4JX8A

Crystal structure of e.coli enoyl reductase in complex with nad and aea16
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
publication title Crystal Structure of E.coli Enoyl Reductase in Complex with NAD and AEA16
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jx8A00
4UUOA 2P5YA 5U1PA 2BF7A 2VWGA 3DTTA 4Q3BA 4A03A 3T7EA 1P1KA 4IM7A 4BNLA 4CM9A 2C54A 4G65A 2DC1A 4ZRNA 5ENVA 3HUDA 3H9JA 3T4EA 2AW5A 4YRBA 4E13A 1RM3A 2GZ1A 5C7OO 3G17A 1ZCJA 3HWRA 5ILGA 3ZGYA 3NTRA 5A5FA 2NACA 3KO8A 3DZKA 2UUPA 1X7GA 4TRJA 2X0IA 1SO8A 4RVHA 1E1LA 4L75A 1IZ0A 1AXEA 4NHEA 1FXSA 2V6BA 4D0SA 3H3JA 1EEHA 3MCVA 2EJVA 4HFRA 4R3WA 1P3DA 3JSAA 4L9RA 3PHLA 4J9UE 4OXKA 1IL0A 4G5HA 3EUWA 1DSSG 3EGOA 4LCEA 2VT2A 3RUIA 1AHHA 1P45A 4Z3KA 3CZRA 1F14A 1SEVA 1LRKA 3D3WB 2H63A 3SJ7A 1F0YA 1B0AA 1X7DA 5G0UA 3PLNA 3ZU2A 4MDHA 1GL3A 4LGVA 2G1UA 1LDBA 1LQUA 3B6ZA 4DPLA 2EP7A 1KVQA 1R0KA 1R6DA 2QZZA 3OIDA 1RPNA 4CM4B 4Z0HO 1ZW1A 2Q1WA 1LTHR 1KERA 1K6JA 4IIUA 1LA2A 1N9GB 4CMGA 4CUJA 3INGA 2AEFA 4NZ9A 3WGGA 3UICA 1SCUA 3L9XA 5JO9A 1RM0A 1TXGA 3HB5X 4Q3DA 2CDBA 1SAYA 1Q2XA 3V2HA 4YPOA 3FD8A 1DEHA 3CH6A 1NFQA 2VNAA 2O4UX 3QA9A 3A9WA 5FFFA 4HY3A 4S1VA 1I0ZA 4IXWA 5JS6A 3AOEA 2Z5LA 4I5EA 3I23A 4WOJA 1U2DA 2GN8A 1LI4A 3GPIA 1SBYA 3GNTA 4BV9A 1DRUA 3GUCA 4Y9DA 1Q0LA 3FBGA 4BNIA 4B79A 4BKPA 2Y0CA 3COSA 1OC2A 5BR7A 4IS3A 1F8GA 1HDGO 1OI7A 5JDCA 4DBVO 1PEDA 1QYXA 2B35A 2NQ8A 1PJ4A 2PH3A 1P77A 3GN1A 4BS9A 4GGPA 2X22A 2I67A 1Y8RB 3PQDA 2O48X 5L4LA 4CQMD 4EYEA 3QVTA 3PWSA 3BMOB 1EVIA 4GSLA 1BW9A 5A04A 1LXCA 4XDYA 4RQUA 2OOSA 1I3MA 2YUTA 5FYDA 1YKFA 4CMCA 3P2YA 2ZB4A 4WLUA 5EMHA 3ZI0A 5IDXA 4K6FA 1H93A 3CTMA 2AEMA 3NYWA 1Z74A 4U6SA 3PFFA 5FEUA 3DBLA 1JKJA 5COQA 4S3MA 7ADHA 4DIOA 3PWZA 3ENKA 1RM5A 4NMHA 4QFCA 2C5AA 1UAGA 2NVWA 1C1XB 3VH3A 5CP8A 5HS6A 4A5OA 2DBZA 4LISA 3VAZA 2FSSA 5A3JA 1ULSA 3CUKA 4UEOA 1X0XA 4WUVA 4DPMA 4DRYA 4H3VA 4RF2A 5A1TA 3ICPA 3TJRA 2C2YA 3FPCA 2YDXA 1ZEJA 2TMGA 3AUSA 2PK3A 4QTZA 3I9KA 5I9MA 3C1OA 1WLYA 4KQXA 3WB9A 4EGFA 4RGBA 4NU6A 4L74A 3INRA 4GL4A 4YJFB 2XF8A 2JCXA 4BNXA 3NTQA 5HM8A 1PL7A 2DAPA 4Z0TA 4HADA 3VPSA 2HJRA 3PJDA 1Z7BA 1NPTO 3GDFA 5I7VA 5GMOA 3GFGA 4QO8A 3WNVA 2ZJ0A 2O7SA 4HFMA 5KVVA 3BZUA 1DAOA 1MGOA 1FDWA 1XLTA 3KUXA 3ONDA 4N5NA 2AE1A 1HE5A 4FFPA 1PGJA 4QEDA 4I1IA 1JA9A 4BO4A 2BRUA 4K6CA 3BMNB 3BXXA 2XOXA 2C2XA 3ZWVA 1HT0A 2BGKA 5JXWA 2CF5A 1EK5A 4E31A 4XRGA 5F1PA 5L51A 1XQ6A 1ULUA 3KEOA 4FQ8A 3L07A 3TFOA 1O9BA 3OQBA 2JHGA 1DIAA 1W8DA 3RUEA 4TKLA 5IXSA 4GX1A 2O3JA 4HBGA 2YHIB 4LRSB 2Y99A 3R3JA 1PU2A 3I9LA 3WJAA 2X58A 3DFZA 1NQTA 1YO6A 3RFXA 4KOAA 1YL7A 4XB2A 4Z9FA 4E6PA 3QVOA 3I9MA 3GVCA 3QRWA 4G2NA 4W7IA 4F6LA 4O63O 1A71A 1XYGA 3NX4A 3WTCA 2FPIA 2CFCA 4PLCA 2IXBA 1PJSA 3D3WA 1E92A 1T1RA 1SEPA 3JD0A 1U3WA 4EUFA 4PCVA 3ZWXA 1R0SA 4NG5A 3H9GA 4PLVA 1UH5A 4CM4A 2W98A 4MKZA 4ZHSA 1H2BA 4EDFA 2Q45A 4CR8A 1N9GA 3KOUA 1NVMB 2I99A 1XR3A 3ZV6A 2WEKA 3INTA 3KYDB 4PLPA 3E5RA 3K6JA 4D43A 4KWHA 3DBRB 2Q2VA 1A9ZA 1RM4A 1HE2A 4FJ1A 2ZB7A 3F47A 1KVTA 1XCBA 2VYND 2ZATA 4IGEA 4Q39A 3M2PA 5IN4A 2JKVA 4ZQBA 3JYLA 3S2FA 4XQEA 3Q2KA 4BO9A 1BXZA 5TLSA 4DC0A 4E2WA 2HMSA 1Q7BA 3GRKA 3HFSA 3K30A 2IRWA 3ROMA 6ADHA 1FF9A 2ZCUA 4FC7A 4YJHB 2CY0A 4JQCA 1EMDA 1OBFO 2IZ0A 2HQ1A 4J2OA 5T8KA 1U3TA 1UXJA 2EGGA 4BO5A 3DZBA 2P4QA 4QFDA 5K9ZA 3ASUA 3DHEA 2IYOA 4XJSA 3DZJA 4AJPA 5KCZA 3WLFA 1ML3A 1MG0A 1YJ8A 2DFDA 1NR7A 1NBOA 3GK3A 3JYPA 4CV3A 3GGPA 4M87A 1YBAA 2QRJA 3BMOA 3DZGA 1ZK2A 4TVOA 3SX2A 4D3DA 3GN2A 2C5EA 1A72A 1GZ4A 1MP0A 5CPFA 2AQHA 3ABIA 3WBFA 5HA5A 2RHCA 4BQRA 1E6EA 4R16A 2OBNA 2ZQZA 3TQHA 4FC6A 3LC7O 5EL0A 2D59A 4EUHA 1E3IA 3UF0A 4PG4A 4BNUA 3QVWA 1GUYA 4W9NC 1YH3A 1BTOA 1A9YA 1L7EA 3KBOA 4NFYA 3EMKA 4OJNA 1E1NA 4W9NA 2VWQA 3Q3CA 2X6TA 4H15A 3HDHA 3PHIA 3PZBA 1VL6A 4IQGA 1SB9A 5IJZA 1KVUA 1KYQA 1ZSYA 5A4DA 2Y0EA 1I24A 1QG6A 3EVTA 3PYMA 4PLHA 1BXKA 4AJ4A 2PD6A 4BKOA 3NT4A 1YL5A 4CMAA 4IDAA 3ZU4A 1VJTA 2DLDA 4CMIB 1HDXA 1GV1A 4UUPA 1ARZA 4ZVVA 2EV9A 3FR8A 3V5NA 2I5PO 4J91A 5A9SB 1R4MB 4YJFA 4INAA 5TF4A 3RIHA 3F3SA 3KEQA 1K2WA 4FSHA 4MKRA 1U5AA 5KKAA 5KJEA 1ISJA 3VPXA 2NVUB 3FHLA 4PLYA 2X0NA 1EDOA 3K31A 4DIBA 5C5IA 4CMHA 3RVDA 3QW2A 2P2SA 1LDMA 4H16A 2UDPA 4XQGA 5JW6A 5F5LA 4LMPA 4DQXA 1IY8A 1YL6A 1PJLA 2HAEA 1GQYA 2HDHA 3CMMA 4J3FA 4AG3A 5CG1A 3TZQA 4AJLA 2YHIA 2FN7A 3VZRA 4W7HA 4BO0A 2VYVD 1VKOA 1HEUA 3WWYA 2I65A 1VJ0A 4XX0A 1ZMTA 3F4BA 3E9MA 4IJWA 3SJUA 4BO6A 3WWZA 2R00C 3G1UA 1TVEA 2H6EA 4CLDA 4UVEA 4TKMA 2IDZA 5TJHA 1CETA 3ZU5A 2AQ8A 1Y5MA 2NU7A 2DBRA 3PQFA 2BGLA 3D5TA 3AI3A 2O2YA 1I3KA 1A4UA 4ZQEA 3UUWA 1LSJA 4EJ6A 1P74A 4RPJA 1R66A 4MIYA 5CDSA 2D1YA 2FMUA 1CEQA 3V1UA 1MA0A 1D3AA 1N7HA 5COAA 3P19A 3HG7A 1K6IA 4L8VA 3ZWOA 1UP4A 2GD1O 1BVUA 4WLFA 4NBTA 2OP1A 3RCBA 1TLTA 3UVEA 2VZ0A 1LRLA 4R51A 3WMWA 4ALIA 1PWZA 3TOXA 3EK2A 2GUGA 5L45A 3KYDA 5L53A 2CD9A 3ETEA 3R0IA 1JKFA 3DBRA 2YY7A 5H81A 4IDBA 5TT0A 3RUDA 1T2FA 2X7HA 4YTEA 5CEFA 5CPBA 5G4LA 2BH9A 5JLAA 5TT1A 4CM7A 3KSDO 1IHYA 3RJ5A 4BGUA 5COBA 3S2IA 4JNKA 1D1SA 1LRJA 2HJSA 