4JX8A

Crystal structure of e.coli enoyl reductase in complex with nad and aea16
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
b'MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
publication title Crystal Structure of E.coli Enoyl Reductase in Complex with NAD and AEA16
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jx8A00
4Z0TA 1Z82A 1JLLA 3IP3A 3U09A 2CSUA 1MX3A 2BFPA 3D4OA 3D5QA 3LQFA 3UCXA 4OQYA 2NM0A 4PG5A 3WMWA 1ENYA 3SXPA 1KVQA 4WECA 4CQMA 1NQOA 1PGPA 1LLQA 1ML3A 1LDMA 4R1TA 1ZXBA 1EZ4A 3V1UA 2HO5A 3WGIA 1BW9A 3GMDA 1KOLA 2QRLA 3WJ7A 1OC4A 5TX7A 4CQLB 2YY7A 2C5EA 4YJGA 3NDRA 1U5CA 4M55A 1JA9A 4DL9A 1RYDA 1MG0A 2BLLA 3OH8A 5K6AC 4NFSA 1PTJA 2I67A 3INRA 1EBUA 2YV1A 1N1EA 1J6UA 1PJTA 1XU9A 5AXAA 2O3UA 1MFPA 1LLCA 1ENZA 1GU7A 3P7MA 5JAZA 5A3JA 2X7HA 1H93A 4CMAA 4EUEA 4J7XA 2YJZA 4IBOA 1ADGA 4UUNA 2QZZA 1X1TA 1I3NA 1K5HA 4OXKA 4BO6A 5I9NA 4WLEA 1W4ZA 4PLCA 1I8TA 3V2HA 3VPHA 4G5HA 5JAQA 4IIUA 3PRJA 1BG6A 1F17A 2PGDA 3E18A 4NNJA 2DTXA 3ZU5A 1TVEA 1DC5A 1NWCA 2WDZA 2ZK7A 4F3YA 1U3VA 4ALMA 4TZTA 4BGUA 2C7VA 3VDQA 3ETEA 5JBIA 4HNGA 1KBZA 1E1KA 2A4KA 2P5UA 3SLGA 2OBNA 3TWOA 3ZV4A 2GRAA 3Q3CA 7MDHA 3WWYA 1N7GA 5L4NA 1ISJA 2PKRA 4QQRA 2UVDA 1E0DA 1N5DA 5KJ1A 3H9QA 4FGSA 1PGOA 1JU9A 2NU7A 4TVOA 1ISIA 1HXHA 3H65A 4UVDA 3VPGA 2YQ5A 3RSHA 3UF0A 4ALKA 3HDQA 4GX2A 3SC6A 1NAHA 3OM9A 1LDBA 1KIFA 4IMRA 4XGNA 3EMKA 3OJLA 5LDGA 1M6HA 3GAFA 1PWZA 4R1SA 5DBFA 3E8XA 1XR3A 3PHJA 4JP2A 3WYCA 4ZN6A 2JD1A 3BMNB 3ABIA 3RUAA 4B3JA 1P77A 3VKVA 3PVZA 4NFHA 2XXBA 3GDOA 2JCXA 1GQQA 3ZU2A 3F4LA 5EERA 4FB5A 1B8VA 3EZYA 4XIJA 1BXGA 1D7OA 4OMUA 3GZNB 4ONEA 2GNAA 3QVXA 4C7KA 1HZZA 2G82A 4XQEA 3K2BA 3OIGA 4GMGA 3NUGA 4DRYA 1JW9B 3RC1A 2X9GA 4LVCA 3PWKA 4B8ZA 1E1LA 1NX6A 3PWZA 5JCJA 3VDRA 3LT0A 5KIAA 4GLOA 5JLAA 2C54A 3M2TA 1NASA 1YJQA 1TT7A 5FI3A 3D3WB 2ET6A 2OMEA 3TPCA 2X9VA 1T2DA 4RL6A 4MJLA 4CMKA 4WOJA 5IN4A 1QSGA 1DRUA 4XWYA 1PZHA 4XYLA 2EKQA 1JKIA 1ZEMA 4N5LA 4E5KA 4EZBA 4HADA 3LDHA 4EGFA 4ZQHA 4QSMA 4NBUA 3QE3A 3NV9A 5CG2A 2IYPA 1B3BA 1P45A 1T2FA 1U3TA 1YVEI 4I1IA 3AK4A 3RQSA 1XWFA 1DBVO 2Q3EA 3PK0A 3K73O 5TSDA 2JJYA 1V3TA 3DFUA 4UUPA 3IKVA 4NR0A 2NLOA 3I9KA 1GEGA 3FBTA 3H5AA 4I5GA 3JQCA 4BNIA 1YQXA 2EP7A 2PGLA 3H7AA 4WKGA 4AJ2A 1DO8A 1LNQA 1QYWA 3FPLA 3L0DA 4ALJA 1QG6A 3ZW9A 3ZDFA 3JYQA 3U5TA 1H6AA 2XF8A 3LC2O 5LDHA 3HE3A 4LGVA 2BI7A 2FR8A 3BA1A 3FSRA 2B4RO 4YBZA 1PZEA 4EJ0A 4J91A 3FTNA 2I66A 4TRNA 4I9HA 3ST7A 3ZWXA 2IODA 4Y6RA 3LYLA 4N7RA 3ITKA 2F00A 3O26A 3KM0A 2O4UX 4BNVA 3RKUA 3UAGA 3ICCA 4KDFA 2IXAA 2Z95A 4OQZA 3AFMA 3C8MA 4Q3DA 4YTEA 5U4QA 1V9LA 2QG4A 3G79A 5JPIA 2CF6A 1DLJA 2QQ5A 2X0IA 4KUHA 3ZGYA 3DBHB 4XZ3A 4XKJA 2HAEA 5KOIA 2WYUA 2DKNA 3I52A 4J9UE 5G4LA 1LDYA 1EK6A 3U4DA 3WR5A 5ITWA 1TXGA 4JJFA 2NSDA 4CQLA 4FC6A 1CWUA 4XYMA 4LK3A 2VNSA 1A9YA 1SPXA 2FP4A 4CR7A 1ISMA 4IUYA 5CDUA 4AJIA 3I1JA 4AJJA 3D1LA 3VKUA 3RCBA 1XHLA 3DEYX 3ZZNA 1R4NA 3OETA 3UW3A 3ZWAA 3PLRA 3QWAA 1NPYA 5TC4A 1NNUA 1LBEA 2GO1A 1YOVB 3VAZA 1M6WA 3U62A 3P5SA 1DIHA 1KC3A 1T2CA 1UP6A 3SLKA 4GLLA 4J2OA 1O5IA 2BFOA 4FFLA 1ID1A 1Y8RB 4K26A 3D64A 2FMUA 2RCYA 3QWFA 1Q7CA 4PLYA 4E33A 3QRWA 1Z74A 4KOAA 4LMPA 4XDZA 1JDJA 3OA2A 1C0IA 1YL7A 3WFIA 4RZIA 2VT3A 3QHAA 1LRLA 1SBYA 4ITUA 3GOHA 4DPKA 1Z73A 5B4UA 3CZRA 4L4XA 1P9LA 2UAGA 2Y1OA 1GD1O 4IXWA 1T2AA 4KUGA 1EQUA 3JQ8B 3VTZA 1UXJA 5COAA 2JHFA 4J16A 4MOWA 3RBXA 3E6AA 3R1IA 2QRKA 5BNIA 3VVBA 4GVLA 2DUUA 2CVOA 2JAHA 4ND3A 3L9XA 4I5EA 5ENDA 1F14A 4CL8A 3I6QA 1X1EA 3KB6A 1T25A 2B4TO 2OUIA 4FFNA 5I7VA 1HDCA 3ZH2A 5JO0A 3NYWA 2CDBA 1X0XA 4D0SA 4HV4A 2CMDA 4QO7A 6ADHA 4TROA 5A05A 4FW8A 3UH1A 3BMNA 4DLBA 3GGOA 4R54A 2CVZA 4B7CA 3OICA 1EMDA 4XX0A 1EFLA 3WQSB 5JNLA 4ZHSA 2GN9A 2YV2A 4JQCA 3DWFA 1S7CA 2PR2A 3I6IA 4KZPA 2GYYA 2HRZA 2PZLA 4YEDA 1MFZA 1ULUA 5TRTA 3B6ZA 1DEHA 1WZIA 1SNYA 4D3DA 4DIBA 2ZJ1A 4MP8A 1DPGA 1RWBA 2GD1O 3VH2A 2PZKA 3F1KA 5HS4A 3GN1A 4BO9A 3D3WA 3QWHA 2P2SA 4CMCA 5A03A 2DUWA 5I9LA 4MVJE 3BHMA 3ENKA 2X0RA 4B8WA 2YHIB 3PPIA 1I5RA 3FRJA 4L74A 3LU1A 4NPCA 3WGGA 3OFSA 3CUKA 1WAMA 4NH4A 1CETA 1F8FA 3JQ9C 1Z75A 5EINA 1VSVA 1O8CA 3M1AA 3O8QB 1H0KA 3NT4A 1LQUA 3NX4A 8LDHA 1E7YA 1H9BA 1GUYA 4DYVA 1PU2A 3GEGA 3NDJA 3JQAD 1ZCJA 2YDXA 3RD5A 4AJ1A 3Q9UA 2EKLA 3GF4A 1KY5A 3MOGA 3MJ4A 1GUFA 4XB2A 3GDGA 5IN5A 1KVTA 1LJ8A 4MVJD 1BTOA 2AHRA 4QT0A 1X13A 3DO5A 3RUFA 4UUOA 4RPHA 1I32A 3C7DB 1VRWA 3VTFA 4D0RA 2P9CA 1B3RA 3S1LA 4UEOA 1RKXA 5HTOA 3DOJA 3OIDA 2IZ0A 2GASA 1FXSA 2Z1NA 2HMTA 1Y8QB 1HLDA 2DAPA 2I99A 5EMHA 3D4PA 5JSFA 2EJWA 3OJ0A 3V8BA 4HX5A 4HFNA 1BGVA 3QLJA 2H63A 3M2PA 3F6YA 3DONA 4A0SA 3Q11A 3IS3A 3A9WA 2X5KO 1NWHA 3KYDB 4MP3A 3WGQA 1I2CA 4HBGA 1GZ4A 3UCFA 3N7UA 4XRGA 1FMCA 1U8FO 3HN2A 3MZ0A 5AQ1A 3TNLA 4GX1A 1JKJA 3A14A 1HT0A 5JDCA 5EIOA 1OZAA 3BAZA 2VT2A 1SCUA 3F5QA 4G65A 2CNBA 1PQUA 4NK5A 5JMPA 2X1HA 4W6ZA 4YQYA 2AXQA 4RVHA 2VTDA 2VWGA 1O89A 3H6KA 3R6DA 4PG8A 5DP1A 3U4HA 2VNAA 1QORA 4BNLA 1DIRA 2DBQA 3C1AA 1IHYA 4IQ8A 3ITDA 3DBHA 1HDZA 5EPOA 3WGHA 4LCJA 4JCOA 1WDMA 1Z7BA 2W2LD 3PYLA 5JYEA 2H9IA 