4JX1C

Crystal structure of reduced cytochrome p450cam-putidaredoxin complex bound to camphor and 5-exo-hydroxycamphor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVACGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Camphor 5-monooxygenase
publication title Structural basis for effector control and redox partner recognition in cytochrome P450.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
total genus 27
structure length 106
sequence length 106
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4jx1C00
2BS3B 1E6EB 2BS2B 1XO3A 3NVWA 4YSXB 1F0ZA 1ZUD2 1DOIA 2HTME 1V8CA 1QF6A 1FRDA 3W5VB 2L52A 4C80A 3CIRB 3P4SB 2MH7A 1FO4A 4WWMA 3AEDB 1JALA 1KF6B 4C7YA 1FFUA 1JRPA 3AE9B 4JWUC 4USAA 3AMZA 4C7ZA 2MJEA 3SFDB 2K9XA 3HUIA 2DWQA 1J7CA 1NI3A 1YQ4B 5EE9A 1RFKA 2PKOA 2W54A 5H8YE 1V97A 2JX5A 1GPXA 1SIJA 1L5PA 1NYQA 1SB3C 3AE6B 1XLQA 1AWDA 1WRIA 1A70A 1ZOYB 2LEKA 1E10A 1WGKA 3PO0A 4YSZB 1JWBD 3NRZA 2W3RA 4HROA 3WCQA 5EE3A 4US9A 1JQ4A 1I7HA 4WQMA 1FMAD 1YJIA 1N5XA 1WXQA 2OHFA 2E3TA 3AEBB 4KX6B 5EE0A 5C2TB 5AUIA 1XLNA 1AYFA 1PFDA 4YT0B 1T3QA 4P6VF 1FRRA 1OFFA 1KRHA 4ZOHC 4YTMB 3P4QB 3AEGB 4ZHOA 3AE4B 1TKGA 3EUB2 2W3SA 1DGJA 2Q5WD 4YSYB 3W5UB 1RYJA 1OQQA 2WLBA 3AN1A 1OQRA 1WWTA 2BT6A 1L0VB 2WDVB 3VRAB 2FBWB 4ZHPA 1ZXIA 1SF0A 1YQ3B 3B9JA 1DOXA 3KWLA 1FXIA 2PVGC 1J7AA 4JWSC 2B76B 3AE5B 1B9RA 3ZYYX 2ACZB 3AE8B 3HVZA 3HRDD 1E7PB 1JW9D 3AEEB 2MJDA 5MPOA 5C3JB 2G1EA 3AM9A 1JWAD 3CWIA 3AE2B 3DWGC 5G5HA 1DOYA 1FXAA 1VDVA 2DBYA 4LTUA 4YTPB 1VJKA 4HRSA 1CJEA 4FXCA 1N5WA 3ABVB 3P63A 1ROEA 1NYRA 1ZP0B 1FM0D 2KMMA 2PIAA 3LB8C 3FC4A 1N63A 2WU5B 2L83A 1NENB 1TJEA 2CU3A 3ETRA 5AUKA 3SFEB 3VRBB 3B2GA 3AH7A 2QIEB 2EKIA 1E9MA 1GAQB 2WQYB 1R7SA 4N58A 3VR9B 2W55A 2AX5A 2PVOD 3BIID 3P1MA 3P4RB 4A9AA 1QOAA 1L6VA 3NVYA 3DWMA 1QLBB 1WYGA 3NVVA 1N61A 1JROA 3FAHA 4ITKA 3NVZA 3AE1B 5G5GA 1RWSA 2JQRB 2K22A 3AECB 2WDRB 1TYGB 2Y5CA 4N59A 3AE3B 4N6EB 5EE1A 4JX1C 5GXGB 3SR6A 1NVID 2CJOA 2CJNA 3L4PA 1QOFA 1TKEA 1VLBA 4YXDB 2WDQB 4YTNB 1J7BA 3RPFC 3AE7B 1N60A 1CZPA 2WU2B 1XLOA 2MJ3A 2QJLA 1YJJA 3AEAB 1E0ZA 1IUEA 1FIQA 1PUTA 3P4PB 1FFVA 3LXFA 1TKYA 2KAJA 3VR8B 3AEFB 3B2FA 1L6UA 1UWMA 2BS4B 2H89B 1RM6C 2WP9B 2H88B 1XLPA 4US8A 2M19A 1NEKB 1QOBA 2M56B 2WS3B 5H92C 3W9CB 1N62A 3AB5A 4IDIA 1QOGA 2N0SB 3NS1A 2K5PA 1KFYB 1PDXA 1EWYC 1QT9A 3AV8A
chains in the Genus database with same CATH superfamily
4OW0A 2FIDA 4KGSA 3DBLB 3RNFC 4IM3A 5C1ZA 4XDCA 3GB1A 3SFDB 1YNTE 1V80A 4TSSA 1WE7A 3KW5B 1WMHA 1I4GA 5BYQA 1WRIA 4LJPB 2LEKA 3NOBA 4UDUC 3X23A 3W1SA 1D5MC 2GBNA 3U4EG 3QARA 4MT5A 4GIVA 4LDTB 1YJIA 1LM8B 2E3TA 1WX7A 2ZPYA 1HZ6A 2M1MA 1FRRA 3QIJA 3KUCB 1I4HA 3WANA 2Q5WD 4KKIA 3L54A 2KWCA 5KHQA 4FBJB 2DZJA 2MBBB 3ZTCA 4WWNA 4WJPA 5FR3A 1VJKA 3DHGC 3PTFC 2KMMA 2XBBC 4NAMA 1L4DB 1I42A 2G9HD 3SFEB 3DDCB 3M63B 2MBEA 2Y5PA 1V2YA 3NZ3A 1R7SA 4LK0M 3H1UA 2JXTA 1L2NA 2J7QB 5C23A 5AEKB 2KFKA 3KLSX 2WDRB 4K7UA 4OZCA 3AE3B 2IZVB 1P9DU 4AWJA 1EO6A 3O65B 2BB6A 4AOFA 3KYCD 2KKCA 2QC8A 3H9DA 2WP9B 3I63C 1SBBB 2DZIA 2N7EA 2VH2A 4ANVA 1GB1A 1Q5WB 1UNSA 1WXSA 1Y8RC 4MGYE 2YEPB 2J4XA 2WXQA 2AYOB 3MTNB 3IT6B 5E6OA 5BYSA 3ZRFA 4MDKE 1YQ4B 3TSSA 4WAAA 1GB4A 2J42A 3WA0A 3V6EB 4HROA 4FADA 4FJVB 1FD6A 5J18A 4GDKB 2XK5B 4LNFA 2SAKA 4A20A 2KTRA 2LI5A 3LYYA 2WDVB 4ZHPA 1C4PA 1I4XA 1J7AA 1SE3A 1UD7A 5HKHA 1IBXA 4KZCA 3RULA 5C3JB 2K8HA 2G1EA 4MGKE 1P3QU 3QC8B 1DOYA 3P42A 2M4NA 4DDGD 4IOIE 2UYZB 3U52E 3PRPB 4B0EA 2WXHA 1TJEA 5IP4D 3I9V1 4ARCA 3URYA 4GDLB 2QIEB 1RAXA 3I3TB 4MACA 4A9AA 1QOAA 4LCDE 3U8ZA 2MWSB 3DVNV 2KVRA 3JSVA 1MFWA 3QAQA 3J9CA 4RFBA 2KJHB 3L4PA 1QOFA 3D32A 3PRZA 4WIPA 4E71A 4XYCA 4CYEA 1FIQA 1C3TA 4GSWA 2RGFA 4G3XB 3GZNI 3TBLD 2WXGA 3Q8AA 3TEZA 1ZDVA 1UWMA 2KJRA 3PLVA 3I5JC 2JZZA 1XLPA 2M19A 5DCNA 2AL3A 3APFA 4BVUC 1BXTA 2HTME 2BS3B 3NVWA 3VVWB 2V0GA 4HPLB 2K6QA 1H4RA 4ARIA 2MQJA 1T0QC 1S1QB 2JUOA 3VDZA 2O2VA 3TJPA 2DX5B 5CTRC 2GBMA 1I4QA 2HJ8A 4KVGB 1XEEA 1SB3C 1WGKA 3NJTA 2BWES 1WFYA 3B0AA 3DVGX 1WXQA 2ZEQA 1D5ZC 2FCQA 1OFFA 4M0WA 1WMHB 4ZRJA 2IGHA 1L7YA 3AI5A 1WR6E 1CK1A 2FBWB 3JVZX 1Q10A 2JRHA 3R7RA 3OG5A 4L2YA 4NQLB 2OOBB 1T0YA 2HJ1A 2PE6B 3EA6A 3RNGC 4P1CC 3IHPC 3NUHB 2MBHA 1WX8A 4OZAA 1UUPA 3PRMB 3QA8A 4E74A 2CS4A 2INCC 4TQ1A 4YTNB 3RPFC 1VZ8A 1V49A 1EF5A 1MHXA 2NBVB 4MSMB 4K7SA 2D2QA 2J0MA 3ZIMA 2KFKB 4A55A 2BYTA 2NMQA 4I6PA 4W9HA 2WS3B 3Q8CA 2XEWA 2DYMA 1IP9A 4CO7A 1T6BX 2K5PA 3RD2A 1WY8A 2ONQA 4DQOC 2YLMA 1IGDA 3KQ4A 3KVFB 3DBRI 3P4SB 3TEYA 4LNIA 3DHHC 3DBHI 5LLIA 2L76A 3S2AA 1NI3A 3TEXA 4ZYSA 5EDSA 1XCTL 2PPHA 2N9PC 1C77A 3IBEA 2R2QA 5LNK1 2C7MB 2IPKD 1R4MI 2K8BA 3ML8A 4W9IA 3WIMA 2HTHA 1FNWA 1A70A 4BOSC 1TGZB 1YD8U 3ZDTA 5TR5A 2I1KA 4D2KA 1AYFA 1PFDA 4WJOA 2IY0B 1KRHA 4YTMB 1IGCA 2WX0A 2Z59B 1YJ1A 3Q3NC 5J2RA 1C9FA 1ZXIA 2DAFA 1SE4A 4ZRKA 4TMAB 4PS3A 1ZDXA 3HRDD 4DWFA 1PYWD 1ZXHA 3PLUA 1FNVA 2N9LA 3AE2B 1VCBA 2DBYA 4OZBA 4FXCA 2WDTB 2KTRB 4BOZB 2NBUA 2EELA 3ZO5B 2D3AA 2V4IB 1WYWB 1E8ZA 1EWCA 2V4LA 2WXJA 2JVCA 2EKIA 1VR9A 2O6VA 3Q3OC 1IBXB 3BK1A 4REZA 3VUYA 5CHVC 3AXCA 3UQBA 1RWSA 1NVID 4C4VA 3Q3FA 4EZJA 2BKRB 3EFCA 2CHWA 4HCNB 2QDFA 1WJUA 3AEFB 1UH6A 4KV2A 3JSVB 3UGBB 2M56B 5H92C 2N9KA 3T3OA 1F0ZA 2A5UA 1QF6A 3M3JA 1YX6B 2WXFA 1J19A 3A9JA 4CQNA 4PYZA 5D7GA 3V6CB 1UELA 2KDBA 1VD2A 3GE8C 1WF9A 1SIJA 2LGSA 2MBQA 2FUHB 2FNJB 4J6IA 1ZOYB 5IO9A 3NRZA 2PEAA 1WH3A 2O2VB 2RSUA 2N1VA 1FMAD 2LUEA 5C2TB 4KSKC 1C4AA 3RZFA 1HTOA 3BVGA 2K1FA 1HXYD 1L0VB 3ZDMC 2WXRA 1UGJA 4FLHA 2XNAC 3UIOB 1NDDA 2K39A 2PVGC 3JYUA 4BKTA 2MW5A 2D3CA 3ML9A 2KT7A 3ALBA 3DWGC 3KYDD 4M0WB 4MGIE 4HRSA 