1A5ZA 1EDZA 1GCUA 4PVDA 5L4SA 4TZTA 3UGKA 4YJHA 3ZW9A 4DYVA 4NK5A 4FDAA 4OH1A 1WDLA 3DDNA 3FTNA 2GGSA 5T57A 5HWSA 4PGFA 4BL5A 4D7AA 1E7MA 4J2HA 2NTJA 4AJNA 4R9SA 2ZK7A 1YDWA 3U4IA 1U7TA 4YR9A 1FDUA 1AGNA 1Q7CA 1QLHA 3TWOA 1O89A 4MKXA 5BSHA 1N1EA 4B7UA 3NT5A 1KEWA 3L6OO 4LCJA 4P22A 3S2GA 2V65A 1MG5A 2OZPA 4A27A 2OO5A 2J3JA 3JTMA 4CMKA 2VHXA 2EW2A 1Z73A 1C14A 1EQUA 1WDMA 2BFMA 3K8ZA 3N58A 4IJKA 1W6UA 3W8DA 1M75A 2YW9A 3STHA 4J90A 2O2SA 5C37A 2B37A 2AG5A 5T67A 2CUKA 5LC1A 3PZRA 4AJHA 5G0TA 3BHMA 3LT2A 4CMEA 1U8FO 3GA0A 2X8LA 3U4DA 4C7KA 2QZ9A 1Y7TA 3QJ5A 4GX2A 4OYRA 4N5MA 3ZDFA 1YVEI 1QP8A 3A1NA 5CHEA 5DBGA 3BHIA 4FIZA 5ITVA 2RBEA 1HYGA 1N7GA 3E6AA 4RDIA 4UVDA 4C4OA 4WCFC 4CMIA 2GZ3A 1H6CA 1DC6A 3E5MA 5A9SA 1R4MA 1BHSA 3G3EA 4R1NA 2OP0A 3SVTA 4BV8A 1HYEA 5JC8A 2W2LA 5EQDA 1GZ3A 1QYDA 1ADBA 4TROA 1GQ2A 3IKVA 5FI5A 3ZU3A 4FFRA 1D8AA 4BNMA 2PZJA 4BNHA 3U5TA 3C3XA 3IUPA 2C20A 4FPXA 2NU8A 4IJVA 5JDIA 4M49A 3PYXA 3ADOA 1P0FA 3ADPA 3QVSA 1OOEA 2P5UA 2CNBA 2ZCVA 2WMDA 3U9LA 4J4HA 2G76A 3K9QO 1CERA 3GGGA 2AMFA 1WZEA 2JFGA 3E8XA 4BUCA 4DYDA 1HZJA 1DHTA 3N7UA 4U0KA 3QV1A 2WE8A 1KEPA 3GEGA 4I9UA 1P1HA 4ZICA 1MX3A 1QYCA 2PY6A 2VUTA 5IDQA 4CM9D 2PR2A 1E3JA 2QHXA 3WLEA 1LDGA 1RYDA 1V3TA 4IMPA 4WLVA 3S55A 1IULA 1E1KA 3FCOA 4R1UA 3NJ8A 3WDSA 4ND2A 3HN7A 2IE0A 4L4RA 5DNAA 1S6YA 1GU7A 2W90A 1UDCA 4PLWA 1K5HA 2RAFA 2JJYA 2X0RA 2Q4BA 3KLPX 2VTDA 5JMPA 4ZQHA 2AQIA 1J0XO 3H5RA 1WMBA 1Q1NA 3RI3A 1CQIA 5B12A 4FFMA 1YQXA 4J1QA 4HNGA 2E82A 2NVBA 2EXXA 2XXJA 2PGLA 1V8BA 3VHRA 1WZIA 1B7GO 3ONEA 4AJ2A 5EJ2A 2HCTA 1I33A 2QYTA 4GI2A 4U7WA 3JQBC 3ZWNA 3ETDA 4OQYA 1HL3A 4Z0PA 1UR5A 5B4TA 1EVYA 3WQSB 3LF1A 4CL3A 1NWHA 3GZNB 1WP4A 3BTVA 1FDSA 1W73A 3T4XA 1TT5A 3H7AA 4M8SA 2FZWA 4ZJUA 2Q2QA 4YQZA 5G0WA 3VVCA 2Q4EA 4II3A 3DONA 4CUKA 2AXQA 4AICA 1EZ4A 4OIMA 1N8KA 4L4XA 5G2OA 4KUHA 3DL2A 3GLQA 4EJMA 2I76A 3QLJA 4N18A 3A06A 3KLMX 4BGEA 5A02A 3PJFA 2Q46A 3OJEA 1UZLA 1H9BA 3Q0EA 1QV6A 4RCVA 3TPCA 4PG6A 2JD0A 5F5NA 2DT5A 3QWBA 1HLPA 1GR0A 4Q9NA 3JQCA 4J1SA 5C7LO 4EZBA 4JLWA 3U49A 1EVJA 3DMTA 2A92A 5JYDA 2PLAA 4OAQA 5KJ1A 2PA3A 1HKUA 4CV2A 4GX0A 1X0VA 1NM5A 2PZMA 2WYWA 3GDGA 2D0IA 4KP7A 1MXFA 1YBVA 1DOHA 3ZWWA 1ZJZA 3OH8A 3JQEA 1DC5A 1N5DA 4RPGA 3JD2A 3PTZA 4PG5A 5ADHA 1XIVA 1BGVA 1ENOA 3LT1A 1G0OA 4D79A 2ZYGA 1Q0HA 1Y8QB 3RU9A 4ILKA 4J49A 4CM3A 2VOJA 1WMAA 3ICCA 3E82A 1UDAA 3QSGA 3EC7A 1E3WB 3D4NA 4L73A 1T24A 2J3HA 4LRTB 4NBVA 4OL9A 4XRRA 4MVJD 1VPDA 4JN6B 3UAGA 2AHRA 2E48A 1DIRA 3FNEA 1ZKMA 1DAPA 2NNLD 4AJJA 1XGKA 4BGVA 1EVZA 2Y67A 4PLTA 1FK8A 3RKUA 4UULA 2E4AA 4MVJG 3SEFA 1ZO8A 4BB6A 3ANMA 3QWIA 4R54A 2J3KA 3RFVA 1ISHA 1I5RA 2NM0A 4UEKA 4GQAA 4MIOA 3JQGA 1OAAA 1P1JA 2CVZA 4RPLA 3GY0A 1R16A 2OGUA 5L3ZA 1YRLA 1DJNA 2Y1GA 3ZNOA 4CM6A 3WXBA 4D45A 3GGOA 5K6AA 2FP4A 3L6EA 4B4VA 2PNFA 4IXTA 1XKQA 3AOEC 3Q1LA 1B16A 1NPDA 2WD7B 1GPJA 1HSOA 5DBIA 2F00A 3O38A 5HTOA 1BDBA 3E9NA 1WNTA 4YBZA 3ZNPA 3ZHZA 4KDEA 4PRKA 2Q1TA 3QP9A 1OC4A 3RU7A 3O03A 3PRJA 2CF6A 4Z9YA 1Z82A 2QW8A 1U28A 2G5CA 1GUFA 1PX0A 1TEHA 3IP1A 3JQ9A 5JDCC 4BNVA 4DA9A 3KB6A 4E5NA 3R6DA 1H94A 5KVSA 3MEQA 1K89A 4I9HA 5LDHA 3FI9A 5DCWA 1QORA 4BO2A 1VL8A 3BTOA 5EIOA 4D0RA 3RC7A 2NADA 3DZHA 2AG8A 3PDJA 3KTDA 2GZ2A 2J5QA 4QSMA 3RUFA 3IIEA 4AL4A 3WJ7A 3E48A 2I3GA 4M54A 1K0UA 3LLSA 1ZSVA 4DLLA 4XIJA 1KS9A 3OM9A 5KKCA 4U0JA 4LVCA 3A14A 4BKUA 2AQKA 4CM8B 1CWUA 1PS9A 1LDNA 4MVJA 3PDUA 5FF9A 2VNSA 1EFKA 3L4SO 2ZTMA 3GG2A 4CUZA 5KVQA 1QLJA 3ITKA 3WGTA 4R01A 2WDZA 3Q11A 1YB1A 2HU2A 3EVNA 1LJ8A 2B4QA 1C1DB 3QIVA 2CDAA 3HQ4O 3NUGA 3DHNA 3GMDA 3IP3A 3KYBA 2C7VA 2P9EA 3OMLA 3TDKA 5AXAA 1XDWA 4ROSA 3V1YA 1T2CA 4O1MA 2DBQA 1GFSA 3E1KA 2JAHA 3C1TA 1E77A 3ENNA 1E6WA 2PZLA 3KXDA 3R1IA 4ALLA 4GAEA 3MWDB 1KC1A 4JBGA 3NV9A 4JX8A 3ORFA 4KTVE 2I6TA 4IGFA 1LC0A 2VQ3A 4AJIA 2QIOA 3ETGA 1NAHA 3OETA 2LDXA 1DRWA 3GHYA 5JBIA 3JCZA 2ZYDA 2PH5A 4YT4A 4UEJA 4Q3NA 1V0JA 4TSKA 5IAAA 4NFHA 4TZKA 3AJRA 2YQ4A 1M67A 4HNHA 1PZEA 3WGOA 3I9OA 1PS0A 1UXHA 1VSVA 3JD4A 2Y93A 1I30A 4R1TA 2BELA 4ZA2A 3SLKA 2Q50A 3V2UA 1I01A 2Q1SA 2EF1A 2TMDA 2NTVA 3WMXA 1Y8QA 4UUMA 4CL8A 1F06A 3TZKA 5CDYA 3UCXA 4YACA 2FHSA 3JQFA 5CAEA 5JNLA 1FDVA 2GN4A 3F6YA 4K1LA 1KETA 4Y98A 1IE3A 3W4JA 2AA3A 3ZHBA 1SZJG 3GEDA 2W4QA 2X0JA 1YDEA 4GBJA 4Z9XA 3I52A 4Y6PA 4DQUA 4K26A 1GEEA 3ZWCA 1PGOA 1YOVB 1SB8A 1UDBA 4TRNA 3OJOA 4GMFA 3RSHA 3VPGA 4KZPA 4I08A 4RPHA 1U3UA 4MVJF 4N5LA 3HB4X 1EE2A 1QMGA 4RV9A 2VHZA 3GHHA 2BFOA 2W2KB 4XGIA 5I7EA 1MC5A 3W1VA 5DOVA 3S1LA 4QXMA 2E37A 3D0OA 1PJ3A 4NU5A 3AY6A 1DFGA 1BVRA 1PJBA 2WD7A 1I8TA 1PZHA 1XU9A 2J6IA 4A2CA 3LZ6A 5L4NA 1DC4A 2X23A 4OSOA 3ROPA 3X2EA 1LBEA 3WGYA 5DCUA 5T8KC 4PG7A 2GR9A 1X15A 4LN1A 2IZZA 1DO8A 3I1JA 1B8UA 1U1IA 1I32A 5DULA 3W6ZA 3TFQA 1AXGA 3UN1A 4YAIA 1LLDA 3AM5A 3IL2A 1UP7A 4KQWA 1K3TA 4HV4A 3IDSA 1Y8RA 4I5GA 4MVJE 1J6UA 4YEDA 5A06A 5L7WA 3AM3A 1BSVA 3FNHA 4NJOA 2DUUA 5F21A 4F3YA 3F5QA 3L77A 3U4HA 1ISFA 4TRMA 4XYEA 5DF1A 2D2IA 1E5QA 2PD3A 4WLNA 5IG2A 4BO1A 3VKUA 5G0SA 4DUPA 4W82A 1PQUA 1I36A 5DDIP 1NWCA 3L4BC 