1DFHA 4TRMA 5JAIA 4WGGA 1WWKA 2EW2A 3JV7A 1PJCA 4ZVVA 4UULA 2VRBA 1C1XB 4JLWA 2VWQA 3K92A 3DHYA 3AOEC 2X0NA 2WYWA 4P4GA 1A71A 1D4FA 4J0EA 4XGIA 3WSWA 1YBVA 1BDMA 5C7OO 3IJRA 2V6GA 2HSDA 3H8VA 1H2HA 4CR6A 4N5NA 5DZSA 5JC8A 4NQZA 1IOLA 4BKRA 4C4OA 5CG1A 3BTUA 3UKOA 1F0YA 1YOVA 3LT4A 1QYDA 4W4TA 4DLLA 5U1PA 1P1FA 1IZ9A 5CDTA 4F6LA 1RJWA 5I8ZA 1I2ZA 1Y8RA 3TZHA 4BQRA 1QKIA 1NVGA 1YH3A 4CMIB 2XOXA 1UP7A 4RCVA 2NUAA 3ZU3A 2AE1A 5KJFA 2B36A 1E77A 3NKLA 5TS3A 2AEJA 5JXWA 1P3DA 3WNVA 4ALIA 4Z3DA 4NJMB 1HDXA 3WBBA 3A4VA 4DVJA 5KNLA 3HZZA 4FOOA 1DJNA 3JQBC 4CMHA 3VH4A 3SEFA 2NADA 3JQ8A 4R1NA 4TSKA 1Y5MA 4BMSA 1E7WA 4PIVA 4J4HA 5I8WA 1FK8A 2D8AA 2ZB4A 1SB9A 1XEAA 4CV1A 4BS9A 3IUSA 4PRLA 5DF1A 3EW7A 4YT4A 3JQFC 4EI2A 3EDMA 4CUKA 1QRRA 5G2OA 3ZWBA 5JE8A 4HFMA 1WVGA 3DFZA 1R4MB 4FS3A 4O1MA 3TZCA 4ND1A 1ZVMA 3RFVA 4O6VA 5IDYA 4R68A 1UZLA 3K96A 2I6TA 4CJXA 4N54A 5EN4A 2HUNA 1HE4A 3FR8A 4RQUA 4K9DA 3DB2A 1LA2A 1KS9A 3TZKA 4D45A 4BNKA 3HB4X 4IY1A 1E1NA 2D0IA 3FR7A 5H81A 1PL6A 1HDGO 4E21A 3WLEA 1N8KA 2Y93A 1GQ2A 1GZ3A 4I9NA 5K9ZA 8ADHA 1GY8A 2FSVA 3OP4A 4H16A 5KVVA 1UJMA 2VRCA 1WNTA 4FN4A 3HQ4O 5C7IO 2B0JA 3DMTA 1KYQA 3OMLA 2H5LA 4IZHA 5TF4A 3RVDA 2IEBA 3DBRB 2YHIA 1E6EA 4NMHA 1QV7A 4FSHA 3AI2A 4WOKA 1MB4A 3MOIA 3I9JA 1IZ0A 3O8QA 3JCZA 3KRTA 1V3UA 5COQA 3QJ5A 5B1YA 3QQPA 5FFFA 2E4AA 1L7EA 2X5OA 4KWIA 3VOSA 3BTVA 2HQ1A 1HSOA 2W2KB 2ZCUA 4UEKA 1NM5A 1TLTA 1R0KA 5G0UA 1WW8A 3ZHBA 3RU7A 2TMDA 3C1OA 5DOVA 2Y1DA 3Q2IA 5L9AA 2BHLA 4CLDA 3LLSA 5U9CA 1X7DA 3OIFA 1HSZA 2DTEA 3JYLA 3TFOA 1KVSA 4J7UA 4TRRA 1HDYA 1UXIA 2PNFA 3FNFA 3KBOA 4PLWA 2R00C 1SO8A 2NV6A 2Y1CA 2IEDA 3CE6A 4BO5A 2O48X 1V6AA 4XB1A 1Y8QA 2C2YA 3DZJA 4Q3CA 4KMSA 3D0OA 4IQ0A 2V7PA 3EVTA 4RJTA 2PH3A 3L6DA 3KUXA 4OO3A 4RPKA 3H5RA 4TWRA 3VPSA 4I8XA 4BMVA 2FR1A 4EW6A 4CPDA 2R00A 3W6ZA 4D42A 1B8UA 4AJ4A 4CLRB 1U1IA 1GYPA 3GA0A 3GR6A 1YXMA 4QX6A 4WPGA 1SEVA 3ETDA 3KYDA 1EVJA 4Z6KA 3EUWA 3TSCA 1WXDA 3HNPA 3DZGA 1QYXA 2J5QA 2YFQA 3KETA 3PFFA 2CVQA 1WZEA 4NJOA 3ZWWA 3S8MA 4PG4A 2GLXA 3ANMA 4PLZA 4L0QA 1PQPA 3WS7A 4YJHB 4R16A 2X86A 4RF4A 1PJ3A 1K89A 1DFGA 1UXHA 2BMAA 5MDHA 3L77A 3F47A 1KEVA 4FIZA 3CZMA 2W8ZA 3E9MA 1SZJG 3ONFA 1ONOA 4PN3A 4RZHA 4BKUA 1HWYA 3RFTA 4W9NC 4EUHA 4F46A 5IXSA 1B7GO 4WLOA 2PK3A 1ZK0A 3MJVA 3PIIA 5EQDA 5DT9A 4M89A 4MVJG 1ZK3A 3RBVA 5ILGA 4HP8A 5JC1A 3FCOA 1C1XA 3RI3A 3ZHXA 4NI5A 4R01A 1U4SA 4MDHA 5CDYA 3OQ1A 4YQZA 2C5AA 2CD9A 4B4OA 3AWDA 2Q1WA 1A4UA 5T8KC 2O7QA 3N58A 3B70A 2D4AA 3LC1O 4ZU3A 1HTBA 4YDRA 3JQEA 1C1DB 4IDEA 5I7EA 3QVTA 5K6AA 1LX6A 3TF5A 4DPLA 1O94A 3VZSA 1YL6A 2D5CA 2Q50A 2Q1UA 1K6JA 4NDNE 2RAFA 4E0BA 3UFXA 2O50A 1UP4A 4CMIA 5KKAA 1UR5A 3V5NA 4BNZA 2DM6A 4BO8A 2X4GA 4GH5A 3GC6A 4J49A 2R6JA 2AMFA 3QP9A 4NJMA 5ADHA 1GDHA 2XAAA 2HMUA 2Y1EA 4ZQGA 3S2GA 5AYVA 3P2OA 3WWZA 3E48A 3FWNA 1LLUA 3WXBA 4R69A 2RHCA 1BVUA 3GFGA 1N2SA 1FDTA 2DFVA 1P0FA 1DAOA 2Y1FA 2ZQZA 3PIDA 1DC3A 4H7PA 4DBVO 1VKNA 4LW8A 2GZ3A 3FN4A 3W6UA 2IXBA 3C1TA 4E5PA 5FI5A 3INTA 1X7GA 2P9GA 4BO3A 4CM4B 4IGEA 1R4MA 2CFCA 3TOXA 3SJ7A 4RVUA 3PQEA 1L7DA 4BNWA 1ENPA 2E6UX 1XU7A 1LDNA 4F45A 3BTOA 1ZK2A 3B1KA 3L07A 4E4YA 4W99A 5DDIP 3ZNPA 4L9RA 4O63O 5F3RA 4KP7A 3I5MA 1O0SA 1E5QA 3C24A 4IDCA 4LSMA 4YAEA 4A10A 3VZPA 5JAMA 1CRWG 1BRMA 5CEFA 3KZVA 3ROPA 3F46A 4NHEA 1N7HA 4IS2A 3KSZO 2YYYA 4ZA2A 4CLOB 3R0IA 1D1SA 3IAHA 2EGGA 1YONA 1NP3A 3F1LA 3TL3A 1ZNQO 2HK9A 1SOVA 3GN2A 1DSSG 4PVDA 3ONDA 3WB9A 3PLNA 1A9ZA 1R12A 3IP1A 3AFNA 3LT2A 2P4HX 3DBRA 2HMVA 1MP0A 1LDGA 4JBHA 3GNSA 4OM8A 2NNLD 4OL9A 4PZEA 2HMSA 4ND5A 2FWMX 2B4QA 1PGQA 4MPDA 2FRDA 4KDEA 2EG9A 1FDVA 3VC7A 1NTOA 5F1KA 2W4QA 5CDGA 4Z0HO 2A35A 2W2KA 2W98A 3ETGA 1VL6A 1B8PA 4HNHA 2VN8A 1NXQA 3DL2A 1HETA 1F8GA 3PI7A 1LC3A 1Y9EA 1T24A 2Z5LA 4UVHA 3VZQA 5I9MA 3OEYA 3WSVA 4XIYA 5JYDA 1HKUA 3SC4A 2J6IA 3DC2A 1DAPA 3MJCA 4CLXA 1E1MA 4K6FA 3F4BA 4GQAA 4R3WA 3ZWVA 2X0JA 1IY8A 4IMPA 4YCAA 3AU9A 3M1LA 3M6IA 4IJVA 4BNGA 4WCDA 2NU9A 4CM9D 2GERA 4YPOA 4FJ2A 3I23A 3WQQA 4A73A 4CLRA 1NQ5A 5TJ9A 2EJVA 5BR7A 3RFXA 4RGBA 3UN1A 3BMOB 3EVNA 4QEDA 1KETA 1XSEA 4MP6A 2Z1MA 5L4LA 1GL3A 2EW8A 4NU5A 4OHUA 5GZ6A 2GPTA 4ZRMA 5F5LA 4ZGWA 3PJDA 5BQFA 4Z0PA 1P1KA 2E82A 3NRCA 1W6UA 4YJHA 3NJ8A 1AN9A 4ESOA 4FC7A 1NYTA 2O7SA 4RPLA 4D3SA 1Y9AA 3WGYA 4KQXA 4AJLA 3E03A 1P0CA 2IYOA 3PWSA 1VJTA 2VYNA 1QP8A 3DHEA 3I83A 4MKXA 5DN9A 2D2IA 4DUPA 4WE3A 1NPTO 5DULA 3WOHA 3BHJA 3ANNA 4PLTA 3H9EO 5L53A 2HU2A 4RF3A 4E30A 2ZCVA 4BKQA 3BTSA 3D3EA 3UCEA 5T67A 1E3IA 1GQYA 5BT9A 3AUUA 3G1UA 2NVBA 4J1SA 4BNHA 4XRRA 5CDSA 4L4SA 3QVWA 2A92A 1AGNA 4N5MA 2BGLA 4B7XA 1AXEA 4PLVA 3JQ6A 1Q0LA 4RVDA 5BSEA 4JBIA 4RDHA 2AEFA 2ZTUA 4IJKA 2I76A 1C1DA 2JD0A 1E6WA 1N9GB 4E13A 1XCBA 1PR9A 4J90A 3EGOA 4Q3BA 4J1TA 4J43A 1BVRA 3CTMA 4U5QA 1UH5A 4JBGA 1TI7A 3RUIA 2CF5A 1W8DA 3ROKA 1ENOA 1EUZA 2AG5A 2B35A 4NFYA 3NJ4A 2TMGA 3QA9A 3NGLA 2C29D 1JN0A 4PLPA 2E49A 2AQIA 1XGKA 4FFMA 4ND2A 3GUYA 5DCYA 2PZJA 1CF2O 3EAGA 4K6CA 4LMRA 1ADCA 1ZK1A 5L40A 5L4SA 1J49A 1PR3A 1FJHA 1VKOA 3BXXA 3ZWNA 3ZV5A 1H94A 3WQRA 1EEHA 3KV3O 4FJ1A 