4JX9A

Crystal structure of the complex of peptidyl t-rna hydrolase from acinetobacter baumannii with uridine at 1.4a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
193
structure length
193
Chain Sequence
b'MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606 = cip 70.34
molecule tags Hydrolase
total genus 62
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4jx9A00
4FOPA 3TCKA 3KK0A 3OFVA 4HOYA 4Z86A 4FNOA 5EKTA 5IVPA 1RYBA 3TCNA 2LGJA 4QD3A 5IMBA 4ZXPA 2Z2JA 2NAFA 4JC4A 2Z2IA 3VJRA 4JY7A 3TD2A 4QAJA 2MJLA 4DHWA 4FOTA 4FYJA 4YLYA 4DJJA 1RYMA 3NEAA 4OLJA 4P7BA 4IKOA 3V2IA 5B6JA 5IKEA 3KJZA 3P2JA 4JX9A 2JRCA 1RYNA 4QT4A 2Z2KA 3TD6A 4ERXA 4JWKA 2PTHA 4LWQA 4QBKA
chains in the Genus database with same CATH superfamily
1J9EA 3C3JA 4P7JA 2Y0BA 2E89A 3LOUA 3WKDA 4LWZA 4MRPA 2TRSB 2JFZA 1W52X 4D42A 5H9WA 4LVNA 3B6MA 5B4UA 3SP1A 2MSDB 1O97C 3SJCA 4J0HA 2AOTA 3FHTA 3FMFA 2EP7A 3HVRA 3GRFA 4K03A 3MCUA 4IXWA 1YZQA 4J2HA 4LJ9A 2B98A 4E2ZA 1KYWA 1GT91 3LY8A 5KTSA 4S04A 4KCGA 3EEOA 4FQ8A 4ZAGA 5MN4A 4IGIA 3C8MA 1NE2A 2B5OA 1AIPA 2LE0A 4XVCA 2IEAA 5AVYA 4ESVA 1UCFA 2GN9A 1EA5A 5DW0A 2I0FA 1B6SA 4EHIA 2UZ1A 3VMMA 4OI0A 4D4HA 2GPWA 1A2QA 3DHWC 3I3OA 4IP0A 4U8GA 1OX4B 1I3OA 5FTMA 5DHPA 1A8SA 4B7ZA 5EIEA 4JQCA 1P18A 4LGMA 1XVVA 2P68A 3C6ZA 1OFVA 3FTPA 1GEGA 3PXAA 4FOOA 2DM6A 4TVSA 2F8TA 1RYBA 2D2IA 2J5QA 2R8BA 2FXVA 4D4LA 4OVKA 3M6MD 5BUSA 4D26A 2O1EA 1XDWA 4C3UA 3KOZA 2DWOA 5ILQA 3AETA 4B8WA 4HB2A 3V34A 1YS4A 1X1RA 2BJHA 2CUNA 3IDZA 4RK1A 2OFXA 4KRXA 4O2AB 1V5FA 4RKQA 4RPCA 3EFOB 5FNVF 5JVDA 3QLUA 1IOVA 2C29D 4V0ME 3BXZA 3P0EA 2RONA 4ZCPA 2IWRA 3IAM1 2NVUB 4MIEA 1SZDA 5DLYA 4EZEA 2NZJA 3LUKA 3IJ5A 2GI4A 4IHAA 1GKLA 