1C1XA 4CM8A 1T2AA 1GYPA 2CVOA 3C8MA 2VZ8A 4BMVA 5B4VA 4Y6RA 4RF3A 2GPTA 3DZFA 4HWKA 4NK4A 4E3ZA 3L4BA 4U5QA 5DN9A 4J4BA 1U4SA 3RBVA 2B69A 1E5LA 3K5PA 3QWHA 2NQTA 3AI2A 3DBVO 3MZ0A 3DOJA 5F3RA 3AK4A 1NXQA 5TGDA 1OMOA 3D5QA 5BNIA 1C1DA 1WW8A 4J7XA 3D4OA 4EJ0A 1CF2O 4BMNA 4DLAA 4E5KA 4GH5A 4IINA 4W99A 1ZFNA 5DT9A 3VKVA 1XG5A 1A7KA 1KY5A 1EUCA 1HWYA 3HHPA 3IUSA 1RJWA 1JW9B 3MJ4A 1BDMA 1HE4A 3G49A 4J7UA 4DMMA 1MV8A 4ONEA 4M1QA 1ID1A 3DR3A 4PVCA 1RWBA 2QQ5A 3CMCO 4WKGA 4NDNE 3UOGA 4OHUA 3GMSA 1TI7A 4JBIA 5DP2A 2BFAA 4HXYA 1E7WA 1JQBA 2Y0DA 1UXGA 3BMNA 5LDGA 1V6AA 3CXRA 1BXGB 4NJMB 4D42A 1NAIA 2OL4A 2X9VA 1FJHA 4PFJA 4YCAA 4CV0A 5L40A 4OO3A 1E0DA 1ONPA 4YQYA 4XJTA 4MIEA 4JJFA 5TQVA 4GGOA 2Y1DA 3OJFA 3H9EO 2HUNA 1PR3A 4BKRA 4NIMA 3R3SA 1YBMA 4OMUA 3WIEA 2LDBA 3GVHA 4J16A 3LK7A 2RH4A 1AN9A 3VZPA 1P1FA 4CLXA 4ZQFA 3GZ4A 1DBVO 4A26A 2O7QA 3GH3A 1HXHA 3RFTA 4BVAA 3TZ6A 2IZ1A 1U5CA 2Q2WA 2C29D 2JHFA 5T6BA 4YA6A 2Y68A 2QYSA 2RCYA 2HMVA 4XQ9A 2IODA 3DFUA 4A73A 3WR5A 4LMRA 4FBGA 5HRUA 2ILTA 2NWQA 1GCOA 4E2ZA 4XIYA 4LVUA 5EN4A 3BIOA 4OM8A 1PQPA 3ULKA 3QHAA 1IB6A 3VC7A 1I3LA 2VHWA 5I7SA 3KETA 5KJ6A 2W2KA 3C24A 3JQAB 1H0KA 1J49A 1SC6A 2YV3A 3JQ6A 4M86A 1R37A 2W2LD 4U8GA 1R4NB 3RD5A 4WASA 4YRDA 1JWBB 3ZWPA 3BYZA 1YONA 1R15A 5EERA 3L9WA 5ER6A 2ZYAA 1XEAA 4R68A 1KVSA 2AE2A 3IMFA 3JYOA 1NR1A 3LU1A 4K28A 4XD2A 4XDZA 4E2XA 5JCXA 2G82A 1PJQA 2J5KA 3H8VA 4BO7A 5CFZA 3FRJA 4RVGA 4WEQA 3VDRA 3I9NA 2HRZA 3AFMA 4J4TA 4PZCA 3AOGA 3CKYA 4URFA 3WGZA 3ANLA 3LYLA 1LEHA 4A10A 5MGBA 1NTOA 3B20A 4KTTE 2ZTLA 1V3UA 3GUYA 3HDQA 3LLVA 2OUIA 3OF2A 4YT5A 2JD1A 4BNJA 2GF2A 3PVZA 4MOWA 1Y9AA 4TRRA 1WXDA 1Z45A 1HE3A 5L9AA 1YQGA 3F46A 4MO2A 2HK8A 2X4GA 3G79A 4XGKA 2O3RA 3V2GA 5IF3A 5DP1A 1WPQA 1PS8A 3JQDA 1KC3A 4G81A 3A28A 3ZH2A 1QXSA 4IY1A 1JTVA 4YWJA 5GZ3A 1JN0A 1M6WA 2X5JO 5JO0A 5BSFA 3ZV3A 1F17A 3HSKA 2YYYA 4XCVA 4ZGWA 1U3VA 1YJQA 3PK0A 2O4CA 1VLLA 3PHHA 1AE1A 2ZQYA 2H1SA 4KUEA 4CMEC 2HLPA 2UAGA 3F1KA 2WM3A 1X14A 1IHXA 3K2EA 4NI5A 1PGPA 4IDDA 4MVJP 1H6BA 4HUJA 3DOOA 5DCYA 4RF5A 3I5MA 3ZNQA 1NFFA 4FGSA 4FJ0A 5JY1A 5IZCC 3DC2A 2VRCD 4CR6A 2JAPA 3OFSA 4Z6KA 1YWGO 4F6CA 3VH2A 5IZCA 1MXHA 2W8ZA 4F46A 4IIVA 4PLZA 4QUKA 1P1RA 3ZZNA 3EW7A 4GSKA 4BNWA 4WK6A 5JAMA 1X1TA 2GASA 3Q9UA 1A27A 1PZGA 1NHWA 3WFJA 2P9CA 3N74A 2WTBA 5AXBA 3PIIA 1OZAA 1FMCA 2NVUA 3TZCA 2BMAA 4DQVA 2V6FA 1HF3A 1PJCA 1B8PA 1WDKA 3MOGA 4FN4A 4FGWA 4RVDA 4XYGA 5JDIC 1DC3A 3VTFA 2B36A 2UYYA 3K73O 2VWPA 5JAZA 2DKNA 2YV2A 4NJMA 1BXGA 1GEGA 4OOEA 4E32A 4ND3A 3QQPA 2E6UX 3KV3O 5JMWA 3NKLA 4L4SA 4O0LA 3OECA 3AU9A 3TL3A 3DTYA 1EUZA 3RUHA 4M89A 1HZZA 3RWBA 3OHSX 2HK9A 3BTSA 3X2FA 2Q1UA 2DPHA 2HO5A 5DBFA 3CEAA 4ALMA 3S2EA 1D1TA 3PPIA 4DGSA 4P4LA 3IS3A 2DBVO 4R5HA 3Q6IA 1W4ZA 4YAEA 2ZKLA 3F4LA 2DFVA 1ISGA 4NBWA 4FR5A 1L7DA 5TJ9A 4MJLA 2C82A 2C07A 1C0LA 1RYEA 1EK6A 3ZWAA 2PFGA 2YHUA 5BQFA 3NDRA 3WGHA 2OMEA 2IEDA 1O6ZA 5TRTA 4CLOB 3NDJA 4L0QA 3DEYX 1HDZA 3SLGA 1O5IA 3JQAA 2VRCA 3HN2A 1XWFA 2D5AA 4PZDA 2X9NA 1R4NA 1DIGA 2RHRA 1YS4A 3BHJA 4JXKA 1U2GA 1C0PA 3OP4A 2DTXA 3RBZA 2WJPA 1ZK0A 3I3OA 4DWVA 4E5PA 5TC4A 3VPHA 1CRWG 1E1MA 3QY9A 2CDCA 1IUKA 3VZSA 2VHVA 4ALJA 5B4UA 5CEEA 3OBBA 2VRBA 3DHYA 4ZN6A 5KIAA 1BW9B 2UV8A 2D5CA 3AM4A 4PLFA 5H82A 4GLOA 3DMYA 2Q3EA 3ON5A 1JVSA 1VE9A 5EESA 4XR4A 3D4PA 1T2EA 3HADA 4ND5A 1Q7GA 3WNQA 1Z7EA 3H4VA 1JAYA 2V7PA 4U6QA 1KBZA 6LDHA 5U9CA 2CMDA 2DUWA 2GRAA 1ZK1A 3OIGA 2DU8A 4HFJA 4MP8A 5JC1A 1KEVA 3GRPA 1BG6A 5CG2A 1ADGA 9LDBA 3DMTC 2B4RO 1LUAA 4GVLA 4I5FA 2JCYA 4GVXA 3V1TC 2XPCA 1JDJA 2O23A 1EQ2A 2Z1MA 3AUAA 3KM0A 5AXCA 5G4KB 3WQRA 2PWZA 5KNLA 1V9LA 3RBXA 2EERA 2NU6A 4IZIA 4Y6SA 1CDOA 3OEYA 4GX5A 1ENPA 1A7AA 1GV0A 4FW8A 4DC1A 1HETA 2D3TA 4R41A 5MDHA 1V3VA 1DXYA 2CSUA 4JK3A 4ID9A 5AXDA 3H3FA 1HDCA 4WGGA 1G1AA 2Q99A 1T1SA 4DIFA 2B4TO 4OKNA 3GF4A 4LW8A 4P4NA 4UREA 3UFXA 3IJPA 3WBBA 3LSYA 5CEJA 4CR7A 1KVRA 3SC4A 3ITDA 4R9RA 1PGNA 1BMDA 1F8FA 3M1LA 3W4KA 1NPYA 1E7YA 1U9JA 1ORRA 2PTGA 3OIFA 3PFWO 2B83A 2OHXA 2OORA 4KDFA 3LF2A 4OGWA 4FS3A 4IDEA 4B3IA 1ONOA 1JLLA 1Y1PA 1MFPA 4MP3A 2WD8A 3HZZA 1QYVA 2FY8A 4EW6A 4PLGA 3C7AA 1NX6A 1KOLA 3FNGA 4CODB 5G0VA 2FRDA 3RASA 1VRWA 4WCDA 1UXKA 3FR7A 4UUNA 4CQMB 1JVBA 1T4BA 2X1HA 3RUCA 2OBYA 4BOYA 2HMUA 4NBRA 1KEUA 1ZEMA 4JJGA 5KJCA 3NT2A 2C7GA 2VN8A 5K6AC 1Y6JA 4JP3A 1DRVA 4RLHA 2BFPA 3ZW8A 4GPD1 3F9IA 1VM6A 4IMRA 2NV6A 3RJ9A 1L1FA 2Y1EA 3TN7A 4A7PA 5B37A 3EZYA 2JD2A 4UVGA 4YT2A 5KWEA 2BD0A 3CINA 4IPTA 1GTMA 4D3FA 2H9IA 3Q9NA 1EE9A 3OQ6A 4BQPA 5JE8A 1EUDA 3LDHA 3HJAA 2V6MA 5C7IO 2X86A 1Y81A 2X5OA 4JCOA 3OJLA 1DHRA 1O95A 1PWXA 4FCCA 3JQ9C 4XWYA 2EKQA 2VCYA 4WNCA 4TMFA 2NTNA 2P91A 3DXFA 1XQ1A 4BIIA 4K9DA 3H5NA 4A0SA 2VUUA 3DB2A 3FTPA 2FSVA 3UCFA 1Z75A 4HFNA 4RL6A 3M1AA 2EJWA 3MJSA 3PGJA 3FN4A 3RC9A 3W6UA 5IDWA 1B14A 3AFNA 5A03A 1M2WA 5AYVA 1IZ9A 2FPGA 1O8CA 4R4JA 1GYQA 5GZ6A 3QE3A 1B3BA 1LDYA 3AY3A 1LDEA 2IXAA 1AHIA 1P0CA 4CLOA 5T64A 4GKVA 1ADCA 1GPDG 3F1LA 4CV1A 2GLXA 4WE3A 1PL6A 2DQ4A 4P8RA 3CE6A 2VWHA 3I4CA 2J3IA 1C3VA 4R3NA 4J43A 3KYCB 