4JX8A

Crystal structure of e.coli enoyl reductase in complex with nad and aea16
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of E.coli Enoyl Reductase in Complex with NAD and AEA16
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jx8A00
3MTJA 4RVUA 2GUGA 3EK2A 3LU1A 2QQ5A 2I76A 1I30A 1WVGA 4J0FA 1KOLA 3WG9A 1ZK0A 1E7MA 1AN9A 5G0UA 5I7VA 1U2DA 2DUWA 3FPCA 3KYCA 3VH2A 2D2IA 2YW9A 3WLFA 4EJ6A 4HY3A 3GK3A 2PLAA 3ADOA 3GF4A 4IQGA 1NM5A 2Y1DA 3ETEA 5T64A 4YAKA 5GMOA 1NPTO 1RYDA 4YRDA 1K89A 4U0KA 2WMDA 5IXSA 2Q2QA 1PSDA 2FHSA 3JQ7A 1I33A 2ZYAA 3I4CA 3OIFA 2HDHA 2H6EA 2WSBA 4W7HA 3AI1A 4BGIA 3M2TA 2VWPA 1ID1A 1GCOA 3PZBA 3WGGA 3DMTC 2YHIA 3GVHA 4YAGA 3JD3A 4FFMA 1PGPA 1GL3A 1HEUA 3I1JA 4UUOA 4OSOA 2BI7A 4L76A 4UVGA 3IUSA 5FYDA 3WJ7A 4LGVA 1ZSNA 5A4DA 1ZSYA 4R51A 1LX6A 1SZJG 1YH3A 3AUTA 3QWIA 4PLWA 1PL7A 4J91A 1MLDA 4ILKA 4BMNA 3JQDA 4WNIA 1R0KA 3GPDG 3QQPA 1I3KA 1ONPA 3CPSA 4GVXA 1H6DA 4DVJA 1UJMA 3LYLA 4I5EA 4MKZA 2X7HA 3RWBA 2VYND 4BO6A 4NR0A 1CJCA 4NI5A 4RVHA 3OA2A 1Y5MA 1WDKA 4XGNA 2VRCD 2AQHA 5IG2A 2OMEA 2Q2VA 4H3VA 3ZZNA 3VTFA 4IS3A 3RI3A 3KVOA 4GL4A 2NTJA 3H9UA 1LNQA 4TMFA 3V1TC 4YVFA 3BYZA 5F21A 4IBOA 5ES3A 2Y1FA 2YV3A 5G0WA 5J23A 2DBZA 1VM6A 2FSVA 3W4KA 1XLTA 2BGKA 4XA8A 4MP6A 1HF3A 1TT5A 5A9RA 4R41A 1KERA 1V3UA 2DT5A 3VDQA 1ZW1A 2QYSA 5JW6A 4UEJA 4PZEA 3AU8A 4DC0A 5A06A 1TT5B 4B4UA 3HDHA 3HFSA 2DVMA 4FOSA 4JJGA 4QUKA 4YTEA 1EBUA 5IN5A 4DIFA 1YB1A 3PDUA 4NBTA 3W6ZA 4AJEA 1LLDA 3D0OA 5JCJA 3F9IA 2VYVA 3VTZA 3PJFA 3LK7A 4J43A 2ZYDA 1PS0A 4PCVA 1LDNA 3GQVA 1OC2A 1R66A 1RJWA 4IM7A 1DXYA 2O7QA 1P0CA 1WNTA 3KLMX 4MVJM 3C7CB 3BMCB 1T2FA 4PLZA 1KS9A 2FR0A 5CPFA 3DBRA 4E2ZA 2QG4A 2NU9A 2AXQA 2AE1A 5JLAA 1PWXA 5I8WA 2VHZA 5F5LA 4OXYA 1YB4A 3C85A 1H6BA 1NQOA 1WDMA 3ONDA 4MVJA 3LLVA 4FJ1A 4XDYA 4I08A 3EMKA 4J1QA 1DO8A 1R4MB 4YJHB 4BB5A 1ZK3A 2QRJA 4ND1A 4LCEA 3WMWA 4IPTA 3P19A 3QVTA 4ESOA 1C1DA 4FQ8A 4BIIA 3KBOA 4B79A 9LDBA 5ENDA 4MVJP 1YWGO 3B1FA 4PIVA 5TSDA 4EBFA 3PYLA 1JKIA 1LA2A 1OZAA 2X5KO 4YJFB 1K0UA 3P2YA 5HM8A 1Z75A 3AOEA 5C7LO 2PGJA 1C3VA 1PQUA 1UDBA 5ILGA 5C7OO 2VUUA 2C2YA 2E82A 1KEWA 3DAFA 3GRPA 1O6ZA 3ZWBA 4DQVA 1AGNA 4OQZA 2VHYA 3HSKA 2B4TO 2G1UA 4ALKA 2NUAA 4ZICA 5JYEA 5B12A 1FDVA 3E5RA 3Q0EA 1LDGA 2I9PA 1EVJA 1F06A 2AE2A 1LLUA 4AJLA 1GTMA 2PZJA 2HK8A 3NRCA 5KNLA 1C1XB 4R1UA 2O3QA 4RF4A 4Z3DA 3RFVA 5TT1A 2FZWA 4O59O 5DP1A 3RU9A 4C7JA 4CMAA 2DC1A 3GZNA 3ANMA 1JAXA 5CDSA 3UN1A 4MVJG 5B4UA 5KCZA 4MOWA 3WGHA 1J5PA 4WASA 2AQIA 1G0NA 3QWBA 3RUEA 4XCVA 2DBQA 3NEPX 4BO5A 2Q1UA 5KWEA 5AXCA 2EV9A 4AJNA 3KOUA 1I36A 4CUZA 4TVBA 4DL9A 4LISA 5DCWA 1EK5A 3ZWYA 5A9SB 1WW8A 3DL2A 4BNNA 1ZCJA 5L9AA 4RVDA 1J6UA 1EVZA 1SEPA 4YT5A 2P5UA 2VRCA 4OXNA 4A10A 2PWZA 3PWKA 2AEJA 3A06A 3MZ0A 1IULA 1I32A 4J7CA 3WGTA 5JC8A 1IZ0A 3CE6A 4D3SA 4CL8A 1N8KA 3EY4A 3ZHYA 1E3WB 4D0SA 2XXBA 4W9NC 2BFOA 4CM4A 1FDTA 2GF2A 1BDBA 4BKUA 4JX8A 4RORA 3BHIA 3NT2A 2W4QA 3TOXA 3FNFA 4PLTA 1DHTA 1KETA 3K5PA 3OECA 1ZEJA 4QQRA 4KP7A 5IDXA 1F12A 2UUPA 3AY7A 3M1LA 1UP7A 3A28A 1RM3A 3O26A 4NPCA 4CQMD 1GEGA 3ZW8A 5EPOA 2AA3A 2EW8A 4CUKA 1PU2A 4YXFA 1MXHA 2VNAA 4WLNA 2WYVA 4QT0A 1EUCA 4R54A 5L4NA 1H2BA 1YS4A 1JLLA 3E9NA 3S2FA 2CFCA 1EUDA 4JGBA 1IOLA 4G2NA 4J16A 4AVYA 3D4NA 3GUCA 3BTOA 3GEMA 5IFLA 4FJ2A 4XB2A 1BGVA 1TXGA 5AVOA 5I8ZA 3VPHA 1R16A 2ZCUA 4CM9A 4BO4A 4J3FA 3E18A 4UVEA 3QIVA 5F1KA 3ZWMA 5GY7A 4XYEA 4E21A 4N5LA 4K6FA 2AG8A 1P1RA 4DA9A 1OOEA 2LDXA 4UEOA 5JMWA 1Y5RA 3WGQA 4MJLA 1LU9A 4CLDA 2WD8A 1U3UA 1IPEA 1X1EA 2DBRA 5ADHA 4KOAA 3ROQA 3KYBA 1S6YA 2OORA 2YYYA 3QRWA 4CLRB 2W8ZA 4JROA 2UVDA 4EGFA 5U1PA 3NT4A 1YQGA 5CDGA 2UYYA 1O94A 3ZDFA 3MJTA 4ND4A 4EI2A 2XXJA 4XYBA 3TOZA 3ZWVA 4E31A 2FRDA 2HK9A 3OSUA 1DRVA 2PR2A 5DDIP 5HS6A 5A05A 3C7AA 4JBIA 4GGOA 3ZI0A 4P38A 5AOVA 1NFRA 5TF4A 2AG5A 4YDRA 3N58A 1A5ZA 2BGLA 1CEQA 1ENZA 1HYGA 1PX0A 2EXXA 1YOVB 2RH4A 1R12A 1GQYA 4U5QA 4E4YA 3H3JA 3JD0A 4OSPA 3IKVA 4CMGA 3NV9A 4J7XA 2CDBA 1RPNA 2R6JA 1YXMA 3KEQA 3VZSA 2X9VA 4FC6A 4CM1A 3RCBA 4CLHA 4A2CA 2GN9A 1TA4A 3DONA 2I67A 2JCXA 3NUGA 1DHRA 3KYDA 4Y67A 1L7EA 2UUOA 2HMTA 2J3KA 3OJOA 1ML3A 3E1KA 1DRWA 1SC6A 3MOIA 7MDHA 1K6IA 3RFTA 1D3AA 5JDCA 3P5SA 5U4QA 2GZ1A 2JAHA 6ADHA 3UGKA 3SJ7A 3LC1O 2E48A 1I2CA 3ZWNA 3JQBC 4LK3A 1IL0A 3JV7A 4IDFA 3VKVA 4BNZA 1JA9A 2UV8A 3DHNA 3BXXA 1A7AA 4RPJA 3DC2A 4X54A 4ZQEA 1U7HA 3VDRA 5HRUA 1H93A 1Q0QA 4YBZA 4WECA 3ZNOA 1TT7A 3AUAA 1EK6A 1H94A 1YL6A 3EW7A 1B8PA 1DBVO 2GZ3A 2PZKA 4WKGA 4FPXA 3LF1A 4XZ3A 4M1QA 3E9MA 1QP8A 3I9KA 1IZ9A 3AFNA 3W8EA 1T2AA 5I7SA 3M6IA 1LC0A 4CMEA 4EUHA 1GY8A 1HDZA 2CZCA 5CFZA 3ZN2A 5KVVA 4MVJI 2IEBA 4ID9A 3ZU3A 2RBEA 3QVOA 1U9JA 4IQ0A 4L4SA 1SNYA 4YJGB 4F45A 3FRJA 4JP3A 1GV1A 1DC3A 1DJQA 3FWZA 5T57A 4DRYA 1Y8RB 3EDMA 3I4FA 2BF7A 1LQTA 2WYWA 4U7WA 1P3DA 1UDCA 4GAEA 4WCFA 3JQFC 2R00A 4ZJUA 2FN7A 4I9UA 3CH6A 4ZN6A 3K31A 3GVIA 3C3XA 5B4VA 2IZ1A 3PHLA 2D59A 4Y6RA 3WLEA 4BNXA 5FEUA 1M6HA 2ZJ0A 3LSYA 4FR5A 4CMHA 1A27A 3TL2A 2HSDA 4DMLA 5TQVA 2YUTA 4W82A 4CMEC 3AW9A 2V6MA 3LT4A 1MC4A 3WDSA 1UXHA 