4P3PA 3KJNA 4S0XA 3AV0B 3T95A 5JFGA 1RAGA 2UZIR 2VYFA 3IPAA 1JAZA 1SD2A 1V7QA 3FGOA 3ZOKA 2B21A 2J9RA 2ZTSA 3HG7A 2JLQA 4I4LA 3M8KA 1ZRSA 2IUYA 2JLCA 1DQPA 3DR5A 3IIJA 5JSUA 5F23A 1SBZA 3OPYB 3BN3A 2HGZA 1GTL1 2I2DA 4IDDA 4MJXA 5EQDA 1X9HA 2D5AA 5EXXA 1OA0A 1X7ZA 5G0SA 5HCNA 2NUAA 4GPZA 1Z56C 1OWNA 1WDMA 1FRQA 4B09A 2EF1A 3AR6A 4EPXA 2PU7A 4JI5B 3VI4B 3PFNA 4MP3A 4ZT3A 4RGYA 4BIMA 4HT3B 1YFKA 3FYHA 2JASA 5CLHA 1R9NA 1QIHA 4GZLA 2OQRA 2WF9A 3K7EA 4BRWA 1ZBQA 2JLZA 2BHLA 5C51B 3CE6A 3V7NA 1C1HA 2C2OA 2C96A 2XUIA 4TMKA 1RZRD 1U9CA 3N8IA 5BO5A 5IC6A 3ENKA 4QLAA 4NE7A 4CLRB 1VM6A 3OQPA 1GPUA 1U2PA 1LZKA 2CHGA 3CF4A 3EEIA 3G2HA 3HB9A 1P5JA 1MX5A 4KMSA 1IDOA 2FGKA 2V7QD 3KD2A 3BSSA 2OQ2A 3IP7A 3U1TA 2B69A 3PUHA 4L9RA 4RD2A 5KAPA 1J22A 1U3VA 3UHOA 3QXJA 2NZXA 2C7RA 4RTMA 1ODLA 4JU9A 1DG9A 2Z1NA 4RF5A 4HX5A 2IEYA 3RT9A 1LK7A 4OQZA 2I22A 4NIMA 3BMNA 4JL5A 3HZZA 5DV9A 1VYVA 1L5KA 2YWFA 3N8HA 5BVHA 3CSDA 1J0AA 1Q7BA 3SSAA 1PDVA 1QE5A 4GVLA 1V7PC 1SC9A 1J8YF 2WYWA 1D2NA 2LRHA 1DX4A 1NW9B 2XTZA 3IUQA 4L50A 3RNOA 4O4HA 5AJHA 5AI8A 1I36A 1XCGB 1AUXA 4BZQA 2RK3A 2HF8A 2NVBA 3CNOA 3RUDA 5TMDA 4XLLA 1M3SA 1XVIA 1JTFA 5JI3E 2F48A 1IU9A 1TYEB 5DF1A 3TAUA 2YJTD 3JAKA 3M4XA 1Y1TA 3QJ5A 2HBZA 3DZGA 4W7HA 4XB6B 1GPAA 2IXEA 1JWLA 1BD4A 4IDOA 3EIHA 2GESA 1PR6A 4B9AA 1F0PA 2ESRA 4DBLE 2WD7A 4OG2A 4ND3A 4FN5A 4RTRA 5LZ8A 1WZEA 4Y3UA 2F9LA 2XMSA 4R8MA 1JV2B 4RCYA 4MWGA 2QTFA 1E7WA 1T43A 4LOLA 1KO1A 5TE9A 1BKSB 4IIGA 5H70A 5FPYA 2P0EA 1VXOA 3FI9A 1LFAA 3KE9A 3LCMA 2ACVA 4LYDA 4UTPA 4IS2A 4J1NA 3C74A 2Q28A 3LO5A 1IZ7A 3WV5A 4CWAA 3T94A 4P31A 1BGVA 2P9JA 1AF7A 1UKZA 3TQCA 1UK6A 2H1VA 3NHBA 2WTEA 3S3TA 4IDEA 4Z54A 3P19A 3OQIB 3A32A 5CFOA 1EWKA 