1N5WA 2ASQA 1V6EA 1FXTB 1ZP0B 2L83A 3DVGY 5AUKA 2J52A 4EUTA 2V3NA 3APDA 3BINA 1EUVB 2D07B 4N58A 1MI0A 3VFKA 2WXNA 3R2TA 1L0YB 1C1YB 4K1RB 2K22A 2QHOA 4RF0A 4BFRA 4WJNA 2N1WA 1TKEA 1ESFA 2GOWA 2WDQB 3Q6BA 4RMAA 2JPHA 2MJ3A 1ZE3D 4PS7A 4LDTD 1FEHA 1UF0A 2FCNA 2GLSA 1Q1OA 1SJHD 4BAXA 1PDXA 3ABVB 4DHZE 1QT9A 4XWWA 3PZDA 4G11A 1SIFA 4IWQA 4IM0A 5HI1A 4RM9A 2V1YA 3C8YA 3VTVA 4USAA 2KN5A 4ZRIA 3L16A 4C00A 5L95C 2O6VD 4C56C 3ZNID 2L05A 4M8NA 5H8YE 1L5PA 4HEA1 4W9LA 2TSSA 1XLQA 1AWDA 3B1LX 2W9NA 1E10A 2HD5B 2J0KA 2YEPF 2CHXA 3SDLC 1T5XD 3TCAA 3AEBB 3CSFA 3PREA 4WJQA 4W9FA 1XXGA 3T9LA 4XGAB 2J53A 2WGSA 4M01A 2FAZA 2NTTA 3P4QB 3W5UB 3AN1A 2QCZA 1OQYA 2OEDA 2AQ1B 3V05A 3HVZA 1RLFA 1E8WA 2KQ4X 3Q3JA 2IJ0A 4E3CA 4XX5A 3QK0A 1D4BA 4XC2A 1VDVA 2KC2A 4YTPB 4KSLC 2PMVA 2LXAA 3M95A 3K9OB 3NHEB 3FC4A 1N63A 3NG0A 3N3KB 1C76A 4JQWC 2C5LC 3VRBB 2BW2A 3VR9B 2W55A 2NCNA 3KUZA 4NAWA 3B08A 2Y5CA 2LGYA 1WGRA 4JL9A 1WM2A 3ZNZB 4HJGE 3AE7B 2QJLA 2WXOA 2O6VB 1LFDA 4HJKA 3N9YC 3ECIA 4OVVA 2BGFA 2EMTA 4IM2A 2KLCA 3LJ3A 3IAM1 2DZMA 4ZDVA 4C4VB 5HFYA 4ANUA 2FCSA 4WWPA 2BS2B 4NPNA 1FRDA 1PGAA 1FFUA 1JRPA 3AE9B 3AMZA 2K3UA 3PPAA 2VRRB 2NS5A 2KD0A 3VTWA 1E8XA 1YMHE 3JW0X 2B3AA 3A4RA 3QCAA 3GS2A 1YIWA 3DCGA 2OJRA 3UF8A 3MP9A 1HQRD 1JWBD 1B1ZA 3A9JB 5E6NA 1I7HA 4GXBA 5L83A 1T0RC 1AARA 4A90A 4K81A 1WJ6A 4MGZE 1YQBA 1GUAB 3GZNB 1P0RA 2ZJDA 1BMLC 2WLBA 1WWTA 1SF0A 5JXVA 2DZKA 3AE8B 1LXDA 4XZ4A 2MJDA 1XD3B 1WXVA 3UQAA 5G5HA 4LTUA 4OVUA 3IT4B 3LB8C 4KDLB 4A3OA 1ZKHA 4IWPA 3LDZE 2INPE 4TUUA 2WQYB 2PVOD 2D10A 4Q2JA 3P4RB 4NZLB 1P98A 1QKZA 3NVYA 2ZPNA 5IAAC 2BKFA 1WYGA 3WAPA 2GRIA 5D94A 1MG4A 4JPSA 3ZVVA 3MFGA 4YWGG 1YOVB 5E6PA 1HZ5A 2WU2B 2BYEA 2MLBA 3V60A 2MBOA 3KH0A 3RFZB 2VH1A 1FFVA 3FILA 5FKAC 3FKYA 5GMVA 3IVFA 4NJCA 2KC1A 3N1ZC 4HLEA 1KLVA 4B0MA 2LZ6A 3Q2AC 3N1XC 5CHWA 3RUIB 2JZ3B 3ZXRA 3HM6X 4PT5A 3WAOA 1HE8A 2MSED 1J7CA 2V9HA 5EE9A 2NBWB 2JX5A 4LJOB 3AE6B 1PQSA 2KMAA 3N20C 1EU3A 1ZPSA 5EE3A 2KK8A 1WGGA 3HK0A 1X1MA 1KTKA 1SXTA 3ZRCA 4PK1A 4AS1A 4ZOHC 1TKGA 4W9CA 2IYDB 5HHDG 1LGRA 3N32A 2L8JA 3EECA 1MVKA 2SEBD 2ICIA 2IO2B 2B76B 4II2B 3SU8X 1OGWA 4I6LB 1JWAD 1HTQA 4LNOA 3DBRB 2L1AA 2PIAA 3DBHB 2AQ2B 2LXCA 4IWOA 1GAQB 4GOCA 1L6VA 2DYBA 4IKGA 2LD9A 5EE1A 2I1JA 4DBGA 4MEMA 5DPTA 1TS4A 2LRWA 2I2YA 1S3SG 4J3OD 1IUEA 1C4CA 2KAJA 1D3ZA 4NAWB 1R4NI 4FJYA 4F8CB 3V62A 1JMLA 1AW7A 2N0SB 1U4AA 4NJ6A 1LO5D 1TS5A 1E6EB 1GNUA 1SGHA 3H6NA 2L0FA 1WGYA 1L0XB 3L0WB 3N30A 5FK9C 2LHEA 3H8HA 3U2SC 2GBKA 3QQ8B 1GPXA 5JZEB 4JIOU 3MC0B 3ZQ4A 4W9DA 1XQQA 4II3B 3VUWA 4IW0A 3W2DA 1CQVA 2LVOA 4XWTA 4A6QA 4US9A 4KX6B 1SSNA 2UWQA 2HDEA 3R8BA 2KANA 3AEGB 1HEZE 1RYJA 2BPSA 3VRAB 3I57A 3ZLZA 3KWLA 1GC7A 3ZJTA 2LHDA 2KQSA 1JCKB 2KXJA 4ZYNA 1FCCC 1L4ZB 1E7PB 3AEEB 2MEKA 2JWUA 4RGOS 3TMPB 4HDOA 1SJED 3GP7A 1CJEA 4GN1A 3EHVA 2K8CA 2BWFA 4MJSA 2WU5B 4DHJD 1KH0A 3AH7A 3R7QA 2M0AA 2LMCA 2N7JA 3BIID 5KHOA 3P1MA 4B6WA 2INDC 1V1PA 4AQ7A 4BBNF 3U7DA 4N6EB 3AECB 4RM8A 4JX1C 3RNBC 2C7NB 3VAWA 3HVDA 4YXDB 1VLBA 2G4SA 1OEYA 1YJJA 2WHIA 4K7WA 2MHJA 3AU5A 3R66C 3IFWB 2D3BA 1P7FA 4HKZE 1DYQA 4KDIC 2IO0B 1V5TA 1BUIC 2WNMA 3ZUNA 5JHAA 1I4RA 2BYVE 1WR1A 2KWVB 1FCLA 4YSXB 1ZUD2 1WXAA 2FCMA 1F9JA 1C78A 1JALA 3FILB 1IYFA 1ACCA 3PVLA 2D3GA 2GI9A 1GOZA 5IA7A 2Y5BB 4FULA 1GG3A 1E8YA 2K0PA 2RPVA 2D5GA 3ZNGC 2W3RA 3UINB 3TUOA 5JH5C 4EZLA 1JQ4A 1WGHA 4WQMA 4DHJB 2KZRA 3TIXA 5AUIA 4L1BA 4ASWC 2JF5A 4W9GA 1K51A 4ZHOA 4KKJA 1DGJA 3UIPB 4B9KA 2YVCA 2BT6A 2KMCA 1UBQA 1WSPA 1DOXA 3B9JA 1SE9A 3BY4B 2VZKD 3E9SA 1EU4A 2ZW0A 5D3DA 4KGRA 2WXKA 2OJWA 2EKEC 1NYRA 1WI0A 3ETRA 3APCA 1PGBA 2RMMA 3BYYB 3M62B 1JRUA 2N4FA 2BTEA 1E7UA 2KN4A 4HXDA 2KWUB 4EFOA 3AE1B 2R61A 2DAJA 1TS2A 3A1QA 1WRDB 2LWPA 2LGDA 2LGIA 2C60A 2IY1B 1YN4A 2MRPA 2MCNB 1TKYA 3VR8B 3L13A 4DHZB 5BMHA 3W9CB 5AZFA 4N9F4 2GB1A 3FAHA 4MM3A 3H7SA 1MG8A 3BVMA 3CF6E 3ZXVA 1V86A 2NR2A 4RGTA 1TY0A 3CIRB 1KLUD 2KDMA 1EM7A 2QEJC 2BF8B 3A33B 4X57B 2V3SA 4GMVA 3CMMB 1Y56A 2VZKB 2PKOA 1KOTA 4A8XC 2WWZA 2AQ3B 2WXLA 4MH8A 1WGDA 5HG2A 4AUQC 4P7IA 3VUXA 1SEBD 1TS3A 1TBEA 2INNE 1N5XA 3KUDB 1XLNA 2KVZA 2KFJA 2KOXA 3EFUA 3EUB2 4O1NA 2W3SA 1ISNA 3Q69A 4R3DA 4ACFA 1D5XC 4OHJA 3RNCC 3V3XA 2KDEB 3AM9A 1XCQL 3PSEB 4H2AA 3RYTA 1ROEA 4HKQA 2LVPA 2RDHA 3ZKJC 2CU3A 5DPWA 5IKCM 1N61A 2XN9C 4MJSB 4B95A 1NI2A 3PHXB 2JYTA 5I4DA 3PZ7A 4BBNC 2ZNVC 1PGXA 4KZ0A 1KJTA 1V1PB 2LRUA 4L23A 1F2RI 3AB5A 1TIFA 1WJ4A 3DPDA 4LNNA 4K3BA 1DOIA 1WM3A 2ZCBA 1F2RC 2JRIB 5G55A 4C7YA 2J0JA 4DXFA 2G4DB 1J8CA 3GE3C 3P2BA 2DWQA 2BVCA 2K6DB 4W9EA 4DXAB 1V81A 3AU4A 2JY6A 2L7RA 3MJWA 1STEA 2REXA 1UZXB 3BK2A 4AP4C 3ZJVA 3Q8EA 2IBIB 2BYFA 1ET9A 1A5RA 3U30A 3NY5A 2A4ZA 2CR5A 4WQOB 3AE4B 1XT9B 3L17A 1WX9A 1D6EC 1MJDA 2G45B 5LXHA 1YQ3B 1WZ0A 4JWSC 2KJ6A 3AE5B 1B9RA 3PT2B 1AN8A 3T3NA 5IOIA 1V1OA 4BKGA 2KDFB 4ICVA 3DBLI 3A9KA 2WXMA 3O13A 3R3MA 4WURA 4NQKE 3V61A 1NENB 2EMSA 1TT5B 1E9MA 3RMKC 2FUG1 4KIKA 3AULA 2E6XA 3VXWA 3GOEA 4K3CA 1ET6A 4XE0A 3MHZA 4N59A 3HM3A 1CMXB 5IN7A 1JWSD 2JSVX 1J7BA 1F77A 1KLGD 3UI3A 2QILA 1PUTA 3P4PB 2LFIA 2GBJA 5BMIA 1NBFC 1QOBA 3RCZA 3A1QB 4IDIA 1QOGA 2KQ7A 4JLCA 4ZRPA 1I4PA 3N1YC 1J0GA 1KM7A 1XO3A 2JT4B 4IUMB 1V8CA 4BKSA 4C80A 3PS6A 1GJZA 3A4SC 1VZ6A 1F52A 2CKHB 3E56A 1YN5A 4WAFA 2MJEA 4MH0E 1UBIA 3NZUA 1RFKA 4RF1A 1VZ7A 3MC8A 4MM3B 2W54A 4DXGA 2NPTA 4BZAA 1NYQA 3C0RB 3VHTC 3KWVA 2G3QB 2N7DA 1Z2MA 1UWXA 2KX3A 2L00B 1T3QA 4P6VF 3H7PA 2KX0A 1UGMA 1K50A 4PS8A 4PYUA 1XF5L 2HE7A 2L32A 1R4NB 1IPGA 1YX5B 3TEWA 3OLMD 2KHWB 2I38A 4NNJB 1TY2A 1P1AA 1M4VA 2LJ5A 1WJNA 4I6NB 2DYOA 1M94A 3NS8A 3ZTDA 1BT0A 2C7HA 2KTFA 2MP2A 