4PZCA 3WGOA 1VJ0A 3S2IA 5DCUA 1TT5B 4E5MA 2NTNA 2FHSA 4CR8A 5JDIC 1ZXLA 1I30A 2E37A 2J3KA 3NT2A 4RQTA 2FN7A 3GQVA 5ICSA 4BNYA 3IIEA 3KLMX 4HXYA 4E3ZA 4MIEA 4XDYA 2NWQA 5IXYA 4KTVE 4WLFA 4NU6A 4NG5A 2HRBA 3JQGB 1JVBA 4CM4A 3JD3A 2VYVD 3KYBA 3L4BC 4GI2A 4Y8VA 1P33A 2HK7A 3HJAA 4DQUA 5ILOA 3WTBA 4A7PA 2VUSA 5J23A 5HWSA 1JWAB 3EY4A 2Y0CA 4BKOA 1LDEA 2Y67A 1O9BA 1YS4A 3TDKA 2DBRA 4XR4A 2VUUA 1ZEJA 1G0OA 3GVHA 3AJRA 3MWDB 2B69A 3LF2A 4L75A 4P4NA 3RUCA 3V2GA 3H2ZA 2OP1A 2EWMA 2OORA 3A28A 4RF2A 2AQHA 3GZNA 1LRJA 2GN8A 4I9UA 1HE5A 5FF9A 3ADPA 4CLOA 3PHGA 1B15A 5A1TA 1IUKA 2HK8A 1I0ZA 4Y98A 2Q4EA 3I3OA 3PZBA 1MA0A 4FDAA 1HL3A 1AHIA 1G6KA 3DR3A 4XQCA 3ONEA 1GEEA 4DC1A 5FEUA 2WE7A 3CH6A 3MJTA 1K6IA 1GUZA 1UAGA 1W73A 1M67A 3AM3A 2JD2A 1LSOA 3S2EA 1DC4A 1PL8A 4MVJF 2ZTVA 3GRKA 3LLVA 4BNNA 1EQ2A 3C85A 1ZJZA 3WBFA 5TLSA 2O4CA 3WLFA 1PJBA 1BMDA 3CMCO 1FDWA 4I5FA 4TZKA 2RH8A 4Y6PA 3U3XA 3N74A 1R6DA 3JTMA 3KOUA 3RKRA 3CXRA 2JAPA 2ZB8A 4PCVA 3JQ9A 5A04A 1TB4A 5MGBA 2C2XA 4ROSA 5KWEA 3AY6A 1HLPA 1B16A 3O4RA 4IDBA 4YRAA 2JFHA 4UVIA 4ZICA 5G4KB 2DTDA 1A7KA 5KJ6A 4DMLA 3ZI0A 3WDSA 2VHWA 2F1KA 1MXFA 2FY8A 5H82A 4H3VA 2D59A 3WMXA 4CQMD 3O9ZA 4KQWA 4E31A 4TMFA 2E48A 4E2WA 5COBA 2GZ1A 1ZUD1 4YA6A 5EL0A 4BQPA 3NTRA 2LDBA 2PD6A 4BV8A 1TEHA 1J5PA 3MTJA 3Q6IA 1JAYA 3QSGA 2NTJA 1PZGA 3BMOA 2JKVA 3WIEA 4WLVA 2ZKLA 1H6CA 3ZHZA 5CEJA 1DFIA 1VL8A 2JFFA 5EESA 4HFRA 2PA3A 3CIFA 2H1SA 3U0BA 3EK2A 1YDWA 5L3ZA 1DC6A 3V1YA 3DDNA 2VQ3A 1NAIA 3X2EA 2I9PA 1YBMA 3ASVA 3WYBA 4BB5A 1LC0A 3GDFA 4R51A 5KVCA 3O03A 4A5OA 1UUFA 4HKTA 4U6QA 4B4VA 1ZZEA 1XELA 4PFJA 4CM1A 4J4BA 4YYZA 3JQAB 3C7CB 1P31A 2WD7B 4YT8A 3NEPX 2PD3A 5LCXA 3RBZA 3RUDA 4FR5A 3BMCB 2X8LA 2PTGA 5TGDA 1DRWA 3ZN2A 4EDFA 2YW9A 3JYNA 4ZD6A 1RM5A 3QV1A 5CFZA 4FFRA 4IINA 3SBOA 4E2ZA 2GN6A 4PGFA 1ISGA 5IZCC 2O2SA 3ZU4A 1E3EA 2FZEA 1LXCA 1UDAA 3STHA 1VM6A 1NQTA 3LF1A 1DHRA 4RLSA 1U2DA 1YKFA 3GAZA 1N9GA 2PH5A 2G0TA 4UVGA 4DBZA 1MLDA 2Q1TA 2VTEA 3T4EA 3AOEA 1IB6A 2Q2WA 3R3JA 4R9SA 3RWBA 5TT1A 4WUVA 1MV8A 5ER6A 1I24A 1N1GA 4PG6A 1MGOA 5F1PA 1LU9A 2CZCA 3GPIA 3DMYA 1GYQA 4A27A 1F06A 2ILTA 4QUKA 3ZCXA 3ZWOA 3PDUA 3GG2A 2VUTA 3PGJA 1H5QA 4CODB 3OQ6A 2P91A 3GVPA 5IDWA 1R0LA 3AUAA 4OGWA 4UREA 1X15A 2VZ0A 1P44A 4XGKA 1TT5A 4B4WA 2IDZA 4S1VA 4XD2A 4MVJI 1XDWA 1I33A 2DBZA 4E32A 4YWJA 5F21A 4AJKA 1LRKA 5JCJD 2EGHA 4BNTA 3JQBA 4OSOA 2OXIA 1ZW1A 2FPIA 2Y99A 1H6DA 4RVFA 3HDHA 1XQ6A 3JQGA 2ZB3A 3GGGA 2FSSA 3A1NA 4B3HA 2AA3A 3BMQB 2RHRA 1AXGA 5GZ3A 5A5EA 3P2YA 3I9OA 4IDAA 3G0OA 4Z9XA 1EVIA 1VJ1A 4JJIA 5G0SA 3JQFA 3WYEA 2AQKA 1B26A 5BSHA 4CMEC 4M49A 3C7AA 3IQDB 4JK3A 2Y0EA 3GHHA 3JD1A 1PIWA 3JD2A 4M54A 4TKMA 5B4VA 5IZ4A 3WGZA 1Q1NA 4B3IA 4M86A 1T4BA 4RO0A 1MXHA 1PS9A 3QIVA 1GTMA 5BNTA 2J3HA 2Q2QA 4GWGA 1BDBA 5CHEA 5DP2A 1ZSNA 3FNGA 5EQFA 1PL7A 3W4KA 2VZ9A 3K30A 4R41A 5ENVA 3FF4A 3H9GA 4MVJP 4ALLA 3CMMA 3B20A 5A9RA 3JYPA 5CP8A 3GNTA 4DMMA 4W7HA 2Y0DA 4U6SA 5DNAA 4YXFA 4CMJA 1CERA 2GF2A 3LC7O 3GEDA 3W4IA 2EP5A 1ZFNA 2NVUB 1MC5A 1YGYA 4YAGA 4X54A 2BRUA 4JNKA 4NIMA 1ONPA 1W0CA 4OXYA 1ZSVA 4GX0A 1T26A 3L9WA 3W8EA 1YQDA 1CDOA 2B5VA 2EXXA 4GGPA 3Q9NA 3UVEA 5AOVA 3KHUA 2NQ8A 4MKRA 1E3SA 4XYEA 5ES3A 1Q2XA 2GUGA 4A26A 4BVAA 3PGXA 5G4KA 3VH3A 5FWNA 1JVSA 4GX5A 3JD0A 2D3TA 1IE3A 1NR1A 2DPHA 2BGMA 2VOJA 3LK7A 3DBLB 1L1FA 3OA0A 4WCFC 1EBFA 1SC6A 4BO0A 4XYGA 3JD4A 4M8SA 1BWSA 1S6YA 4WEQA 1LLDA 2C59A 5A06A 4K1LA 1PZFA 1N92A 4A2CA 3CEAA 3W8DA 1OBFO 4CM8B 4E2XA 4J6FA 5L7TA 4O5OA 3TOZA 5CAEA 5ICMA 5AVOA 2VOEA 4Q3AA 2WMDA 4OIMA 3F3SA 4D7AA 3KYCB 1A7AA 1M76A 2HMWA 1R37A 4AL4A 5IDXA 4DIOA 4U7WA 4CV2A 1E6UA 4D43A 3TN7A 3U49A 3U9LA 2B83A 3RJ5A 1B14A 1YL5A 3FNEA 2HKIA 1U2GA 2IE0A 2IZZA 1VI2A 3HG7A 1AE1A 4MVJM 3G1TA 3TZ6A 4NK4A 1FF9A 3ZWPA 2HCTA 4WJZA 3PZRA 1AHHA 3AY3A 3QVSA 3JQAA 4JROA 5KCZA 1HYEA 3ASUA 2WD7A 3OSUA 2R2GA 4BNJA 3UXYA 2WSBA 3PFWO 3WJAA 3BMCA 4PLHA 4UEJA 5C37A 5B12A 4MKZA 1R66A 1B0AA 3PTZA 2C7GA 1GR0A 1P1JA 4MVJA 5DBIA 5KKCA 1WLYA 2POQX 3E5MA 3E9NA 2V65A 4QO8A 4W9NA 5CEEA 1D3AA 2A94A 2GGSA 2WE8A 5IDQA 4YACA 1HF3A 3G3EA 3AM4A 4F6CA 1SB8A 2O3TA 2YUTA 4NZ9A 4P4LA 4QXMA 2CUKA 4GSKA 3V1TC 3AOGA 5DCWA 4RVGA 1ZMTA 5BNFA 1A5ZA 1I2BA 4TQGA 1ZO8A 1QYCA 4I5DA 1PS0A 2YDYA 4IJWA 4QFCA 4WK6A 1I10A 1P74A 2RIRA 3MCVA 3Q0EA 4R5HA 2O2YA 4CV0A 3C3XA 5T8KA 4BMNA 2B37A 2EHDA 3DZIA 3QWBA 4DPMA 1WMBA 2NTVA 4EJMA 2OGUA 4U0KA 1LEHA 4DQXA 5L95A 1U9JA 1DDOA 4Z9FA 4EJ6A 4OYRA 1HRDA 3OQBA 3PJGA 1I3KA 4YAKA 1R4NB 4OXNA 2BFMA 1NPDA 5IJZA 2FPGA 3K8ZA 5A9TA 1XKQA 4IPTA 4FFOA 4B79A 2PKQO 3NAQA 4ALNA 2OBYA 4BL5A 2CY0A 3DAFA 2O3RA 5G0WA 1NHGA 3IC5A 4BGVA 2ZYGA 4GBJA 4BNMA 2W2LA 3ZNNA 4R9RA 1G1AA 4FD3A 3L6OO 2EIHA 2VWHA 4ZRNA 5G0TA 5DBGA 3INGA 4AJPA 3RU9A 1YBAA 2RH4A 2D1YA 1YWGO 3WG9A 1XLTA 1EE9A 1Q0HA 1U7TA 1PQWA 2BFAA 2WEKA 1LQTA 1F12A 1OC2A 4JP3A 4ZQEA 5A3VA 3TL2A 1VLLA 4YR9A 3BMQA 6LDHA 4UVEA 1T4DA 1CYDA 5HBRA 4GMFA 4DYDA 4L4RA 4AVYA 1GAEO 2AE2A 4M87A 2VZ8A 4R4JA 4LN1A 1GFSA 4XR9A 1RM4A 1PGJA 1U4OA 4NBTA 1KEPA 3AUSA 4Q39A 3KEQA 3OJOA 4AJNA 5KVQA 1HYGA 3OJEA 