4JWEA

Crystal structure of the substrate binding domain of e.coli dnak in complex with sheep bac7(1-21)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein DnaK
publication title Structural Identification of DnaK Binding Sites within Bovine and Sheep Bactenecin Bac7.
pubmed rcsb
source organism Escherichia coli
molecule tags Chaperone/antibiotic
total genus 62
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jweA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jweA01
1DKXA 3C7NA 4H6HA 4EZTA 2BPRA 3T4AG 1DKZA 4EZSA 4B9QA 3OHXM 1BPRA 3H0XA 4EZUA 3T49A 4HY9A 3QNJA 4EZNA 4JNFA 3T47A 1Q5LA 3N8EA 2QXLA 4R5LA 2OP6A 4WV5A 5E84A 4E81A 4JWDA 3C7NB 4EZZA 7HSCA 3T46A 4H6IA 3DOBA 4JWEA 1U00A 3D2FA 3D2EA 4JWIA 4JNEA 4R5KA 4EZOA 4PO2A 4EZQA 1YUWA 1DG4A 4F00A 4EZYA 4EZWA 4HYBA 4FL9A 4EZXA 4WV7A 1CKRA 2WINM 2QFFA 4EZVA 4R5JA 2KHOA 4R5GA 4R5IA 3DQGA 3DPQA 4EZPA 1DKYA 5TKYA 3DPPA 2V7YA 3L3OM 4EZRA 3T48A 4JN4A 4F01A 3DPOA 4JWCA
chains in the Genus database with same CATH superfamily
2RT6A 1E9VA 1GNTA 1UPXA 2QXLA 3I2WA 4DCNC 3B52X 2YLAA 3BVTA 2YIAA 1E2UA 5E84A 3LVTA 4R5KA 3L3PA 4JWIA 4PO2A 1ZWWA 3BVVA 4WPCA 4NQIA 2D4CA 3ER9B 2Z0NA 5KBPA 3ZEFA 3CZSA 3EJRA 2YLLA 4FZOA 1QWUA 3A98A 3DX2A 2ELBA 4JWDA 2X5CA 1HXKA 4EZVA 3O3MB 1GNLA 2ND1A 4H8SA 4JN4A 3CAZA 3DX1A 4IWOA 1R34A 4AZHA 4H6IA 1YUWA 4AZCB 4I1QA 3D51A 1DG4A 3RV0A 2EFKA 3BUIA 3SYVA 4JWCA 2X3XA 4AZCA 4NPHA 3N8EA 3BUPA 3D52A 2FYVA 4FL9A 3VEBA 2Z0VA 3BLBA 2NCZA 4IM3A 4ATMA 4R5GA 2F18A 4AZIA 4I43A 4H6HA 2YKTA 4EZTA 1BPRA 4EZUA 3O3OB 1LQ7A 3KDRA 4WPEA 4JNFA 1OA1A 3DDFA 3DX3A 1Y2OA 4JWEA 2F7PA 1O7DC 2Q13A 5C5BB 2PMRA 3B51X 2N3KA 2GF4A 1DKZA 3G9GA 3I04A 5C5BA 3BUDA 3I01A 1TQTA 4JLCA 3C7NB 4DYLA 4EZZA 3M3WA 2RAIA 4KIKB 1WDZA 3QNIA 3DPQA 2F7RA 2OW7A 2F1BA 3C7NA 1R33A 3BVWA 3CVRA 2F1AA 1HTYA 4IWPA 1Q5LA 4KIKA 2PY6A 3ZEDA 1X04A 2GA9D 3D2FA 3OK8A 2EX3B 4WV7A 3RPMA 5FLEX 2EFLA 2ZXQA 1E1DA 3EJTA 4EZNA 3BUBA 2WYHA 2F7OA 2OO2A 1PS3A 3T46A 2YI8A 1TQSA 4HYBA 