4JX8A

Crystal structure of e.coli enoyl reductase in complex with nad and aea16
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of E.coli Enoyl Reductase in Complex with NAD and AEA16
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jx8A00
5K6AA 4BL5A 4YT2A 3COSA 1A71A 5TJ9A 4YB8A 1LXCA 5EPOA 2YV2A 3AW9A 4URFA 6ADHA 4TKLA 4RF2A 1QSGA 2QRLA 2VYVD 3HN2A 2Q99A 4E5MA 2AQKA 3PHIA 1TXGA 2GNAA 1GPJA 1ONOA 1HTBA 3AK4A 4CM4B 4UEKA 3F4BA 2X1HA 4M49A 3VPXA 4NU6A 5G0VA 3RUDA 4RF5A 1NFQA 1PGOA 4PGFA 4FFNA 4Z0HO 3QVXA 4JK3A 1NX6A 3U09A 1DB3A 1PS0A 3S2IA 3F5SA 3NEPX 5IDWA 1TI7A 2Q1TA 3FCOA 5JAQA 3RD5A 1E7WA 3B1KA 3ZU4A 3H5AA 1TB4A 2JCXA 1HYHA 3TFOA 3ST7A 3VPSA 5DZSA 1X1TA 1ZJZA 4CM5A 3GZNB 3L77A 3WNQA 1MB4A 1R37A 3ZWOA 3L9WA 1XHLA 2HMVA 3LT1A 1BVRA 1E3EA 2D59A 2E49A 2P91A 3KB6A 4EW6A 4ALLA 1R66A 2PZLA 4NQZA 3KSDO 1R0KA 3PJFA 2PD6A 1R0SA 3JYOA 3TZHA 1PZFA 5TLSA 3IL2A 4IPTA 1T25A 4Q3DA 1R12A 3LZ6A 1E5QA 3G0OA 4JQCA 3KBOA 3QWBA 1DLJA 4QSMA 3AU9A 2O23A 5TQVA 3B20A 1HWYA 1QYWA 4B3JA 1IPFA 1LDBA 3O4RA 4DREA 3V8BA 1AN9A 1X7GA 5A9SA 5GZ3A 1WLYA 4WJZA 1ZCJA 4ZQGA 2QX7A 2BI7A 4BS9A 4DMMA 2UVDA 1N2SA 4CL3A 4RVSA 2VHXA 4XR4A 4IS2A 3E9QA 2X9GA 3FWNA 4BO1A 2ZYDA 3PZBA 1C14A 1P31A 3HDJA 4GKVA 1YL6A 1LI4A 4WLNA 4XIYA 3AJRA 1BXZA 3LF1A 2NLOA 3Q9NA 4JJGA 4LN1A 2G82A 4N18A 2HAEA 4S1VA 1MC5A 3F6YA 1BXKA 1E92A 1KETA 4CMEA 3ITKA 3D5QA 4LCEA 3NYWA 4DYVA 2EJVA 4M55A 3ZV4A 1UR5A 3LU1A 2EXXA 1OI7A 1E1NA 5JYEA 2W2LD 4NBUA 1H94A 3BTUA 5JCXA 4LISA 3OFSA 4CUKA 3KYCA 3WFJA 1BSVA 3NT5A 1TT7A 4OQZA 1PL6A 5IAAA 3DAPA 3DFUA 1EE9A 1CYDA 3L9XA 4BNXA 3TL3A 2X0IA 2ZB8A 1V6AA 3PQEA 4B7UA 1A27A 3GPIA 4WKGA 4E31A 5DP1A 1U7TA 4OSPA 1IHYA 1VLLA 3I4CA 3MCVA 3ENKA 3QJ5A 2DT5A 5L9AA 2Q1WA 3JD4A 4BMNA 5JPIA 1ZJYA 1B14A 1JAYA 2GZ1A 2ZTLA 4BUCA 3K2EA 1U7HA 2D1YA 2VYND 3NT4A 1KS9A 3GMDA 3NJ4A 3QLJA 3K92A 5A9RA 1F06A 1SCUA 1B2LA 1JAXA 1H2BA 2EEZA 4TVBA 4ZVVA 2X9VA 2VQ3A 3CZRA 4N5NA 3DWFA 4N5MA 4BNHA 2VTEA 2A92A 5ENVA 4ZN6A 3CMMA 4G5HA 1GR0A 4FCCA 3CZMA 4J7XA 3AUAA 3IDSA 2Z1NA 1XU7A 2C0CA 1PZHA 3QE3A 4BKQA 3O8QB 1DAPA 4IXWA 1P1JA 5T8KC 5G2OA 3H8VA 1DJNA 4HP8A 3WOHA 4YXFA 4ONEA 5IZCA 2FN7A 2HRBA 3FBGA 3GFBA 4G2NA 1UP4A 4OIMA 2Y05A 3RROA 4IGFA 3AM5A 3HHPA 2NVUA 3NKLA 3CH6A 1P44A 5TJHA 2JJYA 2C5EA 1PZEA 3G1UA 3AI1A 1GAEO 3Q2KA 5KJCA 5CHEA 3O38A 4QO7A 4CMCA 3MJSA 4D45A 3E9NA 3WS7A 2G17A 3H7AA 4IBOA 4M8SA 3HN7A 1R4MA 1EVJA 4CMGA 2VRCA 4FFRA 1IY8A 4H3VA 4PZDA 1E7SA 1TT5A 4ND5A 4RF3A 3DBHB 3KRTA 9LDTA 4ZQFA 3ZNOA 1NQOA 1Z82A 2WDZA 4XX0A 4KUHA 1N8KA 2VT3A 2G5CA 2HJRA 3KEOA 2O3QA 4K26A 3VPGA 5C7OO 4XD2A 2B4RO 1JLLA 2W90A 1UZNA 3TZQA 4CODB 3Q0EA 5BT9A 4E12A 4OL9A 2PWZA 4MVJA 1BGVA 3OHSX 2CMDA 5A02A 4NJOA 2BH9A 4C7KA 3WXBA 2AA3A 4PIVA 4I5DA 5JS6A 2YV3A 3KUXA 3VKUA 2HJSA 4GGPA 3LQFA 4MIOA 1B7GO 4J16A 2EW8A 2EHDA 4EUHA 3MJ4A 5IXYA 1R4NA 4ID9A 2AQ8A 3W4JA 1AE1A 1N5DA 4DPKA 4IDFA 4W7IA 2X5OA 1DC4A 1NR7A 3I83A 1RM3A 4BNIA 4I5GA 1YOVA 1YL5A 5L95A 1JVSA 3SVTA 3OSUA 2CY0A 4AJNA 2AG8A 3D4NA 3JQ8B 1A7AA 2V6MA 2IZ1A 1TA4A 2DPHA 2X0JA 4EJ0A 3G79A 1CERA 3JQEA 2HMSA 1KBZA 2GF2A 2Z5LA 4AG3A 3GRPA 1J0XO 1LQTA 2EW2A 2V6BA 3BAZA 1VKNA 2D5CA 2OUIA 5COBA 4EITA 1ZXBA 4HNGA 4Y6SA 4NIMA 5L3ZA 3WBFA 3ZI0A 4AVYA 1SZJG 3H65A 4YAJA 4YAEA 1I3MA 2GN4A 1ZKMA 2VNAA 3QHAA 5A9SB 2XXBA 1V9LA 4JBHA 1BRMA 2C2YA 2JD2A 4L75A 1BXGB 1IYZA 1KYQA 3RUFA 1CIVA 1Y9EA 4PZCA 5BNIA 3F46A 1EUZA 2FPGA 4GBJA 1K6XA 4I5EA 4GI2A 1B8UA 3H2SA 3W8EA 1LUAA 4CMBA 2PKQO 2Q46A 1YXMA 2Q3EA 2GGSA 2ZB3A 3WIDA 5HM8A 3RBZA 2Y1GA 2Y1OA 4E2WA 3ROMA 5EMHA 1TLTA 2EKQA 3QW2A 1C0KA 3W4KA 1P0CA 4XA8A 1HEUA 1GQYA 1MP0A 5JC1A 3TDKA 3WGOA 4DBZA 4WEOA 1E7QA 2OOSA 2DQ4A 3AOEC 1IUKA 4H15A 3DDNA 1PS8A 4CV0A 1KVRA 4UVDA 4K9DA 1JVBA 2C29D 3RKUA 4AJHA 1PJ2A 1CQJA 2NSDA 3WMWA 1ZW1A 3E1KA 4S3MA 2C07A 1Y5RA 4WK6A 4PLCA 2NTNA 4F45A 2SCUA 2H6EA 4B8WA 1UZMA 1LDGA 3LLVA 1OBFO 1LBEA 2BF7A 4E4YA 5JNLA 2IZZA 3JD0A 5DBGA 4J0EA 3ROPA 5L7WA 1Z74A 3DZHA 3GR6A 4P38A 1Z45A 1UUFA 2AQHA 2FP4A 5DOVA 1LX6A 3JQAD 3DOJA 5TF4A 2BELA 3K2BA 5BQFA 1NTOA 4OSOA 3Q6IA 1GZ6A 1WVGA 3CPSA 2GERA 1RJWA 2I5PO 2EWMA 1LTHR 5KVSA 4WCFB 1KVTA 3DTYA 2Y1DA 5ER6A 4Z0TA 4CV3A 2GUGA 1GY8A 4BMVA 4AJ1A 1LSOA 3D4OA 4BNGA 3HFSA 1MX3A 4FR5A 1ZSVA 1GYQA 5HRUA 1YRLA 5KVQA 3GNSA 5J23A 3PVZA 1F12A 1GFSA 1PJ4A 3I9NA 4MVJE 3RQSA 4AJ2A 5KNLA 2A35A 4W82A 1EBUA 4UVEA 4Y9DA 2EF1A 2NTVA 2B5VA 1YDEA 3IAHA 4IJVA 1DC6A 1GUZA 2QYSA 2NQ8A 5KJFA 4BNVA 4CLRB 3BTSA 2HDHA 2J5RA 4FS3A 3TNLA 4IDEA 5I9LA 1BDBA 2LDXA 4XYMA 4TZKA 3F5QA 2Q1UA 1U28A 3L6DA 5DCYA 4Z9XA 1CDOA 1Q7CA 3UCEA 3LT0A 1Z73A 3LYLA 4PLFA 5EINA 3ZWWA 3WTCA 2JAPA 1LA2A 5KKCA 1UP6A 3ZWYA 5I9MA 3OA0A 4EJ6A 1VL6A 3L4SO 4IDDA 3I9MA 4FJ2A 5T67A 4LRTB 1H9BA 3EY4A 3GEDA 3I5MA 3JQ7A 5IF3A 3JQ9C 3C1TA 3AI2A 1HE5A 3EK2A 1GYPA 1XELA 1NVGA 3D3EA 4BVAA 3OIGA 2OFPA 2ILTA 4IUYA 4J1TA 2V7PA 4DGSA 2P2SA 5JXWA 4CLDA 4JP2A 4JIGA 5BNFA 3TL2A 2HMTA 3FHLA 4EYEA 3U0BA 1UJMA 1L1FA 4Y6PA 4J2OA 2HQ1A 1QLJA 2EGHA 4ZQHA 2VCYA 1DFGA 3KXDA 4M54A 1KOLA 4O1MA 4NDNE 2O3RA 3F1KA 