2QZ9A 2OFPA 7ADHA 5K0ZA 3VZRA 1E3JA 1NFFA 5I7SA 1LSUA 2J3JA 4OH1A 1E7MA 2BELA 3TRIA 3K6JA 1YDEA 1GCUA 2BD0A 1WDLA 3FTPA 1U3UA 4EBFA 1K2WA 2PLAA 2DPGA 3IDSA 3U4IA 4C7JA 1H2BA 4CUJA 4OKIA 2NU8A 3ZWCA 1DJQA 2OO5A 3ENNA 3PDJA 5TT0A 1HZJA 3RC9A 3GGPA 4IDFA 3VPXA 1Q7BA 4E12A 3I9LA 4IDGA 2CDCA 2FR0A 2NVUA 4O59O 4DGSA 1Y81A 5JCXA 3PYMA 1YB4A 4CM3A 4PLGA 3WFJA 3GUCA 4IZIA 4JX8A 3FD8A 3RC2A 4GGOA 3NTQA 3CINA 1UDCA 4Y67A 1GPDG 1PS8A 1VC2A 4UUMA 4IDDA 2PGJA 3H3FA 2AW5A 2EEZA 3RAJA 4JIGA 2ZTLA 4RDIA 1IYZA 3JQ7B 3OEWA 2X6TA 3R3SA 2I3AA 2VCYA 4INAA 4D79A 2WD8A 4G2NA 1EUCA 2OP0A 3G49A 4UAGA 5CPFA 4WNCA 3COSA 3GFBA 3GK3A 1HYHA 3KO8A 3EHEA 3DBLA 1NQAO 4O0LA 2X23A 4DA9A 1R0SA 1ZJYA 2GCGA 2Q99A 3FWZA 3PJFA 1V8BA 2QHXA 3MWEB 1Q0QA 1QLHA 1NFQA 1GV0A 4WEOA 2J8ZA 4YAJA 3GY0A 3Q2KA 1DB3A 4Z9YA 4EYEA 3BIOA 2UYYA 3DOCA 4FBGA 1UDBA 1SEPA 3HN7A 3K9QO 2GN4A 4CM8A 3B1JA 1LI4A 3X2FA 3QW2A 1ADFA 4CM7A 5JW6A 2XPCA 1ORRA 5TNXA 3KYCA 3GMSA 1A4IA 1JWBB 1LTHR 2SCUA 4D46A 3V2UA 1PJQA 2O3JA 3PYXA 4E5NA 1BSVA 4OSPA 1NVMB 2DFDA 2P5YA 4NBWA 4Y6SA 3H2SA 1WPQA 1QR6A 3PJEA 2AQ8A 2UUPA 4DQVA 4EUFA 2YQ4A 1GZ6A 3HFSA 5C5IA 1OMOA 3KXDA 1P1HA 4K28A 3TZQA 2FOIA 3NT5A 1CIVA 1DIBA 3SX2A 1IHXA 2HDHA 5LC1A 1M66A 1RM3A 3PQDA 4FQ8A 3GPDG 4ILKA 5C7LO 5I7FA 2EV9A 4L76A 2XXJA 3HUDA 3ZWMA 4CL3A 1GYRA 1R16A 4AFNA 2EF1A 2OZPA 2UUOA 3KEOA 2BH9A 2Q1SA 4YJFB 1I36A 3HDYA 4R1UA 2RBEA 4LRSB 1EFKA 1P1IA 1ZKMA 5KJEA 2G76A 2I5PO 3CPSA 1QV6A 2WM3A 2ZYAA 2J3IA 3O38A 4GKVA 2YHUA 3GLQA 1QMGA 1DRVA 2UDPA 3GNQA 4XEHA 4GVXA 3UHAA 3VH1A 1JKFA 1JQBA 1Q7GA 1CQJA 1JAXA 5HRUA 2A9FA 5JY6A 1PJ2A 1C3VA 2VHXA 3PHLA 4TVBA 1U28A 5AXCA 4CMBA 2HJRA 1ARZA 1EVZA 4XYBA 5JO9A 1YB1A 5HS6A 2JHGA 4W82A 4I08A 2IZ1A 5ITVA 1NHWA 2DQ4A 4LRTB 1OOEA 3DZHA 3NTOA 1LUAA 4FFPA 2FPPA 5A5FA 5IF3A 1O95A 3PQFA 3AY7A 3L4SO 2GZ2A 3TFQA 4CUZA 3AU8A 2O3QA 4CLHA 4WLUA 1U8XX 1WDKA 2QIOA 4DC0A 2VRCD 1PEDA 4OOFA 4W7IA 3OBBA 2AEMA 2G1UA 4II2A 5GZ1A 2GSDA 3F5SA 4RF5A 1LSSA 3QY9A 4D41A 5A02A 5BSFA 3P19A 4YVFA 1Y7TA 4MO2A 4B7UA 3DOOA 1Z7EA 3HWRA 5H83A 5JDIA 4Q3NA 1K6XA 3I9NA 4GWKA 2UV8A 3GVCA 3ICPA 3LT1A 4U8GA 1G0NA 3WNQA 3FPCA 2C82A 5ER9A 1KEUA 1BXKA 4QFDA 3WIDA 3I4FA 4FGWA 4RORA 5F1OA 5TIIA 1EUDA 1YJ8A 4G81A 4XJTA 4CM6A 3L4BA 2QX7A 2YZ7A 3E1KA 3KLPX 4AJOA 3AW9A 3ZNQA 3DHNA 3PP8A 3AI3A 3DBVO 3BHIA 4MINA 4XQ9A 3U4CA 3RC7A 4XQGA 1YB5A 5T64A 3PEFA 4AG3A 5C3MA 3OECA 1YE3A 1OFGA 1XA0A 5G0VA 2BGKA 4RV9A 3A06A 1B2LA 1C0LA 4OJNA 4ZQFA 1ISHA 4JXKA 3ROQA 1C0PA 4YRBA 2VWPA 2ZTMA 1P1RA 4RLHA 5TJHA 1OI7A 4J9VA 3RJ9A 2HLPA 4YT5A 4H15A 3WICA 1PX0A 3CSDA 1K3TA 9LDTA 4DREA 1DIGA 2WWRA 3GH3A 1DHTA 4LCEA 2JCVA 3RIHA 3KSDO 4BGIA 1XIVA 1ADBA 1H9AA 3EC7A 3HADA 3JQ7A 4GKBA 4XCVA 3ROMA 2WYVA 1KVRA 2OHXA 5IFLA 2B5WA 3LSYA 1MUUA 5HA5A 2EKPA 3AM5A 4HWKA 3GVIA 2DBVO 3GEMA 4WLNA 5GY7A 4MIOA 3VHRA 9LDBA 4YAIA 2AG8A 3DTTA 1K0UA 4J0FA 2ZQYA 3SVTA 4GL4A 1EK5A 3H3JA 5A9SB 4P22A 4L8VA 1Z45A 4II3A 2DLDA 4J7CA 4PRKA 4IIVA 1YRLA 1EVYA 2PD4A 5DOZA 4RPGA 3DAPA 4AJHA 3CKYA 1KVUA 4S3MA 3D5TA 3ZNOA 4BO7A 2X22A 4A03A 4CV3A 1E7RA 2P4QA 1SAYA 3EZLA 1IL0A 4RPJA 1XG5A 3PHIA 1U5AA 5GMOA 3G17A 4WCFB 4IGFA 1PJLA 4EEZA 2X5JO 2YV3A 2ZJ0A 5AXBA 5JFOA 3IL2A 1OAAA 5L45A 4DXHA 1M75A 4BO1A 4R3NA 1C0KA 2FZWA 4GAEA 3UICA 2GDZA 3H9JA 4E5YA 1QXSA 4WNIA 3S2FA 4MVJH 2P9EA 5JDCC 1HE3A 2IRWA 1PGNA 1RYEA 4BUCA 2ZIZA 2G5CA 2V6FA 4HUJA 2QYTA 1DLIA 5HM8A 3T7EA 2WJPA 3ON5A 4DTIA 2G17A 2PKQP 2PY6A 3Q1LA 1I01A 3W1VA 4BO4A 1MC4A 4E6PA 2HJSA 1U3WA 3FI9A 2Q49A 4OKNA 3T4XA 3VPFA 1T2EA 2O23A 1NR7A 1WMAA 2I65A 2PWZA 4LISA 1E3WB 3GRPA 3HB5X 4HY3A 2QW8A 4P8RA 4JJGA 5T6BA 3ZWYA 5A4DA 3OF2A 4J1NA 4BO2A 3MEQA 4YJFA 1RM0A 1EE2A 1HEUA 3GZ4A 3H9UA 4JN6B 4Y9DA 3K31A 5KJCA 3LVFO 4BV9A 3PXXA 3WX0A 1V0JA 4GPD1 4CQMB 4URFA 4BOYA 1PJ4A 5L51A 1GCOA 1DOHA 4DIFA 1GADO 1BW9B 4NBRA 4ND4A 4CM9A 3W8FA 3KVOA 4LSWA 2PV7A 4BB6A 4D3FA 5IZCA 1AUPA 3QWIA 4YJGB 5BSGA 2C07A 3DXFA 4RVSA 4BGEA 4KWHA 3ZW8A 2DU8A 3AUTA 1UXGA 1M2WA 1YQGA 3JSAA 3UOGA 3OJFA 1E92A 3KSUA 1NFRA 3E5RA 4OOEA 1FDSA 2O3SA 3K5PA 2JL1A 2W90A 2VHYA 3DQPA 4XJSA 5B4TA 1V3VA 1ZIDA 4QECA 1BHSA 4BNXA 3ORFA 4FJ0A 1XQ1A 3GVXA 1U7HA 1PSDA 1PWXA 2Q45A 2NU6A 4FPXA 1E7QA 2Y68A 3BYZA 4TKLA 5EJ2A 2X9NA 3NDIA 1CJCA 2Q4BA 1UXKA 3IJPA 3QVOA 2JCYA 4ZJUA 4IM7A 2CDAA 1Y6JA 2BF7A 1TA4A 1ULSA 1NVTA 1ONNA 1ZSYA 5THQA 3TQHA 3D7LA 3IKTA 3T7CA 1PJSA 4WASA 2OOSA 3RUEA 2X58A 1E3LA 4LVUA 5CPBA 3ZV3A 5JS6A 1DXYA 1KEWA 5F5NA 2J5KA 5JMWA 2JFGA 4QTZA 1X0VA 4U0JA 4CMGA 3DAGA 3ADOA 5T5QA 1T1SA 2GR9A 1SMKA 1ZBQA 4BIIA 3ULKA 4IQGA 4XA8A 3UUWA 3FNHA 4ID9A 4Q3EA 5THKA 1MG5A 3ANLA 1JTVA 3DTYA 3HFGA 5FYDA 3WTCA 2DT5A 2VHVA 4Q9NA 1CQIA 3GT0A 4OAQA 3DZKA 3AI1A 4YRDA 1UAYA 3JQDA 3L6EA 1LSJA 3NGXA 4EITA 4P38A 4CMEA 3SJUA 1QYVA 2Y66A 1QLJA 3LZ6A 1Y5RA 3ZHYA 2Y1GA 1HE2A 1A72A 1ZK4A 1XYGA 3E9QA 3OHSX 1BXZA 3FBGA 4PG7A 4J1QA 1IPEA 4Z3KA 1GPJA 2Y05A 1KC1A 3HHPA 2WTBA 3S55A 3DZBA 3WGTA 1YO6A 4PVCA 2V6MA 3DZFA 4M1QA 3DMTC 4HFJA 3E82A 4E2YA 2C0CA 1BXGB 3H5NA 1A27A 4KTTE 4L73A 4BNFA 3K2EA 3KTDA 1J4AA 1SOWA 2J5RA 2Q2VA 