3WJAA 3E6AA 3G0OA 4EUFA 4U8GA 4KWHA 3P2OA 3C1AA 3GFBA 2O48X 1W73A 3GRKA 4LMPA 4BHTA 1MUUA 5K9ZA 2H1SA 3V1YA 3DZKA 3IP3A 1SOVA 3FN4A 3IUPA 2V6BA 5HWSA 1JWBB 3AK4A 1WPQA 3DZHA 4XDZA 2OFPA 1LDMA 4IDEA 2QRLA 2I6TA 1V8BA 3GY0A 1DSSG 5EL0A 3ETGA 3GHHA 3X2EA 5JAMA 2VCYA 4B4WA 4JNKA 1PS8A 4CMIB 1B8UA 4EEZA 2Q1SA 4YJDA 4OJNA 3W6UA 1E1NA 3NYWA 5F1PA 2A4KA 3UAGA 3QWAA 3OJLA 3KO8A 3KTDA 3NT5A 4IDBA 2PKQP 2IYPA 3ZHZA 1HXHA 2P9CA 1P33A 4Z9XA 3RKUA 4CJXA 5GZ6A 5THKA 1K6XA 4TKLA 5EQDA 3WNQA 2DQ4A 3E82A 3ONEA 2FP4A 3F46A 4KTTE 4XYLA 3ZH2A 1LDEA 5KVQA 5JDIA 3JYLA 3PK0A 4G5HA 2C5AA 2XF8A 3OETA 4PG5A 2O23A 4UVIA 1L7DA 3I9NA 3JYNA 3TZHA 4UUPA 4J1SA 4GMGA 1P1IA 3GVPA 4BNYA 4TWRA 1WZEA 2IODA 3B70A 3RUIA 1CQIA 3FPLA 1JQBA 4Z0HO 1BVUA 1Z7BA 2VHVA 5L4SA 4RL6A 4D44A 3S2GA 1PJLA 3ZV4A 4CMJA 5KJ1A 1I10A 4RLHA 3SLKA 2FPPA 3WSWA 1V6AA 2JAPA 4TRNA 5DOVA 2AQ8A 3RU7A 4UVDA 5CPBA 3NDJA 1M2WA 3WWZA 5CDYA 5L51A 1PR3A 3QA9A 1P9LA 4L9RA 5IDYA 2VT2A 3VZQA 4A0SA 2DTXA 4KQXA 3L0DA 3D5QA 3PJEA 1UH5A 1C0KA 1XG5A 2J6IA 2OUIA 2BMAA 4GX0A 3FR7A 1M67A 4PVCA 1E7RA 3RC1A 1V35A 3IP1A 4MINA 3TPCA 4GMFA 3R3SA 5CG1A 4CV2A 3V2HA 5L4LA 1DEHA 4L0QA 4YJGA 5IZCA 4MVJE 4Z9FA 1J49A 1ARZA 1XU7A 1UXJA 5G0SA 2ZKLA 2B4QA 3BHJA 1DAOA 4DC1A 1U4OA 3WQQA 1DIGA 1KY4A 4TZTA 3MWDB 4KDFA 1E1MA 2A92A 3U9LA 2CNBA 1U8FO 2NU8A 1VSUA 4XB1A 3NAQA 1T4BA 1Y6JA 1Y81A 1UXKA 4BNVA 4BKQA 5CEJA 4D7AA 3DFZA 3KSDO 4UEKA 2B69A 5BNFA 4DUPA 1E5QA 1P1FA 1WMAA 1ZH8A 5BSEA 3QW2A 1B3RA 4FFLA 1YO6A 1HE2A 1B8VA 1LTHR 4CL3A 3K2EA 4B7UA 1T1SA 4DBVO 3SBOA 4AJ2A 1U3WA 2B83A 4BNFA 4ND5A 1U1IA 4AJ1A 4E5PA 1PEDA 4FFPA 4RZIA 3IAHA 4PLGA 4TZKA 1NXQA 2JKVA 1JVBA 2IEDA 4MIOA 5FFFA 4IY1A 1NNUA 4WEQA 3PGJA 3ZWPA 3W8DA 4J9VA 5A5EA 1H9AA 4CR7A 4K6CA 3QLJA 2GNAA 2V6FA 1WAMA 2YHIB 4XQGA 4AJJA 1R4NB 4URFA 4BUCA 3PWZA 5JPIA 5JYDA 3HNPA 2VHWA 3TZQA 1HE5A 3JYOA 3OA0A 5MGBA 1ENPA 4BNIA 4E13A 1UDAA 4YB8A 5FI3A 3LT2A 5FF9A 3K96A 2VNSA 3K92A 3QSGA 3KSUA 3PVZA 3HQ4O 3OH8A 4PN3A 4OQYA 1BG6A 4AJPA 4HFRA 2OOSA 1LXCA 3JCZA 4JIGA 1QYDA 1AHHA 5IDWA 5DOZA 1N5DA 3C1OA 2YV1A 4N5NA 1XYGA 2QZ9A 4KDEA 1JTVA 1NYTA 2EP5A 3BMNB 3RBXA 4IJUA 1XELA 3ICCA 1ONOA 5DCUA 3ASVA 1QV6A 1EQUA 3RAJA 2O3JA 1QRRA 1B26A 5EQFA 5U9CA 3RC7A 1W4ZA 4HWKA 5L95A 1HE3A 5JY1A 4Q3EA 1ZK4A 4XYMA 3GVXA 3F5SA 1HYEA 3MWEB 2Q1TA 4JCOA 4A03A 5COQA 4E12A 4IDAA 4YACA 2EGHA 4CLRA 1ISGA 4JLWA 3H9GA 5TLSA 4I9HA 2OBYA 1E3WA 4ND2A 1WLYA 3JD1A 4ZQHA 1PJ4A 4GH5A 3UKOA 2I99A 1E92A 4QTZA 3D4OA 4HNHA 1LDYA 3LC7O 2JCYA 4IUYA 5TRTA 3WFIA 4E5NA 5KVCA 2AQKA 3B1KA 3PHHA 2VN8A 4INAA 3JQAD 3RROA 3ZWCA 4BL5A 5I7FA 1Y1PA 5T5QA 3IOYA 5L7YA 5BR7A 1A4IA 1ZUD1 5KVSA 2VWQA 3D3WB 3G3EA 5THQA 3JQ9A 2IZ0A 2EJVA 4RPHA 3JYQA 2NU7A 3JSAA 2B0JA 5DT9A 1P44A 3D5TA 4LSWA 1P1KA 2ILTA 1HYHA 2E6UX 4CQLA 5ICSA 3R3JA 2Q3EA 5A9TA 5TIIA 1Y8QB 1PJQA 2NSDA 3H7AA 3GDOA 3GR6A 3H5RA 4HFNA 1VSVA 4OOFA 2DFDA 1N7GA 4WLUA 5HTOA 1HZZA 2NACA 4R1NA 1HSZA 4HXYA 1Z74A 3RUAA 5JDIC 4I5DA 4U6QA 3IL2A 1YJQA 3CEAA 2OL4A 2HMSA 2X1HA 1LSJA 4NK5A 3GG9A 2PY6A 3SEFA 4I5FA 1H5QA 4A26A 4IS2A 3CMMA 4DMMA 3EZLA 1GUFA 2GERA 1ADBA 1PZEA 4AICA 3GEGA 1DFIA 3GH3A 3Q3CA 3GMDA 1ZK1A 3RIHA 3NDIA 4CR8A 2DUUA 1JU9A 3F4LA 5JSFA 2X4GA 2Y67A 1E7WA 4KZPA 3WXBA 1QORA 1VE9A 4CQMA 2YV2A 1UR5A 1R4MA 1FMCA 1V3VA 4NHEA 4XYGA 1W6UA 1DC4A 4P8RA 3CZRA 4IMPA 5I7EA 1N9GB 1MGOA 1DB3A 3BAZA 5G4KB 4BO0A 4WCFC 4II3A 5B1YA 3ITKA 1B15A 3ZV3A 1R37A 3ZGYA 2H63A 4EDFA 4G81A 4FOOA 4DTIA 1BRMA 1EE9A 1R4NA 3OP4A 1MG0A 3WBBA 2CMDA 3A4VA 4CM9D 2PZLA 2CDAA 4PG8A 4U6SA 4ZRNA 3RJ5A 3KSZO 1E3JA 2C82A 2O4CA 5IN4A 1Y8RA 2X86A 4L4XA 3QWHA 4AFNA 1E5LA 4BMSA 2X0JA 3D4PA 3KLPX 4BNUA 3JQEA 3ULKA 1X7DA 5KIAA 3MEQA 4NQZA 4YRBA 4U0JA 4D41A 1OMOA 2ZB3A 1WP4A 3DHEA 3WICA 3ZNPA 3LF2A 3NGLA 4KUGA 1OI7A 5IAAA 1PZFA 1I3LA 5DP2A 3WGYA 4BGUA 5A3VA 3U4IA 4BNJA 4RDHA 4NBUA 2ZCVA 4ONEA 1YKFA 3E03A 2QRKA 1LUAA 3DBHA 2ZB7A 4AG3A 4E3ZA 3KEOA 4XJSA 3HDYA 3U09A 3CUKA 3L6DA 3Q2IA 3GT0A 2QX7A 3FI9A 4EZBA 3M1AA 1ZXBA 4K26A 2Q49A 3W1VA 2IZZA 4Y6SA 3GMSA 2WE8A 3DBRB 2PZMA 4IGFA 1VPDA 2EIHA 1O89A 3UVEA 1K3TA 3PI7A 1ONNA 4QEDA 3KETA 1NQTA 2ZTLA 2Y05A 3CIFA 4PG7A 4TRJA 1HDCA 2GN4A 3DOOA 3SC6A 3L6OO 1U28A 5JS6A 4J2HA 4CMBA 1PL6A 4WLOA 5DZSA 3UFXA 1B0AA 4DBZA 5BNIA 4P4GA 1LRJA 4QECA 1T2EA 3QJ5A 4PZCA 5T6BA 4CLEA 3GDGA 2GYYA 2WYUA 2J5KA 1N2SA 1MB4A 4R1SA 2DPHA 1PL8A 4HFJA 2PGLA 1HKUA 1MG5A 3PHGA 4YEDA 3OFSA 4FFNA 1ISMA 1F8GA 1ZK2A 2VUSA 3T4EA 4DPLA 3PFFA 3TFOA 2JD0A 4CM8B 1DPGA 4NBWA 4D3DA 4CPDA 4Z3KA 2I66A 1M66A 2A9FA 1QLJA 3OJFA 1I24A 3OQ1A 3I9LA 2NM0A 2GN6A 2DAPA 1R15A 3PYMA 4OM8A 1OAAA 1I0ZA 2CF6A 2H5LA 2VRBA 3DZBA 5CP8A 4HV4A 1S7CA 1M6WA 1HLDA 1X0XA 1H0KA 2OGUA 4IIUA 1NTOA 1XCBA 2BFPA 2O2YA 4I8XA 4YCAA 4UUMA 4CV0A 2F1KA 3VH3A 4P4LA 5L45A 3ZNNA 2O50A 2HJSA 4J7UA 4NK4A 3VPFA 2VTEA 4NMHA 3PQDA 3ROKA 3TRIA 3UOGA 3GVCA 1VJ0A 1EEHA 3G79A 4IJWA 3HG7A 2VQ3A 3STHA 3TF5A 4ALNA 5T8KC 1O95A 1DOHA 2HAEA 3PTZA 1SBYA 1O0SA 4XR4A 5C37A 3ANNA 1YONA 3VH1A 2Q99A 3GPIA 4GVLA 5JMPA 3WQRA 2Y1EA 1OFGA 4FSHA 4EUEA 5CDTA 1EVYA 