1JQKA 1CKRA 3HAJA 4AZ6A 5FIGA 4NSWA 3SBTB 3DX0A 3DPPA 4EZRA 3Q0KA 4ILHB 3T49A 3CV5A 4FZSA 2X3VA 3BVUA 1GN9A 2GAFD 3F7WA 3SOGA 4EZXA 2WINM 3OWGA 4EZPA 2JNKA 2JNSA 3UITA 4F01A 4IM2A 2X3WA 4AZ5A 2OZNB 1QWNA 2MI7A 4G6QA 4IWQA 3CZNA 3HAHA 3KAVA 2V0OA 2O0I1 4E3CA 2RAJA 3DPOA 3QNJA 1I49A 2ALWA 3D50A 3ABHA 3DX4A 2OP6A 3DDGA 2RAKA 7HSCA 2WYIA 4JNEA 3D2EA 2D1LA 4AZ7A 2YIBA 4F00A 1HWWA 2OBMA 3EJUA 4ILIA 2Q12A 1ZYLA 4R5IA 3DQGA 2LM0A 2YIVX 1URUA 5TKYA 2QKWA 1YWMA 1I4TA 3RV1A 1OAOA 4WV5A 1R5EA 3O3NB 1I4LA 2YL6A 3QA8A 3I39X 4EZOA 4UDYX 3QWEA 4EZYA 4AKVA 3BUQA 2QFFA 3D4ZA 4BNEA 1SU6A 1SUFA 3SBSA 4FM3A 4AVMA 3T4AG 4EZSA 3EJPA 3D4YA 4HY9A 2OBLA 4ILGA 1TQVA 4E81A 1MJGA 1TQWA 2EWFA 3CKDA 3FD9A 1X03A 3DYTA 2FICA 3B53X 2YL8A 3H0XA 3BVXA 4IM0A 2C08A 4EZQA 3VEAA 4D8JA 4UDXX 2LXYA 2Z0OA 2OW6A 1DKYA 2V7YA 2YI9A 4AZBA 3L3OM 3T48A 3EJQA 1SU8A 2Z8YA 3Q84A 3ACOA 1O7DB 4FZPA 3VKHA 1I4DA 4JL9A 4IW0A 3QE6A 4R5JA 3ER8C 3PLTA 2F7QA 3LLLA 3LMFA 4HR1B 4AZGA 1OA0A 1DKXA 2BPRA 4B9QA 3OHXM 3EJSA 3T47A 4MQDA 4R5LA 2YL5A 1SU7A 4M0MA 4HR1A 3DOBA 1U00A 3GI7A 1TQUA 4EZWA 1W9MA 2YL9A 3HAIA 2KHOA 3ERCC 1QX1A 2ND0A 3KAWA
chains in the Genus database with same CATH topology
4H6HA 4EZTA 2RT6A 3T4AG 4EZSA 1BPRA 1E9VA 1GNTA 4EZUA 3O3OB 4HY9A 3KDRA 1UPXA 4JNFA 2OBLA 4ILGA 2QXLA 1OA1A 3B52X 2YIAA 1E2UA 1GN9A 5E84A 4E81A 2GAFD 3F7WA 4JWEA 4R5KA 4JWIA 1MJGA 4PO2A 4EZXA 2EWFA 2WINM 3OWGA 3ER9B 3FD9A 3ZEFA 4EZPA 3B51X 2JNSA 3UITA 4F01A 2N3KA 4IM2A 1DKZA 3B53X 3H0XA 3I04A 3A98A 3I01A 4IM0A 4JLCA 4JWDA 2X5CA 3C7NB 4EZZA 4ILHB 4G6QA 4IWQA 4EZQA 3VEAA 4D8JA 4UDXX 4EZVA 3KAVA 3O3MB 4KIKB 1GNLA 2ND1A 3DPQA 1DKYA 4E3CA 2YI9A 2V7YA 3L3OM 3T48A 4JN4A 3DPOA 3QNJA 1SU8A 3C7NA 4IWOA 2Z8YA 4IWPA 1Q5LA 4KIKA 2PY6A 3ZEDA 2OP6A 2GA9D 3VKHA 4JL9A 7HSCA 4H6IA 3D2FA 4JNEA 3D2EA 1YUWA 2YIBA 1DG4A 2EX3B 3RV0A 4F00A 2OBMA 4IW0A 4WV7A 4ILIA 4R5JA 3ER8C 5FLEX 1ZYLA 4R5IA 3DQGA 2LM0A 2YIVX 5TKYA 3LMFA 4HR1B 1OA0A 4JWCA 1DKXA 2BPRA 4B9QA 3OHXM 1E1DA 4EZNA 3T47A 4MQDA 