4CM5A 3MJSA 4DLAA 2PFGA 2QYSA 4FCCA 1D1TA 4YJDA 1KY4A 4CLEA 4JGBA 1I3LA 1VPDA 3H4VA 5JY1A 3IOYA 4IJUA 2ZB7A 3B1FA 4D44A 2VYVA 4BKPA 2Q46A 3JYOA 1J0XO 1GV1A 1CEQA 1ZMOA 2I3GA 1T1RA 1UZNA 2OL4A 3GG9A 3I4CA 2VYND 3BZUA 2V6BA 3FHLA 3MTGA 3ZV6A 1IULA 3VVCA 5A9SA 2NACA 4AJEA 4J2HA 4J3FA 4R5MA 1HDRA 1VSUA 4PLFA 4YB8A 3UGKA 5AXDA 1V35A 1ZH8A 3IUPA 2DC1A 1E7SA 1FDUA 1UZMA 4ZQBA 4IS3A 3TJRA 3IMFA 2NQTA 2QRJA 5KVSA 1WP4A 3HSKA 1H6BA 3RROA 4BNUA 1IPFA 1EDZA 4TRJA 1EDOA 2YFHA 4WCFA 2P68A 4AICA 2DVMA 3GHYA 4N18A 4GSLA 1HDOA 1X7HA 3W4JA 4B4UA 3EYWA 1KERA 3I9MA 2ZATA 1I3MA 1VL0A 4NBVA 5L7YA 2BI8A 1O6ZA 3PHHA 4KUEA 4J4TA 2C20A 4IXTA 5TQVA 4BHTA 1Z6ZA 5T57A 1RPNA 2EERA 1ISFA 2D5AA 2VHZA 4PZDA 5IAAA 5IG2A 1R15A 3RASA 2H6EA 1D8AA 1C14A 2LDXA 3MJEA 4MIYA 5KTKA 1E5LA 4EEXA 5L7WA 2BKAA 2NVWA 1NBOA 4DWVA 1VE9A 3HDJA 5B37A 3F9IA 2PZMA 4FOSA 4YT2A 2ZYDA 1E3WA 3RUHA 1DIAA 1X14A 3D4NA 1Y1PA
chains in the Genus database with same CATH superfamily
4Z0TA 3K71B 4KVGA 5KTMA 2YOGA 1P4JA 4MCIA 3DLHA 4HZGA 1CRZA 1EG7A 4XPZA 4MA4A 2CJYA 4X94A 3WMWA 5CTJA 6GPBA 3FRHA 3R7NA 3QFHA 2WTEA 3CYFA 2DWQA 3QXSA 1TNDA 2B1IA 3ROTA 1WZNA 4K6OA 2H1FA 3ZHSA 5BV2P 1X74A 4B85A 1PGPA 1N57A 3OPYB 1ML3A 2OV6A 1Q83A 2WM9B 4R9NA 1AUXA 4JYZA 2B6NA 3TR0A 3WGIA 1CUEA 4WFQA 2FZ4A 2JF0A 3H42B 1KOLA 3I2KA 5TPZA 3TSOA 3L92A 3SJAA 3KSBC 4Y2VA 5E3HA 3RAEC 1NW6A 1PV1A 1MG0A 1RYDA 3HC7A 3GUHA 4WMLA 3OH8A 2R11A 1HH4A 5AW9A 2Q4OA 1LW6E 5EY5B 1E6LA 1G7TA 3NIBA 4IJ6A 1BO6A 1JG6A 2E89A 2I67A 3INRA 4G0OA 4H17A 3SK0A 1O94C 4YV0A 1WB6A 1J6UA 1ZH0A 5TQ2A 1QNLA 2BGNA 3OOWA 3JARA 2F4VB 5JAZA 3NHFA 1OX6A 3ZC3A 1KMNA 3I53A 4UZSA 5DI3B 1JJAA 1Y3DE 4UUNA 3BGVA 3WZMA 1K5HA 4GPAA 5I9NA 3AO0B 1WXQA 2CJFA 3QUSA 4N5HX 4MR7A 2ISCA 1I8TA 4MLDA 1B6RA 4NH0A 4G5HA 3A1DA 3PRJA 4RTRA 2WTNA 3UK0A 5IAEA 3VYVA 5DM70 2UU9B 1AX9A 1UBFA 2G1KA 3EGXB 5TVGA 5AI4A 5KYWA 4P5PA 3TLXA 1F5NA 3AB8A 1USWA 3RSFA 1EXDA 3BK2A 1AHNA 1H1LB 1O7JA 4TUYA 2DLCX 1DC8A 2PL5A 4OBXA 4RKQA 3ZBTA 5C34B 3L49A 1F8XA 1TUBA 2QRHA 3DLCA 3ETEA 6LDHA 4CLHA 5JBIA 3BE4A 4C3ZA 2GRAA 4BRSA 1NTRA 1V6SA 2GAFA 4IDOA 5L4NA 2PKRA 1KWKA 1K97A 2OAP1 3PA8A 3RVJA 3D59A 3IO5A 1U0GA 2G67A 3P2EA 2BBWA 4HPWA 4GNRA 2IIBA 2RGNC 3EMVA 3JU3A 4JOQA 4TVOA 4E5SA 1ISIA 1KRHA 2O5EA 3E61A 4DA0A 1AKUA 4UVDA 3IEUA 3RSHA 4N48A 2XMDA 1W93A 4NNPA 3ZBPA 4HEQA 4KRFA 4ALKA 1QP4A 2GCEA 1KKMA 4YXWA 3BWYA 3IOEA 4UAJA 2SECE 3OM9A 3T5DA 2CVFA 4FMCF 2P79A 4IMRA 5BVHA 2OMKA 5LDGA 1M6HA 1AD2A 4DNXA 3VU9B 1PWZA 2IYNA 3A8TA 1XR3A 2I78A 3C97A 1SCBA 4FIDA 1GTG1 4EYQA 1HPLA 3IR6A 3FOEC 4MUIA 2KHZA 3RM3A 2VPTA 3GW8A 1JR3A 1XRRA 3STWA 3VKVA 2ZXEA 2ZSHA 3F4KA 4NFHA 1USIA 4F4HA 2JCXA 3EFOB 3TB4A 3ZU2A 3A1WA 3PA6A 3QYAA 3EVBA 5JJKA 5A2QA 2G4VA 2YWEA 1M1ZA 3CW2A 4QATA 4FYHA 4FEGA 4U39A 2PM8A 4YGYA 1S3GA 4XIJA 4CCYA 1IBLB 4RSRA 3GZNB 5DCLA 2GNAA 2P27A 4NXMB 1E9RA 3UJNA 2QPOA 3EGDA 1MC8A 3NUGA 4AKSA 3JZIA 4LJAA 4LVCA 3G5MA 1E1LA 3AGQA 1ZLYA 4KVAA 3C6BA 3HLTA 4GLOA 4GMXA 3M2TA 1NBAA 5BWNA 4XD7A 2XCTB 4PZPA 3N86A 3QU4A 4KE7A 2OMEA 2R25B 4RY9A 2X9VA 4HNRA 2EU8A 3NOQA 4XCVA 1QQ7A 3TPCA 1HEIA 4D96A 1KOGA 1TAQA 3WRWA 1QSGA 2VLIA 3FGOA 4JGIA 4KJZA 4KQ1A 2ENWA 1Z5PA 1F0PA 2AUMA 2RGEA 1JKIA 2GAJA 2WZCA 2ZRFA 4ID3A 4EVRA 5K0EA 1KI3A 4UQOA 5K0NA 1CEEA 1NW7A 1OPRA 3IEIA 4EZBA 1ESCA 1IXYA 3RS5A 3JAMA 4HT3B 4ZQHA 3S3TA 3L7OA 2E4XA 3ISJA 3QLVC 2OFFA 3X0DA 1RYNA 1SULA 2FPKA 4Y9UA 1QRDA 5CG2A 5E6UA 2IYPA 1P7ZA 1RLMA 4PX2A 3TR6A 1X86B 2F3UA 2GYVA 3K20A 1T2FA 4MLCA 4I50A 1C7RA 3ZDXB 4I1IA 4UU7A 5EIEA 1FVXA 3A2LA 3HWSA 2OBMA 3N3AC 5REQA 3RQSA 2Q3EA 5BW8A 3RTBA 1NBMD 3G13A 3EULA 4U6NA 3U13A 2I4MA 1AZLA 2B6HA 3L41A 5LYYA 4PR0A 4FFSA 5C80A 2YFKA 4HDAA 2WIBA 2WJHA 1T9DA 1K88A 4NR0A 2NLOA 1NQVA 3FBTA 3H5AA 3ZE8A 1MCZA 2SKDA 3E3OA 3JQCA 2UYHA 4WKGA 1ZISA 3R5TA 3E5HA 3UT5B 5CA1B 3WWCA 4MWEA 1H6AA 2R48A 4X63A 5LDHA 1N3YA 1JHZA 2BN4A 1M3SA 1VL2A 2OXCA 3HM9A 2N46A 3R5SA 1T1JA 1XAGA 2Q0QA 2UVPB 4MS4A 3FTNA 4YBZA 2DB3A 3GLUA 5T41A 3WLPA 2CL5A 3O3CA 4Y6RA 4B40A 3NATA 1OBHA 3IUBA 4N7RA 5PGMA 5J63A 1DJMA 1WV0A 2JI8A 1GL6A 2X76A 4N6NA 1WXXA 5K0TA 4G5RA 4GOJA 1JKJB 3VSEA 1NF8A 3LL4A 3AUKA 4GZMA 1L4EA 4ZAXA 4CEIB 1V48A 3RKUA 4GZLA 3UAGA 3LA6A 4KDFA 5FAKA 4U7DA 2IXAA 2VQEB 1F2DA 2G1JA 2Z95A 4OQZA 2IEYA 3EPPA 4MW1A 4B5KA 4ZXPA 4EB0A 3I61A 3HL4A 4ON9A 4H7DA 1XROA 4BMYA 4M0CA 5CT5A 3ANTA 1U3FA 3I28A 1W36B 1IN8A 4MV4A 1IWOA 1DLJA 2QQ5A 5F12A 3DBHB 4OAOA 2Q7DA 3ZE9A 4RHTA 4A0RA 4JS0A 1KO8A 5BV7A 4B6QA 1Y7IA 1CFZA 1X9IA 1XVLA 3KT0A 4MPRA 3I52A 2P9TA 3C3PA 1T9HA 2LIVA 2LR0A 3U7FB 4J7AA 4A3SA 1RSZA 5AVTA 4DXAA 1TXGA 2R8RA 2RKOA 3WYNA 3H8JA 5SZKB 5JALA 4RZQA 3CUEF 3NCTA 4WFIA 4LK3A 1IN5A 3A3KA 4J1TC 3T34A 4B32A 4EB8A 1ZR4A 4LJ6A 4F96A 1VQ1A 2AI2A 3SD7A 4KIWA 1WB9A 4AJJA 4N7BA 2PWAA 3BXEA 2OHIA 4BQQA 3FRIA 3LWDA 4UPVA 2J45A 2YV5A 1T9BA 3DEYX 3NEYA 2B82A 4JVNA 3W9SA 3ZZNA 1A76A 1R4NA 3OETA 3STUA 3ZWAA 4D9GA 3PLRA 2I6QA 2NSHA 5C18A 1H8HA 2Q07A 4LEIA 3BORA 4MVCA 4WOPA 1I2MA 4UQPA 1Y33E 2ZR7A 3VAZA 4N3AA 2I2WA 2NSJA 3U62A 3IKLA 2CMKA 4C0LA 