3EVTA 4M49A 2B5WA 3CKYA 2QYTA 5G4KA 3ZNQA 1N9GA 2VZ0A 2F00A 3OEYA 4IJVA 1XDWA 2FOIA 1N7HA 3QVXA 3UW3A 1TI7A 4J4HA 3DHYA 4N18A 5ICMA 3ZHBA 3DZGA 3IC5A 2YQ4A 1B3BA 4PLFA 5COBA 2VUTA 1BXGA 1GZ6A 3V8BA 1LEHA 4OYRA 5DBFA 4EITA 1ISIA 1XEAA 1WWKA 4ZQBA 2LDBA 3L4BA 3HZZA 2PK3A 4M86A 4DYVA 3G1TA 2JL1A 4A73A 3D3WA 3DTTA 3M2PA 4L4RA 3SJUA 4AJHA 5T8KA 1E3SA 1PJCA 2JD1A 3UH1A 1NASA 3H9EO 1JDJA 3O8QA 2GZ2A 5IXYA 4GPD1 3QY9A 1PQPA 4NFYA 5KOIA 3VKUA 1HDRA 3O03A 4QFCA 1I3MA 2Y99A 1VLLA 4P4NA 4H16A 2D4AA 3GA0A 4DQXA 1HE4A 3DMTA 1UAYA 1NQAO 4O5OA 4B3JA 1LJ8A 3EGOA 5IJZA 2HO5A 4ALLA 1G1AA 4BKPA 5H83A 1E1LA 1F17A 4GGPA 1ZJYA 3FNEA 3KRTA 3DZIA 4JJIA 3Q2KA 2B36A 1XA0A 3JQ8B 4WCFB 1WMBA 1JKFA 4Z0PA 2VZ8A 4L75A 4WLEA 2NWQA 5CEFA 3K9QO 1SCUA 1SMKA 4OHUA 3JD2A 3QV1A 1HWYA 2YFHA 3AI2A 1GU7A 5JFOA 3FCOA 4NDNE 4GI2A 4EJ0A 4HX5A 3ONFA 4TSKA 3FSRA 1EVIA 5LDGA 4C7KA 1T1RA 4RPLA 1O5IA 1XSEA 1NHGA 3IJRA 1RYEA 3TFQA 4PFJA 2X0IA 4ZRMA 3U0BA 5JAZA 4HADA 4CM7A 1PZHA 5IDQA 5A3JA 1B14A 4BKOA 1NPDA 3C24A 3PJDA 5KJ6A 2TMGA 2HRBA 3PDJA 1H6AA 1UZLA 4G65A 2B5VA 5F1OA 3GG2A 1QYCA 4OAQA 1PGNA 4AJIA 3LT0A 3RBZA 3F6YA 3BMNA 1Q7CA 5KKAA 1SOWA 1Z82A 3GUYA 4R69A 5JAIA 4NU5A 2NVUA 4WGGA 4PGFA 1B2LA 1TB4A 2QZZA 4BNLA 2P91A 5ITVA 1X13A 2GSDA 3DMYA 4I9NA 4TKMA 5EJ2A 3S2EA 1ZFNA 1E3EA 3CXRA 5GZ1A 5JCJD 4YJFA 4F3YA 1EUZA 2EWMA 4EW6A 3PIIA 2CSUA 4HNGA 4KWIA 2BKAA 2C07A 1QLHA 2YDYA 5TX7A 1A9ZA 4OKNA 3A1NA 3CINA 3KXDA 1LLCA 1VL6A 5EIOA 1I5RA 1A7KA 2X0RA 3DO5A 1JWAB 4BO1A 4IZIA 4KUHA 1ZKMA 1E1KA 3BTSA 1PGOA 1PJTA 1I01A 2QHXA 4PZDA 5B37A 5I9NA 3V1UA 2HMWA 3ZU2A 4Q3BA 1LQUA 1E6WA 1I2BA 4A27A 3WFJA 2E4AA 4DLLA 5IZCC 4YR9A 2NTNA 1Q1NA 3MJSA 5HS4A 3H5NA 3WNVA 3BA1A 3AOEC 5L7WA 4TROA 3L4SO 2FPIA 3PP8A 3NTOA 1U5CA 1YOVA 4OKIA 1ORRA 1SO8A 3KZVA 1EDZA 1PGQA 1LC3A 3TSCA 1YL7A 2NU6A 4XGKA 5CEEA 2BHLA 4BGEA 3SXPA 4GX2A 5DNAA 4OO3A 2D1YA 1G0OA 5HBRA 5IZ4A 3WB9A 3ZCXA 2ZTMA 4Z9YA 3ORFA 3EYWA 3INRA 4HBGA 1LSSA 2X22A 4J90A 1M76A 4KMSA 4D79A 3CMCO 2BI8A 4LSMA 3KHUA 4Q3DA 3WIEA 4OOEA 1Q0LA 1ZSVA 5EINA 3BMOA 4NIMA 2IXBA 2EW2A 1WDLA 3DQPA 3FR8A 1YBAA 2D5AA 2I3GA 3AM3A 3HB5X 3HJAA 4LCJA 3TWOA 2WTBA 4MIYA 4CV1A 3I6IA 1SB8A 1GZ4A 4OL9A 4YT4A 2ZQYA 4JJFA 3T4XA 4BOYA 2G17A 3IMFA 3RQSA 3AM5A 1PJ3A 2HMUA 4RF2A 4HP8A 4BNKA 1LI4A 2C7VA 3E5MA 3AOGA 3JQ8A 4YT8A 5L40A 1HZJA 2X6TA 4B7XA 1GYPA 3DXFA 1PQWA 4W9NA 2WJPA 1GZ3A 2CUKA 3GHYA 2CF5A 4MKXA 4OH1A 1C0PA 1K2WA 1YB5A 3ICPA 1DC5A 3G17A 3Q9NA 2HK7A 1DAPA 1XWFA 2V7PA 1D4FA 4MVJF 3JQ7B 2PNFA 3JTMA 3BIOA 3F47A 3WIDA 1E3IA 3U3XA 2P9GA 2W2KB 5KJCA 3F5QA 1CYDA 3JQGA 3JQCA 2EEZA 3ST7A 1AXEA 4O0LA 1I8TA 4EEXA 3I6QA 5A1TA 4WOJA 2GLXA 5LDHA 3NX4A 5L7TA 4RF5A 2J3HA 2JFGA 3W4IA 3NJ8A 1FJHA 3P7MA 4R9RA 4YAEA 4WK6A 2OBNA 1EDOA 1XR3A 1EFLA 1QKIA 4J1NA 2Y0EA 4TRMA 1Q7BA 4CQMB 1A71A 1BSVA 1FDSA 2BELA 4L8VA 3GAZA 2DBVO 5A9SA 1BXGB 3PJGA 1E6UA 2A94A 3GAFA 3GDFA 4WEOA 3ON5A 2YQ5A 3BMQB 4BMVA 3WQSB 3H5AA 4MVJD 4R16A 1BHSA 3C1TA 5C7IO 2Q2WA 3B20A 4JBHA 5DN9A 1HDXA 1KEPA 2X8LA 2GN8A 4YAIA 1DFHA 2X58A 3WOHA 4ALMA 1AXGA 3AFMA 1JN0A 4CMKA 1F14A 5EERA 1ULUA 3EUWA 3F3SA 3H2ZA 2QW8A 2Q4BA 2DPGA 4Q9NA 1E7YA 2X9NA 2XPCA 2V6GA 2Y93A 5DBIA 1BXKA 2WD7A 2PA3A 5H82A 1KVTA 4WUVA 4MP3A 3R1IA 1NVMB 2GD1O 3MJVA 4JN6B 5AQ1A 2BFMA 1BDMA 4W99A 4XWYA 1NAHA 1GUZA 1X14A 4CLOA 3NDRA 2NVBA 3KUXA 1NR7A 2FMUA 1KC3A 1YDWA 2ZIZA 1VJ1A 2HU2A 3X2FA 2VTDA 1X7HA 4FN4A 3TL3A 4AL4A 5BT9A 3I52A 1ENYA 2EJWA 4R4JA 4RJTA 8LDHA 4UREA 2HJRA 1AE1A 4XEHA 4PLHA 2YJZA 3JQFA 2VZ9A 4QO7A 1HSOA 3H6KA 2Q46A 1P74A 5TS3A 1E77A 2GRAA 4IQ8A 4ZU3A 1PIWA 1KEUA 2C20A 1ZO8A 2IE0A 3H4VA 3O4RA 2O4UX 2Y66A 1VL0A 3OIDA 4QFDA 3AUUA 5ER9A 2R2GA 3HN7A 1GV0A 2I5PO 2W2KA 2B37A 2P9EA 4XR9A 3PQEA 1RM0A 4E0BA 3CZMA 3VVCA 3GFGA 3FBGA 3JQAA 4WNCA 4RV9A 3B6ZA 1CDOA 1UP6A 5EN4A 2OXIA 5JDCC 2A35A 3RUCA 4BS9A 4DYDA 1T2CA 5G2OA 3WYCA 1U5AA 3AUSA 4YQZA 4YT2A 4WLFA 1HT0A 2Z1MA 3BTUA 3F4BA 4II2A 1XQ6A 2EF1A 4BO8A 4RPGA 1Z73A 2J5QA 3L9XA 1NWHA 3H3FA 1HTBA 3I83A 4ZD6A 4XJTA 5K0ZA 4WJZA 3VVBA 4NJMA 1MX3A 4BO2A 5A5FA 3RUFA 2NV6A 2J3JA 4KUEA 2PD6A 1Z45A 3ZV6A 1P45A 2Z5LA 4GX5A 4BNMA 1LRLA 3MJCA 5MDHA 4RVSA 4ROSA 4XQCA 4J0EA 3H9JA 3INTA 4YWJA 1J4AA 4CM6A 3ROMA 6LDHA 2P2SA 3U5TA 1U4SA 4IIVA 2VWHA 4MKRA 4YAJA 3L6EA 2NADA 3KYDB 2HMVA 3O38A 5DCYA 1GEEA 5A03A 2D8AA 1HDYA 1N92A 2PFGA 3R6DA 1MA0A 4A5OA 5H81A 3INGA 4CMCA 1ZMOA 2EG9A 4BO9A 3E48A 4EJMA 3DEYX 3DBHB 2Y1GA 2X0NA 2HCTA 3OIGA 3EAGA 4N54A 3NJ4A 2WWRA 3B1JA 3PHJA 1GR0A 2NQ8A 3ETDA 4MPDA 2C2XA 3JD4A 5JNLA 3TDKA 2RAFA 5K6AC 1EBFA 2G5CA 4DREA 3Q1LA 4GSKA 1KVSA 3E9QA 4BQPA 4D46A 3ITDA 5ITWA 1EMDA 4TQGA 1MC5A 1RWBA 4AJ4A 1Y7TA 1LDBA 3ZWOA 5BQFA 4GLLA 2R00C 4B3IA 1TEHA 2O3TA 1UXIA 4UAGA 4M89A 3WMXA 3CSDA 3GGOA 4FD3A 4H15A 3RASA 3HDJA 3WSVA 1K5HA 1BW9A 2EKPA 2EP7A 3JQ6A 5KKCA 2NTVA 4MVJH 3HN2A 1Q0HA 4PRLA 5LC1A 1B16A 1F8FA 1HL3A 3AM4A 3S1LA 2O7SA 3W8FA 1YBVA 4CLXA 1HLPA 3GN2A 4J4TA 4XGIA 3T7EA 1Z6ZA 4M55A 1Y9AA 3ZHXA 4K1LA 4DIOA 1GQ2A 4E30A 3A14A 1Q7GA 1A72A 2Q50A 2G76A 1QYVA 1CWUA 4M8SA 3UXYA 1XGKA 