4HNHA 5B4VA 3CSDA 4YAKA 2YQ4A 1P77A 3E5RA 3NTRA 4D7AA 4UUMA 1O94A 4YJGA 1QLHA 1M76A 1GU7A 2FWMX 2PGJA 3ZV5A 3STHA 3K8ZA 1CEQA 3TN7A 3UKOA 3MTGA 3PHJA 1C1XB 2DFVA 4BNNA 4GSKA 1I10A 2O3SA 4TROA 4D41A 4Y8VA 2ZB4A 1OAAA 3DONA 3FD8A 1K6JA 4OJNA 4GX0A 2YFQA 1RPNA 4RF4A 1BW9B 1U4OA 5G0SA 4E5NA 3DEYX 3PQFA 4GGOA 1E1LA 3PJEA 3M2TA 5LC1A 3BYZA 2GO1A 3M2PA 2YW9A 2OHXA 3BMQB 3JQ7B 1J49A 3OA2A 4A27A 1I3LA 2Q2QA 1KC1A 3QVSA 3E5MA 2YHUA 1N7GA 3LF2A 4LGVA 1X0VA 3SX2A 1MG5A 2W2LA 3MJCA 3HDQA 3U4HA 2O2YA 3ZNQA 6LDHA 4YJFB 1X15A 1LQUA 1CRWG 4YCAA 4CMIB 3F47A 5I7EA 4KP7A 1PL8A 2NTJA 3UICA 4CM3A 4CM9D 1KC3A 3ULKA 1WZEA 4U0JA 1A4UA 3LSYA 4Q3CA 3U3XA 4L8VA 5DOZA 3DAGA 3IJRA 4XB1A 4B4WA 3BMOB 1PGJA 1X13A 1W6UA 3JV7A 2ET6A 1HKUA 1HDYA 1NFFA 5TT0A 3JTMA 1LRLA 4ZHSA 5K9ZA 5CDGA 3JQBC 4JP3A 1H9AA 3VOSA 4E13A 1OC2A 5A3VA 3JQBA 4R41A 2DVMA 1D8AA 3WGHA 2FR8A 1U3UA 3CE6A 3VPFA 1OMOA 4IDBA 1LEHA 4J9UE 1X7DA 1DIGA 2HKIA 2BGKA 4JGBA 1LU9A 4RZHA 4A26A 4QECA 3M1LA 4FJ1A 3DMTC 3HG7A 5JCJD 1IULA 1VJ1A 5TC4A 3ZCXA 4DQVA 3DMTA 4E5YA 4GWKA 1Q0LA 2I66A 4KOAA 4U6QA 3LT2A 4BO6A 1X14A 3FNEA 3IIEA 2HSDA 1G1AA 1HDGO 1LSUA 1ISHA 1DFHA 3MWEB 1X7HA 4RDHA 4FGSA 3VZRA 4YBZA 3NGLA 4GL4A 4F46A 3BHJA 2PGDA 2HK9A 5L40A 4JJFA 4U0KA 1XSEA 2EERA 4EDFA 2Y1CA 1Y9AA 1QRRA 3EVTA 1O9BA 3D3WA 4II2A 1ENOA 4FBGA 2IZ0A 2ZQZA 3TZCA 3WYCA 3WTBA 1FDSA 3HWRA 1UXKA 3LLSA 3SC6A 2BD0A 2B35A 1NBOA 3TQHA 1EFLA 2PTGA 2VHYA 2UUOA 2E82A 3G49A 4WNIA 3GNTA 2IYOA 2D8AA 1VI2A 4U6SA 5DT9A 3SJ7A 4TSKA 1PJCA 3IP3A 4IZIA 1Z75A 5FF9A 2Y66A 2DFDA 4PLWA 4BHTA 5C7IO 4MKRA 1BWSA 3P19A 4WCFA 5EL0A 4ILKA 3DHEA 4WLUA 1PJLA 4R5HA 4IQ8A 1FDTA 1Z7BA 4GX5A 4UEOA 1T2AA 3CINA 2NV6A 2YDYA 4ROSA 5EN4A 5IXSA 4JBGA 4HUJA 3I23A 1E7YA 2QRJA 9LDBA 2PZKA 1UDBA 3PQDA 1GUFA 1PIWA 1RM5A 3WGGA 4E2XA 1PU2A 5JMWA 4ZU3A 3QA9A 1M2WA 1I36A 2AEMA 3L07A 5T8KA 4MINA 3ITDA 3K9QO 1IPEA 1O89A 4XQGA 3BHMA 4ESOA 4YACA 1ZK0A 2O7QA 5JAZA 1EUDA 1EUCA 3DL2A 2CD9A 1PGNA 1EK6A 3DBVO 1NWHA 2FZEA 3PRJA 1ENPA 4CM1A 4Q3EA 1HDXA 2DUWA 5BSEA 3E8XA 4JJIA 3TZ6A 4CR8A 2PKQP 2O50A 1XIVA 4QFDA 3A14A 3CKYA 3RBXA 5COAA 2GR9A 4ZA2A 3RU7A 3OQ6A 5AQ1A 1KVQA 3NGXA 2YHIB 3WGZA 2JD0A 2R00C 3RU9A 1Y8RA 4BKRA 2C7GA 5G0TA 3B1FA 1HT0A 3LC7O 2A94A 4L74A 4R5MA 4HX5A 3GHYA 1MLDA 2P4QA 5LDGA 5CDTA 3HB4X 4YQYA 4IINA 4D43A 5JLAA 5JFOA 3ONEA 2NWQA 2QQ5A 1U3WA 1IZ9A 4M1QA 2VOJA 1WDLA 4WASA 3MWDB 1V0JA 2I3GA 1RM0A 2GPTA 1ZK1A 2XAAA 4PLPA 1U2DA 3VH4A 4PG8A 5GMOA 5CDUA 1C0PA 4WLVA 3WB9A 2BFAA 4KWIA 1ZNQO 2P9EA 2J5KA 3SLGA 4XGKA 3ANNA 1DIHA 2CDCA 2PH3A 2Q50A 3E82A 4QT0A 2ZKLA 3VKVA 4P8RA 5U1PA 2J6IA 3C7CB 4J90A 1M75A 1QV6A 2RCYA 2P68A 1N7HA 3QY9A 4EI2A 4HXYA 1I2BA 1GPDG 2WWRA 5G0WA 4AL4A 2PZMA 3L0DA 3WIEA 1GADO 4RPKA 4R4JA 3KEQA 4OOFA 1E5LA 2ZIZA 3RBVA 4AJJA 5HBRA 8ADHA 3PHHA 3IKTA 4HBGA 1E7RA 2BFMA 3C85A 4R01A 1F0YA 2AE1A 3WSVA 2BLLA 2DTDA 5JAIA 2VRBA 1FDWA 3PJDA 1V3UA 4UUNA 1KVSA 2AG5A 3OJEA 2P5YA 4RPHA 1JDJA 1A4IA 2DKNA 4Q3NA 3G3EA 4DWVA 2JD1A 3RIHA 4XDYA 1PR3A 3BMQA 5U4QA 1A7KA 4Z9YA 5JCJA 3ETDA 4E5KA 3FF4A 1GYRA 5IJZA 1NR1A 1ISFA 1Y5MA 2X5JO 2E48A 1I8TA 3B1JA 1HE2A 2J3HA 2PA3A 3PDUA 1GQ2A 2NVWA 4W9NA 4BNYA 5TRTA 3UXYA 4F3YA 4D3SA 3AI3A 3U9LA 2ZATA 4B7XA 2JHGA 2GD1O 2YUTA 4OGWA 2B4TO 1B0AA 1JKJA 3A9WA 5BSHA 3WICA 3UFXA 1YDWA 3WYBA 5FEUA 2FSSA 1ULSA 4XYBA 1VJ0A 3DZJA 4ZQEA 1H6BA 2X5KO 1SO8A 3OBBA 5DDIP 4BO7A 3PYLA 2BI8A 4MIEA 2CVZA 2FMUA 3GEMA 4OKIA 1NWCA 2B83A 3DC2A 5GZ6A 1ZK4A 4O0LA 1AUPA 4CLEA 5IN4A 1Q2XA 2B36A 5L4NA 3OIDA 3PHLA 2BMAA 2FPIA 2FR0A 3WLEA 2X0RA 3JQGB 1QG6A 1EEHA 3UCFA 4RL6A 4NR0A 4PLGA 1W8DA 3PGXA 4I9HA 1E3IA 3JQ8A 4HWKA 2Q45A 4DYDA 1R4NB 4QQRA 4CMJA 4J4TA 3L4BA 5IDYA 5L7YA 3K30A 2B37A 1C1DB 3NUGA 4FDAA 2J8ZA 1N1EA 4XCVA 4Z3KA 3WSWA 2IXAA 4NK5A 1FF9A 4XJTA 3DZBA 3ZU3A 1PJBA 4PLHA 2D3TA 5C5IA 4FJ0A 3GVIA 2VZ8A 2Q2VA 4KQWA 1GEEA 5LDHA 2VYVA 3ICPA 4AJLA 3D1LA 4R51A 4KDEA 3GVCA 4IQ0A 1B16A 3C24A 2WE8A 3KYBA 1LC3A 5G4KA 5KCZA 5EQFA 1U2GA 1UXIA 1PS9A 1FMCA 3DZIA 4I08A 1E6WA 1PWXA 4ALJA 2WYWA 4R1SA 3WFIA 4DIBA 4RORA 4HKTA 4NFSA 4LCJA 1G0OA 2UYYA 4J4HA 4G81A 4ND1A 5T6BA 1U4SA 3QVWA 3Q9UA 2C54A 2PD3A 4P4LA 3NDRA 3ADPA 4XWYA 1MFZA 4XJSA 3VTFA 3WWZA 1M66A 2B5WA 4EZBA 2I6TA 1MC4A 1QYCA 1UDAA 2JL1A 3EMKA 1ZMOA 3PYXA 1Y8QB 4NFHA 5CFZA 2OP1A 2OZPA 4P4NA 4F6CA 5ENDA 1DJQA 3KYDA 1ZZEA 2QW8A 4BNJA 2DBVO 4EEXA 2RH4A 2JCYA 1ULUA 3FPCA 3CMCO 4YRDA 1WMBA 2HK7A 2X86A 2IXBA 4NHEA 5L4SA 1T1RA 4QUKA 3QVOA 4W4TA 4N7RA 3TPCA 1MA0A 4CLOA 3ZWVA 2P4HX 3GG9A 3PIDA 5ILGA 3E18A 3I9LA 1LLUA 1K2WA 4UAGA 4WEQA 4J6FA 1P74A 1S7CA 2DBQA 1LC0A 3K31A 2NUAA 3OIFA 3DHYA 3UOGA 2IEBA 4YRBA 3GRKA 2VHWA 3GH3A 4X54A 3UVEA 2NADA 1VL0A 4FN4A 4YVFA 1JA9A 4K1LA 5G4KB 3AWDA 3ZGYA 2O2SA 4E32A 2I9PA 4KQXA 5HS6A 4CUZA 4MVJH 2YHIA 3I4FA 2R00A 2RHRA 1YBAA 3ENNA 1FDUA 3RI3A 3ZWCA 5ADHA 3JYPA 3H2ZA 5B4TA 3AU8A 1ZIDA 1LRKA 1PQPA 4CLXA 4OXYA 2WMDA 2IRWA 3PWSA 3WJAA 4OAQA 1U5CA 3C8MA 1NPYA 2AXQA 3X2FA 3JD2A 3GAFA 1VC2A 4IIUA 2I65A 5JAMA 3OEYA 4ZRNA 1N92A 3FNGA 5KVVA 4ITUA 4RLHA 3WQSB 4U5QA 4KWHA 4YWJA 