2GERA 2BHLA 3FBTA 2IEBA 4OSPA 1G6KA 4DPKA 2Y66A 5TIIA 1ONNA 3TZHA 5A9RA 2ET6A 2GN6A 3GZNA 3ZWMA 3H9QA 1Y9EA 4FJ2A 3WGQA 4OXNA 5T5QA 1IPEA 1J5PA 1H9AA 2O3TA 4ND4A 4RF4A 5IZ4A 4YB8A 3WTBA 2YJZA 2WYVA 4RVUA 4EITA 3TF5A 4PN3A 4WNIA 2Q49A 3S8MA 5IFLA 4GLLA 1E7RA 2PKRA 4CQLB 1P9LA 3DZIA 3PHJA 3D3EA 2EHDA 1DLIA 1GD1O 3GFBA 4I9NA 3QVXA 5KVCA 4L76A 4BNFA 5L95A 4FB5A 1JU9A 1G0NA 1M6HA 3B1KA 3H2SA 1ZXLA 3GEMA 4H7PA 4R5MA 2JL1A 4CM5A 4B4WA 1WWKA 2VZ9A 4AFNA 3L6DA 5KOIA 3DQPA 4BNGA 3KHUA 4IUYA 1IPFA 3MJVA 1DLJA 4DMLA 3OA2A 1YB4A 3ZV4A 3PI7A 2EIHA 5AVOA 5G4KA 1GYRA 4GWGA 4KUGA 1VI2A 5L7TA 3ROQA 4BKQA 3WX0A 1GAEO 3VTZA 4B3HA 3M2TA 3P7MA 1E3LA 1TT7A 4NNJA 4RQTA 4TQGA 4CLRB 4CPDA 4JROA 5THKA 4D41A 3CZMA 1F12A 2OFPA 1C0IA 1ZH8A 5JAQA 3IC5A 1NQOA 3HDJA 3EDMA 4BB5A 3T7CA 4C7JA 2QX7A 1PSDA 3BMCB 1E7QA 1N1GA 4AJ1A 3WFIA 3JQFC 3IAHA 3O8QB 4FD3A 4Y67A 4YJDA 4YAKA 1KY4A 3O26A 3WG9A 4NBUA 3U62A 1PGQA 3O9ZA 1QR6A 3PIDA 4RORA 3D1LA 1I10A 3PJEA 3DOCA 3H65A 3OJ0A 3DAGA 1E3WA 4FFNA 4HX5A 3WGIA 3GC6A 2Y1CA 3SXPA 3FWZA 4XB1A 1XHLA 1AUPA 1U4OA 4ZRMA 1S7CA 2V6GA 3JYNA 2EG9A 4DREA 2FOIA 1NVTA 4BO3A 1B8VA 2FR0A 2NLOA 1MFZA 1VC2A 1EBFA 3JV7A 3W8FA 4R1SA 4CQMA 5CDGA 4BNYA 5JYEA 2PGDA 3PGXA 4RVSA 1LC3A 1D7OA 1U8XX 1TB4A 5KTKA 4EEZA 5I8ZA 3ZWBA 2X5KO 4NH4A 1ZZEA 4O6VA 3C7CB 4W4TA 1ZVMA 5C3MA 7MDHA 3HDYA 3MJEA 5ICMA 1YE3A 2GO1A 3GDOA 1EFLA 4FOSA 4QX6A 1H6DA 3RC2A 1ISMA 1SOVA 3PYLA 4Z3DA 4ND1A 2NUAA 3QWAA 4B8ZA 4XYMA 4HKTA 1Z6ZA 1FDTA 4MVJI 2HMWA 3SC6A 1LSSA 5BNFA 4RLSA 4DLBA 1PR9A 4QQRA 4E4YA 4DVJA 1CYDA 3B1JA 1XSEA 1CQJA 3UCEA 1M66A 4RJTA 1H2HA 3GNSA 4Q3EA 4CLEA 3P5SA 1UZNA 3AU8A 1HLDA 2I3AA 1NYTA 3E03A 3UXYA 1HDYA 5I9LA 1MLDA 4B4UA 3GG9A 4ALNA 2E49A 4RDHA 3DBHB 4O5OA 2P9GA 2FPPA 4OQZA 3I6QA 3KZVA 2GSDA 2WYUA 4QECA 1SNYA 1DFIA 2POQX 1BWSA 2JCVA 4MP6A 4B7CA 1VJ1A 1SOWA 2AEJA 3GNQA 3VH1A 1HYHA 4BNTA 5HS4A 3GVPA 2C0CA 1UAYA 3KYCA 4NQZA 1PJTA 3IKTA 1X7HA 2EP5A 5JSFA 1U7HA 1VSUA 2A4KA 2YZ7A 4XYLA 3GOHA 4HP8A 1UXIA 2YFHA 1ZK4A 1GQQA 2A9FA 3MJTA 4J7CA 3ST7A 2GCGA 4P38A 4RZIA 1PZFA 3EZLA 2QG4A 3WSWA 4CQLA 1B3RA 4YRAA 1M76A 5IN5A 2WSBA 1NASA 4D3SA 1CIVA 3K96A 5IDYA 2FR8A 4J6FA 1QKIA 3FSRA 1N2SA 5EQFA 4YAGA 1E6UA 4JJIA 5ICSA 4WPGA 4XR9A 2QRLA 3EY4A 1GADO 1HTBA 2JFHA 3LQFA 3VPFA 3OSUA 2BGMA 1WAMA 3GAZA 1JWAB 3GVXA 4Q3AA 3GR6A 3NEPX 5J23A 4PIVA 4RZHA 2JFFA 5F1OA 5KJFA 4DBZA 1A4IA 1IOLA 2VOEA 2VUSA 4GKBA 3VH4A 3BAZA 3FWNA 5I9NA 2CZCA 2D8AA 4J0FA 4F45A 1T25A 2B5VA 1QSGA 3K92A 3NJ4A 4JGBA 2DM6A 3B70A 1YXMA 3WQQA 4CLRA 2Z1NA 2O50A 3AUTA 4YYZA 1LLUA 3M6IA 3UW3A 4WCFB 1ZNQO 4XA8A 3TRIA 1HRDA 4X54A 2VTEA 5BSGA 4OXYA 3IOYA 1LU9A 4N7RA 5L7YA 3PLRA 1RKXA 4TVBA 4OOFA 2VYNA 3BMCA 3V8BA 5DZSA 3ROKA 3K2BA 3MTGA 3WSVA 3O8QA 3C85A 1ZMOA 3Q2IA 1YB5A 2ZIZA 5F1KA 1I2ZA 1SMKA 3ZHYA 4WECA 3L0DA 3D64A 4IBOA 5JCJD 1PQWA 3GT0A 3U0BA 1QRRA 4E12A 2HSDA 1LSUA 3UHAA 1HSZA 3ANNA 2GYYA 3DWFA 3NRCA 2F1KA 3ONFA 3HFGA 3NTOA 1MUUA 4LSWA 5I8WA 1ZUD1 1DJQA 2HMTA 2X9GA 3EHEA 3TOZA 4B7XA 1H6AA 1YOVA 5BT9A 5A5EA 3HNPA 1ZBQA 3G0OA 3LT0A 4QT0A 1NHGA 4JBHA 5ENDA 3LVFO 1O0SA 4XZ3A 2FWMX 3W4IA 4R69A 3F5SA 4WEOA 3ZCXA 4EEXA 2QRKA 3ZNNA 1B2LA 3KSZO 2R00A 2EWMA 1MB4A 1P31A 4E33A 2VHYA 3ZV5A 4EUEA 1LLCA 2UVDA 2P4HX 5TS3A 1DFHA 5CDTA 3GAFA 1X13A 1ZK3A 4PZEA 5K0ZA 1Q0QA 2HRBA 9LDTA 1UJMA 2C59A 2XXBA 4CJXA 4E0BA 4E5MA 1MC4A 1DIHA 3PWKA 3TL2A 3BMQB 1UP6A 1PJ2A 4UAGA 1B15A 1IYZA 4BNNA 3H6KA 4IDFA 3AY7A 1ZJYA 3B1FA 3BA1A 2GDZA 3RUAA 4IS2A 2HKIA 5TSDA 3KSUA 2WE7A 3MTJA 4Y8VA 3JD3A 3E9QA 1VL0A 1GY8A 3I6IA 3U09A 3JQ7B 4RO0A 5GY7A 2BI8A 2YQ5A 4QO7A 4MPDA 1ISIA 3JQ8B 3UKOA 3WYEA 4E2YA 4AJOA 3DBHA 5EINA 3DO5A 4J1TA 4XQCA 3KVOA 4IJUA 2B0JA 3I83A 4IDGA 1ZIDA 4J1NA 3TNLA 1XU7A 5IXYA 2VT3A 4DXHA 1TT5B 5DOZA 2O3UA 4YJGB 4RVFA 2ZB8A 4P4GA 2BI7A 1LLQA 3AI1A 1DDOA 1YGYA 4FFOA 4OKIA 4W6ZA 5ER9A 4ZU3A 4AJKA 4D44A 1DIBA 1ENYA 2DTEA 2PV7A 4MVJM 4ZD6A 3QWFA 1ADFA 4PG8A 3MWEB 5FI3A 3AWDA 3LC1O 1E7SA 1XELA 4ZQGA 1LX6A 2O3SA 4WLOA 3UH1A 3CPSA 5JCJA 5ILOA 3WYCA 1CJCA 1K6XA 5A3VA 3IQDB 4B4OA 1DB3A 5CDUA 4N54A 5LCXA 1NQAO 2J5RA 2Y1OA 3KRTA 4GMGA 5BNTA 3CIFA 4YAJA 4J9VA 5GZ1A 1TA4A 2VYVA 4BNKA 2PGJA 3VOSA 1WVGA 1UUFA 1T26A 3JQAD 3PQEA 5FWNA 3OQ1A 2GN9A 1PIWA 5BSEA 4CM1A 1I2BA 5B1YA 2ZJ1A 3HE3A 4FFLA 2A94A 2R2GA 5TNXA 1C0KA 4YT8A 8ADHA 1ZSNA 1VKNA 2RH8A 2Y1FA 3U4CA 1LQTA 5JY6A 2WWRA 1XA0A 3I4FA 3TSCA 1LSOA 2ZTVA 4TWRA 4IQ8A 3OA0A 4KWIA 5AOVA 1P1IA 3CSDA 5JPIA 3NGLA 5A9TA 5TX7A 1PTJA 3U3XA 1B26A 4CLHA 1NFRA 3G1TA 3LC2O 3I9JA 5ITWA 1T4DA 2Y05A 3PXXA 4JIGA 4ITUA 4E21A 3IJRA 3H9UA 4XKJA 1GZ6A 4PRLA 4DTIA 4YXFA 4MINA 5AQ1A 4WCFA 2R6JA 2XAAA 2YFQA 4BGIA 2PKQP 3EYWA 3C1AA 3C7DB 4UVHA 2G17A 3DAPA 2EEZA 4ESOA 3A4VA 4I8XA 2EGHA 4RPKA 2GNAA 4YVFA 2ZTUA 2OXIA 3FPLA 1NVGA 1Y5RA 2O3QA 5HBRA 4MVJH 2Z95A 4NPCA 1R0LA 3PP8A 1P33A 4BMSA 1HDOA 3JQGB 3RQSA 2D4AA 3NGXA 2A35A 3GVIA 3NDIA 3LT4A 4BO8A 2J8ZA 2YV1A 3GPDG 2PZKA 4LK3A 2CVQA 5I7FA 3ASVA 2NU9A 1J4AA 2FR1A 3WICA 4JP2A 4D46A 1KIFA 2HK7A 4E5YA 1R12A 2DPGA 2SCUA 1I3NA 3O4RA 1H5QA 3D7LA 4II2A 4WJZA 