4JWJA

Crystal structure of sctrm10(84)-sah complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
Knots found
sequence length
193
structure length
193
Chain Sequence
HMPRINVNQTDSGIEIILDCSFDELMNDKEIVSLSNQVTRAYSANRRANHFAEIKVAPFDKRLKQRFETTLKNTNYENWNHFKFLPDDKIMFGDEHISKDKIVYLTADTEEKLEKLEPGMRYIVGGIVDKNRYKELCLKKAQKMGIPTRRLPIDEYINLEGRRVLTTTHVVQLMLKYFDDHNWKNAFESVLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine(9)-N1)-methyltransferase
publication title Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 66
structure length 193
sequence length 193
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.30 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jwjA00
4JWFA 4JWHA 4JWJA 4JWGA 4FMWA
chains in the Genus database with same CATH superfamily
3IC6A 2Z0YA 3KTYA 1V6ZA 4E8BA 1X7PA 5GMCA 1K3RA 3BBHA 4YQOA 4YVJA 1MXIA 1OY5A 4YVKA 4YVHA 2I6DA 4YQ1A 1ZJRA 2V3JA 1UAJA 3L8UA 4JALA 3O7BA 3BBDA 5CO4A 4YPZA 3N4KA 4H3ZA 4YQPA 4JAKA 1O6DA 4JWFA 2HA8A 2V3KA 5GM8A 4CNEA 4L69A 4YQGA 1VHKA 4JWGA 4CNDA 4YQNA 2O3AA 3AI9X 4CNFA 4YQ0A 1X7OA 3ONPA 1TO0A 3N4JA 4YQ7A 3ILKA 2QMMA 3KY7A 4MCBA 1UAMA 1V2XA 4YQ2A 4YPXA 4YQSA 3OIIA 4YVGA 1GZ0A 4YQ6A 4YQ5A 2QWVA 4MCDA 4CNGA 4YQAA 3AXZA 4YQRA 4YPWA 4KDZA 4YQKA 5GMBA 4YQIA 1UAKA 3IEFA 4YQDA 4YQ3A 5D9FA 4YQBA 4PZKA 1Z85A 4JWJA 1VH0A 2EGWA 3GYQA 4FAKA 4YQ4A 1IPAA 4YQ9A 3E5YA 4X3MA 2EGVA 4YVIA 1NS5A 1VHYA 1NXZA 2YY8A 5FAIA 1P9PA 4YQ8A 4KGNA 4JWHA 3KW2A 2CX8A 3QUVA 3BBEA 1UALA 4RG1A 4XBOA 3NK6A 4YQTA 3DCMX 4FMWA 4YPYA 1J85A 4YQCA 4IG6A 4YQJA 3OIJA 3NK7A 4MCCA 4H3YA 4YQQA 4J3CA 3KNUA 4YQLA 3OINA 3AIAA 4X3LA
chains in the Genus database with same CATH topology
3IC6A 2Z0YA 3KTYA 1V6ZA 4E8BA 1X7PA 5GMCA 1K3RA 3BBHA 4YQOA 4YVJA 1MXIA 1OY5A 4YVKA 4YVHA 2I6DA 4YQ1A 1ZJRA 2V3JA 1UAJA 3L8UA 4JALA 3O7BA 3BBDA 5CO4A 4YPZA 3N4KA 4H3ZA 4YQPA 4JAKA 1O6DA 4JWFA 2HA8A 2V3KA 5GM8A 4CNEA 4L69A 4YQGA 1VHKA 4JWGA 4CNDA 4YQNA 2O3AA 3AI9X 4CNFA 4YQ0A 1X7OA 3ONPA 1TO0A 3N4JA 4YQ7A 3ILKA 2QMMA 3KY7A 4MCBA 1UAMA 1V2XA 4YQ2A 4YPXA 4YQSA 3OIIA 4YVGA 1GZ0A 4YQ6A 4YQ5A 2QWVA 4MCDA 4CNGA 4YQAA 3AXZA 4YQRA 4YPWA 4KDZA 4YQKA 5GMBA 4YQIA 1UAKA 3IEFA 4YQDA 4YQ3A 5D9FA 4YQBA 4PZKA 1Z85A 4JWJA 1VH0A 2EGWA 3GYQA 4FAKA 4YQ4A 1IPAA 4YQ9A 3E5YA 4X3MA 2EGVA 4YVIA 1NS5A 1VHYA 1NXZA 2YY8A 5FAIA 1P9PA 4YQ8A 4KGNA 4JWHA 3KW2A 2CX8A 3QUVA 3BBEA 1UALA 4RG1A 4XBOA 3NK6A 4YQTA 3DCMX 4FMWA 4YPYA 1J85A 4YQCA 4IG6A 4YQJA 3OIJA 3NK7A 4MCCA 4H3YA 4YQQA 4J3CA 3KNUA 4YQLA 3OINA 3AIAA 4X3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWF A;  4JWH A;  4JWJ A;  4JWG A;  4FMW A; 
