4JX8A

Crystal structure of e.coli enoyl reductase in complex with nad and aea16
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
b'MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Escherichia coli
publication title Crystal Structure of E.coli Enoyl Reductase in Complex with NAD and AEA16
rcsb
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jx8A00
3CZRA 4FFRA 4IINA 4PLPA 4IUYA 3BZUA 3GN1A 2WE8A 1QSGA 2PV7A 3GHHA 4WK6A 1WZIA 4RVGA 5KVCA 1ONOA 4XB2A 3KVOA 9LDTA 3U4IA 4OQYA 4TKMA 4U6QA 4CQMD 1SOWA 1YRLA 4KMSA 1Y7TA 4MKZA 1HDGO 3QVWA 1E1KA 3WWYA 4J9UE 2ZTLA 1MXHA 4H16A 4OYRA 3JTMA 3PWZA 3FNGA 2VRBA 5A03A 2DBRA 1X0VA 4NBTA 3H4VA 4JQCA 2AE2A 2I3GA 3BHMA 1EVYA 2ZB4A 4J1NA 5KTKA 3ENKA 3ZI0A 1ZW1A 4B7XA 5K0ZA 3N74A 3JQ9A 5TIIA 2NQTA 1HDCA 1QRRA 1FXSA 3FBGA 2DPGA 5JO9A 2OP1A 4XZ3A 3BMCA 2UDPA 3I9KA 4LISA 5B12A 2YHIA 4OAQA 1PS9A 1C14A 3ABIA 3Q6IA 1TXGA 5C7IO 1ADGA 4FFOA 1I3MA 5H83A 3U4HA 1N1GA 4YAKA 3NEPX 4RQTA 3BHJA 3U4CA 2X86A 1BRMA 2RHRA 3JSAA 5EN4A 5MDHA 4PCVA 3RUCA 3WYEA 2O7SA 1YQXA 3U09A 4CMIA 3WQRA 2FOIA 4D0SA 2EKQA 2V6FA 1ZJZA 1YB1A 3ICPA 4WE3A 1ISIA 3ICCA 2Y0EA 4RJTA 2RCYA 3IS3A 5KNLA 2Q3EA 5CG1A 1OC2A 3AM4A 5ER6A 1T2CA 3HDQA 1CETA 2PNFA 3DMTA 1QYWA 1Q0QA 2GO1A 3JQ6A 2ZYDA 5AXAA 1NP3A 4GSKA 4YRDA 1GADO 1MUUA 5L3ZA 2IRWA 3GC6A 5JW6A 3GF4A 4BQRA 2Y1EA 1ENZA 2JJYA 4XR4A 4AFNA 4WCFA 2PWZA 3VH3A 1I3NA 3AWDA 1SCUA 3ORFA 1N9GA 4BNMA 4XYLA 3WFIA 4B8ZA 2GGSA 3HQ4O 4J0FA 5EESA 4IIUA 3WTBA 4QQRA 3IP1A 5JAZA 4YJDA 1E6WA 4DVJA 2OUIA 3AM5A 3WS7A 4DLBA 2QW8A 5KIAA 3T4XA 2Q99A 3RUIA 4CMCA 1C1DA 4LVCA 1QG6A 3TPCA 3E82A 1X7DA 1BVUA 4EUHA 4W7IA 3QSGA 1YO6A 3CUKA 4OO3A 3INGA 1QYXA 1D8AA 3OEWA 1OOEA 5JCJD 4HWKA 5ES3A 4AJNA 1VJ1A 5EINA 2NTNA 2H5LA 3DQPA 4BVAA 5A9SB 4UREA 4YJFA 2I9PA 4ZICA 2HK8A 4II2A 4U7WA 2GN4A 4FFNA 1NR7A 1P1RA 4Q39A 4ESOA 2ZJ1A 2AQIA 2DUWA 5F1PA 2DTEA 4YT8A 1WMBA 3WSWA 5A9SA 1DC5A 3EC7A 1C0LA 3W4IA 5JDIC 1E7MA 2ZB3A 3GG9A 3NUGA 3OJEA 4PLCA 3DBHB 1LSJA 5AVOA 4OH1A 4YJGA 4BO3A 1GQYA 1LLUA 1FF9A 1U9JA 4XDZA 4JN6B 1U3VA 2BH9A 5I9NA 3PGXA 1YE3A 3VDRA 4H7PA 1BMDA 3DFZA 2X5OA 1F8GA 4ND1A 3GNSA 1XHLA 1N2SA 3WGHA 3EZYA 5ITWA 3LC2O 4CMEA 2HO5A 5DCYA 1PGJA 5T64A 1NNUA 1UZMA 1HT0A 2NLOA 4MIOA 4CPDA 1SO8A 3F4LA 5CPFA 4CM8B 2IYOA 1SOVA 2O48X 5TT1A 3VHRA 1SPXA 4O63O 5EL0A 4GL4A 5ADHA 3BMOB 3UF0A 4RF4A 5JE8A 3NX4A 2DBQA 4U6SA 1FDTA 1UDBA 4N54A 4MVJD 1PJ3A 4E13A 4HNGA 3K8ZA 1B16A 2W2KB 4E2XA 2ZB8A 4U0KA 2QRJA 2VWHA 2HMSA 1V6AA 5HBRA 3D64A 4YJHB 3V1UA 3Q9UA 1WZEA 1YB4A 2FP4A 4WASA 1HLPA 3V5NA 5BNIA 4KQWA 4AJJA 3GVXA 1ZMTA 4B4VA 2VT3A 3E8XA 2HJSA 3GGPA 5DNAA 2FR1A 2HSDA 2FZWA 4PLWA 4HADA 4CQMB 4KOAA 1K0UA 2GRAA 2DTDA 2B5VA 1ZZEA 3FD8A 4BO1A 4MDHA 1VI2A 1YBAA 3M6IA 4FOOA 5K6AA 1XGKA 4PLZA 4CLEA 5L4LA 5GY7A 1NQOA 3W4KA 1JKFA 1T2FA 2J3HA 4A73A 2O50A 3Q11A 4IPTA 1E7QA 2UVDA 1GYQA 4OQZA 4QECA 4W6ZA 2BGMA 1GFSA 3OQ1A 1ONPA 4RVFA 4XGIA 3WGYA 1WXDA 3F3SA 4Z3DA 1CERA 3GAFA 1CDOA 3SVTA 4IM7A 4PVDA 4XYMA 1F0YA 3EY4A 4ZHSA 3DZGA 4IDFA 4RDHA 3LQFA 2BGKA 1MC5A 3RJ5A 1IL0A 1JDJA 1LSSA 3NJ8A 4UUMA 4I5EA 4ZQFA 2V6GA 4NIMA 4DBZA 3C1AA 5JMPA 1E7WA 4E3ZA 5LCXA 1YWGO 3FR8A 4QXMA 4TWRA 3WLEA 2EJVA 3B20A 2HMVA 4YR9A 1E3SA 1OFGA 3PVZA 2YQ4A 2ZATA 3DZFA 3SLGA 3WB9A 3SC6A 5IAAA 4OSPA 2DAPA 4R3NA 4CODB 2WDZA 4BGUA 5L53A 1I2BA 4OL9A 2B4RO 1I30A 3W6UA 2CZCA 3VZSA 3QQPA 4FS3A 2QG4A 1Z73A 1P3DA 3K92A 3RC1A 1MGOA 5CDUA 4KDEA 2ZB7A 3H8VA 2WD8A 4JX8A 3TZKA 4AVYA 4CUZA 3GG2A 1IE3A 1U7TA 4C7KA 1PJTA 4EI2A 1O5IA 5A05A 4E2WA 3PPIA 3ASVA 4BKUA 2XF8A 3VZPA 1I0ZA 1SBYA 2BFMA 2EXXA 2Q2VA 5KCZA 3G0OA 2FSSA 1YBVA 2YHUA 3SLKA 1XU9A 1XG5A 4ONEA 5IDYA 3UICA 4CQLB 1U1IA 1JTVA 2CMDA 4CV3A 4FN4A 5JO0A 2BHLA 4YT4A 4WGGA 4E30A 1NWCA 3UXYA 1P1JA 3JD4A 1C0PA 2YY7A 2G76A 5H82A 1NHGA 4GWKA 2DU8A 4S3MA 1T2DA 1I32A 2PZKA 5FI3A 1TT7A 2J6IA 1RM4A 3WG9A 3G17A 1WWKA 1C0KA 5G0SA 1B8UA 8ADHA 3OECA 3IDSA 4E4YA 2ET6A 4QEDA 3VTZA 3WQSB 1OBFO 3W8FA 4D3FA 5HTOA 1B8PA 4IQ0A 1PTJA 3ANMA 3GGOA 1P74A 1ARZA 1PS8A 2W90A 2BFPA 2CF6A 4TRJA 3I9JA 4CUJA 1VL0A 3UCFA 4BNLA 4R5MA 3PTZA 2I99A 1BSVA 4ZU3A 2WWRA 3P5SA 4GVXA 1F17A 4Y9DA 4BUCA 3GUCA 5T67A 4J4HA 3H5RA 1EK6A 1JW9B 1YKFA 2Y67A 3DOOA 3DZKA 3I4FA 3KSDO 4PG6A 5CP8A 4BO9A 5I9LA 2C5EA 1J4AA 1KC1A 3E5RA 1PJ4A 2VYVA 3OICA 5KJ1A 4G5HA 4DRYA 3GVHA 2AW5A 4KZPA 2FSVA 2O2YA 3NT2A 5JYDA 5G0TA 4GX5A 2DT5A 4JNKA 3F5QA 1LDBA 4GQAA 2EP5A 3QWIA 4NJMB 1PJLA 1B15A 3WIEA 2J3KA 1WPQA 2ZK7A 2B83A 2J5RA 2BD0A 2YV3A 3INRA 1PL7A 5CDTA 1GR0A 2VUUA 4CLRA 5C7OO 3OQ6A 1X15A 2PH5A 1C1XB 3QRWA 4M54A 3IC5A 2EERA 4IIVA 1J49A 1H9BA 3PJFA 3WXBA 5IXSA 3W4JA 2PTGA 2V6MA 4GH5A 1Y8QA 2CVQA 2VWGA 3LF2A 4QUKA 4A26A 5TX7A 3ONFA 5BSHA 1B3RA 2IXAA 3I83A 4KQXA 4YAGA 2Y1CA 4QSMA 2PZLA 3RUHA 3ZWYA 3JQBA 2NVWA 2W4QA 4H15A 3RKUA 3LT2A 1UP7A 2BKAA 4FJ1A 2O3UA 4YQYA 4Y6PA 1UUFA 2BMAA 1JVSA 3ETDA 3LT4A 2X9GA 3L77A 2HRBA 5KVSA 4JGBA 3DB2A 3WJ7A 4BMNA 4L74A 4DUPA 1H93A 3RAJA 1DAPA 4ALLA 4E32A 1HZZA 2JD1A 4IMRA 3NGXA 1NAIA 1IPFA 4Z0HO 1LDEA 3M1AA 4HP8A 4UUNA 2PD6A 2X58A 2CVZA 3NRCA 1D4FA 