4CMEC 2HO5A 4ZJUA 4WPGA 4CPDA 1NQ5A 1VKOA 4NBVA 1KEWA 3GZ4A 3GC6A 2G0TA 3Q1LA 1MXHA 1VM6A 3GHHA 3SLKA 5CPFA 5BR7A 3G17A 5A3JA 3VDRA 3C7DB 4CLRA 1PJSA 2HMWA 1E3SA 3RUHA 1PWZA 2IDZA 5HWSA 2VYNA 1Y7TA 5TX7A 3VC7A 1ZK3A 1VRWA 2UDPA 3WGYA 5CG2A 1ZMTA 2FSVA 1KEUA 3LVFO 1BVUA 3VZQA 1NFRA 4GWGA 3FR7A 1YE3A 2ZJ0A 1PTJA 1JW9B 4IGEA 1P1RA 3GQVA 1NNUA 5A05A 1B26A 1YL7A 1LRJA 1H6AA 2AE2A 2VRCD 3V5NA 1MXFA 4RV9A 3D64A 4PG4A 4EEZA 4GLOA 3BMNB 4PLTA 4KTVE 3JD3A 3GVHA 1XR3A 3B70A 4TRNA 3V1TC 3CTMA 2AQIA 1YWGO 1QP8A 3GN1A 4JCOA 3BTVA 2X0NA 3GLQA 1ZUD1 4A5OA 4YT5A 3ONFA 5A06A 2Q4EA 2J5QA 4UVHA 3ANLA 5DP2A 4CM8B 1WAMA 3JQFC 3FNFA 1VL8A 5JE8A 3T4XA 3VH3A 4H16A 3LK7A 3IS3A 3PFWO 4MP8A 1EQUA 1H6CA 3RFXA 3WDSA 4CLOB 4NBRA 4YRAA 1F17A 3ZW8A 3C7AA 2GYYA 3RASA 3GUYA 4BO0A 5FYDA 4J3FA 1HDCA 5TSDA 3W1VA 3A1NA 2OGUA 3EAGA 3TF5A 1LJ8A 4NBWA 2WYUA 3QV1A 3LDHA 2XOXA 3UUWA 1NASA 3HZZA 3W8FA 4BGUA 5I8WA 4AJPA 2RIRA 4GMGA 2DM6A 5A5EA 3WBBA 2O4UX 3F3SA 3ZDFA 3PTZA 3E48A 2V65A 2EKPA 5AVOA 3VH2A 1C0IA 3CXRA 1RM4A 4MVJF 1ISIA 1I30A 2GCGA 4DQUA 4WOKA 4MVJM 4PLYA 3JQGA 2ZCVA 4YJGB 2WYVA 3X2EA 3RVDA 4J1SA 3ZZNA 2JKVA 1I2CA 4XDZA 3ETEA 1UAGA 2Y67A 2BGMA 3OQBA 4FSHA 1KY5A 3OP4A 5KJEA 4AJEA 1DAOA 2PD4A 1M6HA 4PLZA 2NQTA 5JY1A 2WD8A 2YY7A 4RLSA 4TMFA 1B15A 2HU2A 2VUSA 3OEWA 1QYDA 3JYLA 4P22A 4BKPA 1YJQA 3PIIA 4YT4A 2DU8A 1GQQA 4TRRA 2NU6A 4YYZA 3EZYA 4BQRA 4PRLA 4MP3A 2PGLA 1E1MA 4IM7A 4WNCA 5HA5A 1FK8A 4AJ4A 4DUPA 2FHSA 4MDHA 4OMUA 3OJOA 2F00A 1H2HA 2GDZA 2JHFA 2HMUA 3BMOA 3GGPA 4IY1A 4TQGA 5TT1A 3F4LA 5AYVA 3JQAB 2OBNA 1WP4A 3FR8A 2CNBA 3FN4A 3OQ1A 4NH4A 4DTIA 1H0KA 3I9JA 5DCUA 1AGNA 3KLPX 3O26A 4BGEA 1LSJA 3GZNA 4FFPA 4Q3BA 2C5AA 1AHHA 2Y1EA 5KJ6A 2E6UX 3FSRA 1WDKA 5C3MA 1E7MA 3GT0A 3KYCB 2OO5A 4OM8A 1EMDA 3WMXA 2CVQA 2PFGA 3WGTA 1HF3A 2H9IA 4Q39A 1U8FO 4MIYA 2X22A 3MOIA 1DRWA 1ENYA 1WW8A 3AUUA 1HL3A 4EGFA 1HE3A 3BA1A 1VSVA 3S2EA 1Q7BA 3H9EO 4KTTE 2AEFA 2WD7B 1I33A 3A4VA 3VH1A 4HY3A 1E3WA 2H63A 3DOOA 5C37A 2OXIA 3DZKA 3NJ8A 1ADFA 1I0ZA 1D4FA 1WMAA 1DFIA 5CEFA 3RUIA 2POQX 1S6YA 5H83A 3PP8A 2UV8A 1YKFA 1HLDA 3U62A 4PG7A 5EJ2A 5MDHA 2QZZA 4PN3A 4J9VA 2Y93A 5CDSA 5A9TA 3GF4A 3FRJA 4RVGA 1B8VA 1RYEA 3RKRA 2BKAA 1BMDA 4I9NA 3H9QA 1NAIA 1QORA 2DTEA 3P5SA 4BNZA 1D7OA 2OBYA 4HFJA 2Q49A 2YDXA 1DEHA 3OF2A 4BNTA 4ZGWA 1R0LA 1E3JA 3UN1A 4BIIA 2PKRA 4GH5A 1Y8RB 2BHLA 4H7PA 2GASA 1PJ3A 5I7SA 5ICMA 3D4PA 4GAEA 3CIFA 5AOVA 5ITWA 3ZWBA 1O6ZA 4GPD1 5I9NA 4TWRA 2NM0A 3HADA 2VNSA 3ANMA 4NMHA 4RVDA 2VN8A 1T4DA 3V1YA 3H9GA 5JBIA 3EUWA 4Q3AA 5DCWA 2ZTMA 3JYNA 2X7HA 4FW8A 4CMIA 4BMSA 2HK8A 2O3JA 3ZU2A 3K5PA 3OJ0A 1I01A 1HDRA 5A04A 3F1LA 2J3IA 1ISJA 2G76A 7ADHA 4RQTA 4J7CA 1XKQA 4UULA 4W99A 3C1OA 1A5ZA 4BV9A 1HYGA 2VUUA 5JDIA 1W4ZA 1RYDA 2NVBA 2ZCUA 3Q2IA 4PVCA 3DBLB 4XZ3A 3KM0A 4R1UA 1Y1PA 2C82A 1Z6ZA 1XU9A 3H3FA 3BIOA 5DN9A 4DMLA 4CQMA 3WQRA 3IP1A 1ZXLA 1SC6A 2BGLA 2W2KA 5CAEA 2Y0DA 3HE3A 4BV8A 4CL8A 5C7LO 3FPLA 4JXKA 2PH5A 4OQYA 4QEDA 1VE9A 2X8LA 3PGJA 1T4BA 4MVJI 3GDGA 4BGVA 1AHIA 1YB4A 3PXXA 2H5LA 4GLLA 4DLBA 4A2CA 4M87A 4BNKA 4XRRA 1F8FA 1HSZA 4YA6A 3O8QA 4J1NA 3S2GA 4BB5A 3WR5A 1IE3A 4J91A 1BG6A 4TRMA 3S2FA 3NAQA 1JTVA 1SB8A 4BNFA 1DRUA 1C0LA 1OOEA 3N7UA 3NX4A 3RFVA 4WUVA 3GVXA 1KEVA 1RWBA 2UAGA 3DTTA 1DIAA 5JMPA 4CMKA 2C59A 3N58A 2VHZA 3ZU5A 3KO8A 4Z6KA 5JYDA 2VWQA 1ML3A 1VJTA 3TZKA 2JFHA 1T1SA 4K28A 4O5OA 5THKA 1D1SA 2JAHA 3UCXA 2P9GA 2ZQYA 1IOLA 1DLIA 1SAYA 3IMFA 1JWAB 2NU9A 4GSLA 4YR9A 1BXGA 3WNVA 1EFKA 1FXSA 1V8BA 2I3AA 3JCZA 4TVOA 3FNHA 4BO3A 1P1KA 3OJLA 4I1IA 1ID1A 4XYGA 3DQPA 2ZYGA 4ZQBA 3ROQA 4LRSB 5FFFA 4R3NA 5TGDA 3TOXA 1H5QA 2P5UA 4DRYA 1ISMA 5A4DA 3GMSA 3ZV3A 1GD1O 2RH8A 1HE4A 4R1TA 1SEVA 1EK5A 1DDOA 3JYQA 1SB9A 4WOJA 1DIRA 4LSWA 1A9YA 4GQAA 5T5QA 3E9MA 4FFMA 1V3VA 4FOOA 4GVLA 4IIVA 3DFZA 3NTOA 1LLDA 3CUKA 1ORRA 4IDCA 1M6WA 2I67A 3PLRA 1G6KA 1HDOA 1IL0A 3I3OA 4WE3A 4XB2A 1PL7A 3W6ZA 5FI5A 4BNWA 2DPGA 4PG6A 3VAZA 2IYPA 4FQ8A 5HTOA 1Z7EA 4U7WA 3QVTA 4IJUA 1GCOA 1AXGA 4IZHA 2NU8A 1NQAO 4ALMA 1QXSA 3TFQA 1K5HA 1CF2O 5IG2A 1OC4A 3PI7A 4R54A 2CVOA 1YVEI 1EVYA 3ASUA 3ZH2A 4RQUA 4KMSA 5A1TA 4HV4A 4LVUA 1EVZA 1I3KA 1LDMA 2HUNA 4BOYA 1UXHA 3ABIA 3ROKA 1ZSYA 4RVFA 2D0IA 4FFLA 3DBRB 4OXKA 1QR6A 2EIHA 3JQCA 3WG9A 1T2EA 2DUUA 3DAFA 4RGBA 4WLFA 3RSHA 5CG1A 1O0SA 3IC5A 4NPCA 1E6EA 1NAHA 2VZ0A 2JFFA 4Z0PA 3IOYA 1QYXA 3GK3A 4E3ZA 1EDZA 2HLPA 4NJMB 2C2XA 4G65A 1UXJA 3BHIA 1GTMA 3QIVA 4I9UA 4NBTA 4CUJA 4IDGA 4M89A 4ND2A 1E3WB 4ND4A 1DC5A 3JD1A 5IZ4A 1SBYA 4ZD6A 1PR9A 1RKXA 5EQDA 1PJQA 1XLTA 5KJ1A 5EIOA 3HUDA 3SEFA 1YQXA 1N9GB 4KZPA 4DC0A 1PZGA 4YAIA 1PQWA 4BQPA 1XDWA 2OP0A 3ZHBA 4BO9A 5L45A 3NDJA 4A0SA 4LVCA 4PVDA 1M67A 3MTJA 4WLEA 1P1HA 1TEHA 4BO2A 1KIFA 5GY7A 4L73A 3ADOA 1ZSNA 3K96A 1PJTA 5B1YA 1UAYA 2A9FA 2BRUA 1P45A 4P4GA 3V2HA 1Q0HA 1NM5A 3SC4A 3IUPA 4FC7A 2DBZA 4E6PA 4PCVA 2DTXA 1XQ6A 2GSDA 3T7CA 2YZ7A 3L6OO 1LDNA 3AUSA 3RJ5A 1WPQA 4LMPA 3OECA 3HSKA 1SPXA 2HCTA 4E2ZA 3ZW9A 1UDCA 2DAPA 1P0FA 4R69A 1LDEA 4C4OA 3NRCA 1SOVA 3L4BC 4ZRMA 2GLXA 5I8ZA 4J2HA 2Z95A 