3L41A 2P9EA 2XQFA 4Q21A 5JV5A 1G4AE 4QKQA 4E2YA 5AVQA 1CT9A 4EHBA 3TRDA 3SZGA 1D2AA 3RGWS 2WTMA 2JIRA 1XO1A 2QY9A 1TIBA 4PAWA 3G2QA 1MQAA 5D7BA 1PEDA 1NASA 1RHUA 4MOWA 5EXEA 3TTSA 3E9DA 5TEWA 1UC5B 2GCEA 3C85A 3WNBA 1V5WA 4PHGA 3K70D 3BH6A 3DDSA 3ZVNA 2E5FA 3BUSA 5DIFA 1L4KA 4IKEA 3PNPA 4EY8A 2JIOA 3COJA 1RTTA 2WHPB 5HKOA 5JAIA 2ZDQA 4KPGA 1LVHA 2D5CA 2H2HA 3UQYS 2XD9A 1UH5A 2WINI 1JKIA 3ORRA 4AJ9A 1DU4A 3R1IA 1XVTA 2ZS9A 3CLUC 1I6MA 5EE9A 5EJAA 2VH5R 2VG8A 3L7MA 4H6XA 3OMXA 1L5HA 1MW9X 2O7RA 3B1ZA 1UANA 5KJCA 1ABBA 1T36A 1YDMA 3TW8B 3O8CA 3THXB 2MSEB 4COKA 3P45A 1Q1AA 3D1JA 1ZCJA 3E7PA 1NM5C 2ASEA 2XE4A 3N1UA 3I62A 4ARAA 1VDMA 1V37A 3SYTA 4B17A 2AUMA 5IH7A 1Z6AA 1GDHA 1VYUA 4NEGA 3NYRA 3O84A 4PICA 1BX0A 1NQ5A 3GLFA 3KAQA 4HVTA 5IT5A 1TYAE 4ZOLA 4ONEA 5H68A 5K3FB 4Y6GB 4LBYA 1EEXB 1XQYA 4ND4A 3H2JA 3H4MA 5FOTA 2V6BA 2QA5A 4O2RA 1VKHA 4V0SA 5I6DA 2VAWA 5AJZA 1XA3A 4EB8A 1B8OA 2XOKD 2PUCA 3PA6A 1WS6A 3Q87B 3D3NA 1KI2A 1C30B 1XTSA 2B6HA 3UV7A 4MJ7A 3VSDA 3QEMA 4G6ZA 3GY0A 2DHQA 1SU6A 3G23A 1JEDA 1MVLA 1NR5A 4N5IX 3RJ5A 2H48A 3U19A 4Q3LA 1WOMA 2ZB3A 1Z4OA 2BOVA 1BH2A 3VV2A 4R1NA 3OOYA 1MAUA 4QOHA 4UM9D 4WK4B 2PUGA 1CYEA 2NYVA 1JJFA 3OLQA 3F4KA 2W5UA 3LO8A 4CM8A 4DDKA 4C7OA 1N6PA 4JLOA 4WXRA 1Q1GA 1EBUA 3CX8A 5FL7D 2VJOA 3RYHA 3RVBA 5A7FA 1EUDA 2ZJ7A 3KQMA 4IG9A 3ZHSA 5A2GA 3HGQA 1LTHR 1C9YA 4MKHA 1I6KA 2VLIA 3HXTA 3F78A 3T4PA 2PANA 5A02A 5DBFA 4Z1MD 2EIXA 2FDRA 3S1AB 1MNAA 2Z2IA 2ZDGA 5BPHA 1XZGA 4TL9A 1FDOA 3VO2A 2J6IA 5LBUA 2VAXA 3MT0A 1A1SA 3RROA 4P82A 1UBLS 4TTQA 4I55F 1OE0A 3W3AD 3WLKX 1MV8A 4BO8A 4DJ5X 1UZLA 1FB5A 1U0RA 1ZNQO 3JXEA 1V39A 4K8OA 1ZK1A 2HBQA 1G8FA 2A57A 4KP7A 4RVFA 1Y37A 4IRXA 3RSGA 4CMHA 