1VPWA 3BD9A 3HGQA 1KC3A 1T2CA 2ZSIA 4Y6QA 3N2LA 3SLKA 2YV4A 1UJ4A 1ID1A 5ECWA 1G5IA 1RBQA 1XTSA 2C3YA 2ASVA 4XDZA 4LMPA 1OX5A 4QXOA 3ZQUA 4JI4B 3FSGD 3U7GA 1I7QB 1GGNA 4AN4A 4RZIA 2FPWA 3QHAA 1LRLA 1Q74A 3CN7A 4ITUA 4TTTS 3GOHA 5AVRA 3HRKA 3QOXA 5B4UA 1NBEA 3DLBA 4V0OA 5EHXA 5K09A 4TV8F 2VP3A 3EVAA 4DG5A 4Q66C 1A2OA 3BXOA 1G8HA 4RIIA 1RAEA 1UXJA 2GPYA 1YI8A 3WJ2A 3IUQA 1CZLA 3LL7A 3RBXA 4PSCA 2QTLA 1T43A 3E6AA 4X95A 1FTYA 3MTBA 2CVOA 4ZO6A 3UJ7A 3CFYA 1YRBA 4RS3A 2H57A 1R8XA 3IMGA 3JS5A 3SDSA 1TE2A 3MILA 4D2IA 5JQGF 4EBBA 3AF6A 3KB6A 3T8YA 1XD2B 5K8VA 3OIUA 1QHXA 2OUKA 2RKBA 1FFEA 3DMDA 1G3IA 4M1SA 3RTDA 4HDMA 4C0HA 4BECA 5J5VA 4AT1A 4C7OB 5M7EA 1VCHA 2CMDA 3MN1A 1JKXA 1WCV1 1SUAA 3VV3A 3BCSA 1DMSA 5DBHX 2R97A 1JLHA 4BV3A 2OAEA 3HP1A 1I9CA 2M6RA 2R8BA 4FW8A 5JTUA 3BMNA 3M6MD 5C1DA 3GGOA 1F2VA 1EFDN 1G42A 2GA9A 4R54A 2ST1A 2H2GA 2JHCA 4TMKA 1OT3A 5A0FA 4ZYZA 1IQUA 1EFLA 3QXJA 1Q84A 2GN9A 2YV2A 4JQCA 1XZGA 2P1DA 3B53X 1E2IA 1ZAKA 3I6IA 1XZCA 4AWBA 2R2AA 3MUOA 1C8LA 3ACCA 1K98A 1V2GA 3KT8A 3SYLA 3GT3A 2AF4C 1EVEA 2PZLA 3LX8A 4FE4A 4YEDA 3EASA 1DEHA 2IP4A 2PGAA 2Z2YA 1YIDA 3LAWA 4DIBA 4JXJA 3CVUA 2ZJ1A 3SHTA 3R75A 2HSJA 3LWNA 4MP8A 4RH1A 2PA0A 2PZKA 2C4MA 4XIFA 5HS4A 3GN1A 3U6BA 4MDFA 4BO9A 3GFRA 5AOBA 4CIXA 5JNUA 2OLJA 3USCS 1T6XA 3Q3EA 4X7BA 1D2GA 3BHMA 3FWPA 3N0RA 4MZDA 3IAM6 4A4DA 1I5RA 3HKCA 4KR9A 2QRVB 4S12A 1K7EB 1VHWA 3L0PA 3O8OB 3WGGA 1WAMA 3DCIA 4GECA 4Z7JA 3JQ9C 3M1AA 2G07A 2I54A 4LXUA 3TLAA 3IP7A 2IS1A 2IHYA 1DRKA 1NT2A 2R79A 2YASA 4UOQA 1EXVA 1HEYA 3WWPA 1XZDA 2DOKA 4QRIA 1UKBA 1PU2A 2XE7A 3GEGA 2NXCA 3NDJA 2YJ5A 1FCJA 4RSHA 1OXTA 4MARA 5B1DA 3EUAA 5CB4A 5CFMA 2D1QA 1ZQ9A 3DTVA 3MJ4A 4PV7A 5LD2B 1ZHHA 1QTQA 5KHLB 3FWHA 5J1SB 4MV8A 2ZLBA 4M8NE 4MVJD 2AHRA 1SOMA 5EKDA 3C7DB 4REQB 1OV6A 1MAUA 1B3RA 2P9CA 3S1LA 2JFPA 5KX5A 2J9XB 1I0LA 3EXG2 4G5GA 1Y9DA 2H3HA 4M0DA 2NO9A 2GASA 5HKLA 1JSZA 1OWMA 1ZUNB 3FDZB 2XTAA 1SM4A 3K9GA 1HLDA 3D4PA 2B4YA 3G2HA 3OJ0A 4O33A 4F4IA 3EPKA 3T7TA 3TYXA 1OGYA 1HT1E 2YZKA 3N76A 1GO2A 2COUA 3ELUA 5GQSA 4X1KB 1PR4A 2OBLA 4MUAA 4TUYF 2WIGA 5E38A 2QWXA 1ZL0A 2XI4A 3C70A 1OIWA 1RLIA 2G36A 3M1YA 5BOSB 2VAPA 1NWHA 3PD7A 2QSUA 2YN2A 1A2KC 2LW7A 4MV6A 2M2IA 1YK0A 5AK0A 1T5TA 2PWPA 1GZ4A 2G6BA 3LHDA 3OTWA 3UCFA 4XRGA 4Q93A 3ET4A 5AQ1A 1O03A 2EWWA 3AETB 3BSWA 3HCFA 3K8QA 1HT0A 5JDCA 2N75A 5EIOA 2B34A 3FCEA 1OZAA 4I6EA 4V03A 3VUFA 4RIFA 1GZDA 4JJAA 4YMVA 5JMPA 3VPBA 1UPBA 4YQYA 2PSHA 4C0KA 4UNQA 4HVLA 4YMLA 2WM2A 1OCEA 2I4OA 3R6DA 5I8PA 1QFJA 1WNFA 1LJLA 4AZWA 2XCUA 5E7JA 4IQ8A 1COWA 4N7MA 2Q21A 4AIIA 4GRAA 3JYHA 5EPOA 2FEMA 3GRYA 3WGHA 1E1YA 4JCOA 4RTQA 3HKBA 3ZDYB 3PYLA 4BXOB 4Z4IA 3OC0A 1U99A 1DFHA 4TRMA 2PEZA 5JAIA 3BXFA 2PSFA 4FHEA 1WWKA 3K3PA 4K9PA 4QHYA 1C3XA 4LWPA 4ZVVA 1BWPA 1M6YA 2BTOA 1OWPA 2AUTA 1QAMA 1V96A 2CZGA 1K92A 1C1XB 1JF8A 1HY3A 4JLWA 5TS2A 5K03A 3PRYA 3JQRA 3K92A 3OEEA 5IDVA 3ND5A 4WK2B 1X1CA 5ED0A 1NV8A 4LE2A 4ZK6A 4UTPA 2OOKA 2ZUTA 3DHYA 4RELA 5FD8A 3VR5A 3TCXB 2PE5A 4M8KA 4RM2A 1U8ZA 2O54A 3W7AA 4W1RA 3BN3A 2XYPA 3OCYA 1G20E 3AEQA 2HSDA 5KNBA 4J0KA 1WKVA 4CR6A 4YREA 3AR7A 4HMOA 4N5NA 1IOLA 1Y7PA 3KOOA 3R5JA 1QO9A 3AESA 4BLOA 4C4OA 1NUTA 1QYDA 2PUTA 2GNOA 4H6VA 3T3HA 5JZOA 3EODA 3LXMA 3HGTA 3SYKA 1H1TA 1Z08A 2CXHA 4F6LA 1RJWA 2ZWPA 3DSRA 3GD5A 1LVUA 4DNOA 2V9ZA 5D5PA 3UFXB 1Y8RA 3PT5A 4LHYA 1QP7A 2R751 1YH3A 3R7AA 3FMFA 5EJ8A 5IVPA 4QUAA 4GPIB 3L0BA 1O5OA 2F1RA 3CUVA 1MMFB 5JH7B 4PO3X 4XLTA 4F3CA 3W9YA 2QV0A 1EFHA 4F4DA 5CIYA 2AEJA 3BHNA 5JXWA 4GKJB 3WNVA 1NNLA 1F3OA 3ZLUA 4ALIA 1HDXA 3RHZA 4FFBA 5LQMA 4E08A 3WBBA 3A4VA 4DVJA 3L8DA 2KM1A 2QN6A 4FOOA 5CB8A 2NV2B 4D1YA 1X9HA 3NHWA 2NADA 5BV0A 4ND8A 3ICOA 2J33A 1PW7A 2VF7A 1O96A 2IV2X 1FK8A 1Z2NX 2D8AA 3E0XA 3EIEA 3PHBE 3ECSA 4U7PB 1SB9A 1D5CA 1XEAA 4FUQA 4TT3A 3G1WA 3LX4A 3IPAA 4OVKA 5FHQA 4CV1A 4CG2A 3PXGA 3L02A 4N5DA 5JROA 3TD9A 3O94A 2Q5JA 3R0ZA 2C31A 4HCJA 1QRAA 1FVFA 3EDMA 4KQGA 1Y0BA 3KTAB 4YMUA 5I4CA 3Q7PA 3RREA 1XTVA 1RPTA 3DFZA 1R4MB 3LKZA 4ND1A 2XCIA 2XBUA 4DFDA 5IDYA 1DU4A 1IG3A 3C8UA 3C3EA 2OAGA 4Q18A 5K20A 3DFIA 3GLGA 1MC1A 1I2DA 2HUNA 1VSQA 1Z4PX 3TNYA 1ZS9A 4K9DA 4DIDA 2ORIA 1DZ3A 1ULHA 4E07A 1K2VN 3HB4X 2QF7A 4YCBA 4ZCLA 3GDWA 1XAIA 3L5KA 2D0IA 2DSTA 4EPWA 5H81A 1IAVA 1V6CA 5D8DA 2Z5GA 1PJ8A 1CRLA 3A9UA 2IVZA 1NGSA 5HPYB 1L4LA 4Q01A 1Y82A 2AJTA 1TTQB 2E7ZA 3OLZA 5CLHA 4OXQA 1DAEA 4MRSA 4C7MA 2XVAA 4PHFA 4YAWA 3R74A 5KVVA 4KWTA 1UJMA 4MW9A 3QBTA 2VRCA 1WNTA 4QVKA 1GAWA 4RJIA 2VQSA 1ORDA 2H31A 2O14A 2ZBFA 1QDLB 1ULBA 3FLAA 3OQVA 1EFVA 1B73A 3AHHA 4KSYA 1N5KA 4KRYA 4P36A 2PO7A 2NU8B 1KKLA 4IZHA 5T6MA 2FKNA 3T1OA 2IEBA 3T9CA 1A8QA 3CC8A 4F5WA 1MR3F 2RGBA 2WVAA 4I1RA 3ZHOA 1QV7A 1NLMA 2C8KA 1CVLA 2LV8A 3I9JA 2AWNA 1VMIA 4O4LA 2JKYA 1V3UA 4QNRA 1KU0A 2G5PA 1RYYA 2P0EA 2QD1A 3QQPA 4LTMA 5LA6F 5FFFA 3X3HA 5B1HA 2V1UA 1WV1A 3II6X 5K3CA 3URMA 1HSOA 1TPZA 5EP2A 1S2IA 1IXKA 5G0UA 3H1PA 3ZHBA 1W76A 2NO7A 3C1OA 3D8SA 4RANA 2ZVPX 4FGUA 5HVNA 5ARCA 4CLDA 1PKXA 3LLSA 5U9CA 1X7DA 1YB7A 3OIFA 1UK8A 4B9EA 3JYLA 2GB4A 