3T7EA 4II3A 4AJOA 5KIAA 3AY6A 3QQPA 2GZ2A 1GL3A 1YB1A 4AJIA 3EYWA 3V2GA 4ALKA 4CLHA 1U5AA 3RCBA 4EJMA 1F8GA 4BNUA 2Q4BA 3CEAA 1YBMA 4NG5A 3S55A 1ZEJA 2XXJA 1U9JA 3AUTA 2VWGA 3AM4A 4L76A 1YH3A 4OKNA 1JKFA 4XYLA 4WCFC 3WJ7A 5U9CA 3EGOA 5HS4A 3R3SA 3HB5X 1NVTA 4HFMA 4FFOA 1P1FA 4J49A 3DZFA 4BO5A 2PV7A 1PGPA 2Y0CA 3BZUA 4Y98A 2RAFA 5AXBA 4YPOA 3VVBA 1NPDA 1VPDA 1QV7A 2FR1A 3ZNNA 2E4AA 1Y8QA 1DRVA 1AXEA 5A03A 1U3VA 3ZHYA 4HFNA 4E21A 1C1XA 1XG5A 4MKXA 4BNMA 2EP5A 3KSUA 2XF8A 3U4CA 1YO6A 1YQGA 4PRKA 4XR9A 3PHGA 5TS3A 2QZ9A 2FZWA 2V6FA 2ZYAA 4Q9NA 1C3VA 3O03A 1NVMB 4J43A 2VWPA 4GMFA 4XRGA 3OH8A 2QHXA 4PZEA 2F1KA 4PG5A 3SJUA 4FIZA 4R1NA 5G0UA 4J0FA 2I99A 1IB6A 3GOHA 3N74A 4R68A 1CWUA 1ZH8A 1ZEMA 2A4KA 3KYDB 5JW6A 1Q7GA 2WM3A 3NV9A 4CV2A 3S1LA 5KVCA 5GZ1A 1P9LA 3AOGA 3RAJA 2R6JA 5IN5A 5B4UA 1V35A 4O59O 4FD3A 1TVEA 4ND3A 3HQ4O 4IMRA 4WCDA 1O8CA 2IODA 1DIBA 1NQTA 3A28A 1LDYA 3F9IA 2AHRA 1LLQA 2EG9A 2WJPA 4B4OA 4BO4A 2O3UA 3QWFA 4JROA 2W8ZA 4WECA 4CMHA 3OMLA 5MGBA 2QYTA 3K6JA 3JQFA 2VOEA 4B4VA 4QO8A 2GN8A 4RO0A 4YJDA 3IUSA 3ORFA 5TNXA 2YJZA 1SOWA 1DXYA 2LDBA 4JX8A 3WLFA 3INRA 4B3HA 2D5AA 4E33A 1E3LA 4B79A 5F5LA 4UUOA 3R6DA 3H3JA 3Q11A 5JO0A 3KV3O 3G1TA 2EKLA 4YAGA 3W4IA 1Y6JA 5ICSA 4NNJA 4A7PA 3U5TA 4B4UA 4DA9A 4EUEA 4RDIA 1KVUA 1MV8A 4O63O 4AFNA 4RPLA 1JWBB 4OYRA 4AICA 2G1UA 3PDJA 4QX6A 4RJTA 4MVJP 1EDOA 2CF6A 3IKVA 4XGNA 3DHNA 1ADCA 2Q1SA 2DC1A 3H9UA 3JQDA 3U4IA 4CQLA 1QYVA 3KSZO 5FI3A 4DIFA 4I5FA 1DBVO 3DXFA 4TRJA 3DZGA 3R3JA 5IDXA 3AFNA 2B69A 1T24A 2W4QA 3PYMA 5F1KA 1H6DA 5IFLA 2TMDA 3KHUA 4DQXA 3M6IA 4CMAA 1K3TA 1K89A 3GGGA 1I2ZA 2Y1FA 4RVUA 4O6VA 3D5TA 3RC9A 5ER9A 4D3DA 5DF1A 1ZO8A 1WZIA 1ARZA 1KEPA 1UP7A 4R16A 3GN2A 4CJXA 2D2IA 1J6UA 2FRDA 2R2GA 1HETA 3UHAA 1N9GA 3HJAA 5EESA 3VHRA 1QMGA 3IJPA 4DC1A 2CF5A 1DC3A 3I6IA 4MVJD 3SBOA 4CM8A 4LMRA 1U1IA 1NPTO 3WX0A 5CEJA 1U8XX 1UH5A 3PLNA 2NU7A 2WSBA 1XQ1A 4E30A 4D44A 3H5RA 1R4MB 5DBIA 5AXAA 1BHSA 2PNFA 3MZ0A 2CDBA 1IHXA 1D3AA 3U49A 2O3TA 4Z9FA 2IEDA 5COQA 2DLDA 4CM7A 3MEQA 3ZWMA 2XPCA 4TKMA 1BDMA 1HXHA 3PFFA 1NYTA 3LC2O 4R9RA 1HYEA 3JSAA 5ES3A 5F5NA 1YQDA 4IDAA 3RWBA 3PWKA 4XGIA 3RC1A 1L7DA 2B4QA 1EZ4A 2CDAA 3TJRA 4JNKA 3QRWA 2J3KA 5F1PA 5H81A 4K6CA 1ISGA 2EV9A 2ZK7A 4DVJA 4J1QA 1JKIA 3EVNA 3KOUA 5A5FA 1ZBQA 1A72A 1DHRA 1HLPA 1Q1NA 2AMFA 2CSUA 3HDYA 3H9JA 1LLCA 1XGKA 1P3DA 4IJWA 4W9NC 4DPLA 3C1AA 4L0QA 3L6EA 3P7MA 3W6UA 3WWYA 2JFGA 3UAGA 3KVOA 2HRZA 2P9CA 3PEFA 3JQ6A 4DLLA 3A06A 1DHTA 1GCUA 1EVIA 4BB6A 5CP8A 4OO3A 2X6TA 3UF0A 1CQIA 5IZCC 3AM3A 4RZIA 1KY4A 1OFGA 1W73A 3T4EA 4MKZA 1NHWA 3V2UA 2Y0EA 1O5IA 1I5RA 3TRIA 3HFGA 5F1OA 3V1UA 3VZSA 1P33A 1UXGA 1X0XA 1ZFNA 2IE0A 4A73A 3WGIA 3I9OA 3DO5A 3BMCA 2ZTUA 5F21A 1BTOA 1T2DA 1YBVA 3RUAA 1K6IA 1XA0A 2WE7A 4CV1A 4IXTA 5JDCA 2CFCA 3GPDG 5DNAA 2VTDA 2X58A 3UGKA 4DIOA 3BXXA 1U3TA 1PGQA 5JDCC 4BGIA 5KTKA 3GY0A 2I76A 2QG4A 3DB2A 3O9ZA 4MO2A 3LT4A 4LW8A 1HZZA 1QKIA 1GV1A 3RJ9A 4DL9A 5I7FA 3QWAA 1SNYA 4J7UA 2YV1A 5KKAA 3ONDA 1ENZA 3VVCA 4MPDA 2YYYA 3IQDB 2WD7A 2O48X 3RC2A 4DBVO 4GKBA 5JSFA 4TZTA 5BSFA 3ZV6A 1CETA 1PSDA 3FBTA 3LC1O 4RCVA 5F3RA 2OL4A 4A10A 3MJEA 1ADBA 2PK3A 3GGOA 4E0BA 3JQAA 4L9RA 3QP9A 3ZHXA 3GAZA 5T64A 1Y81A 3GVPA 2E37A 3UH1A 5CEEA 1DSSG 5JO9A 4CM4A 5JC8A 3GG2A 2VZ9A 3WYEA 5BSGA 2FPPA 2X9NA 4FB5A 5T57A 1MFPA 4E5PA 3TSCA 2GZ3A 2GN6A 3C3XA 4OXNA 3OICA 1OZAA 4OOEA 1E6UA 3PJGA 4FC6A 4CQMB 1JN0A 3ETGA 4KUGA 5LCXA 4R3WA 2W2KB 3P2OA 1YGYA 4D0SA 3TOZA 1J4AA 5JDIC 3GA0A 4LK3A 1R15A 4ZICA 4W7HA 4JN6B 5L53A 2EGGA 3RC7A 1EE2A 1V3TA 1FJHA 4XQEA 1GZ3A 4J4BA 5ILOA 4NI5A 1B3BA 5ITVA 2Q2WA 3P2YA 4N54A 2PLAA 4OH1A 5L51A 5B37A 4BO8A 2Z1MA 3M1AA 4HFRA 2C7VA 4XQCA 3SXPA 1YJ8A 5DULA 3R1IA 1WWKA 2QIOA 2OMEA 1YOVB 4BKUA 4NFYA 5G4LA 1ZK2A 1D1TA 3DBLA 4I8XA 4XQ9A 1R6DA 5JY6A 5CDYA 2B0JA 3EC7A 2J3JA 4UREA 1K0UA 1J5PA 2JCVA 3GDOA 4FPXA 2NACA 4YQZA 2FOIA 1B3RA 1T2FA 3B6ZA 1P1IA 4PFJA 4W6ZA 3I52A 1HZJA 4UUPA 3ASVA 4B3IA 1IZ0A 1VSUA 3MJTA 4MVJG 1F14A 1PEDA 4LSMA 1PX0A 4B8ZA 3PK0A 1MUUA 1GZ4A 1GDHA 2AEJA 1A9ZA 5L4LA 3I6QA 2C20A 2FY8A 2GN9A 4YTEA 5AXDA 4JBIA 2NNLD 2DBRA 1SEPA 3EDMA 3D0OA 3EHEA 1ZVMA 4AJKA 4QXMA 1XWFA 5K0ZA 3K73O 4D0RA 3GDFA 1R16A 3AOEA 4WLOA 2OORA 3RUCA 4YJHA 5I7VA 3KTDA 4DXHA 2EP7A 3DOCA 3INTA 2PR2A 4BNLA 4IMPA 4D3FA 3OETA 2WTBA 4CQLB 1NP3A 5THQA 3GNQA 3ICCA 3VZPA 2VWHA 5CPBA 4CQMD 4EUFA 3HDHA 3AFMA 4YDRA 4CR6A 3QWIA 2BFOA 2W98A 1W0CA 2GRAA 4YEDA 1X1EA 2AW5A 2EJWA 3PZRA 2V6GA 4NU5A 3ZWAA 1DOHA 1H93A 2YFHA 1HSOA 3D3WB 4ALNA 4XYEA 4GX1A 3ZWNA 1L7EA 5KWEA 3PPIA 2TMGA 3ZNPA 4F6LA 1DO8A 3ON5A 4D79A 1T26A 4CR7A 3VPHA 5IDQA 4FOSA 3E6AA 1CJCA 5DBFA 3OM9A 3MJVA 3FTNA 2QRKA 4B7CA 4EBFA 1ONNA 1WXDA 3HNPA 5BNTA 1GEGA 3EW7A 3KLMX 2D4AA 4UVIA 1YB5A 4WGGA 3I1JA 3RUEA 4UVGA 3Q3CA 3H5NA 2CZCA 3QSGA 1T2CA 2X23A 2WEKA 3WQQA 8LDHA 1BW9A 4L4XA 4YJFA 2ZJ1A 1GV0A 2X4GA 4K6FA 3H6KA 1JU9A 3NDIA 3AY3A 4IQGA 2ZTVA 4RVHA 1LNQA 4CM6A 1FDVA 4RPGA 4CM9A 1I3NA 1HRDA 3GFGA 4NK4A 1JQBA 1MGOA 4MOWA 4D42A 3DR3A 1EBFA 3H4VA 4M86A 3E03A 3U4DA 3FTPA 4BKOA 