5DBFA 5ILGA 3GGGA 5L7YA 2RAFA 3C7DB 3SJ7A 5JDIA 4IS3A 1UZNA 2PZMA 3K30A 4L0QA 3JYLA 1E1MA 6ADHA 2O3JA 4DIOA 3ROQA 2X5KO 1MFPA 1B3BA 4RVHA 1HDZA 2VHYA 3DWFA 3RASA 3RFVA 1DFGA 5IZCC 3OJLA 4OIMA 1E6UA 1NM5A 2VN8A 4NI5A 2VOJA 5JY6A 4XWYA 3DXFA 2IXBA 4BB6A 2AG5A 1NFQA 4TSKA 5A9RA 4MJLA 4OOEA 3ZWOA 3H7AA 2C20A 2D2IA 3VKVA 3PYLA 5T8KA 3OF2A 2Y1GA 1BG6A 3E48A 2Y99A 2GSDA 4ALJA 4GWGA 2A94A 3GN2A 4YVFA 1MFZA 1DFIA 1Y8RA 4JLWA 3TJRA 3HHPA 1PQPA 4Y67A 1NAHA 3DHEA 1L1FA 1M75A 2OO5A 2XPCA 4WEOA 4Y8VA 5AXBA 3VPFA 2FZEA 3ASUA 2GASA 4MVJP 2BFAA 4FSHA 4CMIB 4ZRMA 2RH8A 4JBGA 5CPBA 5A04A 1M67A 4HFRA 2CNBA 4PRLA 1E1NA 1PGOA 5A3JA 1V3VA 3Q2KA 3VPSA 3QE3A 3VTFA 1GQ2A 2JCVA 3ETEA 2GZ1A 4YA6A 3OIFA 4P8RA 1QYVA 3FNEA 1Q2XA 4D3SA 4XRGA 4L75A 3TQHA 3FI9A 4AJ1A 1Z75A 2PZJA 5B4UA 1DRWA 1ZK0A 3LYLA 3OETA 4DQVA 6LDHA 3CXRA 4CM5A 2DFVA 2IEBA 5ICMA 4YT2A 1E3WA 1R15A 3KYDA 1E3EA 3OIGA 3QWHA 3GPIA 4MVJI 4UEKA 1X13A 1LQTA 1TT5A 5BR7A 1KBZA 1VKOA 4IDBA 4GVLA 4FJ2A 5CDSA 3CINA 3WGGA 2WSBA 2H63A 3LZ6A 4CV0A 3JQEA 4WOKA 4WPGA 1N7HA 3HADA 3GHYA 3DMTC 4F6CA 2VHWA 1GCOA 2B4QA 2Q1SA 4IXTA 4JCOA 3AUAA 2X22A 4E5PA 2VNSA 2AQHA 3RU9A 3TDKA 3RCBA 4UVDA 3DBRA 1D1TA 2Q1UA 2GF2A 2P9EA 4GMFA 1ISMA 1LLCA 1XQ6A 3NYWA 5JY1A 4R1NA 4WLOA 4PZCA 3QJ5A 3OA2A 5HA5A 5IFLA 2GERA 1HSZA 3COSA 4ALMA 2VYVD 5DF1A 3TFOA 1XIVA 1XSEA 3O38A 1JKIA 4FC6A 4WJZA 3WMXA 1N9GB 2I76A 2POQX 1OZAA 1WAMA 4K1LA 3EW7A 3PI7A 4IS2A 2PGJA 3PZRA 4AJPA 3T7CA 1KEUA 4CM4B 1UXHA 2NU8A 1SZJG 2PD4A 4F3YA 5A5FA 4I9UA 3AOGA 1PS0A 2C29D 2DTXA 2E49A 3H5AA 5BT9A 3K31A 2UUPA 3HZZA 4WUVA 1E3WB 5JDCA 1IYZA 4KDFA 1ONNA 3RI3A 4ZGWA 2DBVO 3D3WB 1ADBA 4K26A 2Y0CA 4XGKA 5L9AA 3IKTA 1GYRA 3PXXA 1FDSA 5JYEA 3GRPA 1U8XX 2FHSA 1LSUA 3HWRA 4MVJE 4M89A 1RWBA 4J1TA 3D4OA 5JDCC 2EKLA 3NTOA 4J0EA 1X7GA 2GZ3A 4OXYA 4CL3A 3IQDB 4HNHA 4HFJA 3HB5X 4RQUA 2PKQO 1EVIA 2Q45A 3MJTA 4F6LA 1WDLA 1WLYA 2XOXA 1LJ8A 2ZYAA 3WWZA 4CM3A 1R0LA 3D3EA 2OHXA 3AU8A 3QWBA 1JA9A 2PKRA 2PGDA 4BO4A 1CYDA 3I3OA 2JKVA 5A02A 1UDCA 2VZ0A 3NT5A 4HBGA 4RPLA 4WCFC 4R68A 3PJGA 1MA0A 1WMAA 3LLSA 4WNIA 1MX3A 1E7SA 2D3TA 4O1MA 3RQSA 4AJHA 4PLTA 2HQ1A 4AICA 4X54A 5FWNA 4ZQGA 3GT0A 5ENVA 2O3QA 3R1IA 3LT1A 3TZCA 2HCTA 4L4SA 5LC1A 1O94A 2AQ8A 3GNQA 1KERA 3LVFO 4NFHA 4W9NA 4BGVA 4B3HA 4PG8A 1E92A 5G2OA 3JD1A 1IHXA 1VJTA 2QQ5A 3TOXA 4FDAA 5G0VA 4ILKA 4IDDA 2GR9A 4AL4A 4XYBA 2UUOA 3I6IA 2WYVA 1KS9A 4CV1A 1ADCA 5HRUA 3ZV6A 5A9TA 2R2GA 2Z1MA 1TB4A 2Y68A 1XCBA 3ZWWA 4BO8A 1LX6A 2VT2A 1U7HA 1G6KA 4OKIA 1XR3A 4J3FA 1BXGB 5L95A 4DXHA 2D0IA 3M2TA 1HDOA 1EUDA 3SXPA 4MVJM 5I7EA 1YH3A 2X0NA 1F8FA 1EE9A 1EUCA 4P22A 1HE3A 4MVJA 5TJ9A 4C7JA 4XEHA 2X8LA 4NK5A 3N7UA 4XDYA 1Y8QB 3FTNA 3RSHA 5AQ1A 4YQZA 1UP6A 4JXKA 1EFKA 3W8EA 2PLAA 3VVBA 1YXMA 4BHTA 5BQFA 3S2FA 5CDYA 3OEYA 4OMUA 2ZTVA 5IJZA 3FR7A 2G1UA 2TMGA 4WECA 3PHGA 3IL2A 3FWZA 2X9VA 4DWVA 5TC4A 3BYZA 3C24A 3DR3A 3HDYA 4RV9A 1RYDA 4RZIA 2F00A 3GR6A 4AJIA 1KY5A 2WE7A 3DMYA 4D7AA 5KVQA 2IYPA 1H0KA 4WCFB 3UKOA 1LBEA 4KWHA 4BKPA 2HU2A 3SBOA 1E3IA 4C4OA 1VJ0A 3ZNNA 1MP0A 2JCXA 3AFMA 4PGFA 4K6CA 1BWSA 1WW8A 3GH3A 4RF2A 2H9IA 3U49A 4IGEA 5HS6A 2VHZA 4QO7A 1HKUA 4WCDA 2VUTA 4RF5A 2FR8A 4CR7A 4D41A 1N5DA 3TZ6A 3DTTA 2JAPA 3SJUA 4UAGA 3JQ7B 2QYSA 5B4TA 1AUPA 1DJNA 3R3SA 1I10A 2DC1A 4NU5A 3ANNA 4DQUA 4P4LA 3PLRA 2YYYA 3T4EA 5JBIA 3B1FA 3K9QO 4GX1A 4BKQA 1M2WA 4BO0A 3L6EA 4AJ2A 1GV1A 4R51A 1R16A 2QZZA 3KLMX 1S6YA 3Q9NA 1HYEA 1DIBA 1R0SA 1FDVA 4N5NA 2WEKA 1UDAA 3A28A 4GX2A 2JCYA 1JQBA 2VCYA 1B2LA 3FNFA 2O4CA 1BGVA 4FJ0A 3PWSA 5AXCA 3TWOA 3C7AA 1U8FO 2X0JA 1HDXA 4IDEA 2NVUB 3GLQA 1ORRA 1K6JA 3O26A 3BA1A 5EPOA 3EYWA 2RIRA 3QW2A 4XCVA 1N7GA 1KY4A 2JHFA 2UYYA 3P2OA 1MB4A 4YWJA 4CMAA 1JWBB 4AG3A 1RPNA 3BIOA 5MGBA 4MIYA 5TS3A 3GNTA 4RORA 3ITKA 4YAIA 1QLHA 3WNQA 4ZVVA 2NU9A 5IF3A 2WTBA 4MPDA 4LRSB 4JJIA 1PZFA 4BQPA 4S1VA 5B1YA 2GLXA 3KO8A 1HTBA 3RBVA 5F3RA 3AI1A 3LF1A 4CMHA 3F1LA 1V35A 3H3JA 4WKGA 4RZHA 3JQFA 4BGIA 5ILOA 2Q46A 3OJFA 1LDNA 1E0DA 4R3WA 1Z6ZA 3HSKA 4GGOA 4BGEA 3UGKA 1T1RA 1A4IA 3G1UA 3ZV5A 5A3VA 5A4DA 3DO5A 1R4NB 4R01A 3LU1A 3FRJA 4Z6KA 3EVTA 4K6FA 5BSEA 2AHRA 1J5PA 3NKLA 3PWKA 2D5AA 1JAXA 4QO8A 4A0SA 3JQDA 3D4NA 2Q49A 1JWAB 3QA9A 3GQVA 3M2PA 4TQGA 4IZHA 4MVJG 3FF4A 4R9RA 4XQCA 4RDIA 3BTUA 5T5QA 5ICSA 3ONEA 4UULA 9LDBA 1N1EA 4XA8A 1KVQA 3AI3A 4L73A 3LT0A 4CMEC 4P38A 3AUUA 4G65A 2IZ1A 1LLDA 1H6AA 2EJWA 3AW9A 3HG7A 4PG5A 4XGNA 2D5CA 1ZO8A 3G3EA 4KUHA 2X9NA 1F12A 1X1TA 1C0IA 3LSYA 1ZEMA 4FW8A 3DAFA 4OM8A 1DFHA 4URFA 1GEEA 2Q4EA 4NJOA 3WBFA 3QWAA 1A9YA 1U4OA 4GPD1 1OI7A 2NVUA 2F1KA 1AHIA 1E6EA 1TT5B 3DBLA 3DEYX 3OP4A 3WOHA 2WYUA 4UUPA 1Y6JA 2O3SA 5HS4A 4RVUA 2DFDA 3UCXA 1EEHA 1HZJA 2EG9A 5KJFA 2EEZA 4TZTA 3QP9A 1WNTA 3I4CA 1KVTA 4YJFB 3FTPA 1VPDA 4J6FA 3IUPA 1IHYA 1A9ZA 1R6DA 1KYQA 1T24A 3SC4A 4MP8A 3PDUA 3KUXA 1NPDA 2GD1O 2CDCA 3KEOA 4Z0PA 3MWDB 2HLPA 4PIVA 1YL5A 4ND3A 4B79A 1ZSVA 1LU9A 1E5LA 2EHDA 4EEXA 3QVTA 3I5MA 3WYCA 1ISJA 2J3JA 3RFTA 4NNJA 3RUDA 3S2GA 3HFGA 3D4PA 4YAEA 3PDJA 1DC3A 3WIDA 1YOVB 2NV6A 1PIWA 2Q2WA 4O59O 3KTDA 3PP8A 3TFQA 