3WTCA 4CODB 1T4DA 2JFHA 2G0TA 2BLLA 3N74A 4GQAA 4LVUA 4F6LA 3WWYA 1VL8A 1R0LA 1IPFA 1T26A 3F1KA 1PJSA 1KC1A 1PGJA 4NG5A 4EYEA 4PLYA 1GCUA 3AI3A 1BWSA 3BMQA 4CQLB 3C8MA 4BB6A 1AHIA 4XRRA 2HQ1A 3ZWWA 2GGSA 4GKBA 4MDHA 4DGSA 4OIMA 1CERA 4UULA 4FIZA 1PJ2A 2BFAA 4E2YA 3AJRA 1D7OA 4NNJA 1KVQA 3GGGA 3NKLA 3OJ0A 2DTDA 1FF9A 4O63O 1D1TA 1E6EA 1ADFA 4R5MA 1SB9A 3SVTA 2CDCA 1ADGA 4E5YA 4HFMA 2FR8A 3O9ZA 5TJ9A 1VI2A 2ET6A 4W4TA 8ADHA 3OQ6A 4UVHA 4C4OA 5I9LA 2ZB4A 4NFHA 1C14A 3LLSA 3RUDA 5TNXA 5A04A 1HDGO 1P1JA 2XAAA 1VC2A 2UDPA 5TT0A 4IMRA 5JC1A 2ZQZA 1FDWA 3OJEA 4LW8A 1BXZA 4H7PA 1I3NA 2W98A 3ANLA 3C7DB 2EGGA 1PJBA 3O8QB 5JO0A 5JE8A 1IB6A 1NHWA 2ZTVA 4IINA 3HE3A 4B4OA 1OBFO 2ZJ1A 5TJHA 3HUDA 1O9BA 3V2GA 1QYXA 2VOJA 1LLQA 2C5EA 2X9GA 3JQBA 4O1MA 1KBZA 3RUHA 4GSLA 4F6CA 4CR6A 3BMOB 3S2IA 7ADHA 3L77A 3VPSA 3DB2A 4B3HA 5G0TA 5IF3A 2EKQA 2Z1NA 2UAGA 2X5JO 4YRAA 4BNGA 4F46A 3I23A 3BZUA 5EESA 4YQYA 3UF0A 3LC2O 4ZHSA 4XKJA 3OEWA 5FWNA 1YL5A 3U49A 1IHYA 3GNSA 2O3SA 4W7IA 2V65A 1YQXA 4RF3A 1T25A 2D3TA 4QO8A 2FSSA 1XHLA 4XQ9A 4GWKA 1NX6A 2FZEA 2PD4A 3VC7A 1ZXLA 3IJPA 1YDEA 1DLJA 3D64A 5AXBA 5JO9A 1N1EA 4BNHA 3LZ6A 4HUJA 3D3EA 1Z7EA 3U4HA 1NVTA 1NFQA 2P5YA 1DLIA 2VYNA 3EC7A 2NLOA 1A9YA 2AMFA 1YQDA 3PXXA 2Y68A 4I5GA 2HUNA 3GZNB 2P68A 4MIEA 4E2WA 4IXWA 2CVZA 2NNLD 5KJEA 4YA6A 3FTPA 4D3FA 1NAIA 1KYQA 3ZU4A 3BMCA 1U7TA 1QYWA 3OBBA 1OC4A 4KQWA 2CVQA 1E7QA 2PKRA 1YRLA 1GQQA 2DU8A 1U2GA 3MOGA 2DM6A 1YJ8A 4CM3A 4E33A 1J0XO 2DLDA 1W8DA 1MV8A 1W0CA 4DIBA 4DQUA 1CQJA 3VZRA 1WXDA 3UICA 3DAGA 2AEMA 4D43A 1LBEA 3FNGA 3GGPA 3DOCA 3OF2A 4LMRA 4R01A 3ZW9A 5JY6A 3KV3O 2GASA 1UUFA 3RC9A 4IDGA 5JBIA 3K73O 2IRWA 2I65A 3DFUA 1JKJA 3HWRA 1ENOA 3R0IA 4FBGA 1D1SA 2NVUB 4BGVA 4PG6A 1D8AA 1FXSA 3FD8A 4R68A 4R3WA 3UCFA 5BSGA 1PZGA 2OHXA 2ZATA 4IDDA 4RDIA 3AU9A 1VRWA 4QXMA 4J6FA 4R9SA 1O8CA 3FTNA 3QP9A 5F3RA 2X5OA 1TLTA 4CM8A 1BVRA 4WE3A 3AY6A 3CTMA 4YPOA 4Q3NA 3HDQA 4N7RA 3K30A 3RJ9A 3S55A 4XIYA 3MTGA 3QE3A 1GYQA 1YVEI 4L74A 4CUJA 5GZ3A 3DZJA 1NVGA 2GPTA 5C3MA 4LRSB 2QIOA 4XQEA 4W6ZA 4FW8A 2W2LD 3TZKA 2WE7A 3G1UA 1X7GA 5HA5A 3PGXA 3F1LA 2O2SA 2WM3A 1Q2XA 3GNTA 9LDTA 1BTOA 2Q1WA 2IYOA 1XKQA 3U4CA 5LCXA 3WTBA 4BO3A 4PRKA 5COAA 4AJKA 3EVNA 3HFGA 3TNLA 4ZA2A 5G4LA 4Y6PA 1E0DA 4GX1A 4PLVA 4RZHA 4M87A 3GOHA 4ZQFA 5ILOA 2C54A 3NTRA 3ZWAA 2YDXA 4JK3A 4NU6A 3GLQA 3QWFA 4XX0A 2AW5A 2C29D 4LVCA 2C7GA 2EHDA 4R1TA 5L53A 3UCXA 3EHEA 1ZMTA 1ISHA 5KTKA 1CIVA 2OO5A 1UP4A 3FF4A 2W2LA 4ND3A 1Y9EA 1L1FA 4RGBA 4UUNA 4RLSA 3DDNA 2DTEA 3H65A 4DPMA 3U62A 2RIRA 3A9WA 3ABIA 2GDZA 1EE2A 2AEFA 3RVDA 4L73A 3KYCB 4J9UE 1SAYA 2C59A 1MFZA 5C5IA 1G6KA 1ZVMA 3UHAA 2B4RO 2E49A 3ASUA 4LN1A 1BMDA 4IGEA 3GN1A 1P0FA 4WLVA 4E5KA 2H9IA 4O6VA 2TMDA 3WBFA 1NBOA 1N1GA 1DC6A 4QX6A 4B8ZA 2RH8A 2JHGA 3MJ4A 2ZK7A 1HDOA 2NQTA 5CDUA 1VJTA 1IHXA 2P4QA 3ZV5A 2JCVA 4FDAA 1IYZA 2OZPA 2J5RA 3WX0A 1X1TA 1DIHA 5AXAA 5CHEA 3D1LA 3MJEA 2YFQA 2JFFA 4CV3A 3DR3A 3S8MA 1RM4A 1X0VA 2FPGA 4PVDA 2SCUA 1P31A 4TVOA 2WD7B 3VPXA 4Q3AA 3DZFA 3PPIA 2CD9A 3GEDA 3RC2A 2RHCA 3VZPA 1ADCA 1ZIDA 4IDCA 4P22A 1C0IA 1GYRA 2WDZA 2EERA 3Q11A 3H2SA 2Q4EA 2W90A 3VH4A 1VKOA 3WGOA 4B8WA 4JBGA 4FGSA 3VAZA 3DBLB 3LQFA 4E6PA 4I1IA 1IE3A 4RO0A 1V0JA 5EMHA 3PIDA 2HRZA 1XQ1A 2ZTUA 5T67A 4BO7A 3JQGB 4QSMA 4BNWA 2PGDA 1Y8QA 4DLAA 3V5NA 2VOEA 1R6DA 3BTVA 4R3NA 3GZ4A 4BV9A 3ENKA 4BV8A 1ZJZA 2NVWA 1RM5A 4FFOA 4JP2A 3WS7A 2CVOA 3ZWXA 1YGYA 3OM9A 1ZBQA 5FI5A 4PLPA 4LRTB 4XRGA 3OQBA 4K9DA 4XIJA 2DFVA 3PEFA 3U4DA 3OHSX 4D45A 2Y1OA 2FY8A 3KM0A 3PWSA 5JCXA 2OP0A 4NFSA 4Z6KA 5BNTA 4RCVA 1DRUA 3I3OA 3LVFO 3NTQA 4DPKA 3PLRA 1KIFA 1ULSA 4N5MA 1DIAA 4J2OA 4FB5A 3VOSA 2G82A 2BD0A 1GPDG 1R0SA 3LT1A 4MO2A 4WOKA 4GWGA 1WZIA 5AYVA 3Q6IA 1GAEO 1F0YA 5F5NA 2VT3A 1I2ZA 1LRKA 1GPJA 1MP0A 4M54A 3BHMA 3QVWA 2EKLA 4BKRA 4OMUA 1LSOA 5TGDA 2HLPA 3I9JA 1GD1O 3IKTA 1QMGA 4K28A 1GADO 1UAGA 1HRDA 1VKNA 4IJKA 1XU9A 2Y0CA 3PQFA 4XD2A 4NH4A 2PD3A 2YY7A 3PRJA 4RVGA 4AJOA 4JQCA 1GDHA 3EZYA 3FHLA 4HKTA 2VWGA 2DKNA 1QV7A 2BGMA 2C0CA 2O3UA 1ZEMA 2Y1CA 1DJNA 1NWCA 4FCCA 1AUPA 1A4UA 1M75A 4FJ0A 1E7SA 1CF2O 2FR1A 1CETA 4GLOA 4IXTA 3HADA 4KTVE 5JAQA 3L4BC 4WCDA 4Y98A 1DIBA 3UCEA 1NFFA 1NPYA 4DXHA 3L9WA 3DOJA 4Y9DA 1FDUA 2HKIA 5CAEA 5G0VA 1SPXA 3ENNA 2O3RA 2XOXA 5ER6A 3VHRA 1KY5A 3VPGA 2D5CA 4J1TA 3LDHA 3RFXA 1IUKA 5B4TA 1T24A 3ADPA 3GC6A 1C1DB 1DFGA 5KJFA 3WGIA 4TRRA 1H6CA 3V2UA 4ITUA 2B35A 2JHFA 3DTYA 4YJHA 4E32A 1BW9B 4E5MA 2OP1A 3T7CA 4BVAA 4PG4A 1UZMA 3DBVO 3TQHA 2RHRA 3FWNA 2I3AA 3PYXA 1QR6A 2GO1A 4D42A 1E3LA 3I5MA 2Y0DA 1PR9A 3JQ9C 4NBRA 3Q9UA 2P4HX 2BRUA 4NJOA 4ALIA 1JAYA 2PTGA 1KEVA 3PZRA 4D0RA 4ZVVA 1EQ2A 1ZNQO 1UZNA 2E37A 4GBJA 1C0LA 4YYZA 3GNQA 1PTJA 2PV7A 2WEKA 1V3TA 4R5HA 5I9MA 3HB4X 4J49A 4OXKA 1KVUA 3IQDB 2X23A 3COSA 3PFWO 3H9QA 3ROPA 3K6JA 4Z0TA 4FFRA 4RQTA 3TZ6A 1QSGA 1HETA 3L07A 1CRWG 1SEVA 4FGWA 4NZ9A 4ZQGA 3WYEA 3TZCA 1QG6A 1EFKA 2Q45A 3I9OA 3IS3A 1XIVA 4MP8A 2IXAA 2ZB8A 5JXWA 1ZZEA 3FBTA 1NR1A 1V9LA 4RPKA 3OMLA 1PWZA 1GUYA 4DWVA 1K6JA 4Y8VA 3WGZA 3E8XA 3DAPA 