5G2NA 2X38A 4HVBA 4HDQA 4URKA 2WXPA 2NVUI 3RZWC 4DDID 4WWOA 3SHQA 2IGDA 2KACA 4EKUA 4ITKA 3NVZA 4ICUA 4AJYB 3SR6A 1TYGB 3X0WA 3VTUA 2IDYA 1N60A 1CZPA 5BO4B 4NJ7A 3MC9A 3LXFA 2KDIA 3IAS1 1WE6A 3B2FA 2M0XA 2BBCA 1NEKB 4CHKA 4HPMB 1G6JA 1R4MB 1N62A 4FHJA 4NY0A 1Z5SB 5JHBA 2ZVOA 3DVNU 3OJ4B 1WXMA 2AWTA 1OTRB 2L52A 2DNFA 1RFAA 2MH7A 4OVZA 1C79A 5BMGA 4WWMA 3AEDB 2AEHA 3HUIA 2L3ZA 4RGNA 1V97A 3QWZB 1FPYA 3L10B 2ZVNA 2RR9A 2BB5A 2JYEA 4YSZB 1SE2A 3ZW3A 1MHHE 2CHZA 1T0SC 4A3PA 1MPEA 2KLGA 4F7ZA 1ZGUB 1K8RB 4FN2A 3VH3B 3QX1A 2RD0A 2M17A 3K9PB 4S0RA 2MX2A 1FXIA 1HA5A 2MA9B 4FA6A 4QAYA 2Y3AA 4RNAA 2KO3A 3IG3A 4BKSD 1LQBA 1FXAA 2Z8LA 3HIZA 3DHIC 3U7ZA 4TV3A 2N9XA 1EF1A 4ANWA 3CSTA 5D2MB 4WH4A 2Z0DB 2DHZA 3B2GA 3BWUD 1TTNA 4DK5A 2KNBA 1K52A 2X8XX 2LASA 3A9KB 5DPRA 4HK2A 5G5GA 2JQRB 3QJZA 3WAMA 3HHMA 5J17A 3QHTA 5DPSA 3C19A 1JWUD 2RPQA 1V9JA 4KIKB 1H8CA 4EOYA 3PGEA 1TZ1A 2LUMA 3ZJUA 2PTLA 2M8SA 1EWYC 2LJIA 1GC6A 2C9WB 5FR6A 3W1SC 3ZNHB 2NTSA 1FO4A 3VH4B 4GLSC 4M00A 2K9XA 3RN9C 5TSSA 5CX3A 4G0NB 1E90A 4M02A 3NZSA 2PE9A 4JGHB 2DENB 4HPPA 3PO0A 3PZ8A 2RDBC 4G50A 2WYQA 2ZCCA 2K25A 1QQRA 2W82A 5EE0A 3ENEA 1QILA 2AL6A 2N9EB 1P7EA 3RNAC 2NPTB 3Q3MC 4RH6A 4S17A 2DLBA 3BVZA 1OQQA 3Q8FA 3SEBA 2R2OA 3R2IA 5AZGA 2IO1B 1ENFA 3VQIA 3Q14C 3CWIA 1Q0WB 2QMTA 3H7PB 2PLPA 1I35A 3P63A 3RT3B 3W1YA 4EE2A 2CU1A 5T8IA 2GBRA 4F1SA 3Q8BA 4ANXA 2AX5A 2PW9A 2ON8A 2ZW1A 4AJWA 1QLBB 3DQVA 1RRBA 2IGGA 4FJZA 2KWDA 4P1BC 2MP2B 4GU2A 3RI7C 1K53A 1E5WA 1WZ3A 4KGTA 1TZOA 1L6UA 4LNKA 2H89B 4TKNA 5E6JA 2GMIC 3IXSA 4JE3B 1YN3A 5D6JB 3NS1A 2PJHA 1OEYJ 2ZZPB 1KFYB 3OJ3A 2RDGA 3DOWA 3ZGZA 2BQQA 3AV8A 3L08A 1F1HA 4IG7B 3ONSA 3W5VB 4EZKA 4ZRQA 1KF6B 4JWUC 4C7ZA 4IC7B 5CHFA 3MHSD 4GDKA 2D11A 2XK5A 5BYRA 4GGQA 1ZW7A 4W9KA 4EEWA 2V3PA 2ZNVB 3WCQA 1E7VA 2OHFA 2WXIA 4YT0B 4FHKA 1N6ZA 2Z0EB 3WALA 2WX1A 4YSYB 2KYWA 1OQRA 4YL8A 4XDDA 4P16A 2L0TA 3EC8A 4GDLA 3OWEB 2QSDA 3ZYYX 2ACZB 2JZPA 5D3IB 1JW9D 3MJ5A 2FE8A 5MPOA 4HCPB 4LLGM 3DBSA 4M8MA 1FNUA 1FM0D 4RCOA 4RGMA 3RNEC 3BYTB 2JWZA 2JXXA 3OAWA 3PHWB 1V5OA 2JU6X 3DWMA 3NVVA 1JROA 4W9JA 3SD5A 3PV1A 5GXGB 2FIFA 2CJOA 3BZDB 2CJNA 4MELA 3EGRA 2LGXA 4TQ0A 1WIAA 2UU7A 1XLOA 3AEAB 1E0ZA 2IO3B 1JWMD 1QZEA 3T8MA 5AZHA 4HWIB 2BS4B 1RM6C 4US8A 4GB9A 1VRAB 3TL5A 5LXIB 4MSQB 2LVQA 2H88B
chains in the Genus database with same CATH topology
1LO5D 1TS5A 1E6EB 1F0ZA 1XO3A 4OW0A 1QF6A 1V8CA 4KGSA 4C80A 1L0XB 2WXFA 1VZ6A 3E56A 1YN5A 4XDCA 2LHEA 3H8HA 4WAFA 5FK9C 2MJEA 3GB1A 3SFDB 4CQNA 3U2SC 1YNTE 5D7GA 4TSSA 1RFKA 4RF1A 1VZ7A 4DXGA 4MM3B 2W54A 1GPXA 1SIJA 1NYQA 3MC0B 3ZQ4A 1I4GA 5BYQA 1WRIA 3W2DA 1ZOYB 2LEKA 1CQVA 3KWVA 4UDUC 4XWTA 3W1SA 1D5MC 3NRZA 4A6QA 3U4EG 1UWXA 4MT5A 4US9A 1FMAD 1YJIA 4KX6B 2E3TA 1SSNA 5C2TB 1C4AA 2HDEA 1HZ6A 1T3QA 1FRRA 4P6VF 3R8BA 3BVGA 3AEGB 1K50A 1I4HA 1HEZE 1XF5L 2Q5WD 2L32A 1RYJA 1HXYD 3VRAB 3TEWA 1L0VB 4KKIA 2WXRA 3I57A 1UGJA 2XNAC 3KWLA 2I38A 2PVGC 3ZJTA 2LHDA 1JCKB 1TY2A 1FCCC 1M4VA 1L4ZB 1E7PB 3AEEB 2MEKA 2JWUA 4RGOS 2DYOA 3DWGC 1SJED 3GP7A 1VJKA 4HRSA 1CJEA 5FR3A 1N5WA 1ZP0B 2KMMA 4NAMA 1L4DB 2L83A 2WU5B 5AUKA 2G9HD 2X38A 3SFEB 1KH0A 2J52A 3AH7A 2V3NA 2M0AA 2WXPA 2Y5PA 2LMCA 3NZ3A 1R7SA 2N7JA 4N58A 1MI0A 3BIID 4LK0M 2WXNA 3P1MA 3R2TA 2JXTA 1L0YB 2IGDA 2KACA 1V1PA 3KLSX 4AQ7A 4ITKA 3NVZA 2K22A 4N6EB 3AECB 4RF0A 2WDRB 1TYGB 3SR6A 4OZCA 3AE3B 4JX1C 3HVDA 4YXDB 1TKEA 1VLBA 1ESFA 2WDQB 2IDYA 1N60A 1CZPA 2BB6A 2MJ3A 1YJJA 1ZE3D 3LXFA 3IAS1 1FEHA 1P7FA 3B2FA 4HKZE 1DYQA 2WP9B 2BBCA 1NEKB 1SBBB 1N62A 1BUIC 2WNMA 1GB1A 1SJHD 1PDXA 3ABVB 1UNSA 1I4RA 1QT9A 4XWWA 1FCLA 4YSXB 1ZUD2 2YEPB 2J4XA 2L52A 5HI1A 2WXQA 1C78A 2MH7A 4OVZA 1C79A 3IT6B 3C8YA 3AEDB 1JALA 4WWMA 5BMGA 3FILB 4USAA 5BYSA 1ACCA 3HUIA 1YQ4B 3TSSA 2GI9A 4C56C 1GOZA 4RGNA 5H8YE 1V97A 1GB4A 1L5PA 4HEA1 2J42A 2TSSA 1XLQA 1AWDA 2K0PA 2RPVA 2D5GA 1E10A 2BB5A 2JYEA 4YSZB 2YEPF 2W3RA 1SE2A 4HROA 1MHHE 3TUOA 1T5XD 1JQ4A 4WQMA 1MPEA 1FD6A 3AEBB 5AUIA 4GDKB 1XXGA 4L1BA 2J53A 2SAKA 2NTTA 1K51A 3P4QB 4ZHOA 4KKJA 1DGJA 3W5UB 3LYYA 3AN1A 2BT6A 2WDVB 4ZHPA 1C4PA 1WSPA 1DOXA 3B9JA 2OEDA 1I4XA 1FXIA 1J7AA 1SE3A 2AQ1B 2VZKD 1HA5A 3V05A 3HVZA 1IBXA 3E9SA 2KQ4X 1EU4A 2IJ0A 2Y3AA 2ZW0A 4RNAA 5D3DA 5C3JB 2G1EA 1D4BA 1DOYA 4KGRA 3P42A 1FXAA 1VDVA 4YTPB 2WXKA 2Z8LA 4IOIE 3U52E 1NYRA 2PMVA 3U7ZA 3FC4A 4B0EA 1N63A 2WXHA 1TJEA 3ETRA 3I9V1 1C76A 4WH4A 3VRBB 3B2GA 3URYA 3BWUD 2QIEB 4GDLB 1PGBA 4ARCA 2BW2A 2RMMA 3BYYB 4MACA 2W55A 3VR9B 2BTEA 1K52A 4A9AA 1QOAA 2KN4A 3AE1B 2R61A 5G5GA 2JQRB 3J9CA 4RFBA 2Y5CA 1TS2A 3L4PA 1QOFA 2LGIA 1JWUD 4HJGE 4WIPA 3AE7B 2QJLA 2WXOA 1FIQA 3N9YC 1YN4A 1TKYA 2WXGA 3Q8AA 3TEZA 3VR8B 1ZDVA 1UWMA 5BMHA 1XLPA 2M19A 2LUMA 3ZJUA 3W9CB 2PTLA 3IAM1 2GB1A 5HFYA 1BXTA 3FAHA 1EWYC 2LJIA 2HTME 2BS3B 3BVMA 2BS2B 3NVWA 2V0GA 1FRDA 4RGTA 1TY0A 2NTSA 3CIRB 4ARIA 1KLUD 2KDMA 1FO4A 1EM7A 2QEJC 1PGAA 4GLSC 1FFUA 1JRPA 3AE9B 3AMZA 2K3UA 2K9XA 5TSSA 1I4QA 1Y56A 2VZKB 2PKOA 4A8XC 1XEEA 1SB3C 1YMHE 2AQ3B 3GS2A 2WXLA 4MH8A 1WGKA 3PO0A 3MP9A 1HQRD 3PZ8A 5HG2A 1JWBD 1B1ZA 1SEBD 1TS3A 1I7HA 1QQRA 2INNE 1N5XA 1WXQA 2W82A 5EE0A 4A90A 1D5ZC 1QILA 1P7EA 1XLNA 1OFFA 4M0WA 4RH6A 2IGHA 3EUB2 2DLBA 4O1NA 2W3SA 3BVZA 3Q69A 1OQQA 1BMLC 2WLBA 3Q8FA 3SEBA 1WWTA 4R3DA 1CK1A 2FBWB 3R2IA 1D5XC 1SF0A 4OHJA 5JXVA 3AE8B 1Q10A 1ENFA 3VQIA 3V3XA 2MJDA 3AM9A 1XCQL 3CWIA 5G5HA 4LTUA 4L2YA 2QMTA 2PLPA 4H2AA 3P63A 1ROEA 4HKQA 3IT4B 3LB8C 2RDHA 2CU3A 2INPE 4EE2A 5T8IA 3EA6A 2WQYB 3Q8BA 3NUHB 2AX5A 2PVOD 2PW9A 4Q2JA 3P4RB 4NZLB 1QKZA 2ON8A 3NVYA 2ZW1A 1QLBB 1WYGA 1N61A 1UUPA 2GRIA 4OZAA 2IGGA 2XN9C 2KWDA 4JPSA 3MFGA 