3G49A 1NQTA 1I2ZA 3KBOA 3DBLB 4FBGA 3ZWXA 2Z5LA 4O0LA 3AU9A 5JAIA 5KKCA 3BXXA 4HV4A 2DUUA 2D4AA 2WMDA 4O6VA 2JHGA 3A4VA 2Y93A 4DPKA 4ID9A 3IKVA 2AEFA 1DIRA 2IZ0A 3ETGA 1DIHA 1BXKA 1CQJA 1YL7A 5G4LA 3VPXA 1AE1A 3HFSA 4PLHA 2OZPA 3AFNA 3C1TA 5JLAA 4AJOA 1E7YA 1Q7CA 3F46A 4IGFA 1H2HA 3JQAA 3GEGA 1WDKA 3V2GA 1LUAA 3HNPA 4J1SA 3RUFA 2X6TA 4JP3A 4BV8A 2CDAA 4YRBA 5F1KA 2HMWA 4EYEA 2YHIB 4CMJA 1ID1A 2VHXA 2YFQA 4CM9A 5JPIA 4J16A 3EHEA 3EK2A 2VZ9A 2G17A 3G79A 2X23A 4WLNA 1ISFA 3ZU4A 3VPGA 3KZVA 4N7RA 3AK4A 2ZYGA 3UHAA 3VZRA 3DHNA 2VRCD 3WDSA 1GU7A 1HDRA 5JFOA 4PLYA 4HX5A 4PVCA 1I36A 3JV7A 3RWBA 3N58A 4B3IA 3JQGB 4OOFA 3EUWA 3M1LA 1ZSNA 3GY0A 2B0JA 1H6CA 3WNVA 2O7QA 1C1DB 1HSOA 3E1KA 1IZ9A 3PHJA 5C5IA 1ZIDA 3IOYA 2VOEA 4RVDA 4Z0TA 2I3AA 3S2IA 4EBFA 5U9CA 4HFNA 4J2OA 1ZVMA 1LC0A 1DB3A 3E9QA 4E0BA 4TVOA 5GZ3A 4II3A 1P0FA 5T8KC 5L7WA 2X0IA 1B8VA 1ZMOA 2P9CA 4CM9D 4U0JA 1H2BA 1ZK4A 1PWZA 3LDHA 1UXIA 5EIOA 3TNLA 5IZCA 4D79A 1B0AA 2I5PO 1FDUA 1ZUD1 3I9LA 3KYCB 1UR5A 1KOLA 1P31A 4D42A 4IQ8A 3KYDB 1PQUA 2C0CA 1NASA 3AOEA 1K2WA 2Q50A 1QKIA 1R4NA 1SB9A 3DDNA 3KHUA 3F4BA 3GFGA 3PK0A 3ADOA 3OQBA 5JCJA 3AI2A 4EDFA 1VC2A 1YJQA 3BMNB 1TLTA 4YB8A 2Z95A 2I65A 2Y1FA 1I2CA 1LA2A 5EERA 1CWUA 1VL8A 4GI2A 1AHHA 4FFPA 4XKJA 1ZCJA 4D3DA 1ZXLA 1Z45A 2VWQA 4NQZA 2OP0A 3RC7A 1U4SA 1TVEA 3AY7A 1NVMB 1KVUA 1IULA 1BXZA 4DQXA 1HE4A 1QORA 2AXQA 1AXGA 1V9LA 1JKJA 1H94A 1XELA 3AUSA 3MOIA 1UAGA 3JQAD 3L4BA 5IDXA 1V3TA 4J2HA 3PIDA 1T4DA 4JIGA 1O95A 4ALNA 2X7HA 5AOVA 1LQUA 3WMWA 2O2SA 4I8XA 4B4UA 3X2FA 4CM4A 2DVMA 1LRLA 5GZ6A 3EAGA 2VUSA 1NBOA 3VAZA 3C3XA 3H9QA 3CE6A 3EZLA 2EWMA 3JD0A 2XXJA 4XJSA 1DC6A 3A9WA 1NQ5A 2PKQP 3ZH2A 1R4MA 2B69A 5TNXA 3B6ZA 1G1AA 3RD5A 2NADA 3VOSA 3L0DA 4Q3AA 4RVSA 4MVJH 2C2YA 4TRRA 3UUWA 4DYVA 3L6OO 2BGLA 2BI8A 1Q7BA 3VZQA 2RBEA 3F5SA 4ZA2A 2VTDA 1NFFA 4LGVA 3NV9A 1DRVA 3JQ7A 3TRIA 1GZ3A 3PJEA 4CR6A 3DTYA 3Q2IA 3ZU5A 1XEAA 3MEQA 4Q3BA 4DTIA 3UOGA 1LDYA 3CMMA 4Z9YA 3ROMA 1QV7A 2OGUA 4E5YA 3GDFA 4IZIA 4DPLA 2P91A 2NQ8A 4CMBA 4B4WA 1ISHA 2HAEA 5ITVA 1ADFA 2CFCA 3ANLA 4FC7A 3RFXA 2EGGA 3JYPA 3P2YA 3G1TA 1LLQA 1NVTA 3TSCA 5FFFA 5H81A 3PFFA 4DREA 1PEDA 1CIVA 1G0NA 4LMRA 1XKQA 5F5NA 4XRRA 3B1JA 1ZKMA 4L76A 1DIAA 1DDOA 3D5TA 4GKBA 3PEFA 1IPEA 3ON5A 1XQ1A 3CTMA 4WLFA 1HETA 3DBVO 5FEUA 2AMFA 4J4TA 1P45A 2HK9A 3ZN2A 1VSVA 1ZEJA 3K6JA 2D8AA 2DBZA 5TSDA 1LXCA 3E9MA 4ZD6A 4R16A 3KLPX 1SNYA 1PJQA 4CLRB 1PGQA 4XYGA 1BW9B 3WTCA 2EW8A 4BNXA 3QIVA 3C7CB 4BNGA 2BI7A 1Z7EA 3NTQA 4IBOA 5EJ2A 2AA3A 4NZ9A 3TL3A 4GX0A 1D3AA 1T1SA 1U3TA 3PQDA 4GBJA 3ZGYA 1O0SA 5JMWA 1GEGA 1ZNQO 3DZJA 3OA0A 5CEFA 5EMHA 5ENDA 1K6IA 3DZIA 1IZ0A 4E5KA 4ZQBA 3OHSX 1AN9A 3GDOA 1RM3A 1X1EA 4IDCA 3SX2A 4YYZA 1PJSA 3F1KA 3JD3A 3ZHYA 4CUKA 4A7PA 4CM7A 1G0OA 3CH6A 1CQIA 3KM0A 1BDBA 1VM6A 3IUSA 2JAHA 4CM6A 1EDOA 2PA3A 2X5JO 3D0OA 2C82A 5B37A 3U4DA 1LDMA 3DAGA 4A2CA 5JC8A 3MJSA 2HK7A 1O8CA 1R0KA 4UVIA 5T6BA 3ZHXA 1Z7BA 4J7CA 4OSOA 2V6BA 5L45A 4GMGA 2QRKA 3RBXA 2Y1DA 2YDXA 4AJEA 1GTMA 1WVGA 3O9ZA 4BNIA 3GA0A 4HFMA 5IZ4A 5HM8A 4PFJA 4U8GA 4FPXA 2VRCA 3BMOA 3I23A 1DLIA 3ZNQA 2C7GA 5L51A 4MVJF 3MOGA 1SAYA 4LW8A 2FPGA 5G0WA 5I8WA 3U3XA 3RKRA 4CM8A 1VRWA 3C8MA 4UVGA 1PU2A 2ZCUA 4YEDA 4W4TA 1Y5RA 1Z82A 3U62A 3FHLA 2I66A 1CJCA 3INTA 5AXDA 1ZK3A 5G4KB 3AOEC 4FGWA 4OHUA 4GGPA 3ZCXA 2UAGA 2Y66A 2OFPA 2FR0A 4BV9A 4NFSA 2VHVA 3H65A 3ZWCA 1EVJA 1LTHR 3P19A 4KP7A 2GPTA 4EUFA 2FN7A 3QLJA 2TMDA 3WSVA 3K5PA 1YGYA 1C1XA 1PQWA 2NVBA 1UXKA 4JBHA 2ZJ0A 4JJFA 4R1UA 3ZWNA 3VH1A 1EBUA 4PZEA 3BMQB 1P9LA 4YBZA 3NTRA 3OFSA 5KJCA 1XWFA 4XD2A 4R4JA 3RUAA 4BNTA 5IDWA 2WYWA 1HWYA 5DZSA 3JQ8A 1PR9A 1Y1PA 2FRDA 3DAPA 3ZWAA 5I7FA 2D59A 1DAOA 2OBYA 1W8DA 4O5OA 1OAAA 2EV9A 1OMOA 1O6ZA 2W98A 4R1TA 5I9MA 3HB4X 3E9NA 4MKXA 4AJLA 5TQVA 3WGIA 5T57A 1GPDG 1JVBA 1DXYA 2EKPA 1PL8A 2HUNA 3K96A 1V8BA 3VH2A 1I24A 3JQAB 4CLOB 4TROA 4IY1A 1A4UA 4BMVA 3UN1A 1T26A 1HXHA 2BLLA 1LC3A 3ZWPA 4DIBA 2GUGA 4L9RA 1K5HA 3PHIA 2NTJA 4N5LA 2R00C 2JD2A 4CM1A 3ST7A 2HKIA 2ZIZA 2DM6A 1UH5A 4FR5A 3DC2A 3QWFA 1F06A 4J91A 1MC4A 2NWQA 1BXGA 1HE2A 4K28A 4WLUA 3R3JA 1GDHA 1F14A 4J7UA 1FJHA 1M6HA 1ZH8A 2JL1A 1QV6A 4XIYA 4LCJA 1A7KA 4Q3NA 3VDQA 3GVPA 4KWIA 1GUZA 4ZRNA 1W73A 3I6QA 3MJCA 3ITDA 5BNFA 2P5YA 2Q4BA 4EJMA 1GL3A 1I3LA 3GRKA 1I33A 4NBVA 3RIHA 5DDIP 4ALIA 2E82A 1EQUA 4FB5A 4QT0A 2PY6A 3WLFA 4OKNA 2ZKLA 2IODA 1MG5A 2RHCA 3H5NA 3HUDA 3LC7O 5DP1A 2VTEA 2B36A 4BNWA 1P1IA 4CLHA 1PL6A 3JQCA 1QYCA 3O4RA 2WM3A 1ULUA 2NU7A 1PJBA 3PQFA 1EUZA 1XLTA 4DGSA 2GCGA 3WJAA 3PIIA 4BNUA 5IN4A 5GMOA 1O9BA 2IZZA 3KYCA 4OJNA 5F21A 1IB6A 4KTVE 5CFZA 2NUAA 3HDJA 3GVIA 5JCXA 4ALKA 1GY8A 2CD9A 3NDIA 3SEFA 2GN6A 3GPDG 4CL8A 1HDYA 1A5ZA 4GLLA 4YAJA 4D43A 1YQDA 3KSZO 3OMLA 4LVUA 2C54A 4RPHA 4BNHA 4NK4A 1B14A 3RVDA 4CLDA 1H6BA 2HMTA 3V8BA 4DL9A 4ZJUA 1I8TA 4IXWA 4XX0A 3BTOA 4XJTA 1R66A 2GDZA 3PQEA 2DPHA 4JK3A 1J6UA 2DQ4A 3U5TA 3AJRA 1CF2O 3HJAA 5TRTA 1NFRA 4YJGB 4RLSA 1DC4A 4TVBA 4MINA 5IDQA 4NG5A 3E18A 4MP3A 4ND2A 2Q2QA 3H9EO 3ZV4A 3RC9A 8LDHA 1T2EA 4R41A 1KETA 1LEHA 4BNJA 