2J8ZA 3WYBA 2PH3A 2JD2A 5K6AA 4BNTA 2VHXA 3SX2A 1U3TA 5BSFA 1RKXA 1U3VA 3QVSA 4NJMB 3SLGA 3PLNA 1ISJA 1DDOA 4ALJA 2AHRA 4PLCA 2RCYA 4DLBA 3G49A 2FWMX 3H8VA 2YHUA 3DWFA 2POQX 4Q39A 3TJRA 1YBMA 3K2BA 2VYVD 3WR5A 4ZGWA 3I9MA 2JJYA 4CM4B 3JYPA 4B4VA 2ZYGA 3JQAB 2Z95A 4OGWA 3RD5A 1EZ4A 4B7CA 3N7UA 3W4JA 2GR9A 1B7GO 1H9BA 2YZ7A 5DBGA 4E2XA 3K8ZA 5BSHA 2IDZA 3UUWA 1PS9A 5DULA 3PHIA 3ZU5A 1KVRA 1H2HA 1JVSA 4NBVA 1GFSA 1MXFA 3RKRA 1MFPA 4J4BA 3RBVA 4Q3CA 4A7PA 1X15A 4WPGA 1T2DA 2CY0A 3DBLA 3KB6A 4RQUA 3MCVA 1YE3A 2PH5A 4GKVA 3HHPA 1NP3A 4S1VA 1QXSA 3NGXA 1TVEA 4FS3A 3IDSA 4JXKA 2GCGA 4BQRA 2BH9A 1ISFA 1JW9B 5DF1A 3SC4A 1NQ5A 1P1HA 1U8XX 4IZHA 3TN7A 4CLOB 2D0IA 3AWDA 5CG2A 1C1XA 3IIEA 3FNHA 5TC4A 3RSHA 1IY8A 5A02A 3AY3A 3OICA 3QHAA 1LSUA 4RVFA 5L3ZA 2J3IA 4CMIA 4CM5A 2PKQO 4FC7A 1UXGA 4S3MA 3D7LA 5AXDA 5ENVA 1P77A 1DIRA 1FK8A
chains in the Genus database with same CATH superfamily
4KB5A 5CFMA 5BRJA 4B75A 5B55A 2W2QA 2GUGA 1G8SA 3HL4A 2QQ5A 3MPOA 1QWOA 4C0HA 4BFTA 4EGQA 1P0IA 4Z86A 1NJGA 2I76A 1TTQB 5IK2D 2FWIA 1NKSA 2XKBA 2C4TA 1X7XA 3HBLA 1KOLA 2A9RA 2KE5A 1ZK0A 5JJ5A 1E7MA 1AN9A 2H2WA 4O4LA 2FR8C 2DUWA 3FPCA 1ZGZA 2D2IA 1GGKA 1GQRA 2F3RA 2EDAA 2N3ZA 2YW9A 3A3OA 4D57A 1RS0A 2HEIA 3KZNA 5BSWA 2N1BA 5JHGB 4MQEB 3RYHA 1NPTO 1RYDA 3KT8A 2ZZKA 4YRDA 2WMDA 4RL4A 5IXSA 2Q2QA 4KR6A 1ZR4A 2YR0A 1C1HA 4JGGA 3ZJ5A 4E3WA 2FHSA 3UMRA 3DUWA 3OJWA 4YBRA 3EDQA 2WG0A 2HDHA 5IEBA 5KYVA 4BGIA 4EY7A 2HIAA 3AUKA 1T1JA 2VWPA 1N5OX 3GJSA 2VF4X 4LMBA 3IAXA 4Y30A 4DLPA 5IK2A 4YAGA 2HHCA 3RGWS 2D3WA 4UUOA 1FYFA 2CXUA 3TW0A 5JXGA 3AJDA 2FJPA 4U7PB 4RFVA 2G83A 1ZSNA 4UD2A 5LYJF 1YH3A 3A1SA 2CK3D 4F6RA 1KSHA 3AUTA 1PL7A 4J91A 1B6RA 1XQXA 2FMXA 2PXHA 2C1ZA 3ME5A 4WNIA 1SH7A 2Q7DA 4TVSA 1XN1A 1U90A 3AZOA 4BBZA 3G2QA 4G5SA 5EJ6A 1OPXA 1ONPA 4GVXA 2CVFA 4KVAA 4TLCA 1SKBA 2VEDA 3LYLA 4JJ8A 3RWBA 2VYND 3EIOA 1HH4A 2HV8A 4NR0A 3U40A 4BRUA 1D2MA 2FETA 3H6HA 3QHQA 5A5VA 1IWBB 2ZR7A 4LHVA 4XGNA 1O95C 5KBYA 2IC5A 5IG2A 3ZTTA 1II0A 1JHQA 3HB0A 2HBQA 3RI3A 1QIFA 4BEJA 4KSCA 1G60A 2NTJA 3HKEB 4DLTA 3V1TC 5J1SB 4IBOA 5HPYB 2YV3A 5G0WA 3OKPA 2B25A 2I87A 3K1AA 5ESRA 2CE7A 4YNBA 1XLTA 2Z6UA 4OFWA 2M1ZA 1E61A 3HL0A 1U1EA 5T3UA 1Q11A 1V3UA 3H0KA 2RGNA 1ZW1A 2XCRB 2XCLA 3QYFA 1UBRS 3TTXA 4Q03A 1BWQA 3ZGLA 2C0QA 3SYKA 3WL7A 5DM70 4BJ1A 1CUBA 4DC0A 1NSTA 4ERXA 1I0IA 2AN5A 4IGIA 2GXUA 3QKTA 4XD7D 5H1YA 1XTRA 1WHSB 1QHSA 1EBUA 1XVAA 2P30A 4DIFA 1YB1A 2O8VA 1AGRA 2WV7A 3PDUA 5EKTA 3ZVNA 1TAHA 2DH6A 3GLRA 2VYVA 2EJBA 3PJFA 3FZEA 3LHDA 3K0FA 3B48A 3LK7A 5DN6D 1PS0A 2F3PA 2QVXX 2VF7A 3O5AA 1UFOA 2C3MA 2Q21A 4PCVA 5EVCA 4ZYUA 3KELA 1LDNA 1OC2A 4IDNA 3STTA 4C05A 3NAMA 3HFJA 4RS3A 3DUFB 3C7CB 3VO8A 1VYUA 4PLZA 2GRJA 1A50B 3IQZA 4DAEA 4A15A 1KS9A 2FR0A 3BZBA 3TLGA 5K3OA 1JKJB 1S89A 4E2ZA 4Y0VA 4CKXA 3OZTA 2WWHA 4MZDA 4HAYA 4AULA 3LD9A 3C85A 5H68A 2H7XA 4C4XA 3EF1A 1NQOA 3ONDA 3SEQA 1XQWA 4RGYA 4MMXB 4C7XA 4GU5A 2HSEA 3EMKA 2A1TR 4TX1A 4EA7A 4YJHB 3HP7A 4X1YA 4BB5A 3N2NA 3LDUA 1MNQA 1ZK3A 2HTFA 1V6CA 2QRJA 2XADA 3GUUA 3B3JA 3DDZX 3IDQA 4LCEA 4ND1A 4OVKA 3SX4A 1SKAA 4C0WA 5AUOB 4BIIA 2QG6A 1Q3TA 4S2UA 3ADCA 3U4GA 2AFIA 1Y4DE 2R4UA 4AF6A 3MILA 1JPJA 4CN8A 4EBFA 1Z0ZA 1AX9A 1EHIA 2XD4A 3VC3A 4JBWA 5ALMA 3RVMA 2GESA 5ILGA 4KVZA 3IHLA 2C2YA 2E82A 4KXNA 3BCUA 3ZWBA 3C3PA 4G97A 4X7MA 4HRVA 4JYBA 2QXYA 5PNTA 4FFBB 2G1UA 1I4EB 2NUAA 3PQCA 4IOMA 4FFSA 5TQJA 4TXMA 2CXRA 1P2SA 3Q0EA 2HU8A 2AE2A 3HGTA 3VNVA 1EB8A 1YCDA 4ZAGA 2CYBA 1C1XB 4C88A 2K87A 4YWHA 1WBDA 3SOZA 3RFVA 5LWQA 3Q98A 2IIPA 4KE7A 3KPUA 4O59O 5ARDA 4FDVA 4LY0A 4IO1A 2ZRLA 3ANMA 3U4QB 3H97A 1SOMA 1P5FA 4MWOA 3TLKA 1TC2A 2EW1A 2I3DA 3BB4A 5CLFA 5KCZA 3TJZA 1NMEA 2WFLB 3QWBA 1E1RD 3RUEA 1Z5VA 4L57A 5KNBA 1AKYA 1Z22A 5K4GA 2JZOA 3R7FA 2C88A 4MYDA 4AS3A 2RGBA 3KOUA 1J33A 2J08A 2WM8A 3W90A 1XMJA 4B80A 1Q7TA 4O2AB 4V39A 1EK5A 2W43A 1IBSA 1FMTA 5FBWB 1CY1A 3VM6A 3ZWYA 2HGZA 1K6MA 3GU3A 1WW8A 3DL2A 3LH5A 1GFIA 2JAQA 4DZTA 5L9AA 1I2AA 1K06A 4RVDA 1GTRA 2C7BA 2AL7A 3R3ZA 4NKRA 3ND9A 4ZU6X 1G3MA 2FGJA 1FFDA 3KFXA 1KZ6A 3S2SA 1KMCA 1C5KA 3RSZA 1XFDA 2AEJA 2PBFA 3ZZTA 1I32A 3V32A 4D3SA 1ODFA 4N8DA 4CL8A 2P1DA 4U9HS 3UXEA 1N8KA 3C3JA 4U00A 5ICCA 1T0IA 2W0SA 1E4EA 4I3GA 3RF6A 1BGXT 2GF2A 3DVRX 3MHTA 3WO0A 1G16A 4AZ0A 1RI2A 3I5XA 4HVAA 4RORA 4RZSA 2QRQA 3NTVA 3CLRD 3SZGA 1VCHA 1STOA 4OMFG 4OHZA 2ARKA 1IDN1 1JIUA 3M5DA 3S1AA 3HN6A 3HUUA 2UUPA 3M1LA 2BDTA 1I14A 5HW0A 2BMWA 3EUAA 2YS7A 1DX4A 1OJ7A 1SVMA 5H80A 5BOSB 2G6BA 3Q7TA 5F1YA 4EKIA 3EQ8A 5B7GA 3D81A 2B1IA 1ATZA 1M5TA 3JATB 5JTUA 4UDOA 1T2NA 1PU2A 2PYZA 4FOTA 5KAMA 2B2CA 5D5PA 1HOTA 4GECA 1NBMD 3GJXC 3VMMA 3AI7A 1EUCA 3CTPA 3M7IA 5FBHA 4EL0A 3L7KA 1H2BA 3VSEA 4C7BA 4QKQA 4UPEA 1LZLA 5L4NA 3S2FA 1U1FA 1NY5A 3U3KA 1L3BA 3P9XA 4KYIB 2QTVA 1RTKA 2I3BA 4FNGA 4PNZA 3HU5A 4CQJA 3E9RA 1QUEA 1E4EB 2I54A 3RODA 3DV0A 3GEMA 5DYIA 4DV1B 4JELA 4B85A 5AVOA 3VPHA 2ZCUA 1GUAA 2OQIA 3NJRA 4WXRA 1ZAKA 1W30A 1II8A 4KQ2A 3KYIB 2AK2A 4K6FA 1RXCA 1P1RA 2AG8A 2CFTA 4YROA 4ZAWA 5J4KA 3FTCA 3WGQA 