1X1EA 8LDHA 2DVMA 5THQA 3BTUA 1N92A 1SPXA 1I2CA 3PEFA 2UUOA 2FZEA 3JD1A 1GDHA 2NSDA 4WLEA 3VDQA 4B3JA 3RROA 2DTDA 2G0TA 2EW8A 3MOIA 1EBUA 3E18A 4LSMA 2BKAA 4WOKA 2EKLA 3BMQA 1ZXBA 1UZMA 3AUUA 4J0EA 4CMBA 1YQDA 5JAIA 4ALKA 4E30A 3VZQA 4DL9A 3FNFA 1LNQA 2RIRA 2IYPA 3MJCA 4BNZA 4M55A 2I66A 4UVIA 3GQVA 1ENZA 1OFGA 3OICA 3RKRA 1P44A 3JQ7A 4EBFA 3H5AA 3P2OA 3ZWYA 5EPOA 4FOOA 4XEHA 1QYWA 1GUZA 3OEWA 5U4QA 1D4FA 1HDRA 4O59O 4IDCA 2I9PA 3JQ8A 5H83A 4XYBA 3WYBA 3DBLB 3JQBA 3EAGA 4IQ0A 4YDRA 3WIDA 1PL8A 2ZB3A 4AJEA 1W0CA 2B5WA 3FF4A 4YJGA 4Q3CA 3ZN2A 2BLLA 3VVBA 3JYQA 1T2DA 3DAFA 1O94A 3RAJA 4EI2A 5JFOA 2H5LA 1DPGA 3PHGA 3WOHA 4I5DA 4NFSA 2P68A 4IZHA 5ES3A 2YDYA 2PD4A 1E3EA 4KMSA 3H2ZA 4AVYA 1QV7A 2PKQO 1JAXA 1NP3A 3PJGA 4NR0A 1NQ5A 4BHTA 4CMJA 1NNUA 5A05A 3SBOA 3AW9A 3RC1A 4XGNA 3NAQA 1JKIA 1E3SA 4GWKA 3WS7A 3W8EA 1V35A 3ZHXA 4B8WA 1BRMA 2EKPA
chains in the Genus database with same CATH superfamily
2HR1A 1B74A 1MC8A 3QFCA 1DCFA 2BF7A 4EAQA 1XZMA 1YE8A 1P1KA 3KAKA 3E7XA 3QXSA 4MYRA 4NF2A 2JVJA 4ZAVA 2LVBA 4P93A 5GM1A 3VHXA 3ZVLA 2Z98A 2KBFA 3GCDA 3KJGA 4LJYA 5JJCA 1TO1E 2YBDA 4G37A 2F1OA 3NORA 4TYPA 2V7XA 4B84A 5K0EA 3KFLA 3LFHA 4E13A 4LI3X 1CZLA 3GBPA 2IHKA 5DSTA 5DYWA 2GO7A 5C7OO 5LYJF 3DZ8A 3U60B 1IN6A 3G17A 1S2NA 4DABA 4AS2A 1QLWA 4A15A 2HIMA 2AWOA 1XTVA 3VISA 4RIHA 3LH5A 5CCDA 2C92A 3FKQA 4F4IA 4YC7A 4JLNA 2R87A 2ZVJA 1JZSA 2P67A 4U7PB 2K87A 3RS0A 3WGUA 2QMOA 4YIHA 1X7GA 3P97A 1T43A 1FEZA 2X0IA 4KQCA 3UMSA 4BBAA 4L75A 3UANA 3P4UA 1D07A 3BN3A 2KE5A 1U0TA 2J9YB 3OZTA 4LWZA 4ZGGA 1KI6B 1Q2UA 2EJVA 3DE3X 4R3WA 3JSAA 3DFKA 1WMSA 3CTPA 4J9UE 4NU0A 5EJMA 1IL0A 4G5HA 3EUWA 4R2XA 1DSSG 3EBOA 3VYUB 2JIOA 2PUGA 2FPIB 3I37X 5J2TA 1POWA 4A2WA 2Q7XA 5JECA 3CZRA 1KI7A 2R5NA 4M83A 3TQRA 2HFKA 5IXJA 2IU3A 3E1GA 1F0YA 3ITNA 4NDAA 5G0UA 3PLNA 3ZU2A 4HXEB 1OX6A 4RHTA 1LDBA 5K9ZA 1IZ7A 1RCTE 3GGCA 1KVQA 1K3UB 3CH7A 3C6MA 2G0NA 2QZZA 4LTMA 4R3UC 1RPNA 2QRNA 3FOFC 4Z0HO 4Z99A 1V39A 2Q1WA 3BB1A 4FX5A 3TNDA 5DNYB 4ARCA 2IS1A 9MHTA 1K6JA 4HWOA 4IZ6A 5CT5A 1N9GB 4GI7A 4F5YA 1VL5A 1FFEA 2IYRA 2V7WA 4G1UC 1DAGA 4C03A 1TF2A 2AEFA 2P5TB 2PBFA 3UICA 4RJJA 4YRQA 4F2PA 4PZ9A 4A6PA 1KHHA 2M6RA 3HB5X 4G63A 3OM0A 4P54A 5TV2A 1IN1A 5EKUA 2G4VA 1ORDA 3T3GA 3V2HA 1U1CA 1W25A 1DEHA 1COWA 4BKMA 1QFSA 1KO5A 4RFSA 4PYOA 4PM4A 4I5EA 3GPIA 4JI1B 2ZUTA 1XQVA 3AY0A 3EEYA 5ETJA 3RYIA 4BV9A 4DMCA 1JWLA 2JGLA 3QXJA 4BP8A 3ZBQA 3GEPA 2ZP1A 1OR8A 5CA0A 4H7EA 5HQTA 1LLFA 4B9AA 4BKPA 4B40A 2DETA 4P5EA 3PA8A 4WZAE 3B3QA 4KE7A 3UK6A 2FWIA 5EXPA 4WY2A 3SJZA 3O91A 1QYXA 2WIBA 5TQJA 5JHGB 3Q5GA 2NQ8A 3GN1A 2PH3A 3OTIA 1G5TA 5KX5F 4GGPA 1AQNA 2FPWA 2I67A 2J0SA 5E9JA 2YCLA 3LDUA 5G1OA 1FLDA 1NBWB 1PBTA 4W1SA 1QE0A 2QTFA 3EXAA 4WW0A 4CQMD 2JLRA 1Z28A 4EVQA 2H16A 3ENVA 5I7RA 4WFIA 4AWXA 4P53A 3AP1A 1OW3B 3OIWA 4GC9A 1BW9A 4XFDA 1LXCA 4XDYA 1AV6A 1YS6A 4KLZA 3KZCA 1AQJA 4A1FA 1I3MA 3WB2A 4CMCA 4R0MA 2ZB4A 5C8YF 4W8GA 2CHEA 1NMEA 3GPBA 4MULA 4MQEB 1FFYA 2EU8A 1HRKA 1H93A 1P19A 3GBSA 3RSZA 3F3MA 1IHUA 1EK0A 1M54A 5HIAA 2JG3A 3G85A 3VJRA 5FEUA 5EGNA 4M0KA 1G3IA 5COQA 1DEAA 2EDAA 3KWJA 3PDCA 3ENKA 1QF9A 5JXHA 3B3FA 3WBKA 1MT0A 4ER7A 4PFKA 1NUSA 1X86B 3VH3A 5A3JA 5JEDA 3VAZA 4DCUA 2XYRA 2EL7A 2WQ7A 2NYUA 3FPBA 2C83A 1NF3A 3KKMA 3CUKA 3LY9A 4UEOA 1ZRMA 4DPMA 1OAKA 3WVNA 4H3VA 4QM6A 3AR9A 3CUWA 3ODGA 2HLDA 2VYCA 3TJRA 1TK3A 2C2YA 3FPCA 5A1TA 1KYZA 2YFYA 3VDXA 3G0CA 3KKPA 3I9KA 2QUHA 4DBLC 5E6RA 4KQXA 3SOPA 3WB9A 1X1AA 1U3FA 2YL2A 3KSRA 4EGFA 3UPTA 3L6CA 3INRA 3F6BX 1DVRA 2ZIXB 4OHMA 2IPAB 4KO4S 1E1QD 5CFPA 2JCXA 4LK2A 2PH1A 1XTBA 2DAPA 2ZVQX 4HADA 2LR0A 3MB8A 3PJDA 1YNOA 5ICGA 2CLSA 5KO2A 5JNTA 4HBZA 5GMOA 2WVJA 3JR3A 2BLNA 4QO8A 4BZXA 1X8KA 1TPZA 2Y2UA 2Y9MB 1A50B 2FI1A 2O7SA 3GRUA 4HFMA 2OSVA 1MGOA 2VLBA 2ZDHA 2P2DA 2VIIA 3O3MB 1JHXA 3U1TA 3ONDA 3PXCX 3IP7A 4N5NA 2AE1A 3D6MA 4N5IX 4QYXA 5SZKB 5A5GA 5DSXA 3ZQ6A 3OUUA 4PBRA 2VDNB 1DAHA 2Q07A 4QEDA 3BMNB 2EFEB 2WJ6A 3SYTA 3R9IA 3O1JC 2CF5A 2HCBA 4UUAA 5C4IA 3AF3A 1CNFA 2BZ1A 1GSIA 2GZDA 3NXKA 1FDRA 4FQ8A 4QJ4A 5BPHA 5JYBA 4P58A 4DUZB 1O9BA 1U11A 2Z2XA 1BQ4A 1X19A 3KPUA 4LXHA 5FA6A 4HBGA 3FLAA 1Q7EA 1JS1X 2DE0X 4AF8A 1FUYB 1KP2A 1VGQA 3H0CA 4PPNA 4CU5A 5GM2A 4G84A 4O08A 1NXWA 5CCXA 3PUKA 4BEBA 1FS4A 3MGKA 5EHXA 1L7XA 1T9ZA 1XFDA 1AQ6A 1M2OA 1XDBA 2BCGY 2Z5GA 1K88A 3GVCA 4O4HB 4ABYA 2KW5A 4R1LA 4M7RA 1XYGA 3M9XA 3NX4A 1RI2A 3SIPA 1T1GA 4F1WA 3OCWA 3A4NA 4PLCA 2VO1A 5B1SA 2IXBA 4DNPA 2M6LA 3D3WA 1E92A 1OKKA 2YHAA 3QFSA 1U3WA 4EUFA 4F1KA 2FEKA 2CV1A 3L18A 2PUFA 5JAHA 1X8JA 4AMZA 3ZWXA 2H11A 3ILHA 3VHQA 3MOSA 3Q8WA 3H9GA 4PLVA 4P4SB 4EMBA 2AVNA 2OQVA 3WWPA 4CM4A 4EUNA 4MKZA 3W3ZB 2ACEA 2PYZA 3CZCA 2QJFA 3NHJA 1KE2A 2Q7OE 4WBNA 1HK7A 3RM3A 5LZ4A 2CLDX 2GZHA 1ETHA 5FULA 5LL6P 3HCWA 4GLBA 1D09A 1P2GA 1K27A 3OU2A 4PLPA 4BVLA 3E5RA 4U00A 3RR2A 3K6JA 1A82A 1QNFA 3DBRB 2F1HA 3RJMA 1A9ZA 2HQOA 2Q2VA 3LOQA 1HE2A 5E6UB 3QVUA 4FJ1A 3VKWA 1FRNA 5A7FA 2ZATA 4IGEA 3IUBA 3SM9A 2D7CA 1U7ZA 3K0CA 3S2FA 4I1SA 4XQEA 5BR1A 2VDMB 3IKMB 5HG0A 1JMVA 