1NXQA 4GVXA 2O4CA 1G0NA 7MDHA 2PY6A 1YONA 3WGQA 3TWOA 2Y68A 4R9SA 4FGWA 3BMCB 3R0IA 5FWNA 3NTQA 4U8GA 1E77A 2O7SA 4A03A 2RBEA 1MG0A 4IS3A 4Y6RA 3EZLA 3KETA 1EQ2A 5H82A 3VDQA 1C1DA 1I32A 3ZHZA 5B12A 3W8DA 3DBRA 3OJFA 4INAA 4L4SA 1SMKA 2YQ5A 4MP6A 3VTZA 1Q0QA 1PQUA 2BFPA 1XYGA 1YS4A 1ADGA 1XEAA 4OHUA 4DPMA 3NT2A 4YT8A 3DBHA 3INGA 4XKJA 1XCBA 3I9KA 2VUTA 5L7TA 1KERA 3ZWPA 4QFCA 4Z3DA 1WDMA 3KZVA 3JQ9A 5AXCA 2PZJA 4C7JA 4JLWA 1E1KA 2RHCA 1B8PA 4NZ9A 3AY7A 4KDFA 1N1GA 2UUPA 4N5LA 3GUCA 4XIJA 2VT2A 3DMYA 4L4RA 2CUKA 1E0DA 5TIIA 1DPGA 1ONPA 4NJMA 4QTZA 2NVUB 3ZWXA 1HDZA 1GUYA 3UW3A 3QWHA 4Y67A 4RPJA 5KOIA 2Y99A 3FWZA 4MJLA 5EERA 3PWZA 4YJHB 2ZB7A 3MOGA 2VHVA 3BMNA 4D46A 1I24A 4GX2A 4ALIA 1NHGA 3ZN2A 4KUEA 1WNTA 4E2YA 1O95A 1UZLA 3RFTA 4UEJA 4XEHA 4IJKA 3S8MA 3BTOA 4DLAA 2H1SA 1LSSA 1TT5B 4PLVA 4HADA 3FI9A 5K6AC 3GEGA 3D7LA
chains in the Genus database with same CATH superfamily
2ZRKA 4D97A 4FDVA 5IHXA 4BE9A 2PUBA 1JHOA 1YZYA 4OY3A 4KXMA 1JMVA 4YB8A 5TJ9A 4LF9B 1FFGA 3EH2A 5TQ2A 3A3OA 3V4OA 2YV2A 3B9QA 4URFA 4AY2A 1RXIA 4Y7CA 1QSGA 1QFJA 1XJWA 3NAGA 2Q99A 4IH9A 2W2TA 1FA9A 4RQAA 3UGQA 1TXGA 4FU0A 2OGWA 4B5KA 1D6MA 1CUHA 2WU4A 2R85A 4NU6A 5G0VA 2OYCA 3IOMA 4P36A 3RUDA 2EYUA 3C6YA 1U0NA 2CXXA 2ZIVB 3LP5A 3DKIA 4NBKA 1NFQA 4BFXA 1FXUA 2XZDA 1RI2A 3Q72A 3HKCA 3QVXA 1NX6A 4X24A 5EZ6B 4ZTUB 3TLGB 1PN3A 3TQQA 3U3ZA 1C1HA 2QK4A 1J2EA 1XPJA 5JAQA 1E7WA 3KKKA 3RD5A 2N46A 3V4FA 2JCXA 1HYHA 5DX0A 2HPHA 3ST7A 1SUEA 5I5EA 3TFOA 1ZJZA 3NH9A 3GZNB 1R37A 5IABA 2ZSEA 2A5FA 2HBRA 3PD0A 1P2VA 2E49A 2D59A 2P91A 3U7JA 1BYUA 1RD4A 3TKLA 5EJMA 5LDGA 2IHTA 4WOPA 5DGCA 4ZI7A 4AZVA 3E05A 1R0KA 1ETHA 2AHOA 4ID3A 2VHQA 3G5MA 3JYOA 3TZHA 421PA 4H2DA 5FYQA 2YYZA 1G38A 4JHXA 1T25A 3NHZA 3NWBA 4JGIA 2GRUA 4HGPA 2ZVPX 3AG6A 1Q1BA 1R12A 4DM4A 2CMGA 1E5QA 1R0BA 1M2OB 4QREA 4WAUA 1TVKB 3D43A 2QSYA 1WPGA 1YUMA 3CLRC 5AJWA 4X66B 4FZ3A 4G1EB 4Q3LA 4B3JA 3RANA 1F0NA 4UDYX 5ESRA 4DREA 2DQSA 1IG3A 1PT8A 4R7TA 3IXLA 4TVSA 3E35A 3HCPA 4I2VA 1WE2A 1P7VA 3LXXA 4LOJA 3BK7A 1XCPA 4LY9A 3OQOA 2BI7A 4RBNA 2DWPA 1FMTA 1SC3A 2VHXA 4MYRA 4A23A 1VMIA 3E9QA 3NUZA 1T15A 4BO1A 2QUJA 3PVSA 4RS4A 3WKDA 4ARSA 1GTVA 3L7NA 3ZY5A 1GNSA 3AJRA 4HWPA 1IJKA 2QUAA 4RTJA 1H22A 3AFIA 4ICIA 2AZTA 4FYJA 1IWOA 1MC5A 3F6YA 1L7OA 4IGKA 4UBIA 2YMLA 5HKOA 3ITKA 4HDSA 4YJKA 4YMIA 3MXOA 1WXWA 1KI6A 4RTMA 3SAJA 4MUEA 4P34A 1GAJA 2EJVA 4TM8A 1MPTA 3X1WA 2QENA 1OI7A 1KEKA 1H2XA 2IP2A 1K7YA 1Y3CE 3EBPA 1H1LB 1Y98A 3BTUA 1NRJB 2ZIEA 4Q9JA 2QGZA 5ERYA 1AQJA 4D6PA 3NT5A 1R9MA 4O29A 2FW8A 3DD1A 1F5NA 1VE3A 3HYRA 4JSRA 5EKXA 3O8OB 2DE0X 2IQ5A 4YCNA 4KMOA 2PQMA 3WIVA 1CYDA 3TLZA 2YWBA 5HK9A 5TE9A 3QLUC 3TL3A 3ABQB 5B1EA 3PQEA 4LYGA 2D13A 1A27A 2J07A 3GJ4A 4FGUA 4EY8A 4GT1A 1YVDA 4GBED 4P7BA 1FQKA 1IHYA 4NOJA 1NLZA 2PBZA 3MCVA 2DT5A 1KZ1A 1Z33A 1NX9A 3OLYA 2GZ1A 1B14A 1Z29A 2C2BA 3C43A 2PZBA 4Z7OB 2H7YA 1G2IA 1MH1A 1U7HA 2D1YA 3NT4A 3STVA 1J21A 5L8VA 2VP4A 3GD5A 3GT7A 1GNTA 2QZSA 3K1JA 3NJ4A 5ALGA 4D99A 2EL7A 4DQLA 3GIWA 2XHZA 5CVDA 2I8CA 4KIFA 4GXRA 1B2LA 2JW5A 4TMZA 2VBGA 4TVBA 3NC0C 2J33A 4DMRA 3K0AA 4N5NA 1T3HA 4N5MA 2ONKA 4EO4A 2GZSA 1KDTA 3ED5A 5ENVA 3REOA 1XWWA 3CMMA 5K8LA 2BIFA 1GR0A 2W11A 3ZPXA 1FMLA 2R3SA 2RDMA 5GM1A 1M8FA 1ZNZA 4DA7A 2VDUE 1KY2A 2O54A 3FDFA 1EGMB 3NS7A 3DMDA 3QE3A 5IVPA 3O8QB 1XD2B 3Q1KA 4PE5B 5T8KC 1F2VA 4DAOA 1GPH1 3WOHA 4HP8A 4YXFA 3GCWA 2HRBA 2VJQA 4MLZA 5JVDF 1R10A 4G2NA 2JGKA 4PYLA 5HUQA 2DR2A 1YDMA 4CYMA 4TKVB 2ZM5A 4IGFA 4U2BA 1TZJA 2BC9A 1MO4A 4B43A 1B93A 2YWXA 1YD7A 5BSWA 1URPA 4ZVNA 2EFJA 1UMDA 3DCYA 1AGPA 3HDGA 3V4PB 1GN9A 2V9ZA 1Q74A 4GR5A 2HM7A 5CHEA 2FPKA 4NCIA 4Y0VA 3SEQA 3CLTD 3DMNA 3WS7A 3H1AA 4M8SA 4NABA 1R4MA 3KE8A 4O08A 3HVJA 2IEAA 1W76A 3A4LA 3L0IB 2W6CX 1RQRA 4FFRA 5FR1A 1TT5A 4ND5A 2HPZA 5D1NA 3GLHB 5EIAA 4NL4H 3RC3A 5IJWA 5IU6A 4ENQA 5JSYA 1Z82A 2WDZA 2V3CC 3N2IA 1ZINA 1X80A 2W6IA 3U7QB 4JVOA 2HJRA 2MDTA 3NHPA 4F86A 3SHWA 1CR4A 3U1BA 2PN1A 4RU1A 2CNOA 2BE9A 4OU4A 2W90A 1UZNA 4UHEA 1U8ZA 2A59A 2CLEB 4ZVPA 5BT9A 4JC4A 4OL9A 3TSAA 3VU3A 3NXSA 2PWZA 4MVJA 4TXNA 2P2GA 1BGVA 2W2QA 4R40A 2NPOA 5G3ZA 3V4VB 2PUEA 3FHTA 4PU0A 2BH9A 1AHNA 4ZZ0A 2WW8A 2HA5A 5SYAA 2KWIA 1UWLA 2FQ1A 2ZRQA 3VKUA 1JHAA 1JIIA 2HJSA 3GD7A 3DB1A 3LQFA 3NHFA 3OX3A 1B7GO 3OWOA 2EW8A 4GGPA 4J16A 4MIOA 4XUEA 1CIJA 1R4NA 4ZXFA 4YROA 1CNEA 4BEVA 4IDFA 4IUCS 1QQ6A 1RMTA 1DC4A 1NR7A 2EX1A 2PJUA 2BMJA 2XYQA 1HPLA 2Z9CA 4PCAA 3T94A 2NX2A 4I5GA 2JANA 4RDCA 1YRQA 2BW0A 1JVSA 1CIPA 1Z8HA 2BHTA 1MTOA 1D0VA 2C4WA 3D8NA 1DKOA 3HXTA 3FJOA 1KFKB 5HFNA 2ZU0C 3URMA 3ZCTA 3TOVA 1YJCA 4EHBA 2AG8A 3WAJA 3BGVA 3D4NA 4L28A 5U4XA 1PBTA 1XMJA 4D57A 3DQZA 2F3SA 5IYZA 1SN7A 4DXDA 3B51X 1T5TA 2GM9A 1XZ8A 2X0JA 4RWEA 5ARDA 3SJZA 3KJHA 1CERA 1XTTA 2HMSA 2PL1A 3O3NB 3JVUA 3OZIA 2XOKD 2P9BA 3BAZA 4PHTA 5DHTA 4J29A 2OUIA 4Y7DA 2HPAA 1YACA 2GD2A 2DQZA 1ZXBA 3GLHA 1Z17A 4NIMA 2YNMD 4O4LB 5FJIA 4URUR 2DMRA 2V7GA 3QMPA 2PUAA 4YAEA 1G6OA 1PL0A 5HE8A 4RNCA 4Q24A 4JNCA 1IONA 1ZKMA 3R7AA 1LK0A 3H0CA 2ARKA 3QHAA 