1Q0RA 1XDZA 3HXLA 1G38A 1A7JA 1X1EA 2DBRA 2YXPX 1TLLA 2OZVA 1L5HA 3WB1A 4TS3A 4B3BA 1Z2PX 2A0KA 3C74A 5FUMA 1XMOB 1LQ2A 2E4WA 4OX9B 4Q1AA 2XT6A 5U1PA 2NXCA 1PZMA 4BX0A 1MENA 1RWPA 1B0ZA 1F4PA 2AOVA 3F9CA 3OCZA 2Z3ZA 3AIMA 4BZZA 2XXJA 1VKRA 4HS9A 5F4ZA 2IX3A 3ZWVA 2Q6KA 2RSLA 3WYNA 3X1ZA 1U3CA 2PR2A 3G5AA 5HS6A 3WLQA 1LB1B 1TZKA 1NQVA 3L8GA 3LUCA 2H1IA 4P36A 2JLAA 1WD7A 3E2PA 3M6UA 4IIEA 4P38A 4QTYA 1MB9A 5K0BA 1ZNXA 2WI8A 3I1FA 1CJTC 4KKXB 2XEDA 3II6X 3N58A 1WXFA 2O5EA 3N5CA 1NVXQ 4JLSA 5KHLB 1I4WA 2FPSA 1OLUA 1M8FA 1MB3A 2OB2A 5JU6A 4M8KA 3LL4A 1UADA 4P82A 3UAXA 4QNRA 2IYXA 5BN5A 5FBRB 4OHRA 3UK1A 3KEQA 1AXRA 2FQWA 4FC6A 1GIAA 3VI4B 4CM1A 1JTEA 2AXNA 4EP1A 1GN8A 1TA4A 3ABRB 4TYPA 1XPOA 3PWTA 1DAGA 4F56A 1BA3A 1IY0A 2C8VA 2YZMA 5LA6F 2JAXA 3K4PA 1QJ4A 1FXWA 4PNHA 2J3KA 2XXAB 1SC6A 4URUR 7MDHA 3S8EA 1FU4A 4I1PA 2PWAA 2D1QA 3FMVA 5JWRA 1LFDB 3F3MA 3TFWA 5KYUA 5FAXA 2CUTA 1L4EA 1WZNA 2CMFA 2JAHA 3RW9A 5LZ9A 3FMOB 3LC1O 1I2CA 1R7RA 4FYWA 3K09C 3ZWNA 1RLTA 4L15A 3DLTA 4S04A 4IHKA 3C87A 3ITEA 4L2IA 3MCAA 2VSQA 1Z2AA 1ONSA 1U31A 1JA9A 3BN3A 1OT3A 3TX6A 5AIBA 1SKMA 2GVNA 4UNIA 5LM3A 5K3CA 3G89A 4JVSB 4ZU1X 3UY4A 4YJ2A 1XJCA 2YC2C 2AD5A 3KOZA 4IGKA 1WMEA 4WECA 1BMFA 4GQBA 4UAJA 1NNSA 1EZ1A 4E5DA 3ZNOA 4DV5B 4IEEA 3OTHA 4RK6A 1EK6A 1H94A 2H2GA 3PR2B 2X2PA 1QP7A 2F62A 4FHDA 3NBKA 4AG5A 1U2QA 3D3JA 5BUSA 4MR8A 2WHYA 1Z12A 4D26A 2NO0A 3NIBA 3LF1A 5EUBA 4BQFA 4CETA 3E9MA 4G4SP 4QFDA 4YY3B 3MGBA 2ZITA 5B58T 1N3YA 1UFVA 5DIZA 1GY8A 4W5JA 2BTEA 4U7DA 2VJOA 3KZXA 4L3OA 1XLUA 5IYZF 2HHLA 4UTPA 5CFZA 3PE4A 3VBEA 3OCJA 2R7AA 2IEBA 1W0JD 2X6RA 1EUCB 1BWRA 3HEMA 4YLEA 3QIAA 4BV3A 2XYPA 3I5AA 3LKDA 1SNYA 3PDWA 2FRXA 5JRDS 1CRQA 3FRJA 2QV0A 1J42A 5F73A 1GV1A 3MT8A 2E9SA 4DRYA 2I4MA 4MUXA 3DHVA 3HMKA 1E6MA 2BF7A 4RMHA 1LQTA 2R6DA 1P3DA 1P2DA 3D6HA 3OTWA 4GAEA 4BFYA 3HABA 2IU0A 3WL5A 2LKDA 3JQFC 2HA0A 4ARBA 1I2MA 4XE5A 4CTKA 3ADBA 3GVIA 4JA2A 1X8JA 3QZUA 4TYWA 1Z28A 5KMGB 2O6HA 2A0XA 5E8JA 3DL4A 4NZZA 3GLHE 1JDPA 1NJ2A 4DCOA 3WLEA 1XQYA 5FEUA 4IIXA 2ZJ0A 3A27A 1IQUA 1SBIA 2YN2A 3DZ8A 4FR5A 4Q48A 5AJUA 1ZJ6A 2DE0X 3TL2A 4C3ZA 1KYYA 2NO7A 4DMLA 2HZBA 3JQPA 5TQVA 2DPXA 5BVGA 1KK0A 2V5AA 3AW9A 1N5JA 3RYHB 1UXHA 1YS1X 3E6AA 1DEKA 3KUKA 4MUFA 2FG6C 4A2QA 4EUFA 4FNOA 4KWHA 4AYTA 2ZM5A 1TIKA 4F0JA 4ZAXA 4ICIA 4YHBA 5M5BA 3STWA 3I12A 3GRKA 3N59A 4NE9A 1X70A 4BHTA 2C9ZA 1ICIA 2WUWE 5LFAA 4CKBA 1SOVA 4P4UA 1QDLB 2G4LA 1E9AA 1FUUA 1R0RE 1WO8A 1FDIA 2PZGA 5TMBA 1JWBB 5HWSA 1PW5A 4WZAE 5CTAA 3NYQA 3CA8A 3GY0A 5IMSA 2G88A 3GHHA 4KEAA 4RHUA 1KIMA 4LECA 4R6WA 1QCCA 4EEZA 1RYNA 1XPJA 1U3GA 2XUFA 1PKEA 4OJNA 3R9KA 3W6UA 4D0NA 2J0QA 3NYWA 3M5CA 4JUBA 4BE9A 1NJ6A 2PRSA 1SC1A 2WFMA 2OCPA 3HDTA 3QTBA 4IIJB 1WMDA 1GXSA 4DSNA 9GPBA 2AB0A 2QTTA 3THYA 1QGZA 1O6CA 2PM8A 1PN3A 1K88A 2Q0SA 1PLJA 2D06A 4N7JA 5BXYA 4Z9XA 4WJKB 2G5PA 3TE6A 3HA2A 3PUZA 4QRHA 2RD2A 1O0CA 5AVJA 1HNWB 5EJEA 4C29A 2V1XA 1AV6A 4QODA 4WK4B 3HCWA 3ONEA 3QJGA 3CNLA 3NV7A 1WIWA 3ZH2A 4J0CA 5JLJA 5JDIA 1CDDA 1JSLA 1G4AE 3LOPA 3IEXA 4NRDA 5F9MA 1J9ZA 1JYEA 2C5AA 5FUVA 3WWCA 1X1QA 4POOA 2QJWA 1L7XA 4PG5A 5EFZA 4JLOA 4RNCA 2O23A 4E88A 4EI7A 3I9NA 5JQGF 4HYTA 4UUPA 4J1SA 4QLAA 2VTKA 3DE7X 4E1BA 2IODA 3MUNA 3QBVA 1RZUA 1JQBA 3I6YA 2FCRA 2GN0A 3ENWA 3O1IC 3X2SA 3ZEAA 5BWLA 1K27A 1PJLA 2RHGB 2ZSKA 1SZDA 3ISTA 4O2LA 1W25A 4PCLA 2FPPA 3FCCA 2JAPA 3FPEA 2XNJA 4I55B 4LYJA 4X20B 4OK3A 3FJ1A 2ZJFA 1SU8A 1W1WA 3HI4A 3FTDA 5K6TA 3G9XA 1T3ZA 4AP6A 3QA9A 5E1OA 2PUGA 1GFWA 3NP7A 5G02A 2VT2A 4BQEA 2VEOA 4KQXA 1U0RA 3L0DA 1CUSA 2CXXA 1P6XA 1W5SA 4BN4A 2BKUA 1LWNA 2QMOA 1OYOA 1WV0A 3AINA 2W5UA 2I6QA 1VSQA 1WA5A 4RD2A 1C0KA 8MHTA 3TG8A 1SU4A 1TO2E 4LQ4A 2V55B 4DMGA 4GW3A 3EOAI 4EX6A 3ASYA 3ER9A 5I3ZA 5DASA 3RSQA 4P4SB 2XR1A 3KDPA 5DEOA 1V8PA 1DEHA 4BLUA 4HS4A 1JEYB 1OF1A 4LTDA 1ARZA 4XARA 2ZKLA 2B4QA 3AF6A 2L18A 5AOAA 1SZCA 3T1YB 2VQEB 5IFKA 4MGEA 1DIGA 2EZ8A 4D99A 4ABTA 2YJ5A 1LW7A 3MNFA 2WJ6A 2CNBA 1U8FO 2FMFA 4Q9AA 5GOZA 2IYQA 2RKOA 2JI9A 2JLCA 4X7RA 1T5BA 2Z6QA 4XB1A 3TVYA 2I4LA 1YRWA 2DBYA 2PBLA 4BNVA 5CX1A 2FMIA 4LXTA 3EDRA 3LP6A 2GBFA 2HD4A 4L50A 4E1AA 5CEJA 3P9NA 4RBNA 4WY2A 4DG8A 1BKYA 2X1VA 1SWWA 1KL7A 4FYVA 1GPH1 1DL5A 5CXQA 2CFRA 1O5TA 1S0UA 2OBXA 3K2QA 5BNFA 3IOEA 1GA6A 4DUPA 3SQWA 3H0EA 1M0WA 2GBLA 2ZE8A 1NBWB 4CL3A 4HDNA 1RYYA 2GKGA 2IUSA 4ZI7B 4E5PA 4TUYF 4BNFA 4AJ1A 5G1PA 3RANA 1TPYA 2XGGA 4RZIA 1ECLA 1PNTA 1IBLB 4X65B 4F04A 4H2DA 4PC3A 1VDMA 2VJMB 3ZZ0A 3I9FA 1PSZA 2CXSA 5A3RA 2CZQA 2H1CA 3G02A 5HKAA 4PZAA 2J6HA 2OC9A 2VH2A 1TGVA 3PGJA 3VKWA 3W8DA 4RK1A 1H9AA 5JFGA 3MRSA 4K6CA 2QLTA 2V6FA 4XQGA 4FCTA 3L43A 1Q14A 1ZU5A 4II7A 4Q1CA 4W63A 3PWZA 2ZLBA 2HDOA 3O4JA 5JYDA 2XYRA 5YASA 4RJJA 1ZJWA 2BZGA 1BRTA 2F4VB 4P35A 1U0BB 4QYWA 1ENPA 4BNIA 1UDAA 2FSHA 4UBJA 3NBZC 1RXWA 1OHHD 1SPBS 3SDSA 1RWQA 1JMYA 3OE7A 5KNDA 1TE2A 2H2FA 4OQYA 1BG6A 4KFUA 4Z9BA 5JJLA 4QPCA 3K0HA 1LXCA 1XZDA 3JCZA 1KK1A 4GF5A 2ZJ8A 4HAIA 1WZUA 1GL7A 1QYDA 1EUDB 5DOZA 2L2QA 1Y5LA 2XYVA 1G9TA 2YV1A 1KMMA 1XYGA 2PYIA 3C8UA 