4YWGG 4TQ1A 4YTNB 2JYTA 3RPFC 1VZ8A 3PZ7A 5I4DA 1HZ5A 2WU2B 1MHXA 1K53A 1PGXA 3RFZB 1FFVA 4KGTA 1TZOA 1V1PB 1L6UA 3FILA 5FKAC 4A55A 2H89B 2NMQA 2BYTA 5E6JA 4L23A 4NJCA 3IXSA 2WS3B 4JE3B 1YN3A 1F2RI 3Q8CA 2DYMA 3AB5A 1T6BX 2K5PA 3NS1A 1KFYB 2RDGA 3ZGZA 4B0MA 3AV8A 2ONQA 4DQOC 1DOIA 1IGDA 1F2RC 3W5VB 3KQ4A 3P4SB 4ZRQA 3TEYA 4C7YA 1KF6B 4PT5A 4DXFA 4JWUC 4C7ZA 2DWQA 1J7CA 1NI3A 5EE9A 3TEXA 4ZYSA 1XCTL 1C77A 5LNK1 2IPKD 2JX5A 5BYRA 3AE6B 1STEA 2V3PA 1FNWA 1A70A 1EU3A 3BK2A 3ZJVA 3Q8EA 1ZPSA 3WCQA 5EE3A 2OHFA 2WXIA 1KTKA 1SXTA 4D2KA 1AYFA 1PFDA 1ET9A 4YT0B 4AS1A 1KRHA 4ZOHC 4YTMB 1IGCA 3AE4B 1TKGA 4YSYB 1D6EC 1OQRA 5HHDG 4XDDA 1C9FA 4P16A 1ZXIA 1YQ3B 1SE4A 1MVKA 2SEBD 2ICIA 3OWEB 4JWSC 2B76B 4TMAB 3AE5B 2QSDA 1B9RA 3ZYYX 1ZDXA 2ACZB 2JZPA 5D3IB 3HRDD 1JW9D 1AN8A 1PYWD 1ZXHA 3MJ5A 3T3NA 2FE8A 5MPOA 1V1OA 1FNVA 2N9LA 4LLGM 1JWAD 3AE2B 2DBYA 4OZBA 2L1AA 4FXCA 1FNUA 1FM0D 2PIAA 2WXMA 2EELA 3O13A 2V4IB 4RCOA 4WURA 1NENB 1EWCA 2WXJA 4RGMA 2AQ2B 2EKIA 1E9MA 1GAQB 1VR9A 2FUG1 3BYTB 2E6XA 1IBXB 3BK1A 4REZA 1ET6A 2JU6X 3MHZA 1L6VA 4XE0A 3DWMA 3NVVA 1JROA 4IKGA 1RWSA 4N59A 5EE1A 5GXGB 1NVID 2CJOA 3BZDB 2CJNA 1JWSD 1TS4A 2JSVX 3EGRA 4TQ0A 1J7BA 1F77A 2I2YA 1XLOA 4J3OD 1KLGD 3AEAB 1E0ZA 1IUEA 3UI3A 1C4CA 1JWMD 2QILA 1PUTA 3P4PB 2LFIA 2KAJA 3AEFB 5BMIA 2BS4B 4NAWB 1RM6C 4US8A 1QOBA 2M56B 1VRAB 5H92C 1JMLA 4IDIA 1AW7A 1QOGA 2N0SB 2N9KA 4ZRPA 2H88B 1I4PA 3T3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS3 B;  1E6E B;  2BS2 B;  1XO3 A;  3NVW A;  4YSX B;  1F0Z A;  1ZUD 2;  1DOI A;  2HTM E;  1V8C A;  1QF6 A;  1FRD A;  3W5V B;  2L52 A;  4C80 A;  3CIR B;  3P4S B;  2MH7 A;  1FO4 A;  4WWM A;  3AED B;  1JAL A;  1KF6 B;  4C7Y A;  1FFU A;  1JRP A;  3AE9 B;  4JWU C;  4USA A;  3AMZ A;  4C7Z A;  2MJE A;  3SFD B;  2K9X A;  3HUI A;  2DWQ A;  1J7C A;  1NI3 A;  1YQ4 B;  5EE9 A;  1RFK A;  2PKO A;  2W54 A;  5H8Y E;  1V97 A;  2JX5 A;  1GPX A;  1SIJ A;  1L5P A;  1NYQ A;  1SB3 C;  3AE6 B;  1XLQ A;  1AWD A;  1WRI A;  1A70 A;  1ZOY B;  2LEK A;  1E10 A;  1WGK A;  3PO0 A;  4YSZ B;  1JWB D;  3NRZ A;  2W3R A;  4HRO A;  3WCQ A;  5EE3 A;  4US9 A;  1JQ4 A;  1I7H A;  4WQM A;  1FMA D;  1YJI A;  1N5X A;  1WXQ A;  2OHF A;  2E3T A;  3AEB B;  4KX6 B;  5EE0 A;  5C2T B;  5AUI A;  1XLN A;  1AYF A;  1PFD A;  4YT0 B;  1T3Q A;  4P6V F;  1FRR A;  1OFF A;  1KRH A;  4ZOH C;  4YTM B;  3P4Q B;  3AEG B;  4ZHO A;  3AE4 B;  1TKG A;  3EUB 2;  2W3S A;  1DGJ A;  2Q5W D;  4YSY B;  3W5U B;  1RYJ A;  1OQQ A;  2WLB A;  3AN1 A;  1OQR A;  1WWT A;  2BT6 A;  1L0V B;  2WDV B;  3VRA B;  2FBW B;  4ZHP A;  1ZXI A;  1SF0 A;  1YQ3 B;  3B9J A;  1DOX A;  3KWL A;  1FXI A;  2PVG C;  1J7A A;  4JWS C;  2B76 B;  3AE5 B;  1B9R A;  3ZYY X;  2ACZ B;  3AE8 B;  3HVZ A;  3HRD D;  1E7P B;  1JW9 D;  3AEE B;  2MJD A;  5MPO A;  5C3J B;  2G1E A;  3AM9 A;  1JWA D;  3CWI A;  3AE2 B;  3DWG C;  5G5H A;  1DOY A;  1FXA A;  1VDV A;  2DBY A;  4LTU A;  4YTP B;  1VJK A;  4HRS A;  1CJE A;  4FXC A;  1N5W A;  3ABV B;  3P63 A;  1ROE A;  1NYR A;  1ZP0 B;  1FM0 D;  2KMM A;  2PIA A;  3LB8 C;  3FC4 A;  1N63 A;  2WU5 B;  2L83 A;  1NEN B;  1TJE A;  2CU3 A;  3ETR A;  5AUK A;  3SFE B;  3VRB B;  3B2G A;  3AH7 A;  2QIE B;  2EKI A;  1E9M A;  1GAQ B;  2WQY B;  1R7S A;  4N58 A;  3VR9 B;  2W55 A;  2AX5 A;  2PVO D;  3BII D;  3P1M A;  3P4R B;  4A9A A;  1QOA A;  1L6V A;  3NVY A;  3DWM A;  1QLB B;  1WYG A;  3NVV A;  1N61 A;  1JRO A;  3FAH A;  4ITK A;  3NVZ A;  3AE1 B;  5G5G A;  1RWS A;  2JQR B;  2K22 A;  3AEC B;  2WDR B;  1TYG B;  2Y5C A;  4N59 A;  3AE3 B;  4N6E B;  5EE1 A;  4JX1 C;  5GXG B;  3SR6 A;  1NVI D;  2CJO A;  2CJN A;  3L4P A;  1QOF A;  1TKE A;  1VLB A;  4YXD B;  2WDQ B;  4YTN B;  1J7B A;  3RPF C;  3AE7 B;  1N60 A;  1CZP A;  2WU2 B;  1XLO A;  2MJ3 A;  2QJL A;  1YJJ A;  3AEA B;  1E0Z A;  1IUE A;  1FIQ A;  1PUT A;  3P4P B;  1FFV A;  3LXF A;  1TKY A;  2KAJ A;  3VR8 B;  3AEF B;  3B2F A;  1L6U A;  1UWM A;  2BS4 B;  2H89 B;  1RM6 C;  2WP9 B;  2H88 B;  1XLP A;  4US8 A;  2M19 A;  1NEK B;  1QOB A;  2M56 B;  2WS3 B;  5H92 C;  3W9C B;  1N62 A;  3AB5 A;  4IDI A;  1QOG A;  2N0S B;  3NS1 A;  2K5P A;  1KFY B;  1PDX A;  1EWY C;  1QT9 A;  3AV8 A; 
#chains in the Genus database with same CATH topology
 4OW0 A;  2FID A;  4KGS A;  3DBL B;  3RNF C;  4IM3 A;  5C1Z A;  4XDC A;  3GB1 A;  3SFD B;  1YNT E;  1V80 A;  4TSS A;  1WE7 A;  3KW5 B;  1WMH A;  1I4G A;  5BYQ A;  1WRI A;  4LJP B;  2LEK A;  3NOB A;  4UDU C;  3X23 A;  3W1S A;  1D5M C;  2GBN A;  3U4E G;  3QAR A;  4MT5 A;  4GIV A;  4LDT B;  1YJI A;  1LM8 B;  2E3T A;  1WX7 A;  2ZPY A;  1HZ6 A;  2M1M A;  1FRR A;  3QIJ A;  3KUC B;  1I4H A;  3WAN A;  2Q5W D;  4KKI A;  3L54 A;  2KWC A;  5KHQ A;  4FBJ B;  2DZJ A;  2MBB B;  3ZTC A;  4WWN A;  4WJP A;  5FR3 A;  1VJK A;  3DHG C;  3PTF C;  2KMM A;  2XBB C;  4NAM A;  1L4D B;  1I42 A;  2G9H D;  3SFE B;  3DDC B;  3M63 B;  2MBE A;  2Y5P A;  1V2Y A;  3NZ3 A;  1R7S A;  4LK0 M;  3H1U A;  2JXT A;  1L2N A;  2J7Q B;  5C23 A;  5AEK B;  2KFK A;  3KLS X;  2WDR B;  4K7U A;  4OZC A;  3AE3 B;  2IZV B;  1P9D U;  4AWJ A;  1EO6 A;  3O65 B;  2BB6 A;  4AOF A;  3KYC D;  2KKC A;  2QC8 A;  3H9D A;  2WP9 B;  3I63 C;  1SBB B;  2DZI A;  2N7E A;  2VH2 A;  4ANV A;  1GB1 A;  1Q5W B;  1UNS A;  1WXS A;  1Y8R C;  4MGY E;  2YEP B;  2J4X A;  2WXQ A;  2AYO B;  3MTN B;  3IT6 B;  5E6O A;  5BYS A;  3ZRF A;  4MDK E;  1YQ4 B;  3TSS A;  4WAA A;  1GB4 A;  2J42 A;  3WA0 A;  3V6E B;  4HRO A;  4FAD A;  4FJV B;  1FD6 A;  5J18 A;  4GDK B;  2XK5 B;  4LNF A;  2SAK A;  4A20 A;  2KTR A;  2LI5 A;  3LYY A;  2WDV B;  4ZHP