5KQGA 4ZO6A 2I8CA 3NNNA 4B2IA 3FWYA 3GRKA 2CNWD 3K30A 3SHTA 3NM4A 3TXAA 3VR5H 3A27A 4ZEXA 5LB2A 5CYPA 2QUZA 3KALA 3W90A 2MYTA 5EWMA 2YNMD 3V1KA 5IJXA 1CR6A 1WEKA 4TMVA 4RTSA 1I5EA 4JQCA 1O08A 2IZ0A 2ZJ5A 5IT0A 4J2OA 1C8BA 4ETMA 1FRQA 2CL0X 2F62A 1NW6A 3AEUB 5IVHA 6AT1A 3DZBA 2P4QA 2ERXA 3T7DA 2F4NA 2V54A 5EMJA 4AJPA 3B7WA 2NUTB 1OLXB 3I5UA 5J5CA 3EXHA 4AT1A 3MD9A 3CR3C 4YY3B 3OAAD 1FVFA 2H31A 1LBQA 3BSSA 4QXPA 1YR7A 2DFDA 4LXXA 1PT7A 4U2CA 4B87A 1VSBA 1VYUA 1PN3A 3GK3A 5FD8A 1P6UA 3A1TA 1UC8A 2ZTHA 3TBFA 3BMOA 3LCVB 4B2YA 4H9GA 3RTCA 1A72A 1Y5NA 4D0GA 3CRMA 3P9RA 1JR6A 3ABIA 5HA5A 3VYWA 4BQRA 2PX8A 3LIPA 2ZQZA 3HSYA 1ACMA 2TS1A 3NO4A 5EL0A 5FL7D 1L5YA 1E3IA 4TV8B 5E2AA 4BNUA 4MAMA 3DMPA 4M0EA 4MA0A 1XXHB 2AHOA 5IEJA 3SP1A 4HYEA 1E2EA 3KTOA 5EXEA 2C31A 5K3BA 1HYQA 1RRKA 3VNQA 5AVXA 1BTOA 1SQGA 2AUMA 3TTVA 3KBOA 4NFYA 1X6VA 2AUNA 3A6FA 4PPYA 4W9NA 4MQLA 2FYTA 1RJGA 4S04A 1DAKA 3OQPA 3PHIA 2DP4E 4OQNA 2X7JA 1N32B 3WK4A 1E5VA 4HB3A 5MF6A 1SB9A 3T5MA 2Y0EA 1AK2A 2ZM5A 2H2FA 1ZU4A 1QGOA 2OM6A 1BXKA 5HZKA 1V7ZA 4AWBA 2YZKA 2BMEA 3C16C 4GMXA 1W88A 3EVZA 4AMVA 4BKOA 2YWXA 5LD2C 3FPFA 4IDAA 4NULA 1XVAA 2V1XA 1ZUWA 4DMRA 3QXGA 1GV1A 3ACBA 5BRNA 3V5NA 3ZXXA 3FR8A 4E5VA 4IIEA 1R4MB 3DTVD 4INAA 5D3ZA 5TF4A 3F3SA 2VSFA 3KEQA 2OD9A 4FSHA 1U5AA 3LNCA 3TD9A 1GSAA 3VDMA 3VPCA 1QRUA 1ISJA 4HGPA 1CUCA 1NMZA 3KR1A 3VPXA 2H29A 3Q7QA 3E2IA 1W2HA 3MWKA 4N01A 4NZNA 5HUHA 3UMJA 1GXSB 4MMYB 4LGCA 2OXFA 2PXXA 3V8NA 2PR7A 3JWHA 1TUGA 3EEIA 3K31A 3AUXA 2ZANA 4V38A 2DSTA 3UB4A 3BHNA 2O1XA 4G1VA 1YRAA 2G5PA 3DLCA 3NAMA 2QBYB 1VXOA 3HUTA 3UMBA 1P0IA 1OF1A 2JDID 2UXCB 1XEXB 5ALYA 1DPFA 1YZYA 2HAEA 4EL0A 4YUAA 5DHUA 1Z8NA 3PFIA 3GMTA 2DERA 2EFGA 2GBLA 1DC8A 2YHIA 5M5BA 4X3OA 3VZRA 2WC1A 4C4AA 2F4VB 3EG9A 1P91A 3PUXA 4BO0A 3DKIA 1M10A 1VKOA 3PR1A 2I65A 3RU2A 621PA 2NPOA 2REQA 2V4UA 3M1IA 4E1BA 3C4VA 3CT4A 4YS6A 1CCWA 1TVEA 4JXJA 1P2FA 4FE4A 1JLSA 2IDZA 3N05A 1CE8A 2B94A 2IIVA 1GM5A 2ZSEA 2AQ8A 2I8LA 2NU7A 2DBRA 2QQ0A 3MUOA 3PQFA 4PZ0A 4ZVUA 3WRWA 4YMWA 3WMFA 1TTHA 4U7DA 5K01A 1I3KA 3BQMB 4XWOA 3RVSA 4FGZA 2NZYA 4X6XA 3REQB 1JIXA 1UCFA 2DR3A 1JDBC 2ES4A 3B6JA 2HEIA 3DBOB 3V1UA 1KQ3A 1ECGA 2HDNB 1MA0A 1PG0A 3AVQA 1D3AA 2QRVB 4CKEB 3HG7A 1USWA 3NPAA 1K6IA 4AX4A 5IVIA 1BMTA 4M60A 3ZWOA 5L3SB 4WLFA 3AETA 3WMWA 4K9RA 2XODA 4DLKA 2E4XA 5BR8B 1TO6A 4HQOA 3W79A 5IKPA 5TQ2A 2FSUA 5HF8A 4HH1A 3DW1X 4BN4A 1LF0A 3L7CA 3AVWA 4LJLA 1WP9A 5A2QA 5L45A 2VBIA 4D9BA 3RRZA 3ICOA 3R0IA 2YY7A 3I64A 3ZR4B 4J1TC 2ISSD 1FP6A 1T2FA 2X7HA 4JSYA 3RUDA 4D9CA 1XFAA 3R3WA 2BH9A 3KCNA 4JLKA 5G4LA 3PKZA 2ZIAA 1MB0A 3KSDO 4KVGA 1U02A 3UV6A 5COBA 2VR1A 3PE6A 3IBYA 2YRXA 3H87A 4K46A 1LRJA 2HJSA 3R3ZA 5FOSA 3W78A 4HOYA 4FLEA 2WRZA 2QVXX 3MA0A 3IAM6 1BX3A 3IHLA 4YJHA 1C7EA 3B1VA 2SKEA 4A5SA 2YXDA 2AV6A 4OH1A 3ZJ5A 1WDLA 2YYAA 3FNBA 3WKEA 1VBNA 1SU7A 3DDNA 3GX1A 2GH1A 4IILA 3N6XA 2A7QA 4JLJA 3OPYI 2YRWA 3LP6A 1E7MA 5J4KA 5M3BA 1R8SA 3FMPB 1SU4A 1YK0A 3OFKA 3F7MA 4WWHA 3VI4B 3VR1A 5JSHA 2OSBA 3LLUA 5DO9A 1FDUA 2XWQA 5AMXA 3AVPA 5ITZA 3RPEA 1O89A 2C94A 2OO5C 4EX7A 4MGHA 3DYVA 4XD7D 3L7OA 1T0IA 4OUDB 3NT5A 2X4IA 5EWLB 3M4JA 4JC0A 3S2GA 1QZXA 2H4ZA 2V65A 1MG5A 4FHDA 5TGTA 4OLAA 3EGEA 3MUFA 3PUHA 1KBQA 4Q37A 1T3SA 2GOYA 5CX1B 2QEQA 4HTAA 4CEHA 1NF9A 2GZSA 2QUIA 4HUTA 5A5VA 4JJ7A 4IJKA 3HVKA 2XWJI 4TXHA 3BKXA 5JI3E 4Z4EA 1JIJA 4WFKA 3NDBB 1S7GA 3O75A 4M8KA 2FMFA 5C37A 4CEJB 2PZEA 1GRQA 1NP7A 2AG5A 2JVKA 3DOHA 1A1SA 4Q4HA 4X1KA 1A2OA 3F6PA 2FRVA 4GQBA 3PZRA 4WK4B 1KF0A 3BHMA 1O03A 5TEWA 4AJHA 1MO4A 2FK8A 4OPMA 4D97A 4HRVA 5AVWA 2M1ZA 3ICQB 1A98A 1G4UR 1Y7TA 3JWPA 2UZ1B 4IHQA 2CE7A 3FTCA 4M36A 4LWQA 4UHHA 3ZZMA 4E6EA 3GJ4A 1QP8A 3ND9A 1RC8A 5CHEA 5DBGA 3BHIA 4FIZA 3CVOA 2HCRA 4B1FA 5ITVA 3P45A 4RDIA 1TECE 1Y7IA 4Z7JA 4YMSA 4WCFC 5H9VA 3MFQA 2GZ3A 2PWYA 4G0ZA 1DC6A 3EAFA 3UK0A 5HOEA 1FFGA 3O31A 2IX9A 4Y0VA 1H69A 3HB9A 3RHFA 4EJSB 3C5WP 3G3EA 2OP0A 2ZRLA 4O4JA 3GLIB 4BV8A 4P3NA 1VIAA 1WTCA 5JBQA 5IBRA 3UJPA 3U7IA 1C81A 1ZG3A 3WB0A 4HC4A 1NOKA 2JATA 5LA6B 2PO7A 5HF6A 4ZCIA 2GHTA 2GPWA 2FQYA 2Q5EA 6YASA 5B5SA 1Y4UA 4TGLA 5DFAA 2AN4A 2E1PA 4GOKA 3MINA 1SZCA 4IH1A 4KFCA 1JI0A 1OXXK 2CNDA 3PQCA 3T54A 2AX3A 1D8AA 1EUYA 4PS1A 4TLDA 3H11B 4FPXA 4PBTA 4RH1A 4M49A 4AZVA 3PYXA 1RWKA 1YTLA 4GRDA 1P0FA 4L0CA 1GKIA 3UJDA 3ADPA 4FZ3A 2B2XA 1TIKA 4HLNA 2I2CA 2JHAA 1QTIA 3K9QO 5BQOA 5CNIA 2AMFA 3B12A 2WFZA 4G01B 4MGEA 4EA9A 2RC6A 1WMEA 3TBHA 4ZFNA 3O8DA 3TR0A 4DCTA 1YHNA 1XRRA 2PSHA 2IA5A 3DE5X 2M2IA 3AERA 4Q48A 4EQZA 3QV1A 2XXAA 4KI7A 2WYHA 3HK2A 3GEGA 1H3NA 1P1HA 2R6FA 3EVBA 3QENA 3MTQA 4N0EA 2QVCA 4CN9A 1QYCA 2OKCA 4V39A 1KWGA 4CM9D 1QF6A 1XRMA 1YUNA 3M7IA 1E3JA 2IHVA 2QHXA 4HDOB 4C7XA 5KU7A 1RYDA 2FPUA 1W35A 3T12A 4KXLA 2XMQA 2Z4SA 2C61A 2YMMA 3NWPA 4F2HA 4S1TA 3F6EX 5EHNA 1JGTA 4RSGA 4UBJA 5FNVB 1S6YA 2FXVA 3EEQA 3VM6A 4PLWA 1E2QA 3F0TA 2C04A 1P4SA 3Q1KA 1EGVB 1SXJA 2VT6A 1JMKC 3F3YA 1T34A 3GAMA 4XVQA 1DINA 5EXSA 4QUAA 4S12A 2N3ZA 3O2NA 3RI3A 1CQIA 1YQEA 1FNDA 5FPHA 5I01A 4AQYB 3D2AA 4OHFA 3REOA 