3HP1A 1JTVA 1NYTA 4IYJA 5L3QB 3A0UA 4JX9A 1XHEA 4LNUB 2FGKA 4ZOEA 5JSKA 4ZI5A 1R5BA 4GDFA 3IR5A 3OUTA 2K7ZA 3EZ9A 2QDXA 4NJEA 4UHDA 4CF5A 1HO3A 1Z5PA 1KMQA 4P4SA 1W59A 1AKMA 4C4SA 4EO4A 1B26A 2JLXA 1SQGA 1P9WA 1O57A 2P2GA 3K7EA 3PE3A 4KXQA 3PKJA 4Y2HA 5KYWA 2BEVA 1DUSA 1S8OA 4H3HB 5KAPA 3T7DA 2R1ZA 1P4JA 2PRYA 1W4ZA 3GBPA 1HE3A 2YOHA 2Q5HA 1D2AA 3P9KA 1J56A 5K99A 2JGDB 2H0QA 3GVXA 3AVYA 2Q1TA 3LECA 4A03A 1U5BA 1R10A 1ZNZA 2P4EA 3N6RA 3UJ7A 5A4IS 2WZDA 2LBPA 3DLAA 4IDAA 4YACA 4UTRA 3HXMA 4LV6A 1Z17A 4MR9B 1V5WA 3GFSA 1JXMA 1P4RA 2OBYA 4DCTA 4ZQHA 2EAUA 4WHMA 3WLRA 3DE4X 2IXGA 2J59A 1IUPA 3BWXA 4HNHA 4RY8A 3HYTA 2Z43A 1LDYA 3OZDA 4B84A 4IUYA 1G21E 3QNUA 5ALIA 3B1KA 4RAOA 1EQAA 1XKTA 3C1UA 2VN8A 4A8PA 1GRCA 1KH2A 1XKLA 1DO0A 1DP4A 4NZMA 3RROA 1KI4A 1GILA 1Y1PA 2G7ZA 2IK8A 4AO7A 5L7YA 3M4JA 2NO1A 1A4IA 1UPUA 1ZUD1 4FMCB 5DGCA 4TTTS 5BVHA 3D3WB 3G3EA 3UB2A 5JOQA 2ZXEA 5THQA 2IZ0A 4EPWA 1M1ZA 3QPCA 3M6FA 2ECQA 1UJ2A 4K0KB 4Q82A 2B0JA 3A6HA 3AHFA 5DT9A 2OVBA 2OO3A 4LSWA 1XZKA 1P1KA 2ILTA 4P9NA 1FUYB 4NCBA 1SCUB 5G41A 2C2MA 3A4YA 5KYNA 1HYHA 4NOLA 1X38A 4IL5A 5A9TA 3TCNA 1CDZA 1M2FA 2NSDA 4EW1A 4MUIA 3G88A 1UXOA 4QOEA 2JH8A 2KQUA 2DFDA 2R5FA 3WMEA 4ZYYA 1O3YA 4M0FA 4G5OA 1DIOB 1Z74A 1B23P 4RY0A 5JDIC 4L5JA 1DOZA 1YJQA 2CYCA 4TKUB 2ZR9A 2XQJA 4PYQA 4QVKA 2HMSA 3EHDA 1INLA 5LVAA 3Q10A 5AJVB 1G2QA 3P27A 4XUDA 3SEFA 1N77A 1NUTA 4IOJA 1YJAA 4Z4QA 2OSVA 2YZ2A 4PNEA 2R1TA 3AH8A 5CCBA 4PZPA 3G8DA 3WZ2A 1JQEA 1N6NA 2C4VA 3GQBA 4GUDA 1ADBA 2ZREA 3IHTA 3OMWA 4LNUA 4AICA 2AC7A 2CDNA 1VRCA 3Q3CA 1ZK1A 3D7SA 3P26A 4PYOA 5DW3A 3NDIA 4CKZA 3CIOA 3M3HA 3P97A 1FLAA 2VXBA 1VHJA 5L6LB 3HJTA 3FVTA 5HSGA 1COZA 1E2IA 1J99A 2YV2A 5IVKA 1UR5A 1TM4E 3AP3A 1R4MA 4JL8A 1JR2A 2EVWX 2OGTA 3FMPB 3HA5A 3QX9A 4NHEA 1MDBA 1DC4A 1V2GA 4XYGA 3QLUC 2GB4A 3ZCVA 4P58A 4G1CA 4AZWA 2BGJA 1DAMA 1QHFA 5F77A 3QF4A 5B1YA 4II3A 3CV3A 1B15A 1EE1A 1KJQA 3Q6NA 3WO1A 2QRZA 1KH1A 4W1QA 5GOTA 3PGMA 4EDFA 3EPHA 2VDRB 4MICA 1E0SA 4G81A 1ZM3A 4YI3A 1GKLA 1XCGB 4U2BA 5ADWA 4JYZA 4Q1VA 3QBEA 3EFBA 3O2JA 2NUPB 1M8GA 5ISMA 1YMUA 2CMDA 1YZYA 5DX8A 1X92A 2KHZA 3VNRA 2XRMA 3A25A 1Z18A 1JHMA 3CF6R 3DQZA 2APJA 3TNJA 3VR2A 1KNQA 4DB4A 1A9XB 1E3JA 3MQFA 1Y8RA 3MLEA 1TVCA 1EUQA 1YQ9A 1Q1BA 2GWHA 3RT9A 2QD2A 2WMOB 4BNUA 3EULA 3NHZA 3UJCA 1AQ6A 3JQEA 4L8FA 1VKHA 5I47A 4QM7A 3HGQA 4UHCA 2PKXA 3MEQA 4YRBA 4U0JA 2WTAA 3SU8A 2HJGA 1R6XA 3DHEA 3COJA 1XZCA 1E3MA 4XX0B 1R88A 1T9CA 1I3LA 3CW2A 4BGUA 4COKA 3JS5A 1JDUA 4RDHA 1PV4A 2V96A 1CF4A 2ZCVA 1JFVA 2I62A 1LUAA 3NVAA 1RHUA 1RFGE 3CRRA 4AG3A 1XYVA 1QGED 4CIBA 1RR6A 4DWOA 2IX9A 2R87A 4XJSA 2PLNA 1WVMA 3CUKA 3SQLA 4EZBA 3R4CA 1SD2A 1M2KA 1PYDA 1RAFA 4K26A 1O96B 4G0YA 2HHHB 4MXDA 2Z6AA 2A0YA 3OOYA 4C2TA 2PZMA 1T8UA 4HNSA 3DVLA 2Z3VA 3KU4A 1VPLA 4E03A 2FKAA 1BVYF 1WTAA 1MGPA 1SKUA 1Q0UA 2PS9A 3GJ3A 4REQA 1EWVA 2GN4A 3K6SA 3DOOA 1FIUA 4ZK6A 3LQ2A 4BUZA 3QVKA 4TN1A 1QIJA 4J2HA 3SQNA 5JZBA 1OHHA 4BP1A 1PL6A 1QO0A 1WV1A 1B0AA 2HF8A 5BNIA 1GGEA 1LRJA 1AF7A 4B6PA 1VHWA 4JEIA 3GDGA 1MJGM 1SIBE 4TUYA 2ZIVB 3SS7X 2J5KA 4LF5B 1DX9A 5HIIA 2WTNA 1A9RA 2ZI9A 3GJ4A 5KX5A 4X45A 4F5DA 1PI3A 1UKYA 1V1JA 4F8YA 4L8WB 3K5HA 2PGLA 1TVKB 3GXOA 3UKJA 2DWOA 1Y8CA 3SG0A 4EIWA 3OFSA 4KLAA 3PNLA 1NVKA 2OCYC 4A92A 1CR4A 3I9V6 3JAWB 2JD0A 3GA5A 4CU5A 1L3CA 3KEGA 4I1YA 2E4VA 2ZBFA 4E6EA 2P1RA 4BAZA 2FEWB 1MX9A 2I66A 1M66A 1U3FA 4CPDA 1EJ6A 4DCGA 1JEQA 4RA9B 1TM5E 4YDQA 1W19A 1DC8A 1TIBA 4LQLA 3PITA 2D1SA 1U8ZA 4HXFB 4F9EA 5DGDA 4HV4A 4TYNA 2JGIA 2VRBA 3DZBA 2W6OA 1GSAA 5CNKA 1M6WA 3HJHA 4K9RA 5DN6A 2PJUA 5HJ2A 4DJ5X 4IIUA 1HY3A 1NTOA 4KFTA 4TWJA 1CCWA 5J2TF 3FCXA 3H05A 5SZKB 4CF6A 4YGYA 3CR7A 1K3UB 1QR2A 2F1IA 5AKKA 3ZD9A 1O58A 2O50A 3PFGA 2IY8A 3G7SA 1BFDA 1PO7A 1THTA 3HY3A 1NZJA 4NEGA 4RHEA 3KZOA 3TRIA 1QDEA 4JUCA 2PX4A 3H99A 1EEHA 3CURA 4ZT5A 4AU1A 3C97A 4C30A 3I62A 1PR6A 1FJ2A 3N8DA 5BV1A 2DUNA 3PTZA 2WP8J 4UHFA 3IV7A 1CC1S 4XR4A 3ZIDA 4JV5B 6Q21A 4OQXA 1MO6A 1U04A 2I7TA 1RRKA 2ICAA 3VH1A 1I6LA 3WB2A 3GPIA 4DEYA 3GPBA 4OU4A 4PQEA 2IXDA 2XOKA 3G9ZA 3WK9A 2V1UA 2MT9A 3H04A 3LYHA 4R1MA 4EUEA 2GVDC 1VLHA 1EVYA 5IWAB 2OHFA 3FDXA 4G36A 2QYTA 3EC2A 3L1IA 3VSBA 1JDBC 2VZ0A 2ZRAA 3OEYA 5MHTA 1VCOA 1CS4C 1XDWA 2LXNA 3H5TA 3QVXA 3UW3A 4CT4B 5KNCA 2W71A 4G3XA 4RHXA 2PBRA 2V9CA 3F6PA 3A6EA 5CFPA 2QL9A 5ICMA 3ZHBA 3EXIB 4YRPA 3LYAA 1UDXA 3BJZA 3QENA 2CNLA 1T8WA 1GCIA 1LEHA 4OYRA 1SUCA 1ZGGA 2I9KA 1ISIA 3QPVA 2PX5A 4NE2A 2WWFA 2JFPA 3DV2A 4ZQBA 3V7YA 1P9RA 2RAVA 1CVIA 4IG4A 5BORA 2LUOA 2HNKA 3EBLA 4JQZA 4OATA 1JIIA 3SD7A 3Q87B 2LW7A 5AK0A 4RFSB 4M86A 4KNYA 1JBKA 4H1VA 4GBGA 3V00A 2DQZA 3W2GA 1EBBA 2E1RA 4A73A 1X42A 3DTTA 2ZSBA 1RT9A 2YIDA 4QEKA 1U6IA 3I0NA 5FNVB 1J8VA 2CW5A 1VOTA 1PJCA 4IOKA 3RJMA 1N0VC 1JLSA 4ILEA 5B1DA 2JEYA 1QAMA 2VXCA 3RVNA 1JDJA 3ZY3A 1QTQA 4JI8B 2GZ2A 3N76A 4DRXB 5IYZB 1FFWA 1U8AA 1PQPA 2IYUA 2O06A 1KGSA 1T9AA 1EFRD 2B98A 1QGYA 3DOHA 4ISBA 2FQXA 2JCBA 4KDRA 3TINA 2X41A 1R6BX 3I5YA 1RZRA 3FTFA 1CYEA 1JLRA 5KINB 1Z3IX 4DQXA 1XLVA 4A8HA 3G2JA 2OV3A 