A;  1C4P A;  1I4X A;  1J7A A;  1SE3 A;  1UD7 A;  5HKH A;  1IBX A;  4KZC A;  3RUL A;  5C3J B;  2K8H A;  2G1E A;  4MGK E;  1P3Q U;  3QC8 B;  1DOY A;  3P42 A;  2M4N A;  4DDG D;  4IOI E;  2UYZ B;  3U52 E;  3PRP B;  4B0E A;  2WXH A;  1TJE A;  5IP4 D;  3I9V 1;  4ARC A;  3URY A;  4GDL B;  2QIE B;  1RAX A;  3I3T B;  4MAC A;  4A9A A;  1QOA A;  4LCD E;  3U8Z A;  2MWS B;  3DVN V;  2KVR A;  3JSV A;  1MFW A;  3QAQ A;  3J9C A;  4RFB A;  2KJH B;  3L4P A;  1QOF A;  3D32 A;  3PRZ A;  4WIP A;  4E71 A;  4XYC A;  4CYE A;  1FIQ A;  1C3T A;  4GSW A;  2RGF A;  4G3X B;  3GZN I;  3TBL D;  2WXG A;  3Q8A A;  3TEZ A;  1ZDV A;  1UWM A;  2KJR A;  3PLV A;  3I5J C;  2JZZ A;  1XLP A;  2M19 A;  5DCN A;  2AL3 A;  3APF A;  4BVU C;  1BXT A;  2HTM E;  2BS3 B;  3NVW A;  3VVW B;  2V0G A;  4HPL B;  2K6Q A;  1H4R A;  4ARI A;  2MQJ A;  1T0Q C;  1S1Q B;  2JUO A;  3VDZ A;  2O2V A;  3TJP A;  2DX5 B;  5CTR C;  2GBM A;  1I4Q A;  2HJ8 A;  4KVG B;  1XEE A;  1SB3 C;  1WGK A;  3NJT A;  2BWE S;  1WFY A;  3B0A A;  3DVG X;  1WXQ A;  2ZEQ A;  1D5Z C;  2FCQ A;  1OFF A;  4M0W A;  1WMH B;  4ZRJ A;  2IGH A;  1L7Y A;  3AI5 A;  1WR6 E;  1CK1 A;  2FBW B;  3JVZ X;  1Q10 A;  2JRH A;  3R7R A;  3OG5 A;  4L2Y A;  4NQL B;  2OOB B;  1T0Y A;  2HJ1 A;  2PE6 B;  3EA6 A;  3RNG C;  4P1C C;  3IHP C;  3NUH B;  2MBH A;  1WX8 A;  4OZA A;  1UUP A;  3PRM B;  3QA8 A;  4E74 A;  2CS4 A;  2INC C;  4TQ1 A;  4YTN B;  3RPF C;  1VZ8 A;  1V49 A;  1EF5 A;  1MHX A;  2NBV B;  4MSM B;  4K7S A;  2D2Q A;  2J0M A;  3ZIM A;  2KFK B;  4A55 A;  2BYT A;  2NMQ A;  4I6P A;  4W9H A;  2WS3 B;  3Q8C A;  2XEW A;  2DYM A;  1IP9 A;  4CO7 A;  1T6B X;  2K5P A;  3RD2 A;  1WY8 A;  2ONQ A;  4DQO C;  2YLM A;  1IGD A;  3KQ4 A;  3KVF B;  3DBR I;  3P4S B;  3TEY A;  4LNI A;  3DHH C;  3DBH I;  5LLI A;  2L76 A;  3S2A A;  1NI3 A;  3TEX A;  4ZYS A;  5EDS A;  1XCT L;  2PPH A;  2N9P C;  1C77 A;  3IBE A;  2R2Q A;  5LNK 1;  2C7M B;  2IPK D;  1R4M I;  2K8B A;  3ML8 A;  4W9I A;  3WIM A;  2HTH A;  1FNW A;  1A70 A;  4BOS C;  1TGZ B;  1YD8 U;  3ZDT A;  5TR5 A;  2I1K A;  4D2K A;  1AYF A;  1PFD A;  4WJO A;  2IY0 B;  1KRH A;  4YTM B;  1IGC A;  2WX0 A;  2Z59 B;  1YJ1 A;  3Q3N C;  5J2R A;  1C9F A;  1ZXI A;  2DAF A;  1SE4 A;  4ZRK A;  4TMA B;  4PS3 A;  1ZDX A;  3HRD D;  4DWF A;  1PYW D;  1ZXH A;  3PLU A;  1FNV A;  2N9L A;  3AE2 B;  1VCB A;  2DBY A;  4OZB A;  4FXC A;  2WDT B;  2KTR B;  4BOZ B;  2NBU A;  2EEL A;  3ZO5 B;  2D3A A;  2V4I B;  1WYW B;  1E8Z A;  1EWC A;  2V4L A;  2WXJ A;  2JVC A;  2EKI A;  1VR9 A;  2O6V A;  3Q3O C;  1IBX B;  3BK1 A;  4REZ A;  3VUY A;  5CHV C;  3AXC A;  3UQB A;  1RWS A;  1NVI D;  4C4V A;  3Q3F A;  4EZJ A;  2BKR B;  3EFC A;  2CHW A;  4HCN B;  2QDF A;  1WJU A;  3AEF B;  1UH6 A;  4KV2 A;  3JSV B;  3UGB B;  2M56 B;  5H92 C;  2N9K A;  3T3O A;  1F0Z A;  2A5U A;  1QF6 A;  3M3J A;  1YX6 B;  2WXF A;  1J19 A;  3A9J A;  4CQN A;  4PYZ A;  5D7G A;  3V6C B;  1UEL A;  2KDB A;  1VD2 A;  3GE8 C;  1WF9 A;  1SIJ A;  2LGS A;  2MBQ A;  2FUH B;  2FNJ B;  4J6I A;  1ZOY B;  5IO9 A;  3NRZ A;  2PEA A;  1WH3 A;  2O2V B;  2RSU A;  2N1V A;  1FMA D;  2LUE A;  5C2T B;  4KSK C;  1C4A A;  3RZF A;  1HTO A;  3BVG A;  2K1F A;  1HXY D;  1L0V B;  3ZDM C;  2WXR A;  1UGJ A;  4FLH A;  2XNA C;  3UIO B;  1NDD A;  2K39 A;  2PVG C;  3JYU A;  4BKT A;  2MW5 A;  2D3C A;  3ML9 A;  2KT7 A;  3ALB A;  3DWG C;  3KYD D;  4M0W B;  4MGI E;  4HRS A;  1N5W A;  2ASQ A;  1V6E A;  1FXT B;  1ZP0 B;  2L83 A;  3DVG Y;  5AUK A;  2J52 A;  4EUT A;  2V3N A;  3APD A;  3BIN A;  1EUV B;  2D07 B;  4N58 A;  1MI0 A;  3VFK A;  2WXN A;  3R2T A;  1L0Y B;  1C1Y B;  4K1R B;  2K22 A;  2QHO A;  4RF0 A;  4BFR A;  4WJN A;  2N1W A;  1TKE A;  1ESF A;  2GOW A;  2WDQ B;  3Q6B A;  4RMA A;  2JPH A;  2MJ3 A;  1ZE3 D;  4PS7 A;  4LDT D;  1FEH A;  1UF0 A;  2FCN A;  2GLS A;  1Q1O A;  1SJH D;  4BAX A;  1PDX A;  3ABV B;  4DHZ E;  1QT9 A;  4XWW A;  3PZD A;  4G11 A;  1SIF A;  4IWQ A;  4IM0 A;  5HI1 A;  4RM9 A;  2V1Y A;  3C8Y A;  3VTV A;  4USA A;  2KN5 A;  4ZRI A;  3L16 A;  4C00 A;  5L95 C;  2O6V D;  4C56 C;  3ZNI D;  2L05 A;  4M8N A;  5H8Y E;  1L5P A;  4HEA 1;  4W9L A;  2TSS A;  1XLQ A;  1AWD A;  3B1L X;  2W9N A;  1E10 A;  2HD5 B;  2J0K A;  2YEP F;  2CHX A;  3SDL C;  1T5X D;  3TCA A;  3AEB B;  3CSF A;  3PRE A;  4WJQ A;  4W9F A;  1XXG A;  3T9L A;  4XGA B;  2J53 A;  2WGS A;  4M01 A;  2FAZ A;  2NTT A;  3P4Q B;  3W5U B;  3AN1 A;  2QCZ A;  1OQY A;  2OED A;  2AQ1 B;  3V05 A;  3HVZ A;  1RLF A;  1E8W A;  2KQ4 X;  3Q3J A;  2IJ0 A;  4E3C A;  4XX5 A;  3QK0 A;  1D4B A;  4XC2 A;  1VDV A;  2KC2 A;  4YTP B;  4KSL C;  2PMV A;  2LXA A;  3M95 A;  3K9O B;  3NHE B;  3FC4 A;  1N63 A;  3NG0 A;  3N3K B;  1C76 A;  4JQW C;  2C5L C;  3VRB B;  2BW2 A;  3VR9 B;  2W55 A;  2NCN A;  3KUZ A;  4NAW A;  3B08 A;  2Y5C A;  2LGY A;  1WGR A;  4JL9 A;  1WM2 A;  3ZNZ B;  4HJG E;  3AE7 B;  2QJL A;  2WXO A;  2O6V B;  1LFD A;  4HJK A;  3N9Y C;  3ECI A;  4OVV A;  2BGF A;  2EMT A;  4IM2 A;  2KLC A;  3LJ3 A;  3IAM 1;  2DZM A;  4ZDV A;  4C4V B;  5HFY A;  4ANU A;  2FCS A;  4WWP A;  2BS2 B;  4NPN A;  1FRD A;  1PGA A;  1FFU A;  1JRP A;  3AE9 B;  3AMZ A;  2K3U A;  3PPA A;  2VRR B;  2NS5 A;  2KD0 A;  3VTW A;  1E8X A;  1YMH E;  3JW0 X;  2B3A A;  3A4R A;  3QCA A;  3GS2 A;  1YIW A;  3DCG A;  2OJR A;  3UF8 A;  3MP9 A;  1HQR D;  1JWB D;  1B1Z A;  3A9J B;  5E6N A;  1I7H A;  4GXB A;  5L83 A;  1T0R C;  1AAR A;  4A90 A;  4K81 A;  1WJ6 A;  4MGZ E;  1YQB A;  1GUA B;  3GZN B;  1P0R A;  2ZJD A;  1BML C;  2WLB A;  1WWT A;  1SF0 A;  5JXV A;  2DZK A;  3AE8 B;  1LXD A;  4XZ4 A;  2MJD A;  