4NPHA 4R5LA 3RV1A 3N8EA 1OAOA 4WV5A 3O3NB 1SU7A 3QA8A 4M0MA 4HR1A 3T46A 3DOBA 3I39X 2YI8A 1U00A 4EZOA 4UDYX 3GI7A 4EZYA 1W9MA 4HYBA 1JQKA 4EZWA 3VEBA 4FL9A 1CKRA 2QFFA 2NCZA 4IM3A 2KHOA 3ERCC 5FIGA 4R5GA 3SBTB 1SU6A 2ND0A 3KAWA 1SUFA 3DPPA 3SBSA 4EZRA 4FM3A 4I43A 3T49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DKX A;  3C7N A;  4H6H A;  4EZT A;  2BPR A;  3T4A G;  1DKZ A;  4EZS A;  4B9Q A;  3OHX M;  1BPR A;  3H0X A;  4EZU A;  3T49 A;  4HY9 A;  3QNJ A;  4EZN A;  4JNF A;  3T47 A;  1Q5L A;  3N8E A;  2QXL A;  4R5L A;  2OP6 A;  4WV5 A;  5E84 A;  4E81 A;  4JWD A;  3C7N B;  4EZZ A;  7HSC A;  3T46 A;  4H6I A;  3DOB A;  4JWE A;  1U00 A;  3D2F A;  3D2E A;  4JWI A;  4JNE A;  4R5K A;  4EZO A;  4PO2 A;  4EZQ A;  1YUW A;  1DG4 A;  4F00 A;  4EZY A;  4EZW A;  4HYB A;  4FL9 A;  4EZX A;  4WV7 A;  1CKR A;  2WIN M;  2QFF A;  4EZV A;  4R5J A;  2KHO A;  4R5G A;  4R5I A;  3DQG A;  3DPQ A;  4EZP A;  1DKY A;  5TKY A;  3DPP A;  2V7Y A;  3L3O M;  4EZR A;  3T48 A;  4JN4 A;  4F01 A;  3DPO A;  4JWC A; 
#chains in the Genus database with same CATH topology
 2RT6 A;  1E9V A;  1GNT A;  1UPX A;  2QXL A;  3I2W A;  4DCN C;  3B52 X;  2YLA A;  3BVT A;  2YIA A;  1E2U A;  5E84 A;  3LVT A;  4R5K A;  3L3P A;  4JWI A;  4PO2 A;  1ZWW A;  3BVV A;  4WPC A;  4NQI A;  2D4C A;  3ER9 B;  2Z0N A;  5KBP A;  3ZEF A;  3CZS A;  3EJR A;  2YLL A;  4FZO A;  1QWU A;  3A98 A;  3DX2 A;  2ELB A;  4JWD A;  2X5C A;  1HXK A;  4EZV A;  3O3M B;  1GNL A;  2ND1 A;  4H8S A;  4JN4 A;  3CAZ A;  3DX1 A;  4IWO A;  1R34 A;  4AZH A;  4H6I A;  1YUW A;  4AZC B;  4I1Q A;  3D51 A;  1DG4 A;  3RV0 A;  2EFK A;  3BUI A;  3SYV A;  4JWC A;  2X3X A;  4AZC A;  4NPH A;  3N8E A;  3BUP A;  3D52 A;  2FYV A;  4FL9 A;  3VEB A;  2Z0V A;  3BLB A;  2NCZ A;  4IM3 A;  4ATM A;  4R5G A;  2F18 A;  4AZI A;  4I43 A;  4H6H A;  2YKT A;  4EZT A;  1BPR A;  4EZU A;  3O3O B;  1LQ7 A;  3KDR A;  4WPE A;  4JNF A;  1OA1 A;  3DDF A;  3DX3 A;  1Y2O A;  4JWE A;  2F7P A;  1O7D C;  2Q13 A;  