3O8QA 2HMUA 3BTSA 4G81A 1PX0A 4B3JA 1CEQA 2JFGA 1GYPA 3KV3O 3L4SO 4K9DA 1T25A 4TKLA 4CQMA 4E31A 3LC1O 3I9NA 3DL2A 1TI7A 4Q3CA 1M76A 4DA9A 2X1HA 4WOJA 3FSRA 1E1LA 1EQ2A 2A92A 3STHA 3W1VA 3WR5A 3AM3A 3CMCO 4XQ9A 1YQGA 5CEEA 4J49A 2IE0A 1X0XA 1KEWA 2GNAA 2NTVA 4D0RA 1B26A 4J7XA 3K73O 2NU6A 3HE3A 4JBIA 3ZU2A 1P1KA 4DIFA 5BSGA 5DCWA 1Z74A 3B1KA 4BMSA 3DBRB 2QRLA 3H9GA 4DMMA 4PLVA 3EVNA 2Y0DA 3VPHA 2VNAA 1P1HA 4MP6A 3C1OA 4BOYA 3I9MA 5G0UA 4Y98A 2QZ9A 1ZK2A 3TZQA 1EBFA 3GMSA 4UUOA 5KKAA 2BRUA 3PHHA 4B7UA 4XYEA 1QMGA 1DLJA 2NACA 2NNLD 1KEPA 4DLAA 5A06A 4F45A 4ND5A 5U4QA 5EQDA 3EDMA 4BO5A 5A5EA 3RUEA 1QR6A 4RF3A 4DPMA 2I6TA 2YW9A 2ILTA 2B5WA 3W6ZA 3ZW8A 2E37A 4BNVA 1S7CA 5TGDA 4B7CA 3HN2A 3FN4A 3JQFC 4EW6A 4LRTB 2C59A 3GMDA 2NM0A 1NVGA 5TLSA 1V3UA 1NPYA 4UVEA 3PFWO 4IJWA 1OC4A 1JN0A 5TJHA 2W8ZA 1YONA 4W7HA 4EUEA 2Q1TA 3HDHA 4CR8A 4M8SA 5IXYA 5KJ6A 4QFDA 3ROPA 2X0RA 2PFGA 2GN8A 2G5CA 5ER9A 4P4NA 3DZHA 1GZ6A 1U2GA 3BMCB 3JCZA 2W2LA 4L8VA 3UH1A 4E5NA 4DC1A 1EDZA 3D3WA 1BTOA 3OJOA 3IIEA 1NHWA 2P4QA 3IAHA 3WGTA 3JQ8B 3UFXA 1RJWA 3MZ0A 7MDHA 4B4OA 2DKNA 1K3TA 1T2AA 3C85A 3IMFA 1SMKA 4NHEA 3B70A 3VC7A 3QY9A 4EJ6A 2BELA 4FOSA 1RM5A 1SB8A 4L4RA 3MJ4A 4BNKA 1NR1A 1P77A 4PZDA 5K6AC 3OIDA 1U3UA 3IP3A 1H6DA 1Y9AA 4GSLA 4J43A 4NFYA 3BAZA 2VYND 5F5LA 3KXDA 5BNTA 3WGQA 4KUEA 4EEZA 4CLOA 5FI5A 1YJ8A 4RO0A 1NPTO 1N8KA 3E6AA 1UXGA 3PYXA 3TL2A 1R4MB 1HL3A 1D1SA 1TA4A 3JQ9C 4ZQHA 3RC2A 4FGSA 3CPSA 5L4SA 2B4TO 5JAMA 3ENNA 3H3FA 4PRKA 5G4KA 1MXFA 3CZMA 4NDNE 4W99A 4I9NA 4BO6A 1C3VA 5AYVA 5DBGA 4PLGA 3PZBA 3H6KA 4BO7A 3KRTA 3KEQA 1PJCA 1VL6A 1X14A 3BHIA 4INAA 4TRNA 3FCOA 1U5AA 1YS4A 5DULA 2O4UX 4J1QA 4YACA 3V1YA 1MV8A 3MWEB 4YT5A 1RYEA 4FD3A 1P44A 5IN5A 4YTEA 2EGHA 3OH8A 3ZWMA 2Q1WA 2XAAA 4EGFA 3KYBA 5CEJA 2EP7A 1YB5A 3W8DA 2PD3A 3TN7A 5A1TA 4BNFA 3R6DA 1E3LA 5DP2A 4BNZA 2E6UX 3JYOA 1GQQA 1XU7A 3BMNA 3WQQA 2W2KA 3WYBA 1T4BA 2OMEA 4LK3A 1HYHA 2FWMX 1ULSA 2J5QA 2NSDA 3L4BC 5JXWA 3OSUA 1E7RA 1P33A 1RM0A 3L9XA 2O3RA 3OBBA 3PJDA 3PGJA 4TRMA 1DSSG 1PGPA 5K9ZA 4IDGA 2C5AA 3BTVA 4E2ZA 4NJMA 4NBRA 2E48A 2EF1A 4Q3DA 4WEQA 4I9HA 4FFMA 3NJ4A 2CVOA 3ZW9A 4LSWA 1V0JA 1B7GO 3S1LA 3V2UA 2QYTA 1O89A 4U5QA 5C3MA 2OXIA 1NTOA 1PSDA 1ENPA 5COBA 3WGZA 3PLNA 4I5FA 4BL5A 3IJRA 4BNYA 1P0CA 4E2YA 2OORA 2SCUA 1GCUA 4LMPA 4IJUA 2WJPA 1YBMA 3UW3A 3S2EA 4YJHA 4EZBA 4FIZA 4A5OA 1NYTA 2Y05A 4YRAA 1XA0A 4LN1A 1PZGA 2FPPA 4R69A 3I1JA 5CHEA 1R37A 2C2XA 4N18A 4I5GA 4R5HA 3UVEA 2CF5A 3A06A 3GK3A 4DYDA 4BO2A 2YQ5A 2AEMA 5KWEA 4W82A 4IQGA 4QX6A 3ZNPA 1I5RA 4NMHA 2ZTMA 1DBVO 1DHRA 2OOSA 1PWXA 1U5CA 1Q0LA 2CY0A 2BF7A 3F9IA 4M1QA 5LDGA 5I7SA 1DEHA 1NQAO 2EW2A 5COAA 3A1NA 3S55A 4MIEA 4XIJA 3GEDA 2YJZA 1UP4A 4EITA 3WGOA 3EMKA 1Q0HA 3MTJA 5DN9A 4M86A 3WICA 4PN3A 4MKRA 1UXJA 4ZQEA 3F6YA 3QVSA 3PYMA 3JYQA 1X7HA 1I3KA 4NBWA 4R1SA 4NH4A 3FPCA 1NXQA 1A27A 5DOZA 4JROA 3DBHA 5U1PA 3FBTA 4M49A 4J9VA 4LCEA 1L7DA 3V1TC 5J23A 5DT9A 3T7EA 1TEHA 4E21A 3F47A 3KETA 2B37A 3DZBA 4IDAA 1K89A 1XYGA 2LDXA 2YV2A 1Q7GA 4L4XA 4MO2A 1ENOA 2P4HX 3L07A 4D44A 7ADHA 1ZK1A 2YV1A 4QTZA 1HEUA 1KVRA 2RH4A 4Q9NA 4M55A 3Q3CA 5TF4A 3K2BA 4Z3KA 4NBUA 3VH4A 5DOVA 2PK3A 4CMGA 4HXYA 1PZHA 5I7VA 3FPLA 3PHLA 3E5MA 4D46A 4H3VA 4CMKA 1FDWA 4J90A 3TZHA 1BHSA 4I5DA 2YUTA 1LNQA 5EQFA 2FPIA 1M66A 3GZNB 3IJPA 5L40A 1FK8A 2A9FA 2QHXA 4HY3A 4P4GA 4D45A 2CUKA 1YDWA 1RKXA 3X2EA 1HF3A 2FY8A 3DOCA 1AGNA 4Y6RA 1ENYA 4FCCA 2P5UA 4PLFA 2AG8A 2C07A 2WD7A 3A14A 3JQBC 1JAYA 1I01A 1ZJYA 1E5QA 3GEMA 3DFUA 3ZHZA 1U2DA 1E3JA 2D1YA 4E5MA 1EZ4A 2Z1NA 3L6DA 4HKTA 2QIOA 2VQ3A 4IJKA 3ROKA 2P68A 2AEJA 2B35A 3D7LA 4PG4A 4BKRA 4BIIA 3Q0EA 1WDMA 5L7TA 1XDWA 3RJ9A 4YDRA 5BSFA 4Z9XA 3L9WA 3QVOA 3OJ0A 4RL6A 5JNLA 2ZQZA 1GV0A 1PZEA 1U28A 1PGNA 2V65A 1QXSA 5FYDA 5TT0A 4AJKA 3GUYA 3JD2A 2YDYA 2O23A 1GUYA 3GAZA 2WD7B 1MLDA 4FQ8A 4AJ4A 2P2SA 2QX7A 4MOWA 5B4VA 1EFLA 2E4AA 1W4ZA 3AUTA 4XQGA 2X4GA 5JAQA 5L4NA 2A35A 3GVCA 1L7EA 3KSUA 4XR9A 4E33A 1JLLA 3PRJA 3ADPA 1H5QA 1LRJA 2YZ7A 1DJQA 4Q3EA 4BS9A 3GZ4A 3H9UA 1NX6A 2GZ2A 5F1OA 1ZFNA 2GN9A 1W6UA 1SEPA 5KOIA 2GYYA 4EJ0A 1QP8A 1DIGA 2FMUA 4CV2A 1HLDA 3O8QB 1CRWG 5LDHA 1ISGA 1DO8A 3CKYA 3I9OA 3MJVA 3R0IA 5COQA 2G0TA 1KIFA 2JD0A 4UEJA 1K6XA 1HYGA 2C7VA 1ZSYA 2BFOA 1VKNA 3K2EA 3VVCA 3DOJA 4I1IA 3ZWBA 2H6EA 1A72A 1ML3A 1R12A 3RU7A 2JFHA 5GZ1A 3CEAA 1MG0A 1QLJA 3QHAA 1W0CA 1Y5MA 2JFFA 4ROSA 1EVZA 3HN7A 3NGLA 4BNNA 4NPCA 4XQEA 4QFCA 4G2NA 2P9GA 1GAEO 3E03A 3KB6A 4JP2A 5JS6A 1DHTA 2R6JA 5CDGA 2HRZA 2VYNA 3AY3A 3JQGA 3U9LA 4TZKA 2Y1OA 4R9SA 4A10A 1HE5A 2OBNA 3LLVA 4RPJA 1PJ2A 3D5QA 2EIHA 3LK7A 1VSUA 3CIFA 4DMLA 1LDGA 3H2ZA 4J4BA 3S8MA 1KEVA 1DOHA 3AY6A 1FMCA 3RBZA 3WFJA 1KVSA 4ND4A 1Y9EA 3U0BA 4BB5A 4I08A 2HJRA 1YOVA 1Q1NA 5C7LO 1GZ4A 4B8WA 3TOZA 2ZQYA 1N92A 1U3WA 4NU6A 3UAGA 2DLDA 4OXKA 2IEDA 3OM9A 4KUGA 4RLHA 4ZN6A 3DONA 3NDRA 2V7PA 4FFLA 1J0XO 1E77A 1LRKA 4GKVA 1BDMA 4E6PA 1IOLA 3CSDA 4W9NC 3ZNOA 3JYNA 4GAEA 4IJVA 2J8ZA 5KVVA 4YPOA 2VWPA 4F46A 1EE2A 3Q1LA 1A7AA 3MTGA 2W2LD 4PG7A 3GZNA 3NAQA 1GPJA 3GFBA 3ULKA 1WP4A 4WLEA 