1XD3 B;  1WXV A;  3UQA A;  5G5H A;  4LTU A;  4OVU A;  3IT4 B;  3LB8 C;  4KDL B;  4A3O A;  1ZKH A;  4IWP A;  3LDZ E;  2INP E;  4TUU A;  2WQY B;  2PVO D;  2D10 A;  4Q2J A;  3P4R B;  4NZL B;  1P98 A;  1QKZ A;  3NVY A;  2ZPN A;  5IAA C;  2BKF A;  1WYG A;  3WAP A;  2GRI A;  5D94 A;  1MG4 A;  4JPS A;  3ZVV A;  3MFG A;  4YWG G;  1YOV B;  5E6P A;  1HZ5 A;  2WU2 B;  2BYE A;  2MLB A;  3V60 A;  2MBO A;  3KH0 A;  3RFZ B;  2VH1 A;  1FFV A;  3FIL A;  5FKA C;  3FKY A;  5GMV A;  3IVF A;  4NJC A;  2KC1 A;  3N1Z C;  4HLE A;  1KLV A;  4B0M A;  2LZ6 A;  3Q2A C;  3N1X C;  5CHW A;  3RUI B;  2JZ3 B;  3ZXR A;  3HM6 X;  4PT5 A;  3WAO A;  1HE8 A;  2MSE D;  1J7C A;  2V9H A;  5EE9 A;  2NBW B;  2JX5 A;  4LJO B;  3AE6 B;  1PQS A;  2KMA A;  3N20 C;  1EU3 A;  1ZPS A;  5EE3 A;  2KK8 A;  1WGG A;  3HK0 A;  1X1M A;  1KTK A;  1SXT A;  3ZRC A;  4PK1 A;  4AS1 A;  4ZOH C;  1TKG A;  4W9C A;  2IYD B;  5HHD G;  1LGR A;  3N32 A;  2L8J A;  3EEC A;  1MVK A;  2SEB D;  2ICI A;  2IO2 B;  2B76 B;  4II2 B;  3SU8 X;  1OGW A;  4I6L B;  1JWA D;  1HTQ A;  4LNO A;  3DBR B;  2L1A A;  2PIA A;  3DBH B;  2AQ2 B;  2LXC A;  4IWO A;  1GAQ B;  4GOC A;  1L6V A;  2DYB A;  4IKG A;  2LD9 A;  5EE1 A;  2I1J A;  4DBG A;  4MEM A;  5DPT A;  1TS4 A;  2LRW A;  2I2Y A;  1S3S G;  4J3O D;  1IUE A;  1C4C A;  2KAJ A;  1D3Z A;  4NAW B;  1R4N I;  4FJY A;  4F8C B;  3V62 A;  1JML A;  1AW7 A;  2N0S B;  1U4A A;  4NJ6 A;  1LO5 D;  1TS5 A;  1E6E B;  1GNU A;  1SGH A;  3H6N A;  2L0F A;  1WGY A;  1L0X B;  3L0W B;  3N30 A;  5FK9 C;  2LHE A;  3H8H A;  3U2S C;  2GBK A;  3QQ8 B;  1GPX A;  5JZE B;  4JIO U;  3MC0 B;  3ZQ4 A;  4W9D A;  1XQQ A;  4II3 B;  3VUW A;  4IW0 A;  3W2D A;  1CQV A;  2LVO A;  4XWT A;  4A6Q A;  4US9 A;  4KX6 B;  1SSN A;  2UWQ A;  2HDE A;  3R8B A;  2KAN A;  3AEG B;  1HEZ E;  1RYJ A;  2BPS A;  3VRA B;  3I57 A;  3ZLZ A;  3KWL A;  1GC7 A;  3ZJT A;  2LHD A;  2KQS A;  1JCK B;  2KXJ A;  4ZYN A;  1FCC C;  1L4Z B;  1E7P B;  3AEE B;  2MEK A;  2JWU A;  4RGO S;  3TMP B;  4HDO A;  1SJE D;  3GP7 A;  1CJE A;  4GN1 A;  3EHV A;  2K8C A;  2BWF A;  4MJS A;  2WU5 B;  4DHJ D;  1KH0 A;  3AH7 A;  3R7Q A;  2M0A A;  2LMC A;  2N7J A;  3BII D;  5KHO A;  3P1M A;  4B6W A;  2IND C;  1V1P A;  4AQ7 A;  4BBN F;  3U7D A;  4N6E B;  3AEC B;  4RM8 A;  4JX1 C;  3RNB C;  2C7N B;  3VAW A;  3HVD A;  4YXD B;  1VLB A;  2G4S A;  1OEY A;  1YJJ A;  2WHI A;  4K7W A;  2MHJ A;  3AU5 A;  3R66 C;  3IFW B;  2D3B A;  1P7F A;  4HKZ E;  1DYQ A;  4KDI C;  2IO0 B;  1V5T A;  1BUI C;  2WNM A;  3ZUN A;  5JHA A;  1I4R A;  2BYV E;  1WR1 A;  2KWV B;  1FCL A;  4YSX B;  1ZUD 2;  1WXA A;  2FCM A;  1F9J A;  1C78 A;  1JAL A;  3FIL B;  1IYF A;  1ACC A;  3PVL A;  2D3G A;  2GI9 A;  1GOZ A;  5IA7 A;  2Y5B B;  4FUL A;  1GG3 A;  1E8Y A;  2K0P A;  2RPV A;  2D5G A;  3ZNG C;  2W3R A;  3UIN B;  3TUO A;  5JH5 C;  4EZL A;  1JQ4 A;  1WGH A;  4WQM A;  4DHJ B;  2KZR A;  3TIX A;  5AUI A;  4L1B A;  4ASW C;  2JF5 A;  4W9G A;  1K51 A;  4ZHO A;  4KKJ A;  1DGJ A;  3UIP B;  4B9K A;  2YVC A;  2BT6 A;  2KMC A;  1UBQ A;  1WSP A;  1DOX A;  3B9J A;  1SE9 A;  3BY4 B;  2VZK D;  3E9S A;  1EU4 A;  2ZW0 A;  5D3D A;  4KGR A;  2WXK A;  2OJW A;  2EKE C;  1NYR A;  1WI0 A;  3ETR A;  3APC A;  1PGB A;  2RMM A;  3BYY B;  3M62 B;  1JRU A;  2N4F A;  2BTE A;  1E7U A;  2KN4 A;  4HXD A;  2KWU B;  4EFO A;  3AE1 B;  2R61 A;  2DAJ A;  1TS2 A;  3A1Q A;  1WRD B;  2LWP A;  2LGD A;  2LGI A;  2C60 A;  2IY1 B;  1YN4 A;  2MRP A;  2MCN B;  1TKY A;  3VR8 B;  3L13 A;  4DHZ B;  5BMH A;  3W9C B;  5AZF A;  4N9F 4;  2GB1 A;  3FAH A;  4MM3 A;  3H7S A;  1MG8 A;  3BVM A;  3CF6 E;  3ZXV A;  1V86 A;  2NR2 A;  4RGT A;  1TY0 A;  3CIR B;  1KLU D;  2KDM A;  1EM7 A;  2QEJ C;  2BF8 B;  3A33 B;  4X57 B;  2V3S A;  4GMV A;  3CMM B;  1Y56 A;  2VZK B;  2PKO A;  1KOT A;  4A8X C;  2WWZ A;  2AQ3 B;  2WXL A;  4MH8 A;  1WGD A;  5HG2 A;  4AUQ C;  4P7I A;  3VUX A;  1SEB D;  1TS3 A;  1TBE A;  2INN E;  1N5X A;  3KUD B;  1XLN A;  2KVZ A;  2KFJ A;  2KOX A;  3EFU A;  3EUB 2;  4O1N A;  2W3S A;  1ISN A;  3Q69 A;  4R3D A;  4ACF A;  1D5X C;  4OHJ A;  3RNC C;  3V3X A;  2KDE B;  3AM9 A;  1XCQ L;  3PSE B;  4H2A A;  3RYT A;  1ROE A;  4HKQ A;  2LVP A;  2RDH A;  3ZKJ C;  2CU3 A;  5DPW A;  5IKC M;  1N61 A;  2XN9 C;  4MJS B;  4B95 A;  1NI2 A;  3PHX B;  2JYT A;  5I4D A;  3PZ7 A;  4BBN C;  2ZNV C;  1PGX A;  4KZ0 A;  1KJT A;  1V1P B;  2LRU A;  4L23 A;  1F2R I;  3AB5 A;  1TIF A;  1WJ4 A;  3DPD A;  4LNN A;  4K3B A;  1DOI A;  1WM3 A;  2ZCB A;  1F2R C;  2JRI B;  5G55 A;  4C7Y A;  2J0J A;  4DXF A;  2G4D B;  1J8C A;  3GE3 C;  3P2B A;  2DWQ A;  2BVC A;  2K6D B;  4W9E A;  4DXA B;  1V81 A;  3AU4 A;  2JY6 A;  2L7R A;  3MJW A;  1STE A;  2REX A;  1UZX B;  3BK2 A;  4AP4 C;  3ZJV A;  3Q8E A;  2IBI B;  2BYF A;  1ET9 A;  1A5R A;  3U30 A;  3NY5 A;  2A4Z A;  2CR5 A;  4WQO B;  3AE4 B;  1XT9 B;  3L17 A;  1WX9 A;  1D6E C;  1MJD A;  2G45 B;  5LXH A;  1YQ3 B;  1WZ0 A;  4JWS C;  2KJ6 A;  3AE5 B;  1B9R A;  3PT2 B;  1AN8 A;  3T3N A;  5IOI A;  1V1O A;  4BKG A;  2KDF B;  4ICV A;  3DBL I;  3A9K A;  2WXM A;  3O13 A;  3R3M A;  4WUR A;  4NQK E;  3V61 A;  1NEN B;  2EMS A;  1TT5 B;  1E9M A;  3RMK C;  2FUG 1;  4KIK A;  3AUL A;  2E6X A;  3VXW A;  3GOE A;  4K3C A;  1ET6 A;  4XE0 A;  3MHZ A;  4N59 A;  3HM3 A;  1CMX B;  5IN7 A;  1JWS D;  2JSV X;  1J7B A;  1F77 A;  1KLG D;  3UI3 A;  2QIL A;  1PUT A;  3P4P B;  2LFI A;  2GBJ A;  5BMI A;  1NBF C;  1QOB A;  3RCZ A;  3A1Q B;  4IDI A;  1QOG A;  2KQ7 A;  4JLC A;  4ZRP A;  1I4P A;  3N1Y C;  1J0G A;  1KM7 A;  1XO3 A;  2JT4 B;  4IUM B;  1V8C A;  4BKS A;  4C80 