4I08A 3UMMA 1N36B 5D5QA 4C0XA 4D8VA 2BM8A 2UDPA 4BECA 5BQ3A 4ZO6A 1RACA 4L0CA 5GVSA 1Y9AA 1H4TA 1BA3A 1O8BA 3NM5A 1M2EA 3ZE1B 1CJMA 5L7WA 1P0FA 5HYVA 4Q9IA 2XRYA 1N7JA 3QVSA 3OT4A 1BX3A 1N2CE 1X1DA 2NUPB 4ZJYA 3L0PA 3DQQA 5JNWA 2BWJA 1L8XA 2A33A 1NOIA 4KQMA 2YOFA 4WLEA 4G63A 1A9PA 1GGKA 4HQ0A 1K68A 4M76B 1FFXA 3DMNA 4C03A 4EW6A 4PHFA 2NU8B 3TD2A 4YPOA 2IS2A 1FMCA 3OHPA 4C7XA 3L1IA 4PC1A 3NBFA 4NJEB 1LU9A 1QVZA 3BCRA 1W5BA 3P4YA 1SIUA 4L6IA 4A0SA 2XHEA 2GZAA 3AUTA 2VUUA 4TV8A 3QFTA 4P98A 4MQUA 2VTBB 1XKLA 3UMVA 5KDOA 1CUIA 1DAGA 4RBNA 1ZG3A 3OIDA 4IDCA 3KYCA 2CE7A 1RAEA 5ENZA 2BELA 4TSFA 3ZHCA 4LHEA 1DAPA 2RHBA 1E6MA 1H85A 5IAJA 5BR7A 3BM5A 3M1YA 2I2BA 3HV2A 2IYAA 5EINA 5DRTA 3K2EA 3JPYA 1QR2A 2CXRA 2X8AA 3MWKA 2RH8A 2OZPA 3E8MA 4I3HA 3SHOA 2DWUA 1JR2A 3H99A 4OQFA 4XX0B 1T5HX 2NV2B 3TLGB 4EOGA 5BR1A 1DDOA 3K1JA 4UJ5A 4H3SA 2EF0A 1BS9A 3OZVA 3KVRA 1Y7HA 2GFQA 2Z1DA 3RSHA 4BO2A 5FLEX 2BLLA 4BLOA 1ISJA 3A31A 3H9JA 1OBFO 4MS1A 3V2HA 1JB1A 1NATA 4X94A 1XCLA 4PANA 3AKEA 3AQ4A 3UA4A 3GEEA 4B3XA 2XUAA 3BWMA 5DBOA 4DT1B 1SB9A 2P2DA 2RBGA 3QUCA 3R6TA 2C2YA 4YRAA 4YCJA 5JAUA 4B47A 2B82A 2YASA 3A8TA 3A27A 4KQIA 1DVRA 1FCJA 4Q3KA 4XFJA 5TT0A 4F8EA 1CIVA 5FOVA 5CX1A 4DIOA 3LFTA 1DT3A 3A6ZA 1J39A 2WF6A 2PKCA 4D9IA 3DKPA 3TMKA 5KNBH 2LKCA 4R2LA 4F0JA 3GO4A 2GPAA 1WQ4A 4DF3A 4UEKA 4KOAA 3WA6A 3LI2A 5FHRA 3DBIA 2ZAYA 1V8FA 1OBVA 3OCVA 1NULA 1XEXA 1LW7A 2PT6A 4II7A 2PXXA 3V8MA 3M2TA 4E88A 2W8BB 3GH3A 1ENOA 3G3EA 3LSYA 2V58A 3BMXA 1YCDA 2R4QA 4Z9YA 2CXHA 5A1TA 1HE1C 1Y9JA 5BV7A 2CBXA 4CEJB 5D3QA 4V0NA 2YMMA 3FPEA 3KC2A 2XWJI 4FYXA 1N8NA 2A30A 1SUSA 3GUHA 5SV2A 2YH2A 1YQQA 3EZXA 3EVZA 4TQGA 2FZ5A 2QVXX 1N6KA 1OASA 2GX6A 3OE7D 4PGAA 