4M87A 1DRUA 3NDJA 1DPGA 3FNHA 4RCVA 5THKA 3ZHBA 4OXNA 1GD1O 4YCAA 2XXBA 3O03A 2HDHA 1UZLA 2YFHA 4TMFA 4R54A 1Y8RB 3FWNA 3H9JA 5CAEA 5I8ZA 1GUFA 3ZU3A 1LSOA 3GOHA 1UJMA 2ZCVA 1AXEA 5FF9A 4WNCA 1EK5A 3WX0A 2PR2A 1A71A 1EMDA 3QVXA 4DBVO 3H2SA 2PGLA 1LI4A 5THQA 4UVHA 3ONDA 3ZWVA 5JSFA 1JU9A 1KC3A 1D7OA 3MCVA 1IY8A 3RROA 1SEVA 4JJGA 1HRDA 1BW9A 3NT4A 3ZZNA 4IMPA 3UCEA 1NWHA 4GLOA 2CSUA 3QV1A 4CQLA 2LDBA 4ITUA 2H1SA 3DHYA 3MJEA 4DLLA 3D1LA 2I67A 1P1FA 1PR3A 1BVRA 4OGWA 4RPGA 1M6WA 1QYDA 4LSMA 4RGBA 5KJEA 4WLVA 1H9AA 4Y6SA 1YDEA 1IUKA 3TF5A 1ZBQA 2CDBA 4XB1A 5HWSA 3I52A 3WBBA 1Y81A 3VKUA 2ZTUA 5C37A 2UV8A 2G82A 2AQKA 5DCUA 5DBIA 4DC0A 1YL6A 2R00A 4CJXA 3KOUA 1ZXBA 2OL4A 3ZDFA 2J3IA 1YVEI 4A27A 4E12A 2PH3A 4HUJA 2O3TA 1UAYA 1VE9A 2A4KA 4CLXA 2AE1A 3GDGA 3P7MA 4RPKA 2IDZA 3ZV3A 2J5KA 4NR0A 5CG2A 3EGOA 4UEOA 5IG2A 4Z9FA 4BKOA 4YXFA 5JC1A 4N5MA 1VLLA 3BMQA 2VZ8A 1SC6A 3V2HA 4A03A 4KTTE
chains in the Genus database with same CATH superfamily
4NS1A 1ESNA 1UCFA 2O1WA 4IINA 3DWIA 4IUYA 5LYJA 2WE8A 1E2JA 3ZYCA 3ETNA 2IH4A 1WZIA 3SR3A 2HPAA 3T3PB 1VHDA 1MO4A 3EGXA 3KVOA 3TVYA 1QFJA 3YASA 9LDTA 5IJ0B 1SCJA 1NDUA 9MHTA 3BE5A 1TJ3A 4ZI7F 2HJHA 5LBUA 1BH6A 4QJ5A 4MKZA 3RTGA 2B94A 4YMWA 2OHOA 2AN4A 2NPIA 4ECEA 3QLUA 3V7YA 4Q7KA 3PQ6A 4H16A 3LH5A 3C3EA 4OYRA 2OHIA 4MDFA 4HAUA 4L7VA 2WAXA 4PWZA 3Q8MA 4WKPA 3PWZA 3FNGA 5EZQA 2B9EA 2ZG6A 1PEKE 3FSJX 2VPQA 2ACWA 5A03A 3JWGA 2XUFA 4OPMA 3H4VA 1G8FA 3HZOA 2I3GA 4AK9A 3BHMA 1QZ3A 4QICA 2ZB4A 1IONA 5KTKA 4KB5A 2NZVG 4B7XA 1NRJB 3JQ9A 4H77A 2X4IA 2Z43A 2AJBA 3Q3GE 1OIWA 3R7LA 1BWPA 2PS3A 2WAAA 5BQ5A 3M83A 2D1FA 1KAHA 1YVDA 2DX7A 3WLOA 4N1AA 4KNYA 4L3VA 1RSZA 3ABIA 5KQRA 1G60A 1RLJA 5LM3A 1BX0A 4P3OA 5C7IO 4C4RA 2G3YA 3SMVA 1J0DA 1TCVA 5HZGA 2EATA 3UQYS 2O2JA 3BHJA 1CB7A 2WICA 2X86A 3RSSA 1HQCA 4MV7A 1SG0A 4D3YA 2NU9B 3SBXA 1UPUA 3AR5A 5L6MB 1CUCA 5MDHA 3GH1A 1WZCA 4M22A 3RUCA 5CD9A 1OLXA 5CFMA 2XDWA 2WSMA 3WP0A 1NY5A 2MJLA 4D0SA 1XZKA 1OBOA 1PSWA 1YB1A 2XYQA 4DUZB 1V7QA 2RONA 3JU3A 2XB9A 2RCYA 4MUMA 2VSQA 4KVGA 1Z5NA 2Q3EA 2AI2A 2Q8QA 4PTLA 1FSSA 5CG1A 2DSNA 1RD4A 3AM4A 3JVEA 1QF9A 3HDQA 3DMTA 4UJ5A 5HUHA 3O83A 2GO1A 4TM7A 1KI1A 4HH3C 2CCJA 1RXCA 5AXAA 1NP3A 4PEVA 2ZOSA 4YRDA 3TEMA 5L3ZA 3HVHA 3GC6A 1U1DA 1CR4A 1WCYA 3I9FA 4BQRA 2WPDA 4I1UA 2CFIA 3K1JA 1CFZA 1UT6A 4AFNA 3DMHA 2GPAA 1OB5A 4X1KB 1MH9A 4PZZA 3B9QA 1I3NA 1K66A 1CUDA 4DABA 2RB5A 1AZTA 3DXYA 4HD8A 4M99A 1KYYA 4C0KA 3SQWA 3UWPA 2AMYA 2E55A 2EC5A 3C7KA 3S70A 4B8ZA 1H4QA 2VQ6A 1GG5A 3KKEA 3IP1A 4B2PA 4FW9A 3ROXA 4WN9B 5KAPA 1EA7A 4AZ3B 4DVJA 4IIGA 3WS7A 4C6RA 3VU3A 4QNNA 3T4XA 2LKDA 2X8BA 1M7GA 2GM3A 2GZAA 1CRQA 1FMJA 4J07A 4QM7A 4LOJA 3LBHA 5KTPA 3TPCA 1DT5A 1RFGE 3E82A 2AMLA 1BVUA 1RZUA 1Z07A 3EGVA 4NFLA 4W7IA 2H11A 5G41A 3QSGA 3SMQA 4D9KA 1IEVA 2WFZA 2VPPA 1N32B 3INGA 1C50A 2QIPA 3VM6A 3BIWA 4D4KA 1XPOA 1IPHA 4UBNA 1VJ1A 2BISA 3NXKA 2F2TA 1WOMA 2NTNA 2H5LA 3KHKA 2OGSA 3MLBA 3N1UA 5D1NA 4OGFA 3P9PA 1GCAA 1R64A 3IDZA 4ZICA 1PG5A 4YP9A 1SIWA 2JJ1D 1K27A 2Z58A 3GLIA 5HJ7A 4E6EA 4FFNA 3K0CA 5BPFA 1YU6A 4DEVA 2FX5A 2XRYA 2G0AA 2ZJ1A 4C0BA 1G3QA 1QH1A 1KPHA 2AQIA 3T34A 4IKPA 4Y2UA 1U0SY 4C7XA 2QQEA 1RT9A 1DC5A 3EC7A 1C0LA 2ZYUX 3PFGA 3UGQA 3KCNA 3VNBA 2ZRMA 4PLCA 4NCXA 1LSJA 4QOEA 5EVJA 1TM5E 2IZ7A 1U3VA 1V25A 3N2ZB 3PGXA 2WILA 1CZRA 2HEIA 3B8HA 4PGAA 5AHKA 3C4JA 4QKQA 3AWIA 1CK4A 4BBAA 5JCPA 2BDUA 1U6IA 2FFBA 3WKBA 3VV2A 2DFPA 3DLIA 1EPUA 1F6BA 3GNSA 4Q4JA 1XNJA 2JAWA 4ROTA 5DMHA 4W5NA 3EWNA 1Q1GA 3MN1A 3UT0A 3M34A 5DLQC 5KUTA 3NMUF 1LTKA 5IULC 1ZKDA 1F5NA 2VEOA 5B30A 3GJ5A 2D2XA 4PPYA 1JT9A 4IYJA 4Y1RA 1AS0A 1U2RA 2FWAA 4IEIA 5DASA 1HT0A 4AF6A 5CFQA 1H4SA 1GA4A 1QE3A 2Y6VA 4MIOA 4PC6A 2ZIGA 4CM8B 5EHGA 1HT3A 2O5VA 1SOVA 3RDPA 4EVSA 1RVV1 1FX1A 1SPXA 4QBIA 4MWZA 2GBPA 4DEXA 3DEAA 1C3OA 2XVXA 2PTHA 2QX4A 3G9QA 3UF0A 4LJ6A 3BZWA 3ZE6A 4D74A 1FDTA 2IGTA 3IUBA 3TRFA 4JUDX 2WHXA 1NXWA 3SS7X 3G0CA 3MWLA 1FJXA 2CKDA 4E13A 4M38A 3IE2A 1B16A 1M1YE 1WO8A 1YNSA 4IRMA 3TMKA 1FNCA 4ZT2A 4E2XA 3LBAA 2H85A 2AR0A 5TE9A 5BW5A 4IXDA 4OHXA 1X70A 2MMCA 2PKXA 1P7YA 4M1TA 5JECA 1PD0A 2FP4A 4C0LA 4WASA 1ELOA 4JC4A 1RCUA 1HLPA 1TA9A 1ISPA 1Z2CA 4EHLA 2GEVA 2PQMA 5BNIA 2IYQA 4KQWA 1ZMTA 2OA0A 2P5TB 4MYCA 3W9BA 3GFOA 4KACA 1RI1A 3DNMA 1NC1A 1M1NA 4ZCMA 1NW5A 3DPIA 5CW1A 2O20A 2B5VA 3W0LB 2VJOA 4OYYA 2BR4A 2A7QA 4MDHA 5ALJA 1NATA 2QE6A 2VBGA 2IYFA 4TTQA 4PYLA 1EAYA 1WL8A 2BHTA 2W0MA 4RFSA 1NQOA 1S9HA 2HMYB 2J3HA 2XVZA 3I6ZA 3HXOA 1T0UA 1Z0ZA 1JP7A 3D8UA 4QVGA 2GZDA 4K87A 3IP8A 4B3SB 1US8B 2B2CA 1GFSA 4L6AA 3FCEA 3BDAA 3S2UA 1CERA 1M1YB 3EXHA 3K0SA 2V3VA 4P3YA 3OWHA 1CDOA 4M1SA 2YWGA 4IM7A 2ODNA 2HLNA 4PVDA 3P0RA 4ZHSA 1G7CA 2V1XA 3SEZA 2F3PA 2BFFB 2G8LA 4X3PA 2ZQ5A 1OILA 4RDHA 1U1FA 2LIVA 1O08A 1W29A 2BGKA 4PX5A 4UDNA 5E1MA 4CFYA 4D56A 1NF9A 3ICVA 2VP5A 3LX4A 3NJ8A 2ATXA 3DYIA 2IH2A 1FRQA 2V6GA 1TYZA 4DBZA 4W8OA 2HWXA 3IUNA 4E3ZA 4JC5A 1IN1A 3TKAA 5JTTA 1TKAA 3FR8A 2EJVA 1LS1A 1G9TA 2PZGA 2XY4A 4XSGA 4C3VA 5TQ2B 1XRLA 1AV7A 5T4HA 1IN5A 3ABQB 1LVGA 3DZFA 1N7IA 