4JWEA

Crystal structure of the substrate binding domain of e.coli dnak in complex with sheep bac7(1-21)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Identification of DnaK Binding Sites within Bovine and Sheep Bactenecin Bac7.
pubmed rcsb
molecule keywords Chaperone protein DnaK
molecule tags Chaperone/antibiotic
source organism Escherichia coli
total genus 62
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4jweA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4jweA01
3QNJA 4EZYA 4R5IA 4EZTA 1DKYA 4JWDA 4JN4A 4PO2A 4EZVA 1YUWA 5TKYA 3T49A 4EZRA 3T48A 4R5LA 3DOBA 4EZPA 4FL9A 4WV7A 3D2FA 4JWCA 3DPOA 1Q5LA 2BPRA 3DQGA 4F00A 3T47A 4EZOA 4B9QA 2KHOA 4H6IA 1BPRA 3C7NA 1DG4A 4HY9A 1DKZA 4EZQA 3C7NB 1CKRA 4JWIA 3T46A 5E84A 3D2EA 4HYBA 3T4AG 4E81A 2OP6A 4WV5A 4EZZA 4F01A 2WINM 3H0XA 1U00A 1DKXA 2QFFA 4JNFA 4EZXA 2QXLA 3DPQA 3DPPA 4JWEA 3N8EA 3L3OM 4EZWA 4H6HA 2V7YA 7HSCA 4EZUA 4R5KA 4EZNA 4R5JA 4EZSA 3OHXM 4R5GA 4JNEA
chains in the Genus database with same CATH superfamily
3VKHA 1OAOA 3D4YA 3EJPA 2YLAA 3DX0A 1TQVA 4NQIA 3DDGA 1GN9A 4AKVA 4HYBA 4KIKA 4KIKB 2D1LA 4IM3A 4E3CA 1SU8A 1DKYA 4JN4A 2F7QA 4AVMA 2PY6A 4AZHA 4F00A 3D4ZA 1URUA 3ZEDA 3H0XA 4ATMA 3DPQA 2ND1A 2MI7A 3CZNA 3OHXM 2OW6A 4D8JA 2Z8YA 4I1QA 1DG4A 4FZSA 2Z0VA 4ILIA 2QXLA 1GNTA 3B51X 1TQWA 4PO2A 2YIBA 4EZVA 3DOBA 2X3XA 2EFLA 4B9QA 4AZBA 1ZYLA 3D2EA 3I01A 4WV5A 4F01A 2WYIA 4AZCB 4EZXA 2NCZA 3EJTA 7HSCA 3Q0KA 3BVVA 3D52A 3RPMA 2EX3B 3DX2A 4FL9A 1CKRA 5E84A 3T4AG 2F1BA 2YKTA 1WDZA 3DPPA 3VEBA 3ER8C 4BNEA 1R5EA 2X5CA 3KAWA 1X04A 2YLLA 2YL8A 4EZPA 1SU7A 3CKDA 5FIGA 1SUFA 2RAKA 3DX1A 2ZXQA 4AZ6A 3T46A 1QX1A 2YIAA 4NPHA 2YIVX 4UDXX 1O7DB 2N3KA 4R5KA 1W9MA 2C08A 3T49A 2ND0A 2ALWA 4EZRA 4AZ5A 4M0MA 4DYLA 2Q13A 3LLLA 3BVWA 4IM2A 2ELBA 2O0I1 4JWIA 2OW7A 4IWPA 1SU6A 3I39X 3M3WA 4FM3A 4HR1A 3I04A 4EZWA 3PLTA 3FD9A 4ILHB 2EWFA 1E2UA 3QE6A 2FICA 4JWDA 3DPOA 2BPRA 3QA8A 4H6IA 2F18A 3C7NA 3C7NB 3BUQA 4E81A 2GF4A 2FYVA 4IW0A 2Z0OA 