A;  3PS6 A;  1GJZ A;  3A4S C;  1VZ6 A;  1F52 A;  2CKH B;  3E56 A;  1YN5 A;  4WAF A;  2MJE A;  4MH0 E;  1UBI A;  3NZU A;  1RFK A;  4RF1 A;  1VZ7 A;  3MC8 A;  4MM3 B;  2W54 A;  4DXG A;  2NPT A;  4BZA A;  1NYQ A;  3C0R B;  3VHT C;  3KWV A;  2G3Q B;  2N7D A;  1Z2M A;  1UWX A;  2KX3 A;  2L00 B;  1T3Q A;  4P6V F;  3H7P A;  2KX0 A;  1UGM A;  1K50 A;  4PS8 A;  4PYU A;  1XF5 L;  2HE7 A;  2L32 A;  1R4N B;  1IPG A;  1YX5 B;  3TEW A;  3OLM D;  2KHW B;  2I38 A;  4NNJ B;  1TY2 A;  1P1A A;  1M4V A;  2LJ5 A;  1WJN A;  4I6N B;  2DYO A;  1M94 A;  3NS8 A;  3ZTD A;  1BT0 A;  2C7H A;  2KTF A;  2MP2 A;  5G2N A;  2X38 A;  4HVB A;  4HDQ A;  4URK A;  2WXP A;  2NVU I;  3RZW C;  4DDI D;  4WWO A;  3SHQ A;  2IGD A;  2KAC A;  4EKU A;  4ITK A;  3NVZ A;  4ICU A;  4AJY B;  3SR6 A;  1TYG B;  3X0W A;  3VTU A;  2IDY A;  1N60 A;  1CZP A;  5BO4 B;  4NJ7 A;  3MC9 A;  3LXF A;  2KDI A;  3IAS 1;  1WE6 A;  3B2F A;  2M0X A;  2BBC A;  1NEK B;  4CHK A;  4HPM B;  1G6J A;  1R4M B;  1N62 A;  4FHJ A;  4NY0 A;  1Z5S B;  5JHB A;  2ZVO A;  3DVN U;  3OJ4 B;  1WXM A;  2AWT A;  1OTR B;  2L52 A;  2DNF A;  1RFA A;  2MH7 A;  4OVZ A;  1C79 A;  5BMG A;  4WWM A;  3AED B;  2AEH A;  3HUI A;  2L3Z A;  4RGN A;  1V97 A;  3QWZ B;  1FPY A;  3L10 B;  2ZVN A;  2RR9 A;  2BB5 A;  2JYE A;  4YSZ B;  1SE2 A;  3ZW3 A;  1MHH E;  2CHZ A;  1T0S C;  4A3P A;  1MPE A;  2KLG A;  4F7Z A;  1ZGU B;  1K8R B;  4FN2 A;  3VH3 B;  3QX1 A;  2RD0 A;  2M17 A;  3K9P B;  4S0R A;  2MX2 A;  1FXI A;  1HA5 A;  2MA9 B;  4FA6 A;  4QAY A;  2Y3A A;  4RNA A;  2KO3 A;  3IG3 A;  4BKS D;  1LQB A;  1FXA A;  2Z8L A;  3HIZ A;  3DHI C;  3U7Z A;  4TV3 A;  2N9X A;  1EF1 A;  4ANW A;  3CST A;  5D2M B;  4WH4 A;  2Z0D B;  2DHZ A;  3B2G A;  3BWU D;  1TTN A;  4DK5 A;  2KNB A;  1K52 A;  2X8X X;  2LAS A;  3A9K B;  5DPR A;  4HK2 A;  5G5G A;  2JQR B;  3QJZ A;  3WAM A;  3HHM A;  5J17 A;  3QHT A;  5DPS A;  3C19 A;  1JWU D;  2RPQ A;  1V9J A;  4KIK B;  1H8C A;  4EOY A;  3PGE A;  1TZ1 A;  2LUM A;  3ZJU A;  2PTL A;  2M8S A;  1EWY C;  2LJI A;  1GC6 A;  2C9W B;  5FR6 A;  3W1S C;  3ZNH B;  2NTS A;  1FO4 A;  3VH4 B;  4GLS C;  4M00 A;  2K9X A;  3RN9 C;  5TSS A;  5CX3 A;  4G0N B;  1E90 A;  4M02 A;  3NZS A;  2PE9 A;  4JGH B;  2DEN B;  4HPP A;  3PO0 A;  3PZ8 A;  2RDB C;  4G50 A;  2WYQ A;  2ZCC A;  2K25 A;  1QQR A;  2W82 A;  5EE0 A;  3ENE A;  1QIL A;  2AL6 A;  2N9E B;  1P7E A;  3RNA C;  2NPT B;  3Q3M C;  4RH6 A;  4S17 A;  2DLB A;  3BVZ A;  1OQQ A;  3Q8F A;  3SEB A;  2R2O A;  3R2I A;  5AZG A;  2IO1 B;  1ENF A;  3VQI A;  3Q14 C;  3CWI A;  1Q0W B;  2QMT A;  3H7P B;  2PLP A;  1I35 A;  3P63 A;  3RT3 B;  3W1Y A;  4EE2 A;  2CU1 A;  5T8I A;  2GBR A;  4F1S A;  3Q8B A;  4ANX A;  2AX5 A;  2PW9 A;  2ON8 A;  2ZW1 A;  4AJW A;  1QLB B;  3DQV A;  1RRB A;  2IGG A;  4FJZ A;  2KWD A;  4P1B C;  2MP2 B;  4GU2 A;  3RI7 C;  1K53 A;  1E5W A;  1WZ3 A;  4KGT A;  1TZO A;  1L6U A;  4LNK A;  2H89 B;  4TKN A;  5E6J A;  2GMI C;  3IXS A;  4JE3 B;  1YN3 A;  5D6J B;  3NS1 A;  2PJH A;  1OEY J;  2ZZP B;  1KFY B;  3OJ3 A;  2RDG A;  3DOW A;  3ZGZ A;  2BQQ A;  3AV8 A;  3L08 A;  1F1H A;  4IG7 B;  3ONS A;  3W5V B;  4EZK A;  4ZRQ A;  1KF6 B;  4JWU C;  4C7Z A;  4IC7 B;  5CHF A;  3MHS D;  4GDK A;  2D11 A;  2XK5 A;  5BYR A;  4GGQ A;  1ZW7 A;  4W9K A;  4EEW A;  2V3P A;  2ZNV B;  3WCQ A;  1E7V A;  2OHF A;  2WXI A;  4YT0 B;  4FHK A;  1N6Z A;  2Z0E B;  3WAL A;  2WX1 A;  4YSY B;  2KYW A;  1OQR A;  4YL8 A;  4XDD A;  4P16 A;  2L0T A;  3EC8 A;  4GDL A;  3OWE B;  2QSD A;  3ZYY X;  2ACZ B;  2JZP A;  5D3I B;  1JW9 D;  3MJ5 A;  2FE8 A;  5MPO A;  4HCP B;  4LLG M;  3DBS A;  4M8M A;  1FNU A;  1FM0 D;  4RCO A;  4RGM A;  3RNE C;  3BYT B;  2JWZ A;  2JXX A;  3OAW A;  3PHW B;  1V5O A;  2JU6 X;  3DWM A;  3NVV A;  1JRO A;  4W9J A;  3SD5 A;  3PV1 A;  5GXG B;  2FIF A;  2CJO A;  3BZD B;  2CJN A;  4MEL A;  3EGR A;  2LGX A;  4TQ0 A;  1WIA A;  2UU7 A;  1XLO A;  3AEA B;  1E0Z A;  2IO3 B;  1JWM D;  1QZE A;  3T8M A;  5AZH A;  4HWI B;  2BS4 B;  1RM6 C;  4US8 A;  4GB9 A;  1VRA B;  3TL5 A;  5LXI B;  4MSQ B;  2LVQ A;  2H88 B; 
#chains in the Genus database with same CATH homology
 1LO5 D;  1TS5 A;  1E6E B;  1F0Z A;  1XO3 A;  4OW0 A;  1QF6 A;  1V8C A;  4KGS A;  4C80 A;  1L0X B;  2WXF A;  1VZ6 A;  3E56 A;  1YN5 A;  4XDC A;  2LHE A;  3H8H A;  4WAF A;  5FK9 C;  2MJE A;  3GB1 A;  3SFD B;  4CQN A;  3U2S C;  1YNT E;  5D7G A;  4TSS A;  1RFK A;  4RF1 A;  1VZ7 A;  4DXG A;  4MM3 B;  2W54 A;  1GPX A;  1SIJ A;  1NYQ A;  3MC0 B;  3ZQ4 A;  1I4G A;  5BYQ A;  1WRI A;  3W2D A;  1ZOY B;  2LEK A;  1CQV A;  3KWV A;  4UDU C;  4XWT A;  3W1S A;  1D5M C;  3NRZ A;  4A6Q A;  3U4E G;  1UWX A;  4MT5 A;  4US9 A;  1FMA D;  1YJI A;  4KX6 B;  2E3T A;  1SSN A;  5C2T B;  1C4A A;  2HDE A;  1HZ6 A;  1T3Q A;  1FRR A;  4P6V F;  3R8B A;  3BVG A;  3AEG B;  1K50 A;  1I4H A;  1HEZ E;  1XF5 L;  2Q5W D;  2L32 A;  1RYJ A;  1HXY D;  3VRA B;  3TEW A;  1L0V B;  4KKI A;  2WXR A;  3I57 A;  1UGJ A;  2XNA C;  3KWL A;  2I38 A;  2PVG C;  3ZJT A;  2LHD A;  1JCK B;  1TY2 A;  1FCC C;  1M4V A;  1L4Z B;  1E7P B;  3AEE B;  2MEK A;  2JWU A;  4RGO S;  2DYO A;  3DWG C;  1SJE D;  3GP7 A;  1VJK A;  4HRS A;  1CJE A;  5FR3 A;  1N5W A;  1ZP0 B;  2KMM A;  4NAM A;  1L4D B;  2L83 A;  2WU5 B;  5AUK A;  2G9H D;  2X38 A;  3SFE B;  1KH0 A;  2J52 A;  3AH7 A;  2V3N A;  2M0A A;  2WXP A;  2Y5P A;  2LMC A;  3NZ3 A;  1R7S A;  2N7J A;  4N58 A;  1MI0 A;  3BII D;  4LK0 M;  2WXN A;  3P1M A;  3R2T A;  2JXT A;  1L0Y B;  2IGD A;  2KAC A;  1V1P A;  3KLS X;  4AQ7 A;  4ITK A;  3NVZ A;  2K22 A;  4N6E B;  3AEC B;  4RF0 A;  