3IEKA 3SF8B 4L75A 3CR3C 4U3JB 4JC0A 4RABA 1XAJA 5BSRA 3IFSA 3ZK9A 4INAA 2QAGA 2ODEA 2X0EA 5HILA 3R7WA 1FNSA 3U5ZB 1LA2A 4EPVA 1LDMA 3BWCA 1Z75A 2ZRFA 2IZ1A 4ABYA 4XOUA 1PR0A 4FFVA 2YWHA 1A04A 1ADFA 4PGFA 2EL9A 3PR1A 3R9XA 4YCMA 1KJ9A 2BMEA 3VO8A 4ENQA 1P7VA 3QXCA 2ZANA 4FJ0A 3K9BA 2BE9A 1K27A 3C7DB 1O95A 3A9TA 3T9FA 4C2AA 4K88A 3NHLA 4BE9A 4G1BA 5HE8A 5GWXA 1TT5A 1E20A 1CUSA 1SCNE 1AQLA 2HQ1A 1GZSA 3LBAA 3SPXA 4LUCA 4DXDA 5LQKA 3Q88A 1VPWA 1E0AA 3T7EA 4IXNA 1N2HA 3UB2A 1Z0UA 4DRYA 1W9HA 1Z4LA 5CYFA 3VYRB 3VR5D 1MMFB 1S3GA 2Q9AA 4HZUB 2J09A 2C77A 2QZ4A 3KSZO 4JODA 2DFLA 5EXTA 3NP9A 4NZZA 3FOBA 2RC6A 4ZTUB 2FK8A 1NVGA 2Z5FA 2CF5A 2VJNA 3GJQA 2O2SA 3R3HA 3X1ZA 4ERNA 2EP8A 5JAHA 3GLFE 4CM7A 3ZLBA 4I50B 1YULA 2ECPA 2IXGA 2XQGA 4JLBA 4WUVA 2PNJA 3IUEA 1M0EA 3R76A 3VA7A 3CV3A 1SPBS 2DUMA 4LW8A 1XTKA 4Y9UA 5KO2A 3HO1A 1XEWY 2XF2A 1W87A 3RU7A 4ZT7A 1MQ9A 3SI7A 5B37A 3RYCB 2BH2A 5L4NA 4PAQA 3RRYA 1GGMA 4YCCA 3IP6A 2CYCA 1ESMA 1RRFA 2R6CA 5L3VA 4KWCA 3OOHA 2C2WA 4QTUB 1LDNA 1EFKA 1P7ZA 3L7YA 3L07A 3N39C 3QPCA 3CB2A 1FXUA 1PW7A 2YQ5A 4J8PA 3JS5A 5KNCH 5BOVA 4JT9A 3PI7A 4ADSG 2G5TA 3KTAA 1Q3KA 4FFSA 4Q16A 4FEEA 2NNWB 3HXLA 3JQ8B 1JYFA 4B3IA 1SXHA 2BFDB 3JQPA 3VHQA 4WKNA 2VP2A 1S3SA 1BD3A 3C7CB 3HR7A 4CMBA 1XRLA 4M60A 2C2HA 3QJYA 2CK3A 3AU8A 2PUVA 4II3A 3Q72A 4J16A 1JLRA 4ZAYA 4DZTA 5CNMA 3A9WA 2DUNA 1KJJA 2PKYX 4UVEA 1KFKB 3ABQB 1RWXA 3ABOB 5DX0A 5FX2A 2IZOA 1O57A 1RJ9B 2IZZA 1SVLA 3BGSA 4JC4A 1JE1A 2W8ZA 2O1WA 5HQJA 4D8TA 4H27A 1K8QA 4R5MA 2QYTA 5IUNC 1XU4A 3O93A 1RWQA 3A3YA 2P2LA 4YP1A 1J2RA 2OO7A 2EG5A 5HFJA 1U0BB 4OYYA 5LIRA 2WQ7A 2POCA 5T4EA 5TV2A 2VHWA 1C1DB 2PN1A 3ZE9A 1IHUA 1ZL0A 2OP1A 2QVZX 3ZY5A 1ECPA 1GFIA 2VHXA 