2RAIA 4H6HA 2OBMA 3D50A 4R5IA 3I2WA 3BUDA 1HTYA 3VEAA 3A98A 3T48A 4I43A 1Q5LA 3BVUA 3UITA 5KBPA 3DX3A 4EZZA 3HAJA 2WINM 2GA9D 1U00A 2YI9A 3GI7A 4IWQA 3N8EA 3L3OM 1HXKA 4EZNA 3BVXA 3B52X 1TQUA 4EZYA 3BUPA 2PMRA 4IM0A 2KHOA 1QWUA 1BPRA 2V0OA 4AZGA 3BVTA 1OA0A 3BUBA 2Q12A 1X03A 4H8SA 2LXYA 4EZSA 2F1AA 3SBSA 3SOGA 2Z0NA 1I4TA 5TKYA 2OO2A 4EZQA 3CAZA 2GAFD 1I4LA 4FZPA 4JL9A 2F7PA 1E9VA 3BLBA 3DYTA 3EJUA 4JWEA 4R5JA 4WPCA 1R34A 2D4CA 1OA1A 4IWOA 2QKWA 2WYHA 3Q84A 4DCNC 3O3NB 4AZ7A 5C5BA 3SYVA 5C5BB 1I4DA 2RT6A 3B53X 2OP6A 3ER9B 1R33A 2QFFA 4JNFA 1GNLA 2OZNB 4FZOA 4HR1B 4JNEA 3HAHA 2OBLA 2LM0A 2F7RA 3D51A 1UPXA 4MQDA 5FLEX 3T47A 4ILGA 2X3WA 3CVRA 2EFKA 3EJSA 2RAJA 3SBTB 1DKXA 4G6QA 3DX4A 1TQTA 3RV1A 3EJQA 1E1DA 3DDFA 4EZUA 2JNSA 3RV0A 4EZTA 1YUWA 3OWGA 3D2FA 1O7DC 3ZEFA 3EJRA 3KAVA 3DQGA 3QWEA 4EZOA 1DKZA 2YL6A 2YL5A 4UDYX 3CZSA 2X3VA 1LQ7A 1Y2OA 3OK8A 3ACOA 4R5GA 1YWMA 3KDRA 1ZWWA 1PS3A 1I49A 3QNIA 4JLCA 1JQKA 1QWNA 1MJGA 3ABHA 3HAIA 4AZCA 3O3MB 4NSWA 1HWWA 3CV5A 4WPEA 3QNJA 3L3PA 3O3OB 4R5LA 4WV7A 4JWCA 3BUIA 3LMFA 2F7OA 4HY9A 4AZIA 2YL9A 3LVTA 2YI8A 1TQSA 3G9GA 3ERCC 2V7YA 3F7WA 2JNKA
chains in the Genus database with same CATH topology
2OBLA 4R5IA 2LM0A 3VKHA 1OAOA 2EX3B 3VEAA 3A98A 3T48A 4FL9A 4I43A 1Q5LA 3UITA 1UPXA 4MQDA 5FLEX 3T47A 4ILGA 1GN9A 1CKRA 5E84A 4HYBA 3T4AG 4KIKA 4KIKB 4EZZA 2WINM 2GA9D 1U00A 2YI9A 3SBTB 1DKXA 4G6QA 3GI7A 3DPPA 3RV1A 4IWQA 3N8EA 3L3OM 1E1DA 3VEBA 3ER8C 4EZUA 4EZNA 4IM3A 2X5CA 3KAWA 2JNSA 3B52X 3RV0A 4E3CA 4EZYA 1SU8A 4EZTA 1DKYA 1YUWA 4JN4A 3OWGA 4IM0A 4EZPA 1SU7A 3D2FA 5FIGA 2PY6A 3DQGA 3KAVA 3ZEFA 4F00A 4EZOA 1SUFA 2KHOA 1BPRA 1DKZA 3ZEDA 3T46A 2YIAA 4NPHA 1OA0A 3H0XA 4UDYX 2YIVX 4UDXX 2N3KA 3DPQA 2ND1A 4EZSA 4R5KA 3OHXM 4R5GA 3SBSA 4D8JA 3KDRA 1W9MA 5TKYA 3T49A 2ND0A 4EZRA 2Z8YA 4M0MA 1DG4A 4EZQA 4IM2A 4JWIA 4JLCA 1JQKA 2GAFD 4IWPA 1MJGA 1SU6A 3I39X 4JL9A 3O3MB 4ILIA 1E9VA 4FM3A 4HR1A 2QXLA 1GNTA 3I04A 4JWEA 4EZWA 3B51X 4R5JA 3FD9A 4ILHB 2EWFA 1E2UA 3QNJA 