2WDR B;  1TYG B;  3SR6 A;  4OZC A;  3AE3 B;  4JX1 C;  3HVD A;  4YXD B;  1TKE A;  1VLB A;  1ESF A;  2WDQ B;  2IDY A;  1N60 A;  1CZP A;  2BB6 A;  2MJ3 A;  1YJJ A;  1ZE3 D;  3LXF A;  3IAS 1;  1FEH A;  1P7F A;  3B2F A;  4HKZ E;  1DYQ A;  2WP9 B;  2BBC A;  1NEK B;  1SBB B;  1N62 A;  1BUI C;  2WNM A;  1GB1 A;  1SJH D;  1PDX A;  3ABV B;  1UNS A;  1I4R A;  1QT9 A;  4XWW A;  1FCL A;  4YSX B;  1ZUD 2;  2YEP B;  2J4X A;  2L52 A;  5HI1 A;  2WXQ A;  1C78 A;  2MH7 A;  4OVZ A;  1C79 A;  3IT6 B;  3C8Y A;  3AED B;  1JAL A;  4WWM A;  5BMG A;  3FIL B;  4USA A;  5BYS A;  1ACC A;  3HUI A;  1YQ4 B;  3TSS A;  2GI9 A;  4C56 C;  1GOZ A;  4RGN A;  5H8Y E;  1V97 A;  1GB4 A;  1L5P A;  4HEA 1;  2J42 A;  2TSS A;  1XLQ A;  1AWD A;  2K0P A;  2RPV A;  2D5G A;  1E10 A;  2BB5 A;  2JYE A;  4YSZ B;  2YEP F;  2W3R A;  1SE2 A;  4HRO A;  1MHH E;  3TUO A;  1T5X D;  1JQ4 A;  4WQM A;  1MPE A;  1FD6 A;  3AEB B;  5AUI A;  4GDK B;  1XXG A;  4L1B A;  2J53 A;  2SAK A;  2NTT A;  1K51 A;  3P4Q B;  4ZHO A;  4KKJ A;  1DGJ A;  3W5U B;  3LYY A;  3AN1 A;  2BT6 A;  2WDV B;  4ZHP A;  1C4P A;  1WSP A;  1DOX A;  3B9J A;  2OED A;  1I4X A;  1FXI A;  1J7A A;  1SE3 A;  2AQ1 B;  2VZK D;  1HA5 A;  3V05 A;  3HVZ A;  1IBX A;  3E9S A;  2KQ4 X;  1EU4 A;  2IJ0 A;  2Y3A A;  2ZW0 A;  4RNA A;  5D3D A;  5C3J B;  2G1E A;  1D4B A;  1DOY A;  4KGR A;  3P42 A;  1FXA A;  1VDV A;  4YTP B;  2WXK A;  2Z8L A;  4IOI E;  3U52 E;  1NYR A;  2PMV A;  3U7Z A;  3FC4 A;  4B0E A;  1N63 A;  2WXH A;  1TJE A;  3ETR A;  3I9V 1;  1C76 A;  4WH4 A;  3VRB B;  3B2G A;  3URY A;  3BWU D;  2QIE B;  4GDL B;  1PGB A;  4ARC A;  2BW2 A;  2RMM A;  3BYY B;  4MAC A;  2W55 A;  3VR9 B;  2BTE A;  1K52 A;  4A9A A;  1QOA A;  2KN4 A;  3AE1 B;  2R61 A;  5G5G A;  2JQR B;  3J9C A;  4RFB A;  2Y5C A;  1TS2 A;  3L4P A;  1QOF A;  2LGI A;  1JWU D;  4HJG E;  4WIP A;  3AE7 B;  2QJL A;  2WXO A;  1FIQ A;  3N9Y C;  1YN4 A;  1TKY A;  2WXG A;  3Q8A A;  3TEZ A;  3VR8 B;  1ZDV A;  1UWM A;  5BMH A;  1XLP A;  2M19 A;  2LUM A;  3ZJU A;  3W9C B;  2PTL A;  3IAM 1;  2GB1 A;  5HFY A;  1BXT A;  3FAH A;  1EWY C;  2LJI A;  2HTM E;  2BS3 B;  3BVM A;  2BS2 B;  3NVW A;  2V0G A;  1FRD A;  4RGT A;  1TY0 A;  2NTS A;  3CIR B;  4ARI A;  1KLU D;  2KDM A;  1FO4 A;  1EM7 A;  2QEJ C;  1PGA A;  4GLS C;  1FFU A;  1JRP A;  3AE9 B;  3AMZ A;  2K3U A;  2K9X A;  5TSS A;  1I4Q A;  1Y56 A;  2VZK B;  2PKO A;  4A8X C;  1XEE A;  1SB3 C;  1YMH E;  2AQ3 B;  3GS2 A;  2WXL A;  4MH8 A;  1WGK A;  3PO0 A;  3MP9 A;  1HQR D;  3PZ8 A;  5HG2 A;  1JWB D;  1B1Z A;  1SEB D;  1TS3 A;  1I7H A;  1QQR A;  2INN E;  1N5X A;  1WXQ A;  2W82 A;  5EE0 A;  4A90 A;  1D5Z C;  1QIL A;  1P7E A;  1XLN A;  1OFF A;  4M0W A;  4RH6 A;  2IGH A;  3EUB 2;  2DLB A;  4O1N A;  2W3S A;  3BVZ A;  3Q69 A;  1OQQ A;  1BML C;  2WLB A;  3Q8F A;  3SEB A;  1WWT A;  4R3D A;  1CK1 A;  2FBW B;  3R2I A;  1D5X C;  1SF0 A;  4OHJ A;  5JXV A;  3AE8 B;  1Q10 A;  1ENF A;  3VQI A;  3V3X A;  2MJD A;  3AM9 A;  1XCQ L;  3CWI A;  5G5H A;  4LTU A;  4L2Y A;  2QMT A;  2PLP A;  4H2A A;  3P63 A;  1ROE A;  4HKQ A;  3IT4 B;  3LB8 C;  2RDH A;  2CU3 A;  2INP E;  4EE2 A;  5T8I A;  3EA6 A;  2WQY B;  3Q8B A;  3NUH B;  2AX5 A;  2PVO D;  2PW9 A;  4Q2J A;  3P4R B;  4NZL B;  1QKZ A;  2ON8 A;  3NVY A;  2ZW1 A;  1QLB B;  1WYG A;  1N61 A;  1UUP A;  2GRI A;  4OZA A;  2IGG A;  2XN9 C;  2KWD A;  4JPS A;  3MFG A;  4YWG G;  4TQ1 A;  4YTN B;  2JYT A;  3RPF C;  1VZ8 A;  3PZ7 A;  5I4D A;  1HZ5 A;  2WU2 B;  1MHX A;  1K53 A;  1PGX A;  3RFZ B;  1FFV A;  4KGT A;  1TZO A;  1V1P B;  1L6U A;  3FIL A;  5FKA C;  4A55 A;  2H89 B;  2NMQ A;  2BYT A;  5E6J A;  4L23 A;  4NJC A;  3IXS A;  2WS3 B;  4JE3 B;  1YN3 A;  1F2R I;  3Q8C A;  2DYM A;  3AB5 A;  1T6B X;  2K5P A;  3NS1 A;  1KFY B;  2RDG A;  3ZGZ A;  4B0M A;  3AV8 A;  2ONQ A;  4DQO C;  1DOI A;  1IGD A;  1F2R C;  3W5V B;  3KQ4 A;  3P4S B;  4ZRQ A;  3TEY A;  4C7Y A;  1KF6 B;  4PT5 A;  4DXF A;  4JWU C;  4C7Z A;  2DWQ A;  1J7C A;  1NI3 A;  5EE9 A;  3TEX A;  4ZYS A;  1XCT L;  1C77 A;  5LNK 1;  2IPK D;  2JX5 A;  5BYR A;  3AE6 B;  1STE A;  2V3P A;  1FNW A;  1A70 A;  1EU3 A;  3BK2 A;  3ZJV A;  3Q8E A;  1ZPS A;  3WCQ A;  5EE3 A;  2OHF A;  2WXI A;  1KTK A;  1SXT A;  4D2K A;  1AYF A;  1PFD A;  1ET9 A;  4YT0 B;  4AS1 A;  1KRH A;  4ZOH C;  4YTM B;  1IGC A;  3AE4 B;  1TKG A;  4YSY B;  1D6E C;  1OQR A;  5HHD G;  4XDD A;  1C9F A;  4P16 A;  1ZXI A;  1YQ3 B;  1SE4 A;  1MVK A;  2SEB D;  2ICI A;  3OWE B;  4JWS C;  2B76 B;  4TMA B;  3AE5 B;  2QSD A;  1B9R A;  3ZYY X;  1ZDX A;  2ACZ B;  2JZP A;  5D3I B;  3HRD D;  1JW9 D;  1AN8 A;  1PYW D;  1ZXH A;  3MJ5 A;  3T3N A;  2FE8 A;  5MPO A;  1V1O A;  1FNV A;  2N9L A;  4LLG M;  1JWA D;  3AE2 B;  2DBY A;  4OZB A;  2L1A A;  4FXC A;  1FNU A;  1FM0 D;  2PIA A;  2WXM A;  2EEL A;  3O13 A;  2V4I B;  4RCO A;  4WUR A;  1NEN B;  1EWC A;  2WXJ A;  4RGM A;  2AQ2 B;  2EKI A;  1E9M A;  1GAQ B;  1VR9 A;  2FUG 1;  3BYT B;  2E6X A;  1IBX B;  3BK1 A;  4REZ A;  1ET6 A;  2JU6 X;  3MHZ A;  1L6V A;  4XE0 A;  3DWM A;  3NVV A;  1JRO A;  4IKG A;  1RWS A;  4N59 A;  5EE1 A;  5GXG B;  1NVI D;  2CJO A;  3BZD B;  2CJN A;  1JWS D;  1TS4 A;  2JSV X;  3EGR A;  4TQ0 A;  1J7B A;  1F77 A;  2I2Y A;  1XLO A;  4J3O D;  1KLG D;  3AEA B;  1E0Z A;  1IUE A;  3UI3 A;  1C4C A;  1JWM D;  2QIL A;  1PUT A;  3P4P B;  2LFI A;  2KAJ A;  3AEF B;  5BMI A;  2BS4 B;  4NAW B;  1RM6 C;  4US8 A;  1QOB A;  2M56 B;  1VRA B;  5H92 C;  1JML A;  4IDI A;  1AW7 A;  1QOG A;  2N0S B;  2N9K A;  4ZRP A;  2H88 B;  1I4P A;  3T3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...