3LGXA 4BNDA 3AUSA 3NDIA 5IVDA 5B57C 4NBTA 4JBIA 1C9KA 4UZEA 4ZRMA 4MWSA 2HY7A 2GS9A 4POOA 4ZREA 2BTEA 2J0UB 2WHXA 4G5XA 4MQ5A 2C5EA 2XAUA 5T3UA 1QRTA 1YB1A 1TEVA 3ASUA 2QSZA 4R2IA 2HHHB 2J30A 3U9SA 1FZTA 1CV2A 3KR9A 3WYDA 5IULC 1OXVA 5IC5A 3SAJA 2QUJA 3OZXA 4ZO9A 2NUTA 2VWGA 3G82C 3HYLA 4TYNA 3NTVA 1Z2NX 5ALTA 1U9ZA 4LDZA 3WE7A 2REXB 4RZ3A 2DC1A 1FDSA 1W2GA 2AJCA 3A4YA 4FYJA 4GDMA 3KHTA 2O2GA 2H4XA 3QA9A 1WXWA 1YZUA 3V1UA 4D1YA 4DLXA 4IAOA 3P71T 3Q6NA 3LY7A 2I4OA 4DZZA 3OZCA 1JG3A 4MYDA 1K5PA 4JP2A 4QUDA 4QT4A 4AQYB 1SGWA 2XDQB 1FDUA 4XKJA 1ZLYA 1MRZA 1JAYA 1KY5A 3KT8A 3Q8XB 5DOVA 1HFJA 1PTKA 1XF9A 4BJ6A 4UTRA 5K8JB 1OXUA 5EP4A 3CLUD 5ITWA 3T4EA 1ZO8A 3V42A 1S3FA 1HR0B 1EZ4A 3CKKA 1GL9B 1QO0D 3OTGA 4ZOEA 4EPYA 3W77A 2C54A 4MGEA 2GBPA 4RMNA 1H9CA 3K1YA 4JB0A 2IQIA 2PVSA 1YONA 4H7EA 1CJTC 3T15A 4LVUA 1AKUA 1NQAO 2YY7A 2LXNA 3IBFA 4H1UA 3ZDRA 3B5JA 3HJFA 4FN4A 4HMQA 4OB8A 1TYBE 5JG7A 2W48A 1XTVA 2PFSA 1F9AA 1U6KA 4WKBA 3UK7A 1PL6A 3FDZB 1RWNA 5FBWB 4YJ2A 4G0UA 2JJYA 1C0EA 1E0DA 4MW2A 4OU5A 5I9MA 2EATA 5IRCD 4MI3A 4DR7B 1FRFS 3X2FA 1NGSA 4RJIA 2FSFA 3FY4A 5EZYA 2ZIFA 3RFVA 4BLUA 2YXNA 3TEFA 4JYCA 4NYIQ 2HKIA 2PD4A 2QXYA 5C7LO 1TZBA 1V8BA 4J03A 1Z3IX 1CY7A 3OT5A 3GLHA 3QXSA 2O0JA 2QVBA 4F9GA 3CG4A 4A6DA 1HTWA 4HLUC 2G4CA 3PTZA 4JCCA 4MTCA 2EW8A 3HA7A 4OXQA 3R5XA 5A4IS 2G25A 2ID9A 3EQ2A 3F5SA 3FXAA 1KYVA 2YHIB 1GG8A 2A9FA 1J8FA 3MTQA 4UU1A 5DXJA 1I1QB 1SCQA 2CFOA 4GL4A 1UPTA 3D3JA 2QSJA 1ISSA 3HCPA 4TMWA 3IIEA 3AJRA 4XOIA 1E1RA 2I5PO 3UWDA 1YAJA 2AJBA 5L9AA 1KOFA 4D8UA 2X7JA 1AGRA 2Z9BA 3NHPA 4LTNA 1PYGA 2F9MA 4J6FA 1XI2A 4J2OA 5K8VA 3NNNA 3I4FA 1NNSA 2OVBA 4K46A 4WFJA 5CA1F 3HE3A 1PG2A 2V9ZA 4L5BA 5BN5B 2BSXA 3G9ZA 