5C5B B;  2PMR A;  3B51 X;  2N3K A;  2GF4 A;  1DKZ A;  3G9G A;  3I04 A;  5C5B A;  3BUD A;  3I01 A;  1TQT A;  4JLC A;  3C7N B;  4DYL A;  4EZZ A;  3M3W A;  2RAI A;  4KIK B;  1WDZ A;  3QNI A;  3DPQ A;  2F7R A;  2OW7 A;  2F1B A;  3C7N A;  1R33 A;  3BVW A;  3CVR A;  2F1A A;  1HTY A;  4IWP A;  1Q5L A;  4KIK A;  2PY6 A;  3ZED A;  1X04 A;  2GA9 D;  3D2F A;  3OK8 A;  2EX3 B;  4WV7 A;  3RPM A;  5FLE X;  2EFL A;  2ZXQ A;  1E1D A;  3EJT A;  4EZN A;  3BUB A;  2WYH A;  2F7O A;  2OO2 A;  1PS3 A;  3T46 A;  2YI8 A;  1TQS A;  4HYB A;  1JQK A;  1CKR A;  3HAJ A;  4AZ6 A;  5FIG A;  4NSW A;  3SBT B;  3DX0 A;  3DPP A;  4EZR A;  3Q0K A;  4ILH B;  3T49 A;  3CV5 A;  4FZS A;  2X3V A;  3BVU A;  1GN9 A;  2GAF D;  3F7W A;  3SOG A;  4EZX A;  2WIN M;  3OWG A;  4EZP A;  2JNK A;  2JNS A;  3UIT A;  4F01 A;  4IM2 A;  2X3W A;  4AZ5 A;  2OZN B;  1QWN A;  2MI7 A;  4G6Q A;  4IWQ A;  3CZN A;  3HAH A;  3KAV A;  2V0O A;  2O0I 1;  4E3C A;  2RAJ A;  3DPO A;  3QNJ A;  1I49 A;  2ALW A;  3D50 A;  3ABH A;  3DX4 A;  2OP6 A;  3DDG A;  2RAK A;  7HSC A;  2WYI A;  4JNE A;  3D2E A;  2D1L A;  4AZ7 A;  2YIB A;  4F00 A;  1HWW A;  2OBM A;  3EJU A;  4ILI A;  2Q12 A;  1ZYL A;  4R5I A;  3DQG A;  2LM0 A;  2YIV X;  1URU A;  5TKY A;  2QKW A;  1YWM A;  1I4T A;  3RV1 A;  1OAO A;  4WV5 A;  1R5E A;  3O3N B;  1I4L A;  2YL6 A;  3QA8 A;  3I39 X;  4EZO A;  4UDY X;  3QWE A;  4EZY A;  4AKV A;  3BUQ A;  2QFF A;  3D4Z A;  4BNE A;  1SU6 A;  1SUF A;  3SBS A;  4FM3 A;  4AVM A;  3T4A G;  4EZS A;  3EJP A;  3D4Y A;  4HY9 A;  2OBL A;  4ILG A;  1TQV A;  4E81 A;  1MJG A;  1TQW A;  2EWF A;  3CKD A;  3FD9 A;  1X03 A;  3DYT A;  2FIC A;  3B53 X;  2YL8 A;  3H0X A;  3BVX A;  4IM0 A;  2C08 A;  4EZQ A;  3VEA A;  4D8J A;  4UDX X;  2LXY A;  2Z0O A;  2OW6 A;  1DKY A;  2V7Y A;  2YI9 A;  4AZB A;  3L3O M;  3T48 A;  3EJQ A;  1SU8 A;  2Z8Y A;  3Q84 A;  3ACO A;  1O7D B;  4FZP A;  3VKH A;  1I4D A;  4JL9 A;  4IW0 A;  3QE6 A;  4R5J A;  3ER8 C;  3PLT A;  2F7Q A;  3LLL A;  3LMF A;  4HR1 B;  4AZG A;  1OA0 A;  1DKX A;  2BPR A;  4B9Q A;  3OHX M;  3EJS A;  3T47 A;  4MQD A;  4R5L A;  2YL5 A;  1SU7 A;  4M0M A;  4HR1 A;  3DOB A;  1U00 A;  3GI7 A;  1TQU A;  4EZW A;  1W9M A;  2YL9 A;  3HAI A;  2KHO A;  3ERC C;  1QX1 A;  2ND0 A;  3KAW A; 