1CV2A 4GBGA 4YCBA 2O5EA 3NBQA 1CZOA 4L3VA 1YQXA 1IK6A 3FHCB 4G0NA 5JPCA 2E82A 3L1KA 2BMWA 2VTVA 3OZAA 5AM3A 1E2NA 1KHTA 2ZU6A 4IDQA 3ONEA 1B7GO 4ENRA 1LI7A 5HX7A 1U8YA 2QYTA 3K72B 3E70C 4LY0A 1XZGA 5ILQA 3ETDA 1EGHA 4OQYA 3KQLA 2QNIA 1WRBA 2VA8A 5E0KB 3UHJA 5IAKA 4Q4JA 5JG7A 3HGMA 1EVYA 4E3WA 3LF1A 4DDTA 5FTLA 1NWHA 2FSHA 3QVMA 1I4OA 4Z2YA 1C7RA 5AOAA 4JQYA 1W5SA 4LF9B 1UJ4A 3I42A 4F11A 4ZK6A 1C3JA 3T4XA 4Q4CA 1TT5A 3IDOA 4ZJUA 3ZOZA 4A8JB 4CCWA 4YQZA 1ZC4A 1SUBA 2Q4EA 3QG5A 3A4IA 3E8SA 5J4YA 2O8BB 3HDGA 3S7TA 3N1UA 4AICA 2H65A 2RHMA 4OIMA 4MZDA 1NXXA 4KUHA 5EYPA 4EJMA 2CMGA 3QLJA 4F5DA 2G5TA 4BGEA 3RF7A 1JG7A 5ALZA 4TKVA 2FV8A 1MOSA 4RDXA 2IHUA 3SZOA 3BXGA 2R60A 2VF5X 4KGXA 3GW8A 5HGXA 2O8EA 4UKDA 3G82C 4IYRA 3QX9A 3FYUC 3KXPA 1HQKA 5F5NA 3R9WA 3K70D 4QRIA 4GW3A 1KZ6A 3LDGA 2HCFA 5JH7B 2DHRA 1GR0A 2XNCA 4KYUA 3JQCA 2QUKA 3Q8XB 5FUXA 5CITA 5K4HA 1LTKA 1SCNE 4J1SA 4FBLA 2DQSA 4LRUA 4NEGA 4RZSA 4EZBA 4IOMA 2WKSA 1DQYA 2AC4A 1EVJA 2Y1LA 3PX3A 1AS2A 1QKJA 2A92A 2PLAA 3HACA 3VBCA 1PR2A 3CT6A 4Y9TA 4MRPA 2O14A 5KJ1A 1GJRA 1HKUA 1MB3A 1Q95A 2X8JB 4GX0A 1UFQA 3HYRA 4OJQA 2J4FA 3Q7RA 4NPHA 4G1FA 1EX9A 2O0LA 3TQFA 5JD3A 2D0IA 4KP7A 3QEMB 1B8NA 3WI7A 3O4VA 3B5JA 4KGVA 3O2QB 1ZJZA 1NT2A 2FB9A 2NOAA 2QS9A 4MS3B 4B3CA 5CH5A 5CJJA 3MN1A 1OBVA 1Y1LA 1N5DA 1PSZA 1Q0RA 1YIAA 2C84A 1AUOA 5A6SB 2SBTA 4PG5A 5CM2Z 4BP3A 2JCSA 2KPOA 4LNAA 3A2MA 2IWRA 1ZWKA 1G0OA 1OASA 2B4KA 1GZSA 4D79A 1Q0HA 1ZJ5A 1Y8QB 2HSGA 5AVYA 1XZLA 2J4DA 2BSAA 2R62A 3EEBA 4Q9IA 3DLTA 2HHCA 2FDCA 4RXTA 4YJKA 3JZFA 5FO1A 3WHIA 3ICCA 4EHJA 5CAEB 1UDAA 3MMZA 3QSGA 2AOVA 4AY5A 3V3TA 5J2UF 3D4NA 1KDVA 1A9RA 1BGXT 4Y2RA 4EIWA 6NULA 4L73A 1MZVA 1I7SB 3JY6A 3IEVA 3B52X 4OL9A 1RQ7A 4XLZA 1USVA 4XRRA 5J1SB 1SXQA 1JHAA 3OIYA 4RHEA 1S01A 5EXTA 3UAGA 1XT6A 2G80A 3FNEA 4HDSB 3VU3A 3OU6A 4X20B 4YP6A 1OH6A 3G5TA 2KLBA 3IP9A 4AJJA 4BGVA 1EVZA 1NZFA 1BN7A 1FK8A 3TEJA 4UARA 2E4AA 2BJWA 3QLVA 1JJ7A 2NZ8A 4Y2JA 3SEFA 1XZQA 4GYYA 4C08A 4JU9A 1GDDA 4R54A 2V8BA 4MV4A 2NM0A 4AUKA 1JDNA 4UEKA 5CBKA 4TYWA 2O7VA 4DZTA 1OAAA 2CVZA 2HCJB 2QSZA 3DPSA 3GY0A 3A0UA 3NOXA 3ODPA 4KK3A 4LKOA 4NCJA 5T4FA 2OV8A 1YRLA 1S2DA 2Y1GA 5CXSA 1SXJE 3DNFA 3NZEA 3WXBA 4J0KA 2Q62A 2VH2A 4OJYA 2GNPA 1M0WA 4JT4A 3E81A 4YQFA 4JL6A 1E5TA 4V0MA 4A6XA 3K05A 1P6QA 2YXPX 1IVYA 4IXTA 4WBSA 5K99A 1FZTA 1I4LD 3Q1LA 5F2OA 1B16A 1PFUA 3BSWA 1FYFA 2FMXA 4HSEA 3GCXA 3HJUA 3ZU5A 3GLFE 2HF9A 3O6VA 1BDBA 3E9NA 4YBZA 5H80A 3AXTA 3LVRE 3ZHZA 1YBHA 4PRKA 1QS0A 3DKVA 5IM4A 2NZVG 1DWUA 5C8XA 1DWOA 1A4RA 2V03A 3GT4A 1CB7A 1F20A 1G3MA 1LK7A 2FEOA 4BNVA 4K1XA 4DA9A 1T15A 4RTOA 2GAFA 3BXPA 3M49A 3NUQA 4P84A 5AHXA 4OK3A 3CH5A 3ZCRA 4E5NA 4G5YA 1NL3A 5KVSA 4TLMB 2G06A 3W9BA 2O5VA 3MEQA 1V1MB 1DMRA 4I9HA 4NBLA 4G0PA 3BRWA 2VKTA 4XH9B 4FFWA 4Z4GA 3AYZB 3E9DA 4IP0A 1QORA 2Q0XA 4BO2A 1NMSA 4BFTA 6REQA 1XRSB 2QR5A 5DWVA 5EIOA 3Q3HA 3C7TA 1W49A 5FOTA 1R6XA 2YN4A 1Y1QA 2G9UA 4C0AC 2GZ2A 5EVCA 2VNJA 2QGNA 3I32A 3IVMA 4NWIA 1ULAA 3FWPA 3A58B 4M54A 1XA4A 3OZIA 3A6DA 4JGIA 3F8TA 2QZSA 3WLKX 2WJGA 2VNIA 4MW5A 4LVCA 3I12A 4RIIA 4KIJA 2GHIA 4BKUA 3KDPA 4DLTA 2J3QA 2J0UB 5K0TA 4CM8B 1CWUA 1G8JA 3KQYA 4JBWA 1LDNA 3NIGB 4MVJA 3UZUA 5AW1A 3PDUA 5FF9A 1QIMA 2GF9A 3NP7A 3REFA 1FP2A 4ZO7A 2ZTMA 3NRBA 4AECA 1E2HA 3ZDAA 3FBWA 3L0YA 3EZFA 1U1EA 1EWTA 2CXQA 2M6SA 2WAOA 3LXXA 3Q11A 2HI0A 5EGSA 1B8OA 4B2LA 1YVRA 1QTRA 3HQ4O 2YIVX 2EW1A 3NUGA 3OX4A 3QX7A 4GPZA 4BU0A 1GFZA 1E4OA 2QZ4A 3NHRA 2HGZA 2N1MA 4XVCA 4N9WA 4PZAA 3F9CA 1T2CA 1IQPA 1HY3A 1ODJA 1KQOA 1E77A 1P29A 1TFRA 3ENNA 2B0CA 4H17A 4MUYA 5D85A 3SOZA 3MQ4A 3VYTB 2FZVA 2MINA 1KC1A 5GPBA 5KNDD 1JFTA 3TLCA 3MB5A 2GXUA 3UG7A 4OP1A 4OX9B 1D6SA 1BCSB 5E7JA 3EGIA 1WL8A 4AJIA 4AQ7A 1X7WB 5DLPA 1NAHA 1RI3A 3COVA 3IXLA 4UTNA 5AVKA 4B6EA 3I1YA 5JAPA 4C20A 4W63A 2VH1A 4YT4A 2QY6A 2N0SA 1X7XB 1Q3TA 4UEJA 1WDWB 4NYJR 3MS7A 2IP2A 4NFHA 4HX9A 5EKSA 4W9MC 3IP8A 4K8RB 1PZEA 2OCDA 2F8TA 4DSTA 1B1AA 3DLAA 2RBKA 3BCSA 1PS0A 3JD4A 1VSVA 2L0XA 3EPJA 4R1TA 1N2IA 3MGBA 3URKA 3WK9A 1CDDA 2Q50A 1I01A 5CHYA 4URZR 1FSSA 4KQ9A 2NTVA 1XRJA 1UADA 2VP4A 4QL3A 2O2GA 4LXUA 1C9JA 1G21E 4CL8A 1F06A 3DKRA 5CDYA 4I4TB 4JBLA 4PAOA 3V7NA 2ZAYA 3LC0A 4TT3A 4C05A 4DMFA 3RB8A 2IH5A 2F8SA 2ZR7A 4P6VF 1H8EA 3F6YA 1CIPA 3HPRA 4Y98A 1G7TA 1IE3A 3STXA 3WMEA 1YZVA 2PWPA 2AA3A 4V0ME 2OXRA 1NBIA 4W5OA 5IABA 4GBJA 5MN6A 2B5OA 3DCYA 2G7MC 4DQUA 4K26A 3T0GA 2XV1A 1PGOA 1VJ5A 1YOVB 3ZWCA 4BWFB 4OHYA 4TRNA 1F3LA 2OV2A 3EMVA 4GMFA 2ADFA 3V33A 3RSHA 4QYMA 4I08A 2EJTA 3C8ZA 5JOQA 1AS0A 4N5LA 1VIVA 3VPBA 1EE2A 3BC1A 4DCPA 1NXSA 3A9VA 3VSCA 4UZEA 4NJEA 2PUTA 2IV3A 4U2FA 1OTXA 2OZVA 2Z6AA 3L01A 4BLUA 4QXAA 3WADA 1EX6A 2P40A 2AMYA 5M34A 2W2KB 3QXHA 3U37A 4DHEA 4EFLA 5KPDA 4GDMA 2I1WA 1XUOA 1O77A 2IXFA 4GOND 4AC9A 1MC5A 5KYNA 3K0CC 2H17A 2R6R1 2XITA 4PYRA 1ZJJA 3D0OA 4Z9AA 2Z58A 1PJ3A 3NH6A 4R98A 3LHSA 3M89A 4C0JA 3HMKA 1FFWA 1BVRA 3KV1A 3CC8A 4AIRA 1I8TA 1D4ZA 1K06A 1DRKA 2J6IA 1AB6A 1EFRD 3LZ6A 4AZSA 2GFQA 3BAFA 3PGLA 3X2EA 3PNLA 2FLVA 1LI5A 2XQFA 3CVWA 