2BR3A 1D2MA 4FGJA 4X7MA 1K5DA 3AO0B 5MN5A 4Q4HB 4JQOA 4OQLA 1VRCA 1QP8A 1A72A 1VIDA 3TXYA 3HJGA 2B99A 1JT2A 3FA2A 2NO9A 5CJPA 1NQOA 3L1HA 3ZHYA 1YIAA 2ET6A 2J3QA 1G21B 1WZ2A 1SBCA 2YRWA 3D5EA 4HGPA 3GGDA 3A6DA 4JB8A 3TOZA 2FWAA 3PC2A 3W8EA 4BBAA 1EG7A 4JNKA 2WUVA 4IJMA 2WPDA 5CA0A 1JKJA 3UUGA 8LDHA 3FYCA 2FY8A 1C41A 1RPAA 1M2WA 1ZGJA 4Q7EA 3C14C 2JRCA 1TVKB 1DAFA 4XJSA 4DFDA 2WMYA 4ZT5A 3GZJA 5EJ5A 5JJLA 2IHZA 1KPHA 4HNRA 4QULA 3B1XA 5KI6A 1UBTS 1RVDA 4AS3A 3PQ2A 2E3JA 1YZKA 1G3UA 4HHEA 4D46A 1YFJA 1SXQA 3B8EA 5U4QA 4UAVA 3R44A 1AQNA 1PR4A 5J1TB 3AHFA 1CNEA 3H6KA 4ZHQF 3H7AA 3O38A 4IZIA 3T7JA 1P73A 3A0UA 3DNMA 3REOA 1DKMA 1TK3A 2X77A 3JSXA 5DHRA 1OD6A 1QKKA 3CZPA 2XA1A 1K86A 4DHWA 3N2KB 3I9LA 5BV0A 5T8KA 2BI8A 1E8DA 3MVEA 2E5LB 4MVJH 1P2BA 5T7BA 1UWLA 2CMHA 3WMEA 2QPAA 1OLSA 3B5IA 2ZAIA 4YP9A 3TD9A 2A78A 3UJHA 2WD8A 4GAEA 4OBEA 1HORA 1LBSA 3WNQA 5TPZA 1NUHA 3DKIA 4F91B 2QROA 3ZQKA 2WNSA 1AJEA 2WJ6A 5J5AA 4ENUA 2JI4A 1SUBA 2CBZA 4TS4A 1H8HA 3WIEA 4O5OA 1NU8A 1B00A 4H3VA 2AI3A 2AMYA 2DVMA 2AX3A 3C98A 4JKOA 4Q9KA 1HDGO 1AY0A 1W6RA 2HK9A 1R66A 3CRMA 3VYUB 2YN0A 3IBTA 1JLHA 3DMYA 4LZPA 1D0VA 4P3XA 1Y6QA 4KMRA 3T7KA 4J9VA 3UW1A 4CHTA 4OHMA 3PIRA 1BDIA 3LVRE 1XFAA 2D8AA 1W9MA 2A9JA 2EGUA 2KJQA 3HKCB 4MLZA 4IDGA 3V1TC 2AKAB 3DHYA 3L8HA 1ATZA 1OV4A 4C7KA 1C8KA 2XVZA 3MCAA 1BHO1 3SY8A 1GL6A 1LBHA 4OP1A 3W2TA 2WMDA 2J4CA 1Y5RA 5JCOA 2P9QA 1EESA 1YHNA 4TT8A 2CHVA 4W7IA 5L6LB 1I3CA 1XRSB 2PRSA 4DDWA 3DKKA 4Y2PA 1Y8QB 3ZY6A 4IQGA 1WCIB 1NWHA 2VP4A 4QOEA 1OBOA 2FOLA 4TVOA 3FMVA 3S55A 4DM4A 1KEEB 3F6CA 4ZDJA 2P27A 3R09A 1VBNA 3D5QA 3HHPA 3MTJA 3TTTA 2BKUA 2IFTA 3ZDDA 3PJGA 3SR4A 621PA 3RFCA 3KB1A 2I2AA 4US1R 4WOBA 3NT2A 4HNTA 