3O3OB 4JWDA 4PO2A 2YIBA 4EZVA 3DOBA 1OA1A 4R5LA 4WV7A 4JWCA 3DPOA 4IWOA 2BPRA 4B9QA 3O3NB 3LMFA 3QA8A 4H6IA 3C7NA 4HY9A 3C7NB 1ZYLA 3B53X 2RT6A 2YI8A 3D2EA 3I01A 4E81A 2OP6A 4WV5A 3ER9B 4F01A 2QFFA 4JNFA 1GNLA 4EZXA 4IW0A 3ERCC 4HR1B 2NCZA 4H6HA 2OBMA 2V7YA 7HSCA 3F7WA 4JNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNJ A;  4EZY A;  4R5I A;  4EZT A;  1DKY A;  4JWD A;  4JN4 A;  4PO2 A;  4EZV A;  1YUW A;  5TKY A;  3T49 A;  4EZR A;  3T48 A;  4R5L A;  3DOB A;  4EZP A;  4FL9 A;  4WV7 A;  3D2F A;  4JWC A;  3DPO A;  1Q5L A;  2BPR A;  3DQG A;  4F00 A;  3T47 A;  4EZO A;  4B9Q A;  2KHO A;  4H6I A;  1BPR A;  3C7N A;  1DG4 A;  4HY9 A;  1DKZ A;  4EZQ A;  3C7N B;  1CKR A;  4JWI A;  3T46 A;  5E84 A;  3D2E A;  4HYB A;  3T4A G;  4E81 A;  2OP6 A;  4WV5 A;  4EZZ A;  4F01 A;  2WIN M;  3H0X A;  1U00 A;  1DKX A;  2QFF A;  4JNF A;  4EZX A;  2QXL A;  3DPQ A;  3DPP A;  4JWE A;  3N8E A;  3L3O M;  4EZW A;  4H6H A;  2V7Y A;  7HSC A;  4EZU A;  4R5K A;  4EZN A;  4R5J A;  4EZS A;  3OHX M;  4R5G A;  4JNE A; 
#chains in the Genus database with same CATH topology
 3VKH A;  1OAO A;  3D4Y A;  3EJP A;  2YLA A;  3DX0 A;  1TQV A;  4NQI A;  3DDG A;  1GN9 A;  4AKV A;  4HYB A;  4KIK A;  4KIK B;  2D1L A;  4IM3 A;  4E3C A;  1SU8 A;  1DKY A;  4JN4 A;  2F7Q A;  4AVM A;  2PY6 A;  4AZH A;  4F00 A;  3D4Z A;  1URU A;  3ZED A;  3H0X A;  4ATM A;  3DPQ A;  2ND1 A;  2MI7 A;  3CZN A;  3OHX M;  2OW6 A;  4D8J A;  2Z8Y A;  4I1Q A;  1DG4 A;  4FZS A;  2Z0V A;  4ILI A;  2QXL A;  1GNT A;  3B51 X;  1TQW A;  4PO2 A;  2YIB A;  4EZV A;  3DOB A;  2X3X A;  2EFL A;  4B9Q A;  4AZB A;  1ZYL A;  3D2E A;  3I01 A;  4WV5 A;  4F01 A;  2WYI A;  4AZC B;  4EZX A;  2NCZ A;  3EJT A;  7HSC A;  3Q0K A;  3BVV A;  3D52 A;  3RPM A;  2EX3 B;  3DX2 A;  4FL9 A;  1CKR A;  5E84 A;  3T4A G;  2F1B A;  2YKT A;  1WDZ A;  3DPP A;  3VEB A;  3ER8 C;  4BNE A;  1R5E A;  2X5C A;  3KAW A;  1X04 A;  2YLL A;  2YL8 A;  4EZP A;  1SU7 A;  3CKD A;  5FIG A;  1SUF A;  2RAK A;  3DX1 A;  