3EA4A 3WB9A 3DKIA 3L5KA 4OSPA 1A9RA 5FUXA 4A92A 5K1ZA 4BGUA 1VHQA 4KYUA 1YUBA 4OL9A 4TYQA 3SZLA 2B4RO 2GFQA 2J7PA 3UKDA 2IH5A 3H1FA 1Y6GA 1NSYA 3HSYA 1YZKA 4RZUA 2QG4A 1IZ8A 1Z73A 5G1OA 1MGOA 3DE0X 4KDEA 2AOUA 3NQ41 4RVOA 4P34A 2OTCA 4F2DA 3ILYA 1YQUA 1NVFA 3ZWDA 3TZKA 4CUZA 1FLVA 1L3BA 2JIDA 1WJGA 3GG2A 1D9ZA 3KZCA 3RBAA 1QONA 1NUUA 3FWHA 1HMYA 4FYVA 1CNMA 2H59A 2XSZA 5A05A 3NHFA 5DYTA 4E2WA 5DWVA 5I3CA 3TDNA 1BU5A 2UU9B 3R5SA 4ZZ1A 3PSHA 5LJIA 5CMLA 1W9HA 2VDLB 3G0OA 1E89A 1YBVA 1ZH0A 3TIXB 4ETNA 3GLGA 4NE2A 3SLKA 2IS2A 1P6XA 2JFPA 1PHPA 1UBUS 3PCTA 3A2KA 4HDOB 5T41A 1K88A 1QGOA 3UICA 2J6HA 3PUZA 3WWCA 4GMDA 3I45A 4EHBA 3A1CA 1JSCA 1U9ZA 3OM0A 2VDRB 4Q1FA 5EYPA 2QMYA 2W43A 2DFTA 2X2EA 3EVBA 2D0OB 3HJCA 3I09A 5K51A 1RXWA 1FQWA 4K03A 4PYKA 2QN6A 2CL5A 4LHYA 4E30A 2Z08A 1NWCA 3NIGB 4I1VA 2QKYA 1M6YA 1P1JA 2FPWA 4TQAA 1VG1A 1EJ0A 5AWFC 3RRNA 2G76A 2TS1A 1KAMA 1NHGA 4PRZA 1I32A 1Y6RA 2PZKA 1X1DA 2WUDA 3UMCA 1A1SA 2J6IA 1RM4A 1A8HA 3G17A 8ADHA 4YIHA 1B8UA 3ESRA 3VU9A 4U00A 2XHEA 4E4YA 3T06B 2NUTA 4AQ7A 4QEDA 1L8LA 1UODA 2O5CA 3VTZA 4CKEB 3QKTA 4FOTA 2I03A 2JJ2D 5FBKA 4FE7A 1B8PA 2WV9A 3AIKA 4IQ0A 4HOYA 5CJPA 5E6RA 4IFEA 3UPTA 1LGYA 2W90A 4I4NA 4BJHB 4KITB 2XQJA 2CF6A 2J0EA 4KLZA 5BWBA 5IHXA 3TOVA 2W6PA 2XJ4A 2PU7A 4DRZA 3F5FA 5AVTA 1P4AA 4RDXA 4R5MA 3L5OA 3DDUA 2SKEA 2WD9A 3PTZA 3GLTA 1QH9A 1JJVA 1TMYA 3P5SA 5ALIA 3HRKA 4AULA 1IY9A 3GUCA 3AUJB 3KKZA 4FT4A 3DOOA 3HCOA 4PG6A 1GQSA 4KGDA 1E2LA 5CP8A 4WACA 3QU5A 3UK2A 4CTOA 2YKGA 3JR3A 3AP2A 1KC1A 2VUHB 1UDRA 3NB0A 1E1RD 1HOXA 4R0NA 2G36A 3USCS 5FUBA 5HKBA 3PT5A 2O2YA 3NT2A 5CA0B 1GSAA 1I7DA 4X20A 4GZ3A 1YSCA 4EBBA 1QCZA 2ZRLA 4GZ6A 4BMDA 1PT8A 1XFAA 3AZQA 3ADCA 1YE8A 2VJAA 1M2VB 3WGNA 1ZD5A 4NJMB 5KU7A 3PXUA 4K8OA 1VJGA 2XITA 3DJFA 5BV0A 3KJGA 4PQEA 4R2WA 3WIEA 5AW7A 1J1UA 2J5RA 3RU2A 4E7OA 3A6DA 4N0MA 3KAPA 1A4XA 3INRA 5CNKA 3UJ7A 2P77A 4CIVA 4CF7A 5CDTA 1YHYA 2BMJA 2B8JA 2VUUA 3HBNA 4G24A 1SRQA 4B83A 3RW9A 4EARA 4CLRA 3W2IA 1FS4A 2VJKA 3WYGA 3TIIA 4OU4A 1M5RA 4M54A 3IC5A 2OO5C 3LYAA 1JL3A 3PDWA 4MULA 4X1OA 5D3MA 2GXUA 2GK4A 3RTDA 3ZBUA 4ZOLB 4K9RA 3GEIA 3DQQA 1P7WA 1Y8QA 2A0YA 4GYWA 3QOFA 5TX7A 3ONFA 2CXXA 4UHDA 1QIMA 5DTMA 3I83A 4DIKA 4W7SA 2Y1CA 5H70A 3PS9A 4JI1B 1Z2PX 3BKWA 3CB2A 2ZETA 1XMQB 2NVWA 4XPZA 4Q7MB 3P4YA 3QHPA 1BXRB 4MV3A 3BS4A 5E3JA 4FJ1A 1BX3A 4YQYA 3MUOA 2YMLA 4R2XA 2RHHA 1NVVR 5KC8A 3WK6A 3K0FB 4DJAA 4RMNA 4WD3A 2ERCA 2HT6A 5EP3A 2J3EA 4IICA 5IBPA 2EL9A 4BMNA 4L74A 3KYJB 3CZQA 3RYIA 5KYNA 3FNQA 3AESB 2DPMA 1NLZA 1II9A 1HZZA 5B5SA 4PO1A 1KSJA 3O93A 3BG5A 2IZOA 3M1AA 2PD6A 2X58A 1YE5A 2AVDA 3KVNA 4YRLA 2OD7A 4IDHA 5DBFA 3KC2A 3C7DB 4OBWA 1R8QA 1B93A 1O94C 2XYVA 4IS3A 1ADJA 1UZNA 2IX9A 3IQFA 1SRRA 2JCBA 1YRHA 4BCBA 4LYAA 3T1HB 6ADHA 2ECKA 3EFOA 1UWVA 3HCAA 3LLCA 1GU1A 1QQAA 4TLMB 1AN0A 3G9TA 1MFPA 5D5HA 3E3OA 3W1WA 1T4MA 1HG1A 2I7DA 4UBLA 1XVAA 2FNAA 1E6UA 1VLVA 3MCTA 3WKCA 5JU6A 1DBPA 5JY6A 1P5ZB 2VOJA 1KQFA 4WHMA 2FX3A 1EFVA 3GPBA 4DMRA 1GTVA 4HB4A 1RXEA 2C96A 4TSKA 1C3OB 2YWJA 2Q3DA 3QZUA 2IUFA 5IW8A 3FZEA 5A3SA 4Q4AA 5T8KA 3UK6A 3X1XA 2PRJA 3A6LA 1RC0A 3MCWA 3GLFA 4FCTA 2UXCB 3PDIB 4ALJA 3GN2A 2ORED 2QM3A 2R1UA 2WUGA 3OO0A 1MFZA 1DFIA 1MPXA 2BONA 1JDBB 2I62A 3HHPA 3NORA 2HRRA 3KJIA 1PQPA 5G3YA 4O4IF 4YRSA 3HCFA 4IRXA 3PLAE 1QIGA 1XTKA 4UMEA 3Q8LA 2WHQA 1YJCA 2AZ4A 1L1FA 2Y9PB 3KXPA 1H22A 3LL4A 2RGXA 1IIRA 3ANTA 3PI6A 1P2SA 4FNOA 4WEOA 3Q5EA 3VPFA 3FLAA 4MQ4A 4AIRA 2GASA 4LJAA 2BFAA 4FSHA 1MMFB 4CMIB 1VKJA 3L18A 2RG7A 5FV4A 2XYRA 1ZICA 2YY6A 2OAGA 4QTXA 1HA3A 1E1NA 5EMJA 5A3JA 1V3VA 3FCAA 3IAS6 4U2BA 4TLBA 1SUSA 5TB5A 4CT0A 4YCCA 5LQUA 3ETEA 1QYVA 1KZGB 4IVRA 2J3LA 4AQDA 2ZIXB 2EDCA 3AB3A 2P6MA 4I3GA 4XRGA 1W94A 4D3SA 4QUDA 3LX6A 3T5AA 2F8SA 1LW6E 4HDMB 3QVMA 4YUXA 3OETA 4OI1A 2PUDA 2ASEA 2XRMA 3FOEC 2DFVA 2IEBA 2QQGA 5BRJA 4YT2A 3IQGX 1E3WA 4Q66C 1G5QA 4MQMA 3HFRA 3NRJA 4J8PA 3L2OB 5HOQA 2JAXA 1GKIA 1LQTA 1P4JA 4LNHA 4NTZA 5KSPA 2E3JA 4GOJA 4F3RA 5I7UA 4FJ2A 2MSWA 2R1TA 4HGPA 1VJCA 4ZVKA 3PXGA 4WY2A 3LFUA 1SUAA 3E58A 4PS1A 1GTRA 4O5AA 4IJ6A 1VA5A 4FDTA 4L22A 1U3GA 4QXQA 2I33A 2HU7A 5AKXA 1R0XA 3AUAA 4EFNA 2BM8A 2X1VA 4KH1A 4RU1A 3NWBA 3IT1A 2OB2A 4M88A 4UVDA 2QZSA 2CLLB 3DBRA 4JY7A 4X3CA 3D6HA 4LXGA 2VK2A 3LV8A 4KPUA 5FTKA 2Z3VA 1LLCA 9GPBA 3O7WA 1WOYA 4HB0A 4RZQA 1B8NA 1FS6A 1KBQA 3UWSA 2IVFA 3QJ5A 3OA2A 1CFJA 4PZCA 5HA5A 5IFLA 3COSA 3Q9LA 2JANA 3EXEB 3KKKA 4O0MA 4QGFA 3CNQS 3ZDRA 4ALMA 4EMBA 5BWMA 3W77A 1N9GB 2BMVA 2I76A 3CCCA 1IXKA 3X1YA 1OZAA 1W44A 3OZTA 3I04M 4IS2A 2AOUB 5HGXA 3ZIUA 3PZRA 1RLOA 3RIEA 1IAVA 1A8SA 3HNOA 4X8MA 3VVLA 4OU5A 4QOSA 3JAWB 2QXTA 2PD4A 1RQGA 4DE5A 5DM2A 1KL7A 1PS0A 2C29D 2OZVA 3A1UA 3AOGA 4J0HA 5REQA 1HQDA 3RYIB 4RTOA 5C53B 1MCZA 2JI9A 2P35A 4KDFA 5TY0A 4MS4B 5LZ8A 3RI3A 5E9JA 2A1UA 4WESA 2DBVO 1OH6A 2XDAA 4US2R 1QE0A 1U9IA 1JEDA 1TUBB 2HCBA 3FYUC 3U60B 4FMBB 3CC8A 4B34A 3QUSA 2CZGA 4B2YA 1U8XX 3DE4X 4L50A 4XW2A 5IP5A 3GCDA 3HWRA 4UBIA 3EEFA 4JDPA 4CKBA 2KYRA 2XE8A 2WHPA 1MJ5A 3D4OA 5EXXA 2EKLA 5JDCC 3AR9A 3BCSA 