#chains in the Genus database with same CATH homology
 4H6H A;  4EZT A;  2RT6 A;  3T4A G;  4EZS A;  1BPR A;  1E9V A;  1GNT A;  4EZU A;  3O3O B;  4HY9 A;  3KDR A;  1UPX A;  4JNF A;  2OBL A;  4ILG A;  2QXL A;  1OA1 A;  3B52 X;  2YIA A;  1E2U A;  1GN9 A;  5E84 A;  4E81 A;  2GAF D;  3F7W A;  4JWE A;  4R5K A;  4JWI A;  1MJG A;  4PO2 A;  4EZX A;  2EWF A;  2WIN M;  3OWG A;  3ER9 B;  3FD9 A;  3ZEF A;  4EZP A;  3B51 X;  2JNS A;  3UIT A;  4F01 A;  2N3K A;  4IM2 A;  1DKZ A;  3B53 X;  3H0X A;  3I04 A;  3A98 A;  3I01 A;  4IM0 A;  4JLC A;  4JWD A;  2X5C A;  3C7N B;  4EZZ A;  4ILH B;  4G6Q A;  4IWQ A;  4EZQ A;  3VEA A;  4D8J A;  4UDX X;  4EZV A;  3KAV A;  3O3M B;  4KIK B;  1GNL A;  2ND1 A;  3DPQ A;  1DKY A;  4E3C A;  2YI9 A;  2V7Y A;  3L3O M;  3T48 A;  4JN4 A;  3DPO A;  3QNJ A;  1SU8 A;  3C7N A;  4IWO A;  2Z8Y A;  4IWP A;  1Q5L A;  4KIK A;  2PY6 A;  3ZED A;  2OP6 A;  2GA9 D;  3VKH A;  4JL9 A;  7HSC A;  4H6I A;  3D2F A;  4JNE A;  3D2E A;  1YUW A;  2YIB A;  1DG4 A;  2EX3 B;  3RV0 A;  4F00 A;  2OBM A;  4IW0 A;  4WV7 A;  4ILI A;  4R5J A;  3ER8 C;  5FLE X;  1ZYL A;  4R5I A;  3DQG A;  2LM0 A;  2YIV X;  5TKY A;  3LMF A;  4HR1 B;  1OA0 A;  4JWC A;  1DKX A;  2BPR A;  4B9Q A;  3OHX M;  1E1D A;  4EZN A;  3T47 A;  4MQD A;  4NPH A;  4R5L A;  3RV1 A;  3N8E A;  1OAO A;  4WV5 A;  3O3N B;  1SU7 A;  3QA8 A;  4M0M A;  4HR1 A;  3T46 A;  3DOB A;  3I39 X;  2YI8 A;  1U00 A;  4EZO A;  4UDY X;  3GI7 A;  4EZY A;  1W9M A;  4HYB A;  1JQK A;  4EZW A;  3VEB A;  4FL9 A;  1CKR A;  2QFF A;  2NCZ A;  4IM3 A;  2KHO A;  3ERC C;  5FIG A;  4R5G A;  3SBT B;  1SU6 A;  2ND0 A;  3KAW A;  1SUF A;  3DPP A;  3SBS A;  4EZR A;  4FM3 A;  4I43 A;  3T49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...