2L2QA 4W63A 3DDUA 2XXBA 2OQIA 3TLGA 4JBHA 1BRMA 4L75A 1BXGB 1IYZA 3TM4A 4BMPB 1CIVA 1Y9EA 4P86A 2Q5FA 3DWEX 3CH5A 2Z04A 3WWPA 2GBCA 4GBJA 1K6XA 4I5EA 4GI2A 4M0FA 3H2SA 5JU6A 3AXSA 2WG2A 4JODA 1S89A 4TT3A 2ZS9A 5KYGA 2RI1A 5F7XA 5KINB 2C3MA 2I3BA 4YRSA 2D1RA 2Y1GA 1E1YA 3RSFA 2IHZA 2VIIA 4BZWA 2JJMA 4E2WA 1Z08A 1CZLA 3U3DA 5CCEA 4GR9A 1OYWA 5TGZA 4BZQA 3WMGA 4UNPA 3UJAA 1QRTA 6Q21A 1Z7GA 1FP4A 4MW1A 5DGTA 4OI4A 2P0YA 3WGOA 3HLTA 1ZH0A 2JFXA 3RNLA 1E7QA 4DBZA 2OOSA 3OCVA 3RTAA 3IMKA 2PRSA 2OBFA 5JS1A 3B8EA 2ZUUA 2REQB 1SQ5A 5AIBA 1PS8A 3NHLA 3SICE 4FWBA 4AJHA 3RKUA 4HEA1 2NSDA 1L7BA 2AUMA 2HB6A 4HYTA 4L5JA 2C07A 1Y5RA 2YIMA 4JOQA 2OWEA 1AK1A 2OBLA 1GDTA 3GLGB 2BCJQ 1LBEA 4KSYA 4B80A 1LCIA 5DLYA 5JNLA 5DBGA 5AOAA 4R0VA 3FY4A 3JWIA 4G5QA 5FLEX 5HTKA 3ROPA 2WNSA 5B57C 5JZ9A 4DLYA 2IL1A 1QCYA 2C9YA 5I4IA 1Z36A 4INJA 2WWYA 4MRAA 4P38A 3OTGA 1W44A 3K70C 1UKEA 1ZCZA 2FW1A 5DOVA 1AS2A 1LX6A 1K7CA 1VPVA 2FN8A 4IHQA 1TRKA 2BELA 4L95C 4MGYR 4CG0A 2CLOB 4V1CA 1UJBA 1WVGA 3E9EA 2GERA 2I5PO 2EWMA 1LTHR 3FDXA 2VAVA 3BCUA 4JLOA 1KVTA 4WCFB 4MXDA 2CJPA 5ER6A 1AQYA 3NHSA 4Z0TA 3VSDA 4RK0A 2OYRA 4DS3A 3DE3X 4BTVA 1DQZA 3LPNA 3MWFA 1D2NA 1QYRA 3KQVA 4COKA 1A4RA 1WPRA 4BMVA 3ERCA 1APBA 1KJ9A 2GVDC 2IWRA 5A4JA 2QT9A 3AP2A 3D4OA 4PYMA 1XV5A 2X1MA 2F3UA 4YRCA 2R8PA 4A5SA 3JS5A 3NIFB 5CXXA 4DVGA 4Q3KA 3KB2A 4UBLA 2LBPA 3ONNA 3CWZA 1TCBA 3H19A 1PJ4A 3L8CA 2GETA 3GELA 5D5HA 5KNLA 1WU7A 3QTLA 1E0JA 3O1LA 4G36A 2BM1A 4JBYA 1QQBA 2DRIA 2RHBA 3KSBC 3TTXA 4PONA 4LQ4A 4HGOA 5A62A 2ZGVA 5JARA 4PPFA 4ABYA 4BNVA 3K32A 5F2KA 1M83A 2PMEA 4CLRB 3NGMA 3UAYA 2HDHA 4TUYA 1AT1A 1S8FA 2HWXA 5I9LA 3D02A 1BX1A 4QLBA 3L7LA 3KAQA 4Q01A 1XTSA 4RLFA 4GZLA 4M9RA 3L6DA 5DCYA 4Z9XA 5B1SA 2Y77A 3LYLA 2J48A 1IZZA 2AJCA 4PLFA 5EINA 1LA2A 1RDFA 1ADYA 1G2QA 3UA3A 5KKCA 4JI7B 2OLKA 1UP6A 4BWGA 1VL6A 1JHYA 1O87A 3TRJA 1ZICA 1E63A 3DDWA 3I9MA 5T67A 4TKVA 1JWLA 3H04A 2IDMA 2ZAGA 1GIAA 2AUNA 1IM8A 4BLWA 5IF3A 1SU7A 1XTJA 3UXMA 4ZYUA 3DLTA 3M6WA 5BY2A 1IVSA 4OHVA 3EK2A 3KXPA 1WB9A 1LQ2A 1NVGA 3D3EA 4O1HA 1QPZA 4HZGA 3GFOA 2J09A 3WK9A 1ZM3A 4C3ZA 4DCOA 2O19A 4OGLA 4A8JC 1R6AA 2L42A 2SICE 5EKSA 1XRQA 4CLDA 1KOGA 1HG1A 4G9BA 4JP2A 5BWMA 4Q15A 2CUNA 4KQCA 1B6GA 1RCFA 2Y76A 4OHOA 4TYPA 1RLOA 3TLBA 1POWA 3NATA 1TO1E 1U0GA 5LZ5A 5DM60 1QF9A 4J2OA 2HQ1A 2EGHA 1W88B 2MOKA 2VCYA 5I5GA 3OKFA 3B1VA 1K27A 1VBKA 2I78A 5EMKA 1KOLA 3ZG6A 4LE2A 4I2NA 3ZK8A 2WUWE 5DCLA 3N39C 1CQJB 2XZOA 2C61A 3P4YA 4YAKA 1PKXA 3DV0B 4KQJA 4ZV9A 2XLBA 1QLHA 4O2AA 1GU7A 1L6RA 3ZV5A 3PQ2A 4TLCA 3K8ZA 1CEQA 3MTGA 3PHJA 4KNYA 4L4ZA 2P9TA 2O3SA 2PWBA 2E18A 2KE5A 3E81A 4TROA 1P2GA 1WXIA 1YS2X 3CFYA 5EFOA 3RRYA 4MO9A 4UHFA 2CEKA 3DONA 1HYQA 3FD8A 1BQ3A 3G88A 4OJNA 4X9XA 4C6TA 4GX0A 4JKIA 3STTA 1U4OA 3DEYX 1JTEA 2I2CA 4GGOA 1KK2A 3D31A 5BQOA 1A9RA 4A0RA 1QRAA 4R0MA 3T9FA 4DV1B 3N87A 3CBQA 4ATNA 4CCAA 3AUXA 1G9XA 2FOLA 2FUCA 2VEOA 3CVJA 3UWSA 4AROA 2HHHB 2OHXA 3JQ7B 3GQBA 4RVCA 1RVDA 4TL9A 5HIMA 1WA5A 1VP3A 2Q2QA 2X1VA 2RHGB 1CR6A 3E7XA 3LMKA 5DSTA 1YSCA 4FEAA 2B92A 3LF2A 4M1MA 1WD7A 1E1DA 5EXSA 3RRBA 3AJ9A 2R84A 1IXYA 3ZNQA 3OE4A 6LDHA 1P1CA 1YKSA 2A0FA 2FZGA 3FNRA 1N1MA 4Y2RA 3PL1A 3X1XA 3CGWA 3H4TA 3KP1A 1SXJB 4CMIB 2IYSA 2NAPA 3CJTA 2NTJA 2F1JA 3NQ41 4D81A 2Z3VA 1ABBA 5DNDA 5EIBC 2OPBA 3MRVA 4QWWA 1A4UA 4Q3CA 4WKNA 3HJBA 4XD7D 3U3XA 3ZE6A 3Q8MA 2OA0A 3ZGOA 1DXOA 3NP7A 2H4YA 3C2QA 3C3CA 3BMOB 1G19A 3N2LA 4B4WA 1X13A 4AN1A 5ISMA 1HQDA 3WIOA 3NXKA 4KIWA 1M8GA 5K4GA 3BGOS 2ZS8A 1W48A 3OHMA 3B2EA 1HDYA 2ZT5A 3TCXB 3JTMA 2WSIA 4QDOA 4ZHSA 1LPOA 4QM6A 1KP9A 1DVRA 4UAJA 3W7BA 1JHMA 4XD7A 1J0DA 5IJ0A 3JQBA 1D8AA 2FR8A 3ESRA 3ZYCA 3VJRA 4M60A 1OMOA 2J46A 4IDBA 3CPJB 1QKJA 2O2CA 3LRTA 4RKFA 3EOBI 4A26A 1LU9A 4EF4A 3V7FA 3PFHA 3HG7A 5HIIA 3M9XA 5AJHA 1VJ1A 4BMYA 1M8JA 2DLNA 3CZCA 3EEFA 4RTLA 2BGWA 4D56A 4GWKA 1Q0LA 4KOAA 3EDOA 4BO6A 1ODJA 1X14A 3IIEA 1U1CA 1OUMA 2VYQA 1ZJJA 2BN4A 3C3DA 3CLTC 4O3FA 4HYYA 4DSUA 4PC6A 5DM1A 1LSUA 4HGYA 5JS7A 3UK7A 5FPYA 3JARA 3KQSA 1AJEA 1RJDA 3U81A 3KAJA 4V24A 2WOJA 4PSKA 1MW9X 4KQFA 4M1TA 3U3MA 5FRDA 3GA7A 3S81A 1V96A 3S28A 3SQNA 1FRQA 1LI5A 1SFRA 1KYZA 3CCBA 1KDYA 2R6FA 2HK9A 5ED4A 3UEOA 5KOHB 4YUYA 2EKDA 3WKAA 3EVTA 1Y9AA 1QRRA 3EHDA 3KUUA 5K0FA 3D3WA 1XKXA 3DE6X 1S4QA 1OI2A 1VIVA 1T9ZA 3PKIA 3MIIA 1HH4A 1Z4MA 1W0JD 4I46A 4QYIA 1FFXA 3AIIA 3DUFA 2XF2A 2GO7A 2G9QA 3UWMA 3G7UA 3MT8A 2AR7A 3F3YA 3FOAA 4G1BA 3WYCA 2FI1A 3MBKA 4PTZA 4PXSA 4ZEWA 2M6KA 3V00A 2IU0A 2OC4A 3S2SA 4BATA 3W2GA 1LFAA 3KXKA 1EFLA 1VPEA 5K2MA 2PUFA 4RIFA 5I7FA 4G4IA 4A0GA 4Z54A 3CW2A 3PNMA 2H1OA 3WI7A 4N0MA 2QAGC 3OOSA 1X9HA 3L46A 1KWKA 5FBHA 1VI2A 3D59A 2EDCA 2A84A 1E5VA 3H5VA 5HZMA 1ZBDA 4QELA 5HKBA 3RYCB 4LTNA 5FF9A 3LX8A 2Y66A 2V5UA 3QY0A 1ODFA 1OU4A 4MKRA 4WCFA 2DCMA 1J8QA 3H9CA 5TQJA 4DEYA 4ILKA 5AI0A 5ALMA 2F59A 2XZPA 4C4RA 4IQ8A 4JJEA 1BHO1 4UEOA 2ZVDA 3RK0A 3CINA 3SXUB 2J32A 4ZREA 1YU9A 4DEVA 4HS9A 5EN4A 4H6PA 2IX3A 4O2BF 2H11A 3KQKA 3NKVA 2H4ZA 4HUJA 2IOFK 3I04A 1WULS 4IEIA 3IKMB 4RSGA 4WHMA 2ZYWX 