4P93A 4AS2A 4EYOA 2OAQ1 4OXYA 2COKA 3UG7A 5DNVA 4HNHA 4HFJA 2GPYA 3HB5X 1Q83A 2PKQO 1EVIA 1JJAA 4MV0A 1NVBA 4I50B 5BW6B 4P80A 4OL0A 4OP3A 1LJ8A 2EZ8A 2ZYAA 4I4TF 3WWZA 3AF1A 3D3EA 1O5OA 2WJ3A 4BN0A 1Z06A 1D04A 5B58C 4JFRA 4MR8B 3I5YA 1FFYA 1JA9A 1FP2A 2PKRA 3IALA 4ZO7A 5EHNA 1OH8A 1PYGA 3WY9A 1UM9B 3C14C 4W5QA 1SVLA 4GP9A 2AXPA 2GI4A 1C4XA 1LPNA 1MC1A 1DV2A 1CE8A 3KFLA 4LEIA 4FQ7A 4R68A 4LHSA 3PJGA 4ZAYA 5EA2A 1MA0A 2Y1KA 2D2EA 4IIJA 2NUAB 3LLSA 3UK0A 5LWHA 4UBKA 1DJLA 1E7SA 3B8EA 3SS9X 2R1ZA 4O1MA 4LHWA 2WJHA 3RQSA 4V0MA 4PLTA 2NXNA 3UTCA 3N6XA 3QLTA 4AICA 1VGVA 2V9PA 2AT1A 3GDHA 2FPUA 2ZTSA 3KJXA 1SUCA 2MSKA 2CXHA 5FOWA 3OQNA 2TECE 5IPFA 4L4SA 2Q5OA 1E9BA 1T4GA 3ENWA 2QD5A 3RS3A 4P0TA 3RS5A 1E60A 3JR7A 1C9KA 2A9PA 3I1IA 3PE3A 4I55A 4NFHA 3C97A 1VLQA 2W2XA 1GRRA 2IHJA 2XKBA 3GBSA 4W63A 2QRPA 3TI9A 5G2OA 1CQZA 1VJTA 3RRXA 4JXZA 1JYSA 3UM9A 4EF4A 1G20E 1IATA 3GT4A 4RY9A 3Q7PA 4CKBB 4IDDA 5AJVB 1K97A 1KJIA 4YYEA 1R6XA 3WYFA 3CZ4A 1E2GA 1W5FA 1ZS9A 3PR3A 5CX1B 1YBFA 4C2BA 2WYVA 4R8KA 4TUYF 5FWYB 2IOYA 2O2EA 2WABA 4JD5A 1Q2UA 1TQ8A 2YBEA 3VC2A 2Z1MA 5LKAA 4XUDA 4MS4A 4EKYA 1UXOA 5MN4A 3DULA 3PNLA 1RAGA 1U63A 3FDJA 2ZWIA 2VJQA 2EAUA 4GM0A 4RTSA 2AKAB 3FDIA 2MDTA 1Z88A 4DXHA 2HFJA 3RAGA 3SVLA 3PKIA 4P92A 4RM3A 2OKGA 4NYMR 3CPHA 1CUGA 1DAHA 1YH3A 1MH1A 2Y4OA 3EEIA 1EUCA 5BMVA 3B7PA 1CUFA 1NYQA 4II7A 1QP4A 4MVJA 4INZA 4C7JA 1RMTA 1VIYA 2MYPA 3OC6A 5EJAA 4MQEA 2V9CA 5B7PA 3R3VA 4YQZA 3R4VA 1RTKA 1DINA 1EFKA 4JXKA 3L4JA 5KYYA 5BQFA 3AG6A 2HRCA 3OEYA 4JNCA 3QPCA 2ZTVA 2QN7A 1S1CA 1HQKA 1QQTA 2JGDA 3FR7A 3O8LA 2GZHA 5H1YA 4UFPA 4JOQA 1YR7A 2XUZA 4JODA 4WECA 1XLTC 2WWYA 4KPUB 1LVUA 3Q2OA 3FWZA 4TTIA 4ZEWA 4DWVA 7REQB 1Y3BE 1JXMA 3KT8A 1E8NA 1EUDB 2O8BB 2XIQA 2I1WA 3EH1A 5EAIA 3HVRA 3EQZA 3BH7A 4PCUA 4YRJA 4YCSA 4N7BA 4HDNB 3HY4A 3UKOA 1S8OA 1NUPA 1KU6A 3GFPA 4MGYR 4MRSA 4AMZA 3SBOA 4BKPA 1V71A 1ZITA 4OI4A 1VJ0A 2ZYRA 4O4JB 1DEXA 2O9JA 2JCXA 3V8PA 3B7WA 4JIMA 1POXA 2DUJA 3PXCX 5AFSA 1BWSA 3GH3A 3DOUA 3U39A 3C5VA 3VHQA 5FBVB 3ODGA 1FP7A 1PUJA 4GYYA 1RCTE 2ZJ4A 3C0KA 4WINA 3QJGA 3OURA 4B35A 3V46A 3FDFA 4Q6WA 2DJ5A 4HZIA 2E1RA 3W3AA 1WLSA 3D7SA 2PMDA 3F98A 1N1DA 3JQ7B 3L8EA 1AUPA 2AZDA 3R3SA 2DC1A 4DQUA 4CEHB 2A0XA 3SGLA 2NYUA 3I05A 4HL6A 5JWOA 3B1FA 1U9YA 1TF2A 2ZU0C 2QF7A 3HJBA 1KHTA 1IQRA 1GNQA 2AUNA 1P81A 1RXYA 1QHNA 2PVCA 2YJ6A 5ALSA 3W78A 4CCWA 1R16A 2IELA 2JLRA 2ZRBA 3TH5A 3VTKA 5KOHA 1YAJA 3AEZA 4PGMA 1S6YA 1C3EA 1HYEA 1FYEA 1ZHFA 1YRBA 1L1EA 2OWEA 4N5NA 4EJSA 5LXTB 2WQ6A 4ZTBA 2EZ9A 1PDOA 1N8NA 2PL1A 2WEKA 5EUQB 5K2MA 5BORA 2JCYA 2PX5A 1WBDA 3T9BA 4F6RA 4IIJB 2ZRPA 5LIPA 3FNFA 4H08A 4M0FA 2ADMA 1BGVA 4FONA 4MVYA 4X63A 1U8FO 1KF0A 1R27A 5CUQA 2MCFA 4DLVA 2QBYA 5IKEA 2M98A 3JS5A 3BA1A 3O26A 5H5JA 3QW2A 3BCRA 3RS4A 1N7GA 1NUTA 2PIAA 3P2OA 2ZIWB 5LNK1 4TLEA 4FZ3A 3BRWD 5CU7A 5GONF 4UNNA 3EFBA 5F4ZA 2DKFA 3S44A 1RRCA 1MEEA 3T7AA 1DS6A 4CNBA 3UAWA 2ISSD 4MIYA 4N01A 1IN8A 5TS3A 1HT1E 1BJTA 4YAIA 1RYFA 1ZGHA 3GZTB 1LD3A 2IY9A 5E6SA 3WNQA 4LFBB 2MSLA 4NZNA 3DEHA 2K5UA 3DNPA 3MWFA 3IIMA 4N8EA 5B1YA 3RBVA 5KNBA 4G5FA 1XNGA 1GXSA 1NXOA 4G07A 3ZLTA 1WY5A 1FY2A 4R3WA 3KCQA 1GA1A 1E0DA 3X2SA 1EGHA 4D5EA 4F3NA 4E07A 3QX3A 3W5AA 4GE0A 2CKMA 1SUEA 1N6PA 1A4IA 4GBED 2VJMB 3GGSA 3IVGA 1U8UA 3KOZA 3OE1A 1JG7A 2ZXFA 4R01A 5A4DA 1EIZA 5BSEA 2DRIA 3Q88A 2X9QA 4HDAA 3SE0A 2D5AA 3H5TA 5LD2B 1OAOA 2GBGA 2I4RA 1NMZA 3EWIA 2IPOA 1MJHA 3JQDA 2Q49A 1JWAB 3QA9A 4JVMA 5HPYB 2LCQA 5SY4A 1NLUA 5EMLA 2I54A 2EGUA 2P9HA 3B3GA 3CLUD 1BFDA 1TKCA 1W75A 4IZHA 5T5QA 3BTUA 2BGJA 5A4MS 3M5CA 3I2HA 3DMDA 3KTAA 4YRCA 3RIYA 3WMFA 5ICSA 1BXRA 3WDKA 1OB2A 5CVEA 3ZHVA 3ONEA 2HBZA 3BIFA 4G84A 4QQ8A 1KDVA 4IYRA 4QUAA 2VP4A 4KBFA 3FG9A 3MRVA 1RI4A 2J9XB 2PEZA 2V7WA 3I2JA 1M1XB 5EIBD 3AI3A 3D7MA 3R09A 4CF5A 3LT0A 4KL8S 5HUQA 3BBPA 521PA 3AUUA 3KJFA 5B1DA 3BT7A 4K6KA 1H6AA 4PG5A 4X1IA 3IDOA 4F4DA 2HUPA 3L1KA 5A4KA 2D5CA 1ZO8A 2TMKA 5H16A 4KCGA 1F12A 4QYWA 1I1QB 3QA3E 1C0IA 4F38A 2QSYA 5DNDA 1ZEMA 3U6KA 2IYNA 1UBKS 3DAFA 1AGRA 3KQHA 2Q4EA 1PD1A 1OZFA 4NJOA 5AKZA 5JQGB 1BVHA 4NYIQ 4RBNA 2REXB 1L6RA 1U4OA 1XZFA 3M9LA 4NSNA 4JOSA 4UAUA 1OI7A 2WF5A 4ZANA 3IB6A 1AHIA 1BA2A 4JEIA 2C5SA 3GUUA 3PGLA 2O3SA 3GWGA 4BNDB 4BRUA 1DKOA 4O4HA 4ESVA 2V59A 2DFDA 5IX8A 3BL5A 2YNMC 4PC3A 2I2DA 3K0EA 1LQ2A 1V11B 4JZYA 4X44A 5J2TB 5CA0A 1EEHA 2EG9A 2PS1A 3D43A 5K4HA 1AQLA 4KZKA 3I4CA 3ESBA 4DDUA 3OO1A 4ZVMA 3UNXA 4J6FA 4TYWA 3IUPA 3SVZA 5FCDA 3U9TA 3AYZB 1M8FA 2IU6A 1U9IC 2OCYC 2WHEA 4DV2B 2CNKA 1T24A 4NHOA 5EI5A 2ZI9A 2HWKA 5FLYA 4C2AA 1L5MA 4RKYA 4F4HA 2FE1A 1KAQA 1E9AA 4EY3A 4YY3B 4EP1A 4MZXA 3E7DA 4M36A 3LHKA 1JA1A 4L51A 3SX4A 3K71B 2RHGB 5KOYA 5CB4B 2QTFA 1PHRA 2QWXA 3MWDB 2OV8A 4G8DA 2WAYA 2H92A 3ICQB 2QXYA 2P6RA 2ZJBA 3NU1A 4K6GA 4L8LA 3REGA 3NC4A 1VRCA 4EEXA 3ZXIA 3HI4A 3GGCA 1AQUA 3QHQA 1U2PA 3ETJA 1R5JA 4EB6A 1ISJA 1M83A 3RFTA 3REFA 1K5GA 2AB0A 3HFGA 2ZPTX 3D4PA 3V00A 3RSFA 3FAKA 3Q3EA 2GSWA 1DC3A 2XKAA 3BGIA 4ZPXA 1PJZA 2L2QA 5EXEA 3EF0A 3PP8A 4NCBA 3WRWA 3FB4A 1SFRA 4FBGA 3RRFA 3NOXA 