1YFZA 5M7EA 1NQAO 1P5RA 4PXYA 1T8YA 3ADKA 3ANSA 1OXTA 1LJ8A 3VZBA 3ESXA 3BSSA 5JBQA 2UVPA 3OE7D 2W6ZA 4CEIB 2BL4A 5H83A 1F17A 4GGPA 3IBFA 2RHDA 3FNEA 1AQIA 3KRTA 4G9BA 5BP7A 3E9DA 5EE1A 1XA0A 1NOIA 3GLGA 2W2PA 4HUQA 2P6RA 3MTIA 5CNJA 2P79A 3LCCA 4WCFB 4P31A 1I1OA 2G8LA 2QQGA 2AFVA 2AG0A 3CGWA 3G9UA 3Q7IA 1V37A 2CBZA 5CEFA 1N2ZA 4KR0A 2XUGA 2QYOA 4V24A 1U81A 3QV1A 3RU2A 1E9DA 3STXA 1HWYA 5K8IA 4WXMA 3AI2A 1NI5A 3LIIA 3UZUA 1F4LA 3IEUA 1XEFA 4IIFA 4V2UA 4EKDA 5BSMA 1PR5A 3KSAC 1VIDA 4BN0A 2NU6B 8OHMA 4TSKA 4Y2UA 3KXLA 3FSRA 2KM1A 4Q9HA 3BSFA 3O7WA 1KI2A 1R3DA 3ZZUA 5F7ZA 2XTAA 2X0IA 4U9UA 4ZRMA 3L1VA 1EYZA 2VP9A 5JAZA 1VCIA 3ERCA 4W5TA 5IDQA 3MN1A 2QN3A 1B14A 4BKOA 2AI3A 2GS9A 2QN7A 3R3WA 1ZVKA 1DO2A 2IYSA 2TS1A 3O8DA 1OB5A 4C7OA 3FOFC 4LAFA 5GJWC 5BURA 4OQ4A 4D3ZA 1RSZA 4ARUA 4YQFA 3N6XA 4G5XA 3QVMA 1G7CA 4XPZA 3E7WA 5EE9A 1QLWA 1DG3A 1TJ4A 4OXQA 4BXOB 3EXHB 2IYNA 1ULBA 1UMDB 1Z3CA 1PGNA 3PDCA 3MWLA 1JLHA 3Q7EA 4GI3A 4OJQA 4AK9A 1O5OA 4DCMA 1AO0A 4FXPA 2R5WA 3BMNA 3EZ7A 4HYEA 3L3BA 1YC2A 2BM0A 3UXMA 3VSDA 4R69A 2RAUA 2YBEA 4OHPA 4RV5A 5CDFE 5MFPA 4L2IB 3O4HA 5E3IA 4LRUA 2QZZA 4YPFA 1RC0A 3DMYA 4TKMA 2EFDB 1V9CA 1E3EA 4GFDA 4YJFA 5TS2A 4WZZA 1NQUA 3K35A 4INJA 2OB1A 2JLYA 2X76A 2C4HA 2FWBA 3FCUB 5A6SB 3RG2A 3RYFA 4B3GA 1EP2B 3CINA 4FZJA 4TL9A 1VL6A 2P27A 5LQMA 1QFSA 2R85A 3O95A 4OHVA 1JWAB 2NYRA 3ZDQA 4YLYA 1H22A 1QOQB 4XPIA 3V97A 5BVGB 5JSHA 2FEXA 2R1VA 4ZODA 5EYPB 1PJTA 1I01A 3FB1A 5TE9A 2BP7B 2UZ1A 2ZJ5A 4B46A 1E9FA 2CL6X 4Q3BA 1LQUA 3C48A 2ZRNA 2JGMA 2OZLA 2E4AA 3NBXX 1IN8A 1IRXA 1ZD5A 3IUBA 2ZUSA 4NG4A 4QNMA 4YJ3F 4YCSA 5B7NA 5WRFA 3OX1A 4K03A 5AHKA 4REOA 3QELA 3MJSA 3U26A 2J3EA 3FYSA 4KYVA 5AJWA 5EP1A 3AOEC 4TS4A 3OQPA 4JHLA 2WRZA 4DM7A 4NULA 1P5ZB 2DQSA 3NW9A 3PP8A 3BDVA 5BW4A 1YOVA 5HHTA 1BA2A 4QJBA 1X80B 4X61A 4OBBA 1CPYA 1GZ5A 1ORRA 2PH1A 1HBJA 1PEYA 4JXJA 1EDZA 2ZUVA 1XLTC 3I6ZA 1E32A 1PV2A 1E58A 1YL7A 1VYHA 4A82A 4B3FX 1HTWA 1CUAA 1QV9A 2BFCA 2PT6A 3UFXB 2VTBA 1E0AA 3L0OA 2WM2A 4PYMA 3T61A 1KFKB 4BGEA 4IDPA 1H1LB 1WUKS 3E4DA 2HJWA 4Z9YA 1GRVA 3ORFA 4ZOLB 4RIHA 4H1WA 5LQNA 4DF3A 3MB5A 1LSSA 1LNZA 1JT2A 2A5YB 1UEXC 1M76A 4LZOA 4Z1OA 1D2RA 3I28A 5ED0A 4HGQA 5GJBA 2QR5A 1Y6RA 4Q4DA 3CLSC 5CT9A 3O2NA 5DBHX 2OFFA 2EFCB 3U5ZB 4H9GA 3ACDA 4PAMA 2JLSA 1OVMA 1ZSVA 1PVVA 1C9JA 2VS1A 2YJ6A 3DD1A 3GIWA 3LKZA 2Q1YA 3DA8A 3WV4A 2EW2A 2FZCA 3DQPA 3FR8A 2D5AA 3HB5X 2PS1A 1G8AA 3INTA 3IUQA 4LCJA 1P2TA 5EJIA 3DDSA 8ATCA 1RVDA 1J1ZA 5C3UA 1R18A 2NAPA 4GNKA 5JZ9A 3T4XA 3X0DA 1G5TA 2JW5A 1E18A 2I6GA 5KB3A 3DULA 1TCAA 4W5OA 4QWWA 1Z37A 4RF2A 4HP8A 3KJHA 3I0ZA 2X6TA 5ANRB 3UAOA 4B7XA 4M3NA 3PUJA 3GLGB 1XZGA 1PQWA 3M3PA 1UK9A 2JFVA 4ENWA 3WLNA 2WJPA 2J0VA 4DYHA 1CP2A 1OFUX 5G3ZA 1YRHA 1RW4A 3AUFA 2B6NA 3ECSA 2FSGA 3LUHA 4YJ2F 1I94B 3G17A 4LXXA 5CFNA 2C3OA 5F7OA 3E5HA 3HV0A 2X1MA 2WJZB 3AVUA 2GHTA 3PICA 4M7PA 1K4KA 3WIDA 4MUYA 4TYQA 4R7TA 3U3XA 1JRLA 1K2VN 4HX9A 5ICEA 1D09A 2WKRA 3IH5A 3IGFA 3JQGA 4OQFA 3KQWA 1FFBA 1M2VB 2W42A 1Z7WA 3R5FA 2LZ0A 1HNXB 3IR7A 1QOPB 3I6QA 3MT9A 2GHIA 4WOJA 5BRNA 2RKBA 2GLXA 3C45A 3UHOA 2FJ0A 5IBQA 3G23A 3ZE8A 1PFYA 2AJLI 4MS3B 2J3HA 2JFGA 3X1KA 4E4RA 5K9ZA 3NJ8A 4Y0AA 1S4MA 2OHVA 3FKSA 3CVYA 2B92A 2GJKA 1BS2A 2ZWMA 5T4HA 4YAEA 4UBOA 3ET5A 4BAUA 2XLBA 3QVJA 5CD1A 2OBNA 5DGTA 5HF8A 2R9VA 3NHBA 4QYXA 2MOKA 1YZGA 3IPRA 2G4CA 2P40A 4AN0A 4C76A 1Q7BA 3LXUX 1A71A 2BELA 3SYLA 3IIMA 3BK2A 2CNOA 2VHQA 3JVEA 4HEA1 2CKMA 3LFTA 4QBKA 2XUOA 3REFA 1E6UA 2A94A 4WEOA 3GDFA 1DBSA 3ON5A 3SM9A 4ITVA 1Q0TA 1JFSA 1OUMA 4TLLB 3WQSB 3A3KA 3KLBA 1BHSA 1ELOA 3IQGX 4JC0A 4XI9A 1ULHA 1TJNA 5DN9A 1L4NA 2VBGA 4BO7A 3PC7A 2EWVA 2X8LA 4BZXA 2FFQA 3O8LA 4JLVA 5TF0A 1H8EA 3H84A 3ZKWB 2JZNA 3I61A 5BSTA 4YFYA 4ALMA 2X5NA 3RJTA 4MGIR 1ULUA 4JEHA 3WKAA 4DIUA 4UNQA 1F8YA 3KE9A 3NC1C 4Q9NA 1Z2NX 4UM5A 3DW1X 5FFNA 3ZD7A 1RAGA 5H82A 4YAWA 4ZV4A 1J2JA 1L7QA 4NMXB 3EY9A 1AU9A 2ZE7A 1ZD2P 2XEXA 2QLNA 4XWYA 1FS4A 1BS1A 5B3AA 1W4CA 3NDRA 4QTTB 4JJAA 4CLOA 4BWFB 3KBBA 4BB9A 3H2JA 1VJ1A 1E6CA 4C2AA 3MTEA 3T7RA 2XA1A 4ESEA 2NU7B 4FN4A 4OHBA 5GM1A 4XWOA 1M1YB 1K66A 3I52A 4EA9A 1VE5A 1ENYA 5CFOA 3LKVA 3A9VA 2HJRA 4HPWA 2AFHE 3Q5DA 1NIJA 1QNFA 4A0FA 2GZAA 2YJZA 5L3SA 1YZLA 1GNSA 3A26A 2J67A 3ER8A 1VPTA 2H4FA 3EISA 1XRLA 2O1EA 4NQRA 3TYXA 1XCJA 2P6NA 1BDIA 2ZAMA 4PE5B 5FI1B 3SI7A 1A76A 4RE6A 1Y1SA 2Y76A 5JZVA 3LXRA 3VR5D 1XK7A 3H2IA 2R2GA 1IHDA 3LGXA 4FHEA 1Q44A 5C8DA 3CVXA 4OCZA 4YMVA 3GLIA 1IOWA 1E1CB 4V2IA 1GZHB 4HQ6A 1M34B 2P9EA 4B1FA 2PJZA 2ZRBA 1T6XA 3DWIA 3OKFA 4QDKA 5A62A 3CZMA 3VVCA 2BMDA 4LF6B 3FBGA 3JQAA 4ZVKA 4F38A 4RV9A 2LIVA 1UP6A 4M83A 5F7XA 5LLTA 2ZZNA 1DCKA 2A35A 1R2QA 1UIMA 1Q5PA 2PAAA 3RLFA 4NYIR 1N34B 1GQSA 3NS7A 1KP3A 4UM8B 4TT3D 4DMHA 1WQ1R 2IHYA 4WLFA 1UBSB 2Z1MA 4BECA 2C2WA 1AK2A 4R0VA 1L4HA 1QHEA 2L69A 1XQ6A 2EF1A 2Q29A 1PDOA 3CONA 3G59A 4L8GA 1WUYA 4P34A 2BHRA 8ABPA 2BYTA 1MRNA 2C3YA 1NWHA 3H3FA 3KCQA 5K7SA 3N2EA 1QRDA 4A36A 7GPBA 3AB8A 2X40A 5K0ZA 4L51A 2ZJYA 3HZHA 2P8JA 4NCJA 3TCXB 5JS7A 2YRFA 4NJMA 1MX3A