5HMMA 3IE2A 2VAXA 1S01A 5EEGA 5FH9A 1U7ZA 1YOBA 2QRJA 1E2JA 2RIPA 2WTNA 9LDBA 1UDBA 4AP9A 5ALRA 4E2XA 4LNUB 3TQCA 1GKLA 2ZAIA 3TUJC 2PJDA 1LI7A 3EJ6A 1KBQA 4A92A 1JA1A 1RADA 2HLDD 4MINA 3K9QO 3TPFA 1O89A 5CB8A 4MTLA 3NNSA 2PG3A 4G2TA 1O2DA 3IB3A 1IOWA 3LY5A 2CL6X 2UZ1B 1F5SA 3LL4A 2ZWPA 4YACA 5JS2A 1EUDA 2IHJA 3DL2A 2UKDA 2XVMA 1PGNA 1VFPA 4ZHQA 1JEQB 3MWYW 1MV5A 2PX4A 1R1DA 1YB7A 1JSCA 2P6OA 3PRJA 1RAHA 4GYJA 1LVGA 3OQPA 4C30A 2C7QA 3WYDA 3AVTA 4Q3EA 1HDXA 2BZGA 1KARA 4OK6A 3DZ8A 4HWOA 3K70B 4QE3A 4MTCA 5BWLA 1UT5A 3RBXA 4Q1BA 4ZA2A 1N0HA 3HUUA 1J8VA 4A8TA 1A5BB 4XI9A 1SKMA 1KVQA 3GLFE 3NGXA 2YHIB 1AGRA 1Q15A 2JD0A 2GM4A 3PGVA 3WO0A 1HDIA 4EJSA 4ZANA 2JGMA 2QM8A 5FTNA 2F90A 2W83A 3OT1B 4R2KA 1KZ4A 1SQSA 1W87A 1E9RA 3FCYA 3MCUA 3OCZA 4FCWA 4YQYA 3R7WA 1N6OA 4D43A 5A4AA 5JLAA 5JFOA 3QITA 3ZWKA 4G8BA 4I55F 4PNZA 1QCCA 3JWEA 4P81A 1DJMA 2NV2B 1WDLA 2DWUA 4WERA 3ZYZA 3J81k 3Q8LA 4ZU1X 2XYPA 2XAAA 1K9SA 1M1YE 1ZK1A 2VLIA 3AHHA 5H1YA 4PG8A 3CM0A 2BFAA 3CVOA 5ULLA 1VXRA 3QBTA 1ZNQO 3KIPA 1EIZA 2J5KA 2AD5A 2G36A 5AVTA 4BUZA 3I2KA 4XQ0A 2ZIUB 3ZBQA 2YWEA 4G26A 4NOLA 2PKWA 3O8CA 1F4LA 4XGQA 1H2AS 2FZVA 5CTAA 2LIPA 4RCZA 2W2MA 4LJAA 1USGA 3C7CB 4X20A 4C4XA 3CLUD 3LUGA 4NBSA 1Y3FE 4J90A 3DWGA 3D6NB 2HGSA 2Q3BA 2P68A 3W78A 1TQ6A 4EI2A 4AL4A 1GPDG 5G0WA 1GADO 3G5TA 4OOFA 3AB7A 1BU5A 3RBVA 1POXA 4L4UA 8ADHA 5K0CA 3PHHA 3IKTA 3CUSA 4HBGA 1SHTX 1YI0A 1PNRA 2NP7A 3ZD6A 2E2WA 2FP3A 2BLLA 3GJXC 2DTDA 1JFVA 3PJDA 4UUNA 1KVSA 1C8BA 3MILA 4QUHA 3C41J 3PRYA 3JZAA 1C7IA 3HCOA 2JD1A 4ENPA 4XDYA 4HNVA 2E1PA 4LQCA 4F7DA 2OOKA 4H77A 1EWTA 2VDKB 2EAUA 1QFXA 5JCJA 3F6PA 4FILA 3B38A 4QA9A 1NR1A 5BW6B 1KPIA 3B1JA 3OIUA 3N2YA 2ZJFA 1PWYE 5E6RA 2IYXA 1SCDA 4DQ0A 1JFTA 2XRFA 2QTCA 1PG5A 3IHLA 4YCSA 4FNOA 4DARA 2NVWA 3MMZA 3N2GA 5FEMA 3SSAA 1NNEA 2GJKA 1T6BY 3UXYA 4PQFA 4YRGA 4D3SA 1NP7A 3TR0A 3OFND 3U9LA 3UWPA 1SWVA 1G9TA 2GCIA 2GD1O 3RV4A 2V03A 4D4KA 4DCJA 4ZYWA 2B4TO 2YYAA 3RHFA 2YRWA 3BBPA 5CA0B 1RP7A 3B5EA 1B0AA 3H9BA 4JMPA 1PT9A 3IXMA 4LKOA 5H16A 3TSYA 3UFXA 1OD6A 5BSHA 5C1IA 1F0PA 1YDWA 3ANXA 5DYTA 1SVOA 4MGIR 4C4ZA 4TL7A 1M10A 2C7RA 2C8VA 5BW4A 3P27A 1DX6A 3QMMA 2Z0MA 3DZJA 1RXSA 1DBSA 2ZYRA 4V0ME 2O8DA 1H6BA 1C2YA 4AQ7A 1T9HA 3P52A 1WSWA 2G08A 1FP7A 2O0JA 1BVYF 5F2OA 2A14A 1SHUX 4KTVE 3RTBA 1OWPA 3T3IA 4HDMB 2ZG6A 2R6CA 4FKBA 4CE6A 1P61B 2OBXA 3RIGA 4ZIRA 1B43A 1UKBA 3QHPA 2XDQA 4Z1MD 1L8OA 4ZKEA 1MO3A 1JAHA 3QBEA 2ZSBA 5IN4A 4QUIA 1I9GA 1KHHA 3PHLA 5AKIA 4CF7A 1FYFA 1DQRA 2RGXA 4J1TC 3UV6A 5JFGA 4US2R 1A98A 4HZIA 5AKEA 2X0RA 4CKEA 1GTZA 1KJYA 3UCFA 4KVAA 3ZW7A 1W8DA 2BFDA 3ZLJA 2CXOA 4RE5A 4ZDKA 3SWWA 3GRVA 4RWZA 1RIFA 1E3DA 1P91A 2DFNA 2LIVA 2Q45A 4YAUA 1GWNA 3QKRA 1R4NB 4HDKB 4AZ3B 1SVNA 4CHGA 1Y1TA 1T3LA 4LZLA 3DKVA 4J4TA 3L4BA 3G9UA 3QPUA 2BMDA 2HLNA 4LXUA 2X4DA 4IIJB 2OHOA 4NPAA 2IXTA 7REQB 4RHYA 3DMRA 5BOSB 3ZU3A 4GQIA 4GEGA 2GPYA 2Q2VA 1OHHA 4PFKA 2DEUA 3ICPA 4ZYXA 3PUZA 1QAMA 5CJJA 1JAIA 3K1YA 2IF2A 1N6LA 4O4HA 4MW0A 4MW9A 2WF5A 1Z88A 1HQCA 4OP2A 5BN3A 2AMJA 4AG6A 1CVRA 2WZBA 1YZTA 3I62A 4KK4A 3GOQA 1ELOA 1ESDA 5EUBA 5KCZA 2ZBGA 3TW6A 2ZDHA 3JW8A 4LYEA 4I08A 1E6WA 1PWXA 3B3QA 3IUYA 4EIWA 4R1SA 1RLMA 1ODLA 3AXTA 5H80A 5LB2A 3SKVA 3WFIA 3MNFA 1N9KA 1EAMA 1Z4OA 4F4UA 1ZVQA 2DOKA 3HABA 2X40A 2C1XA 1U4SA 3ITNA 3SPXA 4RKYA 5JHGB 2M2IA 3RNOA 2CFSA 2J0SA 2GZAA 3K6SA 4N9WA 3VTFA 1SIUA 3A26A 3A6HA 3WWZA 5CT4A 3EFOB 3CF4G 4JENA 5KNCA 4OQDA 3KPVA 5TGTA 1JEQA 4EEKA 1MC4A 2OCXA 3BWCA 3G2KA 3T7DA 1DAKA 4PZ0A 2F2TA 3RF7A 4MQ5A 5J4LA 3PYXA 1KFCB 1Y8QB 2OCKA 1C2TA 4P4NA 1KY3A 2I3ZA 2AJ8A 1UK6A 5ENDA 1UWKA 2BGNA 4MROA 1W0KA 4EHLA 3KYDA 1HMPA 1OX4B 3H99A 4H7HA 1ZZEA 2C00A 5DI3A 4EEXA 3MYYA 5EKTA 3L8HA 1ULUA 3CMCO 5I7WA 2HK7A 2X86A 2IXBA 4NZNA 4W4TA 4EENA 5BMVB 4N7RA 4E3WA 4CLOA 2PPLA 4B48A 5LQRA 2W6QA 3IB6A 5CFRA 3STYA 1U63A 3AVXA 5F2NA 5ILGA 3PUVA 5E9QA 3I9LA 2GPAA 3REFA 2I1QA 3RVQA 3BULA 4ENWA 2UZAA 4J6FA 3ICOA 5JRZA 1BE6A 1WHSB 2X7XA 2OTCA 5T4FA 3UAZA 3K31A 3OOJA 3VR0A 1SBCA 5LKRA 3OIFA 2VC2B 3L05A 3UOGA 4BFVA 1ECLA 2P5SA 3FNBA 3OQJA 3NONA 4G1VA 1RPZA 2LVBA 1IIRA 2NADA 2WQZA 4NZPA 1VL0A 2JI7A 1N7JA 1YHZA 2VDOB 1ZOPA 2KBEA 3C6MA 4FN4A 4IVQA 2O2DA 3M1IA 1CJKC 4I1SA 5HVNA 5CLHA 1E2EA 1ZGJA 3C48A 3ZGYA 3N2NA 1G8JA 3OJWA 5HS6A 3MCWA 2Z9DA 4EFDA 4HRXA 1DV2A 1RT9A 1XDBA 5BOVA 3NEYA 4RSHA 1FDUA 3C3MA 4UU7A 1DQSA 3RI3A 5HCUA 1ECCA 5FPHA 3FYCA 3S6JA 1CUSA 3DEFA 1PV4A 3WC4A 4HG2A 4QJ4A 5B4TA 5BVGA 2Z6UA 4OXYA 3KSAC 5LQJA 1ZGZA 2WMDA 1U90A 4OAQA 4CCSA 5REQB 2OVFA 1NPYA 2Q28A 1MDBA 3GAFA 4IIUA 3W8RA 4JI3B 2X8BA 3COPA 4RIHA 4ZRNA 4XVUA 3CLKA 4KRXA 5JAMA 4MV0A 1EUQA 3FNGA 3VNRA 4EJSB 5KVVA 4ITUA 5M3BA 3R7WB 4YWJA 3R9KA 1J7JA 1KKLA 1K3UB 4WPGA 5CIWA 1DCKA 4B3DA 4BU1A 4CPDA 1Z62A 3HCBA 4POOA 2A7QA 4BC0A 4FFWA 1JHVA 4HMPA 3BCSA 3GC6A 2DPXA 3DG9A 5KZMB 5IVHA 2DWOA 4DUZB 3D1JA 4RH1A 4LRXA 2XEDA 4ZT2A 3SLKA 3T34A 3UHJA 3UMRA 1PJSA 4EHKA 4QJIA 4ZC8A 2JFPA 3KLBA 5CK5A 5ALYA 1CF9A 3HLYA 1XTKA 3LZDA 3U44A 4N5DA 4DUGD 4BFTA 2O8NA 3EBLA 2ZI3A 2PT6A 2ORWA 