2ZXQ A;  4AZ6 A;  3T46 A;  1QX1 A;  2YIA A;  4NPH A;  2YIV X;  4UDX X;  1O7D B;  2N3K A;  4R5K A;  1W9M A;  2C08 A;  3T49 A;  2ND0 A;  2ALW A;  4EZR A;  4AZ5 A;  4M0M A;  4DYL A;  2Q13 A;  3LLL A;  3BVW A;  4IM2 A;  2ELB A;  2O0I 1;  4JWI A;  2OW7 A;  4IWP A;  1SU6 A;  3I39 X;  3M3W A;  4FM3 A;  4HR1 A;  3I04 A;  4EZW A;  3PLT A;  3FD9 A;  4ILH B;  2EWF A;  1E2U A;  3QE6 A;  2FIC A;  4JWD A;  3DPO A;  2BPR A;  3QA8 A;  4H6I A;  2F18 A;  3C7N A;  3C7N B;  3BUQ A;  4E81 A;  2GF4 A;  2FYV A;  4IW0 A;  2Z0O A;  2RAI A;  4H6H A;  2OBM A;  3D50 A;  4R5I A;  3I2W A;  3BUD A;  1HTY A;  3VEA A;  3A98 A;  3T48 A;  4I43 A;  1Q5L A;  3BVU A;  3UIT A;  5KBP A;  3DX3 A;  4EZZ A;  3HAJ A;  2WIN M;  2GA9 D;  1U00 A;  2YI9 A;  3GI7 A;  4IWQ A;  3N8E A;  3L3O M;  1HXK A;  4EZN A;  3BVX A;  3B52 X;  1TQU A;  4EZY A;  3BUP A;  2PMR A;  4IM0 A;  2KHO A;  1QWU A;  1BPR A;  2V0O A;  4AZG A;  3BVT A;  1OA0 A;  3BUB A;  2Q12 A;  1X03 A;  4H8S A;  2LXY A;  4EZS A;  2F1A A;  3SBS A;  3SOG A;  2Z0N A;  1I4T A;  5TKY A;  2OO2 A;  4EZQ A;  3CAZ A;  2GAF D;  1I4L A;  4FZP A;  4JL9 A;  2F7P A;  1E9V A;  3BLB A;  3DYT A;  3EJU A;  4JWE A;  4R5J A;  4WPC A;  1R34 A;  2D4C A;  1OA1 A;  4IWO A;  2QKW A;  2WYH A;  3Q84 A;  4DCN C;  3O3N B;  4AZ7 A;  5C5B A;  3SYV A;  5C5B B;  1I4D A;  2RT6 A;  3B53 X;  2OP6 A;  3ER9 B;  1R33 A;  2QFF A;  4JNF A;  1GNL A;  2OZN B;  4FZO A;  4HR1 B;  4JNE A;  3HAH A;  2OBL A;  2LM0 A;  2F7R A;  3D51 A;  1UPX A;  4MQD A;  5FLE X;  3T47 A;  4ILG A;  2X3W A;  3CVR A;  2EFK A;  3EJS A;  2RAJ A;  3SBT B;  1DKX A;  4G6Q A;  3DX4 A;  1TQT A;  3RV1 A;  3EJQ A;  1E1D A;  3DDF A;  4EZU A;  2JNS A;  3RV0 A;  4EZT A;  1YUW A;  3OWG A;  3D2F A;  1O7D C;  3ZEF A;  3EJR A;  3KAV A;  3DQG A;  3QWE A;  4EZO A;  1DKZ A;  2YL6 A;  2YL5 A;  4UDY X;  3CZS A;  2X3V A;  1LQ7 A;  1Y2O A;  3OK8 A;  3ACO A;  4R5G A;  1YWM A;  3KDR A;  1ZWW A;  1PS3 A;  1I49 A;  3QNI A;  4JLC A;  1JQK A;  1QWN A;  1MJG A;  3ABH A;  3HAI A;  4AZC A;  3O3M B;  4NSW A;  1HWW A;  3CV5 A;  4WPE A;  3QNJ A;  3L3P A;  3O3O B;  4R5L A;  4WV7 A;  4JWC A;  3BUI A;  3LMF A;  2F7O A;  4HY9 A;  4AZI A;  2YL9 A;  3LVT A;  2YI8 A;  1TQS A;  3G9G A;  3ERC C;  2V7Y A;  3F7W A;  2JNK A; 