#chains in the Genus database with same CATH topology
 3IC6 A;  2Z0Y A;  3KTY A;  1V6Z A;  4E8B A;  1X7P A;  5GMC A;  1K3R A;  3BBH A;  4YQO A;  4YVJ A;  1MXI A;  1OY5 A;  4YVK A;  4YVH A;  2I6D A;  4YQ1 A;  1ZJR A;  2V3J A;  1UAJ A;  3L8U A;  4JAL A;  3O7B A;  3BBD A;  5CO4 A;  4YPZ A;  3N4K A;  4H3Z A;  4YQP A;  4JAK A;  1O6D A;  4JWF A;  2HA8 A;  2V3K A;  5GM8 A;  4CNE A;  4L69 A;  4YQG A;  1VHK A;  4JWG A;  4CND A;  4YQN A;  2O3A A;  3AI9 X;  4CNF A;  4YQ0 A;  1X7O A;  3ONP A;  1TO0 A;  3N4J A;  4YQ7 A;  3ILK A;  2QMM A;  3KY7 A;  4MCB A;  1UAM A;  1V2X A;  4YQ2 A;  4YPX A;  4YQS A;  3OII A;  4YVG A;  1GZ0 A;  4YQ6 A;  4YQ5 A;  2QWV A;  4MCD A;  4CNG A;  4YQA A;  3AXZ A;  4YQR A;  4YPW A;  4KDZ A;  4YQK A;  5GMB A;  4YQI A;  1UAK A;  3IEF A;  4YQD A;  4YQ3 A;  5D9F A;  4YQB A;  4PZK A;  1Z85 A;  4JWJ A;  1VH0 A;  2EGW A;  3GYQ A;  4FAK A;  4YQ4 A;  1IPA A;  4YQ9 A;  3E5Y A;  4X3M A;  2EGV A;  4YVI A;  1NS5 A;  1VHY A;  1NXZ A;  2YY8 A;  5FAI A;  1P9P A;  4YQ8 A;  4KGN A;  4JWH A;  3KW2 A;  2CX8 A;  3QUV A;  3BBE A;  1UAL A;  4RG1 A;  4XBO A;  3NK6 A;  4YQT A;  3DCM X;  4FMW A;  4YPY A;  1J85 A;  4YQC A;  4IG6 A;  4YQJ A;  3OIJ A;  3NK7 A;  4MCC A;  4H3Y A;  4YQQ A;  4J3C A;  3KNU A;  4YQL A;  3OIN A;  3AIA A;  4X3L A; 
#chains in the Genus database with same CATH homology
 3IC6 A;  2Z0Y A;  3KTY A;  1V6Z A;  4E8B A;  1X7P A;  5GMC A;  1K3R A;  3BBH A;  4YQO A;  4YVJ A;  1MXI A;  1OY5 A;  4YVK A;  4YVH A;  2I6D A;  4YQ1 A;  1ZJR A;  2V3J A;  1UAJ A;  3L8U A;  4JAL A;  3O7B A;  3BBD A;  5CO4 A;  4YPZ A;  3N4K A;  4H3Z A;  4YQP A;  4JAK A;  1O6D A;  4JWF A;  2HA8 A;  2V3K A;  5GM8 A;  4CNE A;  4L69 A;  4YQG A;  1VHK A;  4JWG A;  4CND A;  4YQN A;  2O3A A;  3AI9 X;  4CNF A;  4YQ0 A;  1X7O A;  3ONP A;  1TO0 A;  3N4J A;  4YQ7 A;  3ILK A;  2QMM A;  3KY7 A;  4MCB A;  1UAM A;  1V2X A;  4YQ2 A;  4YPX A;  4YQS A;  3OII A;  4YVG A;  1GZ0 A;  4YQ6 A;  4YQ5 A;  2QWV A;  4MCD A;  4CNG A;  4YQA A;  3AXZ A;  4YQR A;  4YPW A;  4KDZ A;  4YQK A;  5GMB A;  4YQI A;  1UAK A;  3IEF A;  4YQD A;  4YQ3 A;  5D9F A;  4YQB A;  4PZK A;  1Z85 A;  4JWJ A;  1VH0 A;  2EGW A;  3GYQ A;  4FAK A;  4YQ4 A;  1IPA A;  4YQ9 A;  3E5Y A;  4X3M A;  2EGV A;  4YVI A;  1NS5 A;  1VHY A;  1NXZ A;  2YY8 A;  5FAI A;  1P9P A;  4YQ8 A;  4KGN A;  4JWH A;  3KW2 A;  2CX8 A;  3QUV A;  3BBE A;  1UAL A;  4RG1 A;  4XBO A;  3NK6 A;  4YQT A;  3DCM X;  4FMW A;  4YPY A;  1J85 A;  4YQC A;  4IG6 A;  4YQJ A;  3OIJ A;  3NK7 A;  4MCC A;  4H3Y A;  4YQQ A;  4J3C A;  3KNU A;  4YQL A;  3OIN A;  3AIA A;  4X3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...