3R3WA 1U1CA 3LBYA 3KQQA 1LVGA 5ALXA 1E61A 1HDYA 1F60A 1UXIA 2PNFA 2ZTSA 3JW8A 2R00C 3QLUC 4CN9A 3FYDA 4DE5A 2NV6A 2MSLA 5BUQA 4BO5A 1V6AA 3O8LA 4W5NA 2X2EA 3WIBA 2X1MA 1DXHA 1RI4A 2C2YA 4AN0A 2Q4DA 3D0OA 4IQ0A 3UA4A 5LQUA 2UUAB 3L8FA 4LDQA 4QDKA 4DBLC 2A9PA 13PKA 2QM7A 3VPSA 2MSEB 3B6KA 3ZZ0A 2FR1A 1OAOC 4CPDA 2HRCA 1CDEA 2WAAA 4EW6A 5ICCA 2QX8A 1U7DA 3QITA 2DHCA 4AJ4A 4D9EA 3CLUD 1B4DA 3DE0X 4K87A 4KN9S 4KXXA 4UBLA 1GYPA 3GA0A 2B0CA 1YXMA 4QX6A 2XRMA 3AVVA 3KYDA 4GIBA 4RVOA 4Z6KA 1Z4NA 1V5GA 4V0MA 3MK31 4EECA 3HCCA 1WD5A 1YR9A 2I4IA 1E79D 3DD1A 3GA7A 3NO4A 3THXB 4Q4CA 2XOKD 4DCPA 1QQAA 2BM8A 1JR4A 3D8RA 5B3JC 4QKQA 2OXRA 2YFYA 1D0SA 3KJZA 2IUEA 3RYFB 5JASA 4BFLA 4PAMA 4L02A 4BP1A 4CL2A 3PX2A 1XYYA 4YJHB 3SJCA 3I2HA 4R16A 2X86A 4L9WA 4RF4A 1BVHA 1DGQA 1QHEA 4WHMA 5FOXA 4JJ6A 2XNDA 3OFVA 4YDQA 1E4EA 5MDHA 3F47A 1KEVA 4K8RB 3HKDB 4JLJA 2OVBA 2WBLC 3KPJA 4E2FA 2BGTA 1AJEA 2PFSA 1U1EA 3VZDA 1P81A 4YRQA 4PN3A 3SZOA 1OBCA 1NG9A 4U3JA 1E5XA 3RFTA 3AL3A 1CBUA 3GJ7A 4XEUA 2HBYA 3FPHA 3RODA 3MJVA 1ZK0A 1M6VB 2OSVA 5DT9A 5AK3A 1UK9A 2BZ1A 2MSKA 2XITA 4MVJG 2B4AA 3RBVA 1W5AA 1I6LA 3B2QA 1D0IA 4HP8A 5KINB 1W6RA 3SXUA 1BX0A 4WKOA 5CM8B 2HLDD 1QG4A 3AJ8A 3E27A 3UEOA 1DT3A 4OGLA 2GESA 4X91A 4B7AA 3LDAA 4BZWA 3ZHRA 2X9LA 3GJRA 1D2CA 5KYYB 3NNDA 2HCFA 2JFYA 3IPXA 2FUKA 1YUMA 3ORYA 5DTJA 3TOCA 4PR3A 2WUVA 4C1NA 1AY0A 3OO0A 5DBEX 2R8ZA 4V02A 3B70A 3NTLA 3JATA 1OXVA 2DFPA 3UB2A 2RGAA 5A4KA 5LPNA 5EJ6A 4IDEA 2Q8QA 5I7EA 1AKNA 5CIWA 3O3NB 4F5DA 4Z7OB 1M5TA 5A3QA 4YPFA 1CPYA 4C2AA 5F2NA 4QU9A 4LJYA 4QLBA 1D6NA 1SVUA 2H2AA 4G1UC 1RRKA 2Q50A 2V7UA 2PWYA 3GYBA 2R7MA 4PGMA 5HZKA 2PL1A 5KDDA 2YXEA 3F3MA 4JL8A 3ABZA 3FSJX 5F2EA 3SS8A 4DZTA 5JLJA 1MHTA 2O59A 3S1AB 4N7JA 2Y27A 2A5DA 4H0FA 4QPJC 5KKAA 1UR5A 4CWAA 2OFOA 3ZWQA 2C5FA 3EMBA 1GPKA 4QXQA 4GH5A 1Z4LA 2J0UB 4MS3B 3M82A 3SFZA 1S5PA 4OYHA 2CUTA 5DJ5A 1PFYA 2ZRBA 3QP9A 4KSBA 4JYBA 1JEEA 4QEZA 4R7ZA 5CB4F 1RZVA 1QO7A 3MT9A 3ODGA 3WWZA 3KUCA 4MVXA 3HA5A 5H16A 2R60A 5ITSA 1LLUA 2GBPA 4QUGA 4ER3A 4QZVA 1FDTA 1P1CA 2DH5A 2ZIAA 2WHPB 3C3AA 1RXSA 3CEHA 3HU5A 3IT0A 3O21A 4G37A 5LB4A 4B7ZA 2ZQZA 1DAOA 2Y1FA 3ENVA 4G56A 4L8GA 3DYBA 4P35A 1PF7E 3LWBA 4YX9A 4LSZA 5C1PA 5D3KA 5JECA 4JXXA 1LCIA 4JT9A 1GZSA 3T7JA 2QAJA 2IXBA 3F5DA 1RHRA 1DXOA 3INTA 1UPUA 1X7GA 2XMRA 4OHFA 1N5JA 3QELB 1N2BA 1UC8A 4BFXA 1XCLA 5KHAA 2IBTA 4Q7EA 1NW5A 1ENPA 5I7WA 4WY5A 1XU7A 2AKAB 2AG1A 1XRNA 4KK4A 5F7ZA 3BAFA 3BTOA 3WMFA 5DSTA 1UL1X 3S99A 3TG2A 1CJVC 1AO3A 3WL4A 2AMJA 4I3HA 4L9RA 2A1TS 4O63O 5G1PA 5GONB 5F3RA 3VSAA 2XV1A 4KP7A 3ZEAA 4A2PA 2PZBA 1QKJA 2CFRA 1EJBA 1E5QA 1FNMA 3HN6A 2LKDA 1NMQA 3C24A 2HTEA 4WNYA 4A10A 2JLYA 1CRWG 3GJTA 2ODEA 3KB2A 3KZVA 1APBA 4IS2A 1T3SA 3KSZO 2GTIA 1U98A 4IGAA 3RFUA 1MENA 3T38A 1D1SA 5DNDA 1LTKA 2EGGA 4DB2A 4PTLA 1W5EA 4AROA 1NP3A 2C1XA 5JU6A 3TAHA 1I4WA 1OH5A 2GD2A 1O87A 1UK6A 1T36A 1DO0A 3FI0A 2K5UA 3ML1A 2P4HX 4ARZA 3DBRA 3EF0A 3T54A 4ERXA 3DT8A 4OYLA 1QFMA 3RB8A 2ORYA 2WQ7A 3M6VA 3HJUA 3MAJA 1A69A 1CUWA 3PGVA 4ABTA 3JZDA 4MTLA 4YP1A 3R0XA 4JBHA 4ZYTA 4OM8A 1BEEA 2YWBA 3IIIA 2AOTB 4OL9A 3FOZA 2G80A 4GOMD 5HJ7A 2ZUCA 3SKYA 3CVWA 2B4QA 1PGQA 4MPDA 2FRDA 1JDVA 3OZRA 3HH8A 5FKJA 1FE8A 4IMIB 3HZHA 4WUTA 1DE0A 4R1LA 5DT2A 3NG1A 4FI3C 2A1IA 1F8GA 2FWIA 1NA5A 1R5OA 1Y9EA 1T24A 2Q9UA 3PI7A 3DMFA 2HF2A 3RTAA 3OEYA 2WWXA 4X6LA 2QIPA 2ODQA 5A7HA 1WSDA 4JBYA 3R5XA 4KQJA 1QHFA 221PA 5TMDA 5JYDA 5KPDA 1L5WA 2UUCB 1TJPB 2PBZA 1N7IA 5EAIA 4GP9A 4Q1BA 2WLSA 1NT4A 1ANKA 4NESA 3N2GB 1C1HA 2JI6A 3PD1A 5E1MA 2C58A 4IMPA 1R6XA 4JLVA 4J0DA 4RLFA 1Y9JA 3M1LA 5E8JA 3HHEA 2RKWA 1U81A 4EHJA 3BRWD 2DWPA 4OHXA 4BNGA 4CM9D 3AY0A 1BCRA 2GERA 4FJ2A 1KWGA 3WQQA 2IA5A 4A73A 4CLRA 5CLFA 3GMIA 1FTWA 1M9NA 2RAPA 1JJ7A 2BGIA 4BBPA 2UZAA 2QNIA 4GRIA 5A4JA 1GA1A 3E15A 4UBIA 5LQCA 1KETA 1A8IA 3V8PA 3GA5A 4JI0B 2A14A 5L4LA 2D7CA 4NHOA 4US2R 1QIKA 4NU5A 4OHUA 1JHYA 1BJRE 2GPTA 1ITZA 4ZRMA 5G02A 2XCSB 1EWTA 4RPIA 2I4RA 4NRDA 4WN3A 5F9HA 1QH8B 1VCMA 1Q57A 2PLWA 1O9GA 3DW1X 4LIPD 4WA7A 1T9CA 1TU3A 4EMSA 1GUDA 3AG5A 4LYAA 3UMBA 3DVQX 3QX7A 4IRXA 1AKWA 2RK4A 4OQMA 5D7BA 1CJTC 1P2FA 2YXNA 3E03A 1VIYA 1P9NA 1VJTA 2LGJA 4MUEA 3AX6A 2IPMA 2YJTD 3N1UA 4QUHA 5CT8A 3TGLA 1E1RD 2ZBEA 4WE3A 5LYJB 1P9RA 5DULA 3WOHA 3BHJA 5DTEA 1PKEA 1D0VA 3TSZA 3ZJYA 4PLTA 5ARBA 5SZJA 3QU2A 5L53A 4QXAA 3ZQ4A 5HIKA 3M83A 1ST3A 5TARA 2CW5A 4BKQA 1MNQA 5FQNA 1GZ7A 5T67A 4E1BA 4P3NA 8GPBA 3G1UA 4WZZA 5CDSA 4XRRA 3F67A 2INGX 1R5BA 3E22B 4IHKA 4NF2A 3KL4A 2BGLA 3OCVA 3UZUA 1AXEA 4F3KA 2AWOA 3QFTA 1GNTA 1QBKC 4QNMA 1SXJA 1IUPA 3BIJA 4E3WA 1IQPA 1QRTA 2NGRA 5DW0A 1LBSA 5BN4A 3BDAA 2VP5A 1JPUA 2I76A 1C1DA 4B87A 1E6WA 3DVLA 2OY0A 1MDBA 3HXKA 5EIBC 3IUNA 1AKVA 1IJFA 4BN0A 1X7YA 4DM4A 3ZDRA 1CW2B 4Y0NA 3SZRA 1XA3A 3RUIA 4G4JA 3EOZA 2VHJA 3TQTA 2B35A 1A8PA 2IPOA 2C29D 3CO5A 3K32A 4PLPA 4H9GA 2VTBB 1XVTA 1OIXA 4HX9A 4B0OA 3QVGB 3E1GA 2FDCA 1CF2O 1X92A 3EAGA 3HSYA 4O4LF 1KSGA 4LMRA 4ENRA 1GDTA 1VYVA 2PEYA 2VHEA 3A3YA 3DV9A 2SKEA 5L40A 1DT5A 3B6JA 1P91A 3HMQA 3MGGA 4WZAA 