3NZEA 1JDTA 3HCDA 4IW3B 1YS9A 3ES9A 3ZWXA 4WK4B 3CX8A 1MEJA 2A5GA 3S4YA 2GK7A 1GWNA 3E1SA 4MCJA 3A4VA 1JIXA 3UKJA 1YTLA 1KH2A 1XL1A 3QI2A 5FPHA 4PW0A 4DMUB 5BV2P 1I2DA 3S1SA 2X13A 2ZRGA 3ETGA 3IXLA 2PUAA 1O58A 1RI5A 2ZEJA 2VPZA 5JZOA 2DFKB 1DDGA 4J3JA 4HVCA 4IWXA 2BEKA 3LCCA 4L4UA 4M83A 4RH0A 2WKPA 4X1IB 5JXHA 3GELA 4PO3X 4RIEA 4PLHA 2OZPA 1MHTA 1XMXA 5JLAA 4AJOA 1XF9A 1OBHA 2WFAA 4YP1A 1YB6A 4RNCA 3ZPXA 2BBOA 3JQAA 3KOYA 3EJ6A 1DMRA 1NN3A 5EQJB 5BOSB 5HE8A 4YUVA 4I1SA 2HTEA 2V97A 4F5DA 1CQPA 2NZXA 4BV8A 1ACJA 3L4EA 4ZO4A 3LCJA 2VHXA 2YFQA 5CH5A 3EHEA 1WB9A 1LV7A 3CH5A 3EK2A 2VZ9A 3R3ZA 3RYFB 4GEGA 4QHYA 4YQFA 4MWBA 1ISFA 3A0RB 4B71A 3VPGA 4C3UA 3WHKA 2GNOA 3OY2A 3U9SA 3VZRA 4OEHA 4FOPA 1U8CB 3CSUA 1QG2A 3QEKA 1E2IA 1KFCB 2HMAA 2HIHA 4UFNA 2G71A 4I4TA 1DQSA 1HDRA 3CKKA 3U81A 5LB2A 1WZNA 3RWBA 5AM0A 4K1XA 2VNIA 4B3IA 2BM9A 3T7KA 4LX8A 3EXG2 1BX1A 2KJQA 2QK4A 1KFEB 3AC0A 4FFVA 5BMVF 1KWKA 3EEOA 1XTZA 4ZOLA 3F6CA 4QYSA 2PJZA 2O7QA 4KQ6A 4B17A 1C1DB 4Z1MD 3H04A 3E1KA 1D1QA 1TF7A 4WZAB 2VOEA 3EOAI 2CXNA 3VQTA 4PWYA 4LTNA 1ZVMA 4LSGA 5KQMA 2HBQA 3E9QA 3KXIA 3N2YA 4E4TA 2XMBA 3P26A 5AH0A 5GZ3A 4HSEA 2ZJFA 3VR1A 4DJDC 3F7TA 3FIJA 3NRBA 1SXJA 4CIWA 4XAQA 2B92A 4ZDWA 3DT6A 4CHTA 1N6OA 2OZLB 4YNBA 3GRFA 1ULBA 5KINB 2BKEA 1FRFS 3TNLA 4H0NA 3ISVA 1IZ7A 1PQYA 3I9LA 5AP9A 1F4LA 3PT9A 3MXTA 4D8WA 2C0CA 2JI6A 1KI9A 1KTVA 1R4NA 3FYCA 1SB9A 3DDNA 3KHUA 4C4XA 1QRUA 1DKMA 2PWBA 3TLGB 2BGTA 4XWKA 3N0WA 1OGYA 3OQBA 5JCJA 1L5FA 3AI2A 1IHOA 1UEXC 1VC2A 1GGNA 4DIEA 1K0FA 1TUGA 1JECA 2W00A 3KE8A 3N3AC 4WRRA 1I4TD 1ZIPA 2I65A 2CMKA 2GK6A 1I2CA 2IEAA 2YHSA 1CWUA 5EERA 1NUQA 4GI2A 5A6SB 3WB1A 3B78A 4XKJA 1PUXA 2R7MA 1H2EA 5JATA 4C0WA 3L8FA 4EM6A 4MS1A 2VWQA 4BVFA 1QDUA 2PAAA 1GUBA 2FP4B 4NQZA 1L7OA 2RAVA 3AY7A 3RC7A 1EDDA 2PLRA 3Q7EA 1U3DA 2M32A 3GI1A 4YI3A 5ALVA 3BXPA 3CR8A 3O4VA 3DZCA 4DQXA 1L4GA 2GD6A 2QM8A 4OBEA 1GTZA 1XELA 4G37A 2D7CA 4L9SA 4TV8A 4B6EA 1JDVA 1UAGA 1I4LD 4HG2A 4PV7A 5FQNA 1BKYA 4PAGA 3E84A 2AC4A 1O95A 2DWPA 1J42A 2RC6A 2X7HA 1VI6A 3BGDA 3GLUA 4L6CA 4NOMA 4JI8B 1H3NA 1ZMBA 4UNQA 4AURA 2BTQB 4RFLA 5A0TA 2OYSA 4B4UA 4CV0A 2HSZA 1G8KA 2ENUA 3SDBA 1BCRB 3C3XA 5P8WA 5KTTA 4QWMA 3KEMA 4A1OA 3T3DA 1JFFB 1IBSA 3E0QA 3EZLA 1N2OA 5GJCA 4YJ2A 2WSYB 4P1ZA 3V3TA 1DC6A 3LX8A 4A2PA 5I6DA 2FSIA 3A9WA 5IYZB 2FTKE 2GWHA 5F12A 1R4MA 3IKJA 1GTSA 1EP9A 2FMXA 5AR1A 1M6EX 3RD5A 2NADA 3UMVA 3W3ZB 3AEQA 4YV2A 2JH3A 2VLIA 4MVJH 3T7TA 2BKVA 2IPLA 1CYEA 4TRRA 3UUWA 1VLZA 4J0KA 1RMQA 3VZQA 2RBEA 3F5SA 4M9XA 2PXAA 5F9MA 1JG2A 3RVNA 1NFFA 1F2TA 1SKYB 3GAMA 5TPWB 3CEMA 3KJHA 1Y3DE 2ZWAA 4QBHA 2JIZA 3V6MA 1RDFA 3ZU5A 3BFPA 3UOGA 3CJRA 3CMMA 3VR4A 3MSXA 1QV7A 4G5XA 4RSMA 2YTZA 3D6JA 2IQIA 3GDFA 2P91A 5C1IA 4D96A 1V47A 2XW6A 5EGSA 3TVDA 4ENSA 2LTAA 1XXHB 2XYPA 3PCXA 1ISHA 2HAEA 4KV7A 2ZSEA 4L8GA 4ZVOA 2IUYA 2YHBA 2PBFA 1V39A 2B3DA 3RFXA 5F64A 3TSCA 1QK4A 4MUNA 3SIPA 1M5TA 2AI3A 5H81A 3VU8A 1WV1A 3KFVA 2H1IA 7AT1A 1G0NA 2BE9A 4UZSA 3FOBA 4NDAA 1A2BA 1DJOA 3T9EA 2V4MA 1NKSA 4ZODA 4YRKA 5CFPA 1Z6PA 4GKBA 1NJ1A 4KO1S 4Q48A 4CTKA 1IPEA 4F96A 1JUDA 4QE3A 5J40A 1UKYA 4JH0A 3DBVO 3OCUA 2A86A 3DWEX 2HK9A 3AIMA 4J4TA 4LZAA 5YASA 1ZEJA 3ZN2A 4PO8A 4WQMA 3JPYA 4DDVA 2AUTA 1FSZA 3BEDA 1SHKA 1VHLA 4L5IA 1JG1A 2VEDA 5TSDA 3N3BC 3QNMA 3WV4A 1VLJA 1KSHA 1D7AA 2YWFA 3O84A 1A7UA 3TJMA 1E2DA 2NOAA 3BRSA 4PXYA 2IEZA 9ABPA 5BSUA 4XYGA 4BNXA 2AN3A 4YK7A 3H9BA 3C7CB 3QIVA 1JEAA 4EL0A 3HL4A 5EJ2A 4WH0A 2AA3A 1N2XA 3DEZA 1SXHA 2HJWA 1MDBA 4N3BA 1ZNQO 2PBLA 5GP1A 3DUFA 5CEFA 4MUAA 5EMHA 5ENDA 5JT1A 3JRNA 1UM9A 2QLMA 3VOTA 1VB5A 3OE7A 3GDOA 2VH5R 4KQJA 4IDCA 3ZKWA 3EG9B 3PF8A 4WKNA 3T5TA 5BXQC 2X7XA 3MQ2A 2PJDA 4Q9DA 3WLPA 3ZHYA 1GGHA 3EZNA 4JI0B 3FYHA 4R2JA 4A7PA 2HB6A 3GLFE 1CQIA 3KM0A 1VM6A 4M53A 5B37A 3DAGA 2NU6B 3UMFA 4A2CA 4LDAA 5JC8A 3MJSA 1O8CA 3A31A 4G4GA 1R0KA 1S1MA 5IAKA 2H3EA 2JS7A 1QF7A 2V6BA 3C6KA 5L45A 1BO6A 1P6UA 4OB8A 4XQ0A 4L28A 4XWOA 3T5MA 1TJ4A 1Z5WA 2RHWA 2AZTA 2P75A 2Y1DA 1THZA 3B6MA 4GVPA 4MJ7A 1KS2A 2PFKA 1NI4B 1GNVA 1WVGA 2D5LA 4P54A 4BNIA 5C1DA 2W8BB 4YGXB 5EKTA 5IZ4A 2NIPA 3M8KA 4PFJA 1VG8A 4U8GA 1M34E 2VRCA 3BMOA 3U3JA 5L51A 2WMOB 4GBGA 3MOGA 4AKGA 3ZXXA 2ZI7A 2I2BA 2QLBA 3LHFA 3OOWA 3RKRA 1NMEA 3K5IA 2HNKA 4RWZA 3KQLA 5EUBA 1PU2A 1ZUNB 4W4TA 1T1EA 5U4XA 2VKQA 4LYDA 3HKCB 1ESDA 2VDWB 1X7YB 1MOPA 3E9CA 1WMEA 1XP5A 5ICCA 4OHUA 4LOHA 4PR0A 5THXA 2UAGA 5GOTA 3G0GA 5AW5A 4N0QA 4X00A 4C05A 2AI1A 4HEHA 2WUEA 4NFSA 2VHVA 4XM0A 5J3JA 2OV1A 1IMJA 5BN4A 4GKAA 3E23A 3OG9A 1EVJA 1LTHR 3DBOB 4YUWA 4MLPA 2YXPX 3LYHA 4AMBA 3RYHB 1OHHA 5HBGA 3S29A 4BLVA 1SJ9A 4GNRA 5A0VA 3NV7A 1PQWA 1C30A 4UU8A 4US1R 4JJFA 3GUVA 4JKOA 4KE6A 1N2CA 4QDZA 2NZYA 3L7CA 3QFSA 3NYIA 4MWEA 3SPXA 3VR2A 2JLVA 1Z26A 2P9QA 1P9LA 1NU8A 1MIHA 3NTRA 3CZCA 4DLYA 4WMLA 5KJCA 1M9NA 4YJ3B 5KDDA 2I4LA 4R4JA 5EZ5A 3JW8A 2AWNA 5IDWA 2DB3A 3IP9A 1KBOA 2WYWA 4LXQA 1S8FA 3KPYA 1F9AA 4E4RA 1R9NA 4IFBA 2YWRA 1DAOA 2HWWA 5KS2A 5F9FA 4IMJB 2W11A 5JJCA 3T94A 2PZ8A 4FINA 4RXUA 2OBYA 4BFXA 5ELXA 4OQFA 4DANA 1VL2A