2J1LA 2GPNA 3FDFA 4H7HA 5DCUA 1P62B 2QSYA 4LN1A 3BJRA 1TVKB 2IZZA 2F1IA 3CCCA 4ZCRA 1CDZA 4IDOA 4Q9AA 1KDYA 3N75A 3TJMA 1FDOA 4LBVA 1VJGA 3EXHC 1NXVA 5IAGA 3IT2A 2A1TR 3W6ZA 4YAIA 5K6RA 1LLDA 2DLCX 4MEBA 1PR6A 4QOJA 3BQNB 4YRKA 1K3TA 2HF8A 2ZE5A 4KG7A 3RVPA 3DG9A 3HHEA 4C4TA 1S9HA 1Y8RA 1JJVA 3PB3A 5DGXA 4E5YA 4MVJE 1J6UA 5A06A 1Y9ZA 2Q6LA 3H5VA 4N6GA 2CE2X 5FFMA 3UJ3X 4NJOA 3P9CA 1GR1A 2DUUA 3AHDA 4GZ6A 1DTEA 4KFUA 5ELMA 5AK6A 2ECQA 1OQAA 2WVGA 4OHOA 3UHOA 3U4HA 5EHQA 4NXMB 3FCEA 4TRMA 1A04A 1P0MA 3AFIA 1G3RA 4XYEA 1SU8A 2QTRA 1JBEA 1IQUA 5GGXA 1E5QA 4WLNA 2YHBA 4OYHA 1CUHA 3STUA 1KQGA 4ZVTA 4DA6A 1DBRA 1ZA1A 3CFYA 3H19A 3NGMA 5E95A 4KX3A 3I61A 1GGHA 2H8KA 4BVFA 2AFIA 3PFKA 3L4BC 1C1XA 3FYTA 4K9PA 2NQ2C 1T2AA 3QVLA 1U5BA 2VZ8A 2WUEA 3ZGNA 3BIJA 2GPTA 4HWKA 4E3ZA 1FFDA 3LTEA 4LE2A 3AJEA 5DN9A 1U4SA 3RBVA 2B69A 3IVXA 1E5LA 3K5PA 3AI2A 1B43A 3DBVO 1BD3A 2R1ZA 4RMNA 4XARA 3EPKA 2NO0A 1A7JA 4D74A 1NXQA 1OMOA 1YU9A 1EAMA 1C1DA 1K75A 2R8EA 4LYGA 3QU4A 4C29A 2CC2A 3TE7A 4CN8A 2G9NA 1RSZA 1XG5A 4KH0A 5FUBA 1EUCA 2DWPA 1NBMA 5GIPE 3FRHA 3HHPA 5BXYA 3OTOB 1JW9B 1USKA 2X7XA 2HTEA 1QRSA 2R7AA 4BLRA 4N39A 4ONEA 5TXGA 4M1QA 5L3VA 4M8NE 4KI0A 3V8MA 3O2JA 2HLNA 2AGVA 1VA5A 3GJ8A 3DR3A 4WADA 3AF4A 2JAWA 5PGMA 4RBNA 1MAUA 4NFLA 1LQ2A 1XD2A 5D84A 5CFRA 4AF7A 5KHLB 4PQRA 5K0LA 1U1DA 1EWKA 5DP2A 3ZHQA 3D8HA 4HXYA 3O4JA 4JR0A 4J6EA 4RCZA 1XE3A 3L0BA 5KDDA 3L3BA 3AEYA 2C9MA 1BXGB 3GJTA 2P2ZA 4CV0A 1MU0A 2Q3JA 5TVGA 2PSEA 3I0MA 4BQOA 1EJ2A 1J0DA 4XJTA 4U7HA 2AD1A 3IBSA 3KQSA 4YQYA 5AI9A 5FA8A 5B30A 4NZMA 1DZIA 3QKIA 4GGOA 3NEAA 5IT4A 1NLFA 4DMUB 2HLHA 2CLCX 1NRIA 2HUNA 1PR3A 3EJWA 1JJBA 4NIMA 2FMTA 2CLLB 4E5SA 2WUVA 4DV1B 2WWHA 2LDBA 4QULA 2XZDA 2OAQ1 4ZYLA 1VHWA 3KG2A 4BE7B 2DB3A 1RHUA 1G2PA 2WABA 3QLUC 1JJIA 4GYKA 1J07A 3O92A 3PCRB 5HQJA 1SVMA 4QDKA 2CUTA 2YVLA 1X94A 2Q2WA 4JXXA 2QN6A 3QJYA 3QPVA 4YNBA 2BSQA 4H3HB 4KMOA 4OQXA 3O1IC 1DJMA 2VDVE 2HMVA 1M83A 1JDTA 2J9RA 2R97A 3ASZA 3PXEA 4QBTA 3UT0A 2NAPA 2IODA 4AROA 4JI8B 3C14C 4FHGA 3RRFA 4YJ2F 5HRUA 4UXJA 2ILTA 2NWQA 1GCOA 3I5AA 4NAVA 1RWPA 5EN4A 5JZMA 2AOTB 1PQPA 3GRRA 4OM8A 3KLNA 1ISSA 1RXSA 1ZIXA 4JELA 4S0XA 3VC7A 2CMKA 2IDMA 1M2HA 2VHWA 4F8EA 1KQNA 1D6NA 2J6CA 4H0NA 1S2LA 4JJ4A 2NP7A 3VMMA 5KTTA 1M9NA 4ZEMA 1H0KA 1L1EA 1OYVA 1SC6A 2AZ4A 2VDWA 1E89A 2VK2A 2YV3A 3CWQA 2W93A 3JQ6A 3KKLA 4KSCA 4EB3A 5J58A 5LYJB 4Z4FA 4YRDA 3IUNA 2RG1A 1M34B 3MYRA 1QG0A 1T6YA 2VBCA 4NE9A 3L9WA 4Y7CA 4BLWA 2ZYAA 1XEAA 5LZ9A 4R68A 1CJSA 2QVGA 3IMFA 3WWEA 4DJEC 1I1NA 1MB9A 4ZHQA 3E7WA 1F2TB 3WZLA 4MI1A 4GG1A 1PJQA 2G4LA 1ATZA 3N70A 5CFZA 4BNDA 3ABQB 1KYTA 3CR8A 2X5NA 3I9NA 1UMCA 2W0MA 2YJNA 1AO3A 2H06A 5I4BA 2XF2A 1JFVA 1J9EA 3VR3D 4WN9A 3ZJ4A 2ZLBA 2E4YA 4FNOA 4IHJA 4URFA 4A10A 3DVAB 4MR7B 4E88A 1JG4A 4TLBA 4KXQA 2O0HA 1W9HA 1CZKA 3C3JA 5FPQA 3UC9A 3LLVA 4BNJA 1XPRA 3SJAA 2GF2A 4XJVA 1XJ5A 2R6GA 2PQ0A 3BGIA 3PVZA 4TRRA 5JR3A 3PT5A 1HPLA 3RAGA 5L9AA 4EHAA 2I6GA 4XGKA 2PL3A 4KWCA 1BDJA 1JALA 5AKJA 3MBKA 5LKAA 1PS8A 1I6MA 4N8DA 1C41A 3A28A 1P73A 3O8BA 4H31A 2IEAA 1T9CA 3IQWA 3R5KA 3SS9X 1JN0A 4A36A 4LZNA 1U6IA 4J7AA 4FHCA 1U3VA 3PK0A 1PG5A 2BFDB 1XMPA 1UKZA 3SQXA 2OECA 2YV4A 4AQDA 3LXMA 1L5ZA 3IE1A 2H1SA 5B6JA 1NBME 3HYCA 2HHJA 3MUNA 1BKYA 3IUQA 3LPNA 2HREA 2UAGA 3AF6A 1X14A 2Q5OA 2YN0A 1SWWA 2R7MA 5TMDA 4L8GA 4RF5A 3ZCUA 2HW8A 1U7PA 1L4FA 5JY1A 2CBZA 5KNCH 4DB2A 1N6OA 1VSQA 3UFXB 2XMGA 4BFZA 4LS3A 2K5UA 2Y1WA 3OFSA 3ANYB 3WQBA 2I4OA 1Y48E 5F2KA 2FOLA 4F5EA 2VPTA 1H4QA 4QUKA 4KQMA 2ZWVA 4LDJA 3ZDCA 3EMBA 2C0PA 1U0JA 5KX5B 3I9FA 1TJYA 4NLLA 1PZGA 4HDNB 4WL0A 1SVWA 4D9JA 4ZOCA 1G6Q1 4DUGD 3HGTA 5HKKD 3K1TA 3VI3B 2NVUA 3MAGA 1KDZA 4DT1B 2BMAA 3SC2A 1Z12A 2FDRA 2QP9X 1DUSA 1JIQA 1X1CA 1L4MA 3HKDB 4YXFA 4JA2A 2R6DA 2C4KA 1TUEA 2YMQA 3BDVA 3AHJA 3MOGA 4RVDA 4DSOA 1ZYUA 2C3UA 4ME6A 3LPLA 3VTFA 1XQXA 2B36A 5BUSA 2RGYA 1YHYA 1AQIA 3GRAA 1NUPA 3GRZA 2ZRKA 5DXFA 5JAZA 4TN1A 3RH0A 2PA0A 4NJMA 4D5EA 4KBGA 3AKYA 4OLFA 3RIGA 3Q87B 2OZLA 5DM70 5KNBD 1B6GA 3TLAA 1QO7A 2QSUA 5DBHX 5SYMA 1F5SA 2ICAA 3FWKA 4L4SA 2PZBA 2ZRBA 3EF1A 3DTYA 4PAMA 5IC6A 1HZZA 4X1YB 2WG1A 3OO1A 4IIFA 1RU3A 3NHUA 3RWBA 3OHSX 4A23A 5I6DA 1T5IA 1VP3A 3GLUA 4TLCA 5D3KA 3AUKA 1QRAA 1ZNXA 2DPHA 2NT3A 5JQGA 2IH4A 2EKZA 3CEAA 3CLTD 1EWVA 1Z16A 4NG4A 3S2EA 3THYA 1D1TA 2RJNA 2WJZB 4HGZA 1KFBB 2PGOA 2ZYVX 1YQTA 1EG7A 1ZNYA 1KFJB 1SXJC 3H17A 4KJXA 4AS3A 3OOHA 4ZI5A 1V37A 3AKZA 3DNMA 5TJ9A 5E4FA 5CXXA 2C82A 2C07A 2IH2A 4NYMQ 1RYEA 2WUGA 1EK6A 1XMQB 3BE4A 4V3CA 1U2EA 3V4RA 1QOQB 4HEA1 1TAHA 2YHUA 3K09A 3OZSA 1HE8B 1Z4KA 1Q1AA 2X2EA 3K4QA 4R83A 3IUMA 4KC0A 1NJ8A 4CLOB 3NDJA 2C1ZA 2WTMA 2IUYA 1CLUA 2FKAA 3CNEA 3DEYX 3L7NA 2JLZA 3JQAA 4DAEA 2VRCA 3QU7A 3DEHA 2CEKA 2D5AA 3THXB 1R4NA 1I3OA 3TOCA 4F3KA 2DR2A 1U2GA 3U44A 4GZ5A 3Q15C 3RBZA 1JQKA 3HC7A 1U2ZA 3I3OA 2CB0A 4QOIA 4E5PA 2W7TA 3Q6NA 1CRWG 1FNMA 4MQMA 2ZBFA 3E0XA 3R5SA 3LPCA 3OC6A 2CDCA 2AF4C 3FYDA 1KJQA 4NVRA 1TCVA 2BISA 3DHYA 4D4HA 3LKZA 1E9DA 1TEVA 2R68A 3G2HA 2VP9A 5I9BA 1L3BA 4AB1A 1E9FA 4YRLA