;  3I04 A;  7HSC A;  2FIC A;  3O3M B;  1TQU A;  4MQD A;  3BVU A;  4EZW A;  2YI8 A;  1YWM A;  3DX2 A;  3SYV A;  4WPE A;  3DOB A;  3RPM A;  4AZH A;  2RAJ A;  4NSW A;  2F1B A;  3EJR A;  2PY6 A;  2PMR A;  1SU8 A;  2N3K A;  3D2E A;  3F7W A;  4HR1 A;  4JNF A;  2WYI A;  2QXL A;  3B51 X;  3LMF A;  3ERC C;  1UPX A;  2O0I 1;  3QA8 A;  4NQI A;  3DX3 A;  4BNE A;  4PO2 A;  2Z0V A;  4R5L A;  1O7D B;  3CKD A;  4FZP A;  1GNL A;  5TKY A;  4EZV A;  3SOG A;  2EX3 B;  3EJS A;  4UDY X;  4ILG A;  3SBT B;  4EZR A;  4AZI A;  2YI9 A;  4R5I A;  3DPO A;  2C08 A;  3DPP A;  5C5B B;  2KHO A;  3T46 A;  1Q5L A;  3QNI A;  4FZO A;  1I4T A;  4AZB A;  4AZ6 A;  4B9Q A;  3ACO A;  5E84 A;  4G6Q A;  4R5G A;  4AKV A;  4EZQ A;  3BUI A;  2OW6 A;  4IW0 A;  3KAW A;  4JWC A;  3ER9 B;  3LLL A;  3H0X A;  4H6H A;  3QE6 A;  3OWG A;  2Z8Y A;  3I39 X;  4JWI A;  3ZEF A;  3DX0 A;  3O3N B;  3SBS A;  4IWO A;  1E2U A;  2RAI A;  4HY9 A;  2YIV X;  2BPR A;  1PS3 A;  4JWD A;  1O7D C;  4EZZ A;  3C7N A;  4JL9 A;  4EZY A;  1URU A;  3CVR A;  2FYV A;  2ND0 A;  2WYH A;  2ELB A;  3L3O M;  1SU7 A;  4WPC A;  2F18 A;  4NPH A;  2YL6 A;  1I49 A;  3GI7 A;  4AZ7 A;  3BVV A;  4FZS A;  3DX4 A;  2YKT A;  4JWE A;  1X03 A;  3D4Z A;  3BUB A;  1OA1 A;  2EFK A;  2Q13 A;  4JLC A;  1E9V A;  2GA9 D;  1DKZ A;  4FL9 A;  2Z0N A;  3D2F A;  3RV0 A;  4EZX A;  1WDZ A; 
#chains in the Genus database with same CATH homology
 4IWP A;  4ILG A;  4UDY X;  3SBT B;  1U00 A;  4EZR A;  3QNJ A;  2RT6 A;  1E1D A;  2YI9 A;  4R5I A;  3DPO A;  3T47 A;  4EZO A;  2ND1 A;  1DKY A;  3B53 X;  3DPP A;  2KHO A;  4E3C A;  3T46 A;  1Q5L A;  4ILI A;  1MJG A;  3VEA A;  5FLE X;  2X5C A;  4B9Q A;  4IWQ A;  4HYB A;  4FM3 A;  4E81 A;  5E84 A;  4G6Q A;  1JQK A;  4I43 A;  3OHX M;  4WV5 A;  4F01 A;  4R5G A;  3T4A G;  4EZQ A;  1SUF A;  2OBL A;  4IW0 A;  4IM2 A;  1OA0 A;  3KAW A;  4JWC A;  3ER9 B;  3C7N B;  3H0X A;  2JNS A;  2OBM A;  1YUW A;  4H6H A;  4M0M A;  1ZYL A;  2LM0 A;  2YIA A;  3T48 A;  2GAF D;  4D8J A;  3OWG A;  2V7Y A;  4KIK B;  4R5J A;  4EZU A;  4EZS A;  2OP6 A;  3A98 A;  2Z8Y A;  3I39 X;  4ILH B;  4JWI A;  4R5K A;  3ZEF A;  3O3N B;  3I04 A;  3SBS A;  7HSC A;  4IWO A;  3O3M B;  3I01 A;  1E2U A;  4HY9 A;  1GN9 A;  4IM0 A;  4MQD A;  4JNE A;  2YIV X;  4F00 A;  3ZED A;  2BPR A;  4JWD A;  3N8E A;  4EZW A;  4EZZ A;  3C7N A;  1DKX A;  4JL9 A;  4EZY A;  3B52 X;  1W9M A;  2YI8 A;  2EWF A;  1BPR A;  2ND0 A;  1CKR A;  3DOB A;  3DPQ A;  3KDR A;  4KIK A;  2NCZ A;  4EZT A;  3L3O M;  3O3O B;  2PY6 A;  4H6I A;  3VEB A;  3UIT A;  4HR1 B;  1SU8 A;  2WIN M;  1SU7 A;  2N3K A;  3D2E A;  4EZN A;  3F7W A;  1DG4 A;  3RV1 A;  4HR1 A;  4JNF A;  4NPH A;  2QFF A;  4JN4 A;  4UDX X;  2QXL A;  3VKH A;  4EZP A;  1SU6 A;  3B51 X;  3GI7 A;  3LMF A;  4IM3 A;  4JWE A;  3ERC C;  1UPX A;  3QA8 A;  2YIB A;  1OA1 A;  3FD9 A;  5FIG A;  3DQG A;  3T49 A;  4WV7 A;  4PO2 A;  4R5L A;  4JLC A;  1E9V A;  3ER8 C;  2GA9 D;  1DKZ A;  1GNL A;  4FL9 A;  3D2F A;  5TKY A;  3RV0 A;  1OAO A;  4EZV A;  3KAV A;  4EZX A;  1GNT A;  2EX3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...