3HVUA 1J49A 4B31A 5JPDA 1PR3A 2P35A 4W8GA 1JEJA 1BKSB 5F1YA 1H94A 4M1OA 4C87A 5G53C 4K0KB 1E99A 1H2EA 2XWPA 3KV3O 3KZOA 1FPMA 1U0SY 2R6CA 4PZCA 4GKAA 3WGOA 2P2NA 3S8EA 1QWSA 1VFPA 3E9ZA 4L9AA 2FHSA 1E8NA 2O0JA 4HEA6 2FRXA 5DNCA 1L5YA 4CR8A 1D2NA 3A4MA 4U2CA 1JEAA 1QPBA 2R4QA 2FV8A 2PPVA 4RQTA 3MMNA 2IZOA 4LY0A 5ICSA 4BNYA 2XTMA 5B7NA 3COZA 4UATA 3PXUA 4M8LA 1AKMA 3U5ZB 1KO4A 4MULA 3WLSA 3ABQB 2NWQA 4KV7A 4OLJA 4I1UA 2FGKA 1MO2A 1EG2A 3SM9A 2HRBA 3O92A 2OV2A 1JVBA 1KYZA 3A04A 1Y4SA 3KYBA 3JVIA 4GI2A 4UW9A 3RT7A 4DQUA 4CGYA 2A1TR 4Q1FA 1EJ6A 1WO8A 1JWAB 1L5HA 3IQZA 4FHFA 2BGGA 1O9BA 1NULA 3AEYA 3PFNA 5EZ6B 3PEUA 2XW6A 4IRUB 2DBRA 1OH8A 1G0OA 4M0PA 2P8JA 2PJDA 4RV4A 4AF6A 1OVGA 3MWDB 3B9BA 3MSXA 2I8AA 3LF2A 5DWVA 4MEAA 1ZESA 3RGGA 3V2GA 1Z6XA 1TW3A 2J41A 2OP1A 3O1HB 3NWEA 3VR6D 3A28A 5KNDD 4OV6B 2C5GA 4F2PA 1HE5A 1A9XB 1FFBA 4GICA 4CLOA 1T1GA 3PHGA 5A1TA 2GEDA 1G21A 4QYIA 3ZIAA 3NNSA 4P2BA 3W8NA 1XQWA 2Q4EA 4J03A 3I3OA 3I72A 5KQGA 5TY0A 2WFZA 3MAAC 4KC0A 2MSCB 4I36A 1JSRA 2PXCA 4QGFA 3AT1A 4M88A 1IK4A 3GP8A 4Q1VA 1GEEA 2M1XA 3CJTA 3ZIDA 3C4QA 3N2NA 1JAHA 3DE4X 3CH6A 3UK6A 1QU3A 5JSZA 1UAGA 2EFJA 3VR6H 3FKQA 5KNDH 3ZK9A 2ZKIA 1X1RA 3I37X 3QNMA 4OP2A 2QLJA 5BRAA 4P84A 2XQFA 1Q91A 1QZZA 2H65A 2ZUDA 2ZTVA 3PGLA 2EZ4A 4URWR 3QE0A 4BNNA 5FNVF 2CMFA 1ODLA 4FT4A 4DEYA 3R3HA 2CJPA 1XEXB 1Z37A 3L1HA 4G1FA 4J75A 2IE8A 1CVRA 1JZQA 1BMDA 2EQBA 3SLRA 2W2PA 4CIBA 2E5WA 4BLQA 1T0PA 1XALA 5A0TA 1RWMA 2ZJ5A 3KOUA 5D6OA 1MH1A 2JAPA 4DDKA 2JVJA 4PCVA 4YJ2A 1TB4A 1OLOA 3FB4A 4RMJA 3TBKA 2JFHA 4HRAA 2V74B 3AMVA 3EF3A 2X4DA 2IWRA 1G60A 1A7KA 4G5FA 4PC7A 2PLRA 5E8RA 4EY5A 1Q1QA 5LP6B 3ZI0A 4ZYYA 3NDPA 3ZYCA 5CT9A 1U4NA 1X7WA 2YNMA 4DG8A 3QUAA 3EZXA 4M0KA 3EPLA 2DG2A 4XM2A 5EL0A 1N5LA 4DXDA 3NTRA 1U0JA 4IEIA 1KI4A 2PD6A 4ER6A 4FOLA 1TEHA 5TPZD 4LY9A 4TWAA 2XR1A 4JFRA 1YS7A 3UV3A 1L7VC 2HCBA 4DANA 2QQ0A 1UKZA 3BSSA 3RVOA 4EP1A 4XTRA 2NTJA 1RP7A 3BMOA 1C5KA 2BFWA 3AKYA 3AIOA 2ZKLA 1H6CA 4PXAA 5AUOB 3ZHZA 5CEJA 1VL8A 2JFFA 3FHCB 3L8ZA 2GHTA 3DWGA 1WY5A 2FNAA 4PXYA 3K16A 4JBXA 4X93A 2PA3A 3CIFA 4RTMA 3PFHA 2H1SA 4JT8A 2J4FA 4NCKA 5B1EA 3EK2A 5DHUA 4Q3KA 3DDNA 1V16B 3V1YA 4W8HA 1NAIA 3WO0A 3FNQA 4OHOA 4DUYB 3K70C 2I9PA 1YBMA 3RRFA 4C04A 3WYBA 1ACMA 3ZVLA 4GGMX 4L15A 1VLMA 5DM2A 1UUFA 4PRYA 4FZRA 4N41A 2QLLA 3VI3B 4Z86A 3TRJA 4ZODA 2VVTA 4Z54A 4IDNA 4B4VA 1L6RA 2HADA 1ZZEA 3KFVA 5A5GA 2Q6OA 3CH7A 4HF7A 1ABEA 3K05A 2IH2A 4CM1A 1MNAA 3A3OA 3P4YA 5E2AA 4EQZA 2JGRA 2JLRA 4YYZA 3PQ5A 3C7CB 5SY9A 1P31A 2WD7B 3T15A 3CA8A 3NEPX 4JBWA 4P54A 5ITZB 5A5VA 3EXHA 2F9FA 3BMCB 3HPRA 4FR5A 1L5GB 3F9CA 3IP6A 3QHPA 2P9YA 4OQEA 3AM1A 4LECA 1U2DC 5J5CA 3V4RA 2E4ZA 5ESRA 4ZYUA 2X3YA 5FJIA 4ZD6A 3PV0A 2P7HA 3RHFA 3SBOA 2D7JA 2I0FA 2V0CA 3P0JA 1NJ8A 2O2SA 1NUPA 2FZEA 2N47A 1C8BA 1YR6A 2QDXA 3STHA 1E2JA 1W88A 2G88A 4JLOA 2R7KA 4DCOA 4LFBB 2EZ8A 3OAAA 3GBSA 5C4IA 3NOOA 1N9GA 1NI4A 3EC2A 5EKXA 3RQIA 4FD2A 3B3GA 1R2QA 1J0DA 4N3CA 2AFRA 2FFHA 3X43A 2FYTA 3DWIA 2N42A 3BEDA 1RMYA 3MBIA 3Q1KA 4MWZA 1XMSA 3H4TA 4OUDB 3ZJ4A 4IDQA 1I7NA 3A4NA 2GCIA 3OLXA 1O8BA 2CYBA 2ZWIA 5TT1A 1E1CB 1MJGA 3KQNA 2H51A 4W5WA 5FRDA 2D5LA 2G04A 1JHMA 1TF2A 2B30A 5F1PA 4CEJA 4N0MA 2CZCA 4ZMSA 3GPIA 2QTFA 3IIKA 4ENVA 4WSOA 1JR3D 4ZVPA 1SXHA 1Z34A 1NY5A 4RC9A 1U0TA 2EVWX 2ISSD 1Y3BE 1BAPA 2XQIA 4G0WA 4X1OA 2W6MA 1UMDB 4BAUA 4BE9A 1EQAA 4CODB 1CHNA 1JU3A 3KCQA 3UTCA 2P91A 3LY7A 1WPXA 3KAKA 2VZ0A 4UREA 2ZZNA 4S1VA 3F74A 3SWWA 2R8YA 2FUEA 4MVJI 1VCOA 1XDWA 1I33A 1BGXT 5DIFA 4YWJA 1G1MA 1Q11A 1KI6B 3G2LA 3Q3IA 2EGHA 4RK5A 3T94A 4OI4A 1V1MA 4KQ2A 4QFMA 2SICE 4XD7D 1NV9A 4PC6A 5MF6A 1UK7A 4JH0A 1RC0A 4RVFA 1X38A 5FPTA 3GGGA 2W2TA 3A1NA 4MI3A 1I13A 1A9TA 5LZ2A 3QW4B 2AA3A 2PGXA 5JNRA 2RHRA 3I9V1 1IJBA 1XN4A 2JB9A 3ND9A 1ZMBA 4G01B 2EW1A 2AV6A 5HQJA 4O08A 1MZVA 4DEXA 1XPUA 1EVIA 2QT9A 4JJIA 1BNCA 3EJ6A 4PYMA 5KOJB 2HHAA 3EDCA 3SKXA 2O8CB 1XD9A 5BSHA 5FP0A 2Q7XA 2J4CA 4F21A 4WNAA 2QE7A 1VOTA 4MX8A 4WBNA 1J9GA 3JD2A 1QGOA 4M54A 5IZ4A 1Y80A 3COYA 3WGKA 3WGZA 1Q1NA 2H2HA 1R7RA 1FZQA 1T4BA 1JG7A 1WEHA 2C4TA 3IAS1 3O1JC 5BQ3A 1SCKA 1GTMA 1VDMA 2VEDA 3BFKA 4Q1DA 2AYYA 2BR4A 2J3HA 1OFVA 5DMHA 3W4KA 3O7MA 1PL7A 2H17A 3WIUA 4OHCA 2VJLA 1ZHOA 4LF8B 3NWBA 4MEBA 3FF4A 2CJWB 3WZ2A 4ALLA 3IERA 3MRVA 3U1BA 3OTGA 4OHRA 1KXZA 3ZU6A 3L0OA 5J4HA 5FLXA 5CCXA 3W5UA 3ZGXA 4DMMA 5G41A 4D4JA 1H23A 3IUEA 2DEUA 2Y0DA 3OEHA 1PZNA 3I1YA 3OCXA 2JIRA 3R3YA 1WB4A 4MKGA 2EP5A 1ZFNA 4B6EA 1OROA 1NY6A 4I6JA 1GGMA 5BSVA 4GXQA 1N2CB 1YRQA 7ABPA 3IEVA 1P9WA 3ECAA 4HS9A 3M34A 3ETLA 2OM6A 3KSAC 2FJ0A 2NP7A 4LE0A 4OXYA 3RVLA 3TCNA 2WOOA 2HSEA 3FFWA 2ZRKA 2O8EA 4S0ZA 2XE8A 2EXXA 1IN7A 3HNOA 3UVEA 1PNTA 5AOVA 4CTKA 1JQDA 5DNYB 1IWBB 1VIDA 2FSFA 5ES3A 3G0GA 4ZDWA 1Q2XA 4A26A 3SMQA 2QPAA 3GL9A 2Z58A 1EUCB 2PKWA 3AVPA 1JVSA 1W8IA 3PGXA 5G4KA 3VH3A 2IQIA 2D0PB 4I6GA 5JANA 2C78A 4KLAA 5AM5A 2DPHA 5H80A 3R5KA 4RK0A 3DBLB 1CJSA 4WD3A 4Z5XA 5LQJA 1ZR2A 4MLPA 3X1ZA 1I7SB 4I1OA 1SC6A 3I42A 4DJDC 3ZLTA 1AO0A 3PKZA 3V55A 2B3TA 2VG8A 2VJDA 1S6YA 4RVNA 1SQ0A