#chains in the Genus database with same CATH homology
 2OBL A;  4R5I A;  2LM0 A;  3VKH A;  1OAO A;  2EX3 B;  3VEA A;  3A98 A;  3T48 A;  4FL9 A;  4I43 A;  1Q5L A;  3UIT A;  1UPX A;  4MQD A;  5FLE X;  3T47 A;  4ILG A;  1GN9 A;  1CKR A;  5E84 A;  4HYB A;  3T4A G;  4KIK A;  4KIK B;  4EZZ A;  2WIN M;  2GA9 D;  1U00 A;  2YI9 A;  3SBT B;  1DKX A;  4G6Q A;  3GI7 A;  3DPP A;  3RV1 A;  4IWQ A;  3N8E A;  3L3O M;  1E1D A;  3VEB A;  3ER8 C;  4EZU A;  4EZN A;  4IM3 A;  2X5C A;  3KAW A;  2JNS A;  3B52 X;  3RV0 A;  4E3C A;  4EZY A;  1SU8 A;  4EZT A;  1DKY A;  1YUW A;  4JN4 A;  3OWG A;  4IM0 A;  4EZP A;  1SU7 A;  3D2F A;  5FIG A;  2PY6 A;  3DQG A;  3KAV A;  3ZEF A;  4F00 A;  4EZO A;  1SUF A;  2KHO A;  1BPR A;  1DKZ A;  3ZED A;  3T46 A;  2YIA A;  4NPH A;  1OA0 A;  3H0X A;  4UDY X;  2YIV X;  4UDX X;  2N3K A;  3DPQ A;  2ND1 A;  4EZS A;  4R5K A;  3OHX M;  4R5G A;  3SBS A;  4D8J A;  3KDR A;  1W9M A;  5TKY A;  3T49 A;  2ND0 A;  4EZR A;  2Z8Y A;  4M0M A;  1DG4 A;  4EZQ A;  4IM2 A;  4JWI A;  4JLC A;  1JQK A;  2GAF D;  4IWP A;  1MJG A;  1SU6 A;  3I39 X;  4JL9 A;  3O3M B;  4ILI A;  1E9V A;  4FM3 A;  4HR1 A;  2QXL A;  1GNT A;  3I04 A;  4JWE A;  4EZW A;  3B51 X;  4R5J A;  3FD9 A;  4ILH B;  2EWF A;  1E2U A;  3QNJ A;  3O3O B;  4JWD A;  4PO2 A;  2YIB A;  4EZV A;  3DOB A;  1OA1 A;  4R5L A;  4WV7 A;  4JWC A;  3DPO A;  4IWO A;  2BPR A;  4B9Q A;  3O3N B;  3LMF A;  3QA8 A;  4H6I A;  3C7N A;  4HY9 A;  3C7N B;  1ZYL A;  3B53 X;  2RT6 A;  2YI8 A;  3D2E A;  3I01 A;  4E81 A;  2OP6 A;  4WV5 A;  3ER9 B;  4F01 A;  2QFF A;  4JNF A;  1GNL A;  4EZX A;  4IW0 A;  3ERC C;  4HR1 B;  2NCZ A;  4H6H A;  2OBM A;  2V7Y A;  7HSC A;  3F7W A;  4JNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...