1Y7TA 2NPIA 4QPNA 4YGXB 1COWD 4B3CA 5FWXB 5KSZA 2MR6A 5LUAA 1SD1A 3LVFO 1L5SA 2XV1A 3IR7A 4F06A 2JGNA 3LHSA 3R4VA 1D4AA 3D8TA 4MRPA 1TA0A 4IGEA 1RRKA 5A05A 8MHTA 2AE2A 1OLSA 2HHAA 3QUSA 4G6ZA 1U1EA 1PT5A 2VRCD 4FGJA 3E22B 3SS7X 3D64A 4KFSA 5D51S 5EHIA 1RLUA 2LUOA 4EEZA 4GLOA 3BMNB 1FTNA 1KP2A 1II0A 1MOSA 3OSZA 2GKSA 3B70A 2NXEA 3CZQA 1SUBA 2QRNA 3HP7A 3IP6A 2WUVA 1C3EA 4GG1A 5EE3A 4LWZA 4TTTS 2QVCA 2AZMA 1N2BA 3BTVA 3CNOA 1V4BA 3DZDA 3P94A 4JYZA 1ZUD1 1DG1G 4MVYA 1AKUA 1DO2A 1LBHA 4UCFA 4YT5A 1KL7A 1JJBA 1FSZA 1L4MA 5DP2A 2P41A 4RX1A 1YRAA 5CA1F 4GM0A 1VL8A 2FN4A 5AW0A 2MIIA 4TV8F 5LBIA 2H1IA 1K98A 4QDUA 3LK7A 4YRMA 2G3YA 4LHYA 3PFWO 5KYNA 4NZMA 2TS1A 3LIPA 4PHCA 5AI9A 1E9AA 1ORIA 3L3BA 3HM2A 4CLOB 2OO3A 4YRAA 4JZKA 2WZCA 3OE7D 1SRRA 2IHUA 1F17A 4PN7A 3LTNC 2LTAA 1YV9A 3C7AA 2GYYA 2JBHA 3RASA 1NQUA 4YUZA 4XLTA 4ZI5A 2E3JA 2XA9A 2QRHA 4ND7A 3L0YA 3O2QB 2NZVG 4EMTA 3MBOA 2QAGB 4QPJC 1MB0A 2PX2A 3GMIA 2IU3A 2K2WA 4NPHA 3AF0A 3LDHA 3WLOA 3BA6A 2EBFX 5B58C 2IX9A 4JC8A 1X2BA 2DHQA 2J45A 2FPIB 4I1UA 4K3VA 1QIFA 3W8FA 4AJPA 4BGUA 2XMQA 4E5UA 1Z4IA 3WBBA 3OT5A 4MI3A 4BFWA 3OPXA 3WL7A 4C6HA 3LOUA 5BN1A 3DBIA 4IO1A 3DJYA 2RB4A 3K4HA 1R3UA 1UBJS 3DT9A 3QG5A 3BK1A 1G8SA 5DMHA 3PI6A 1X8XA 3VH2A 5BV8A 1DINA 2BKLA 2GCGA 3U60B 2IY8A 4P98A 4MVJM 3U7FB 2XQGA 3EQ6A 2R5NA 3O2NA 1R4AA 4PLYA 3M70A 2MU1A 1DUSA 2WYVA 4QZVA 5I9TA 2HCFA 5DKFA 5I4KA 1E2BA 2QTHA 3AVUA 3K0KA 1NONA 1PFWA 2CCKA 3FMFA 4TYQA 1UAGA 1XP5A 2Y67A 5IZCA 3EFHA 3A1FA 3ROTA 5ECGC 3OQBA 3KQQA 2YHSA 4IUDS 3BS4A 1DAOA 1K7SN 1P7CA 2PD4A 1E4EA 2NQTA 5E3JA 5JY1A 1TO6A 2OCLA 1B15A 2ODEA 4IIJA 2PBFA 1PQ4A 3AF6A 3IMCA 1CUYA 3R5XA 4AULA 2VHTA 3AUYA 5KYVA 1GQQA 1XAHA 2G6TA 3C3AA 1ZC3A 3EIOA 3NBAA 4TRRA 4U00A 4BQRA 4XSGA 4IIGA 1SU8A 3A1SA 4MP3A 1UEXC 2JLZA 5IBRA 2FHSA 1I1NA 1XHFA 3IKJA 1H2HA 3GGPA 3K0CC 3BMOA 4TQGA 5TT1A 4U2DA 1FU4A 4UM5A 4YMSA 5AHWA 1KEEB 1W4RA 2GF0A 2WRZA 1WP4A 3FR8A 3NH6A 3UHFA 4EVQA 3L06A 2OAP1 4U2FA 4TLBA 1H0KA 3D2BA 3I9JA 4DRXB 4BGEA 3O26A 1U0LA 4FFPA 1Z0UA 3QF4B 2OXFA 3IAM6 5SZHB 5EIEA 3ILHA 2OHVA 1I80A 1L7NA 2FK8A 3QH4A 5KJ6A 3D7RA 3FSRA 3ILVA 3VNBA 2OO5C 3GPCA 3HKCB 4AN4A 5F98A 1UPTA 3SNKA 3I6ZA 4P0TA 3W6NA 1UBKS 4TYWA 2E89A 1OXKB 4OM8A 4B73A 4G4SP 5KTOA 4BP1A 2PFGA 3WGTA 1GPAA 2BMEA 2F62A 2H9IA 1RHQA 4MI9A 1E2NA 2ZJ4A 3MOIA 1DRWA 1ENYA 2WAMA 1N5MA 3AUUA 4GC9A 4RMHA 4DKXA 1OXBB 1WHTA 1IHDA 2VPPA 1ZONA 1UBHS 5KB3A 4PSVA 3DLBA 5BR8B 1GILA 2AEFA 3KUCA 2MR5A 2WD7B 721PA 1RFGE 2H63A 5B7NA 3DOOA 5C37A 1D5WA 1IK6A 2VDPB 4LJ4A 1FLAA 2HA6A 3FCAA 4JV5B 1RHRA 3AKCA 2XVZA 3D0RA 1D4FA 3KZCA 1QCZA 4L8YA 1B42A 1I2MA 4NYJQ 3FIJA 2ACEA 2NIPA 2ZIFA 5E4JA 5EIBD 5H83A 3AVVA 3H8WA 3FJYA 3HKBA 4KWEA 4ZPJA 4EHDA 5EWJA 3MELA 1IAVA 3D2LA 4TXMA 1G5RA 4PG7A 3ZDQA 1TOAA 5EJ2A 3HCRA 3DFMA 2QZZA 4PN3A 1J07A 1R5OA 2O8BB 2WNIA 4HX2A 4OXXA 2FFHA 5E3IA 4Z51A 3FTEA 5GP1A 4N40A 2JF0A 2GD6A 3NTXA 2NT3A 4BBPA 3OFKA 5E2IA 2XUGA 4EA9A 3FNQA 4OYLA 4TL6A 3RB8A 5LPNA 3ZHRA 4BCDA 4AKEA 3B78A 3ORYA 4M1KA 2DTEA 5JMPA 4XM0A 3P5SA 2K6GA 4HFJA 1X3LA 2OXEA 1TE2A 3LS2A 4KMMA 3VA7A 1JH8A 1MH9A 1K86A 4MICA 1DEHA 4KW7A 1SKYB 4HUQB 3OQIB 3N5CA 2D62A 4ZGWA 3E9RA 5F51A 2X4IA 1R0LA 3BDIA 4NZYA 3MS4A 4JJZA 5HE9A 1KJWA 5CK4A 1HT3A 1OAOA 1XZEA 1MHTA 2RGNC 2WMYA 2ZSUA 2GASA 2XMDA 3GV0A 1EFPA 1L9KA 3MTQA 3ILYA 4GAEA 1TQDA 5CYPA 2D54A 3VJKA 3IURA 5KWVA 2UUCB 2O2EA 4FNMA 5FB3A 2WM2A 3UPDA 1Z6YA 3EZ2A 3HADA 1FU7A 4FDMA 2VNSA 1QHHB 2QLTA 3CW8X 3D7MA 4HMOA 4NCJA 4RVDA 2VN8A 4CKBA 4AWAA 4D9HA 4PQYA 3IE1A 5IC4A 3AR4A 3EUWA 1CG6A 3TBHA 2BFCB 1WUTA 1OIVA 5JWHA 1SXJA 4FW8A 4CMIA 3WLNA 3QPBA 2XR1A 3MMNA 2O3JA 3BT7A 1QU3A 3O8OA 3K5PA 1JLSA 1NVWQ 1A2KC 4V2IA 3UMCA 3UWOA 4I6JA 1SKUA 1QGZA 1TJ5A 1JU4A 2BISA 2FSPA 2PUHA 1Q5PA 2PPVA 4IWYA 2C2KA 2J3IA 2QQGA 2SKCA 3F1LA 3GRCA 1U7DA 1VMEA 3PBKA 4LHSA 3ZS8A 4C0SA 3FZEA 4W99A 4F5YA 4FR2A 4FYKA 4W8OA 1F51E 4GLFA 3LLMA 2IYUA 5HQ3B 2OCAA 2P2LA 1RYDA 5IAJA 4CWAA 1Z5PA 4A15A 2AEEA 3KM0A 4ZTZB 2O6LA 2VJPA 1KOJA 3HY4A 3QLVA 4E5DA 1MB3A 4DEXA 2XQIA 1MB2A 3KEFA 1FNDA 1MQAA 3IP1A 1ZXLA 3W77A 5FO0A 1SC6A 2BGLA 4YJ3B 3R7NA 3TE7A 4MWSA 2Y0DA 3N75A 4LDNA 2GK4A 4XSVA 4DZZA 4J0IA 5TQ0A 2ZJOA 3VR3D 4C6RA 1V11B 1ZQ1A 4D4GA 2E85A 2JPDA 3P0HA 4G0UA 4OEHA 3H2GA 3W3AH 1VE9A 4YMVA 3PGJA 1EUDB 3LDFA 2C5SA 2BJWA 2ILVA 4GICA 3BH0A 4TTSA 4BGVA 2B6HA 1Y8ZA 2H5LA 4B8YA 4Q9HA 3M8KA 2ECKA 4U7GA 1T0JB 3BB4A 4A2CA 3AR5A 1NJSA 1ECJA 3IT2A 5BXYA 4CW7A 2Z4TA 3K9BA 3OUZA 4RMNA 3CBGA 1HSZA 4LYDA 3O8QA 3PHBE 4IYJA 4TT3D 3HZHA 2IHVA 5HQJA 1KSGA 3VUFA 1NLYA 3ZHUA 4AZTA 2R9VA 1XZAA 4U2CA 3S2FA 2YVKA 3CU5A 3O74A 3QVGB 2FSHA 5A2QA 3V2IA 1SB8A 2I80A 2GT1A 3FPFA 3I92A 4L5IA 4BNFA 2QL5A 3N7UA 1DELA 2CFOA 3GO4A 3I72A 4QXQA 3DCNA 3DTTA 4IH1A 2C59A 2WI8A 2G7MC 3ZU5A 2P30A 5JYDA 4C88A 5FX2A 2O0LA 2VWQA 1ML3A 3MMSA 1VJTA 1MN6A 3MG9A 3AIOA 4JASB 4K28A 5BVHA 4O5OA 1JKJB 1GO2A 3E7DA 4XVQA 2HIGA 2WILA 3HKBB 1SIOA 3PEYA 1GSIA 1TD9A 3QPDA 2P9GA 4HK4A 4KR2A 2J9FA 2PLFA 1FFDA 1BDJA 3IMFA 2NU9A 3DOEA 4V02A 4Z5XA 2VUIB 4JFRA 4D25A