3VNQA 4NBUA 1IY9A 4QYSA 4Y9TA 1IWBB 3TVYA 2XDAA 7ABPA 1P91A 2AWNA 3IQWA 4HI0E 4U5XA 4AJPA 4BNZA 1K66A 3GPIA 2C2XA 1JLLA 1W4RA 3LT1A 1JN0A 4FWIB 4GYKA 4RVCA 4RS3A 3I58A 4JT2A 1NIPA 3HB4X 1Z47A 2EFGA 2VTEA 5DOZA 2PUJA 3ZD9A 3L7DA 1FFBA 2SHKA 4KGZA 3R3VA 2ZU6A 1SUEA 1N2BA 2JA2A 1MC5A 1CQXA 3F5FA 3JVIA 2AD1A 3HCAA 3FUTA 1PBTA 4JJ6A 1QC5B 1Z8DA 3G59A 2COUA 1TM3E 4XIYA 1D5CA 3VISA 4BJ3A 1QKIA 4HVCA 2JCXA 2GZRA 4PZZA 1AQJA 4BXOA 2RGCA 5GINE 4KI7A 2WHEA 5L3SA 2VP9A 1XQVA 4HMOA 2AFVA 4LEIA 1WP9A 3DT9A 1JHAA 3OESA 1DAIA 4K9LA 4DQVA 3K5HA 2R5FA 2YWGA 4KEAA 3N7TA 1RW4A 4EHDA 2QAIA 2X4DA 5KYWA 4KBGA 2GD0A 2O0KA 2A88A 2IHBA 3DVQX 3U17A 1UBEA 1NZDA 1Q50A 2BHRA 3B9BA 4LSWA 3ONFA 2F1HA 1I0LA 2FWIA 2H1SA 3ZQJA 2ZR7A 3HCEA 4OK3A 1RZUA 3QVOA 4Q1EA 5TJHA 3EEFA 4B4VA 3K30A 4TLAA 4EYOA 4GKKB 2ZP1A 3EDYA 3SE0A 2DEUA 3GR6A 1C1YA 1TZCA 4ARSA 1JALA 2EWVA 3LLSA 4HDAA 4BMPB 1L7MA 4E4TA 3TR6A 1GPDG 3BX1A 4IX1A 4PLCA 4KQCA 3WLJA 1MEJA 3H5NA 2Z98A 3WGMA 3HXQA 3THYB 2R1TB 2ZRCA 1U94A 2FWJA 3SZLA 4AZ3A 1DBSA 2JGLA 1NQWA 4YNBA 1CB7A 5DFAA 1RLUA 2GPNA 3PXBA 5F7JA 3TOVA 2NZ8A 4OLHA 3EZ9A 3PQ7A 4W5JA 4UPEA 1R4MB 4GPBA 1RQRA 4CM5A 1HWYA 2C5HA 3H5RA 4MB6A 3Q98A 1PZXA 5LQCA 3RO7A 5JZ9A 3DOFA 3U0VA 1CNMA 4JJ8A 1CSEE 5DN6D 1YD7A 1HFWA 3STWA 1Z33A 2BEKA 1FVHA 1PJ2A 1EVLA 2XNCA 3FOWA 3GLHE 1V2GA 1XZAA 1Y3HA 3DUWA 3DDWA 3F5QA 5LWHA 1JR6A 3GA5A 1L0BA 5HFAA 5IVKA 3D0QA 4LXYA 2YJNA 2ID8A 3VR3D 4BKRA 1Y1LA 5EXPA 2OG2A 4DANA 1D8AA 3PF8A 4O8CA 3QVVA 5LZ7A 5K0GA 1T4CB 1ZDMA 4F5WA 4FGKA 1FU7A 3KD3A 5KTMA 1S5PA 1YZVA 4BYMA 4TYWA 2EKBA 4JLPA 3TLYA 1AS3A 1CCWA 1TOAA 1ZN2A 2DQSA 2G9UA 3DLIA 5BT8A 2GDJA 4DG8A 3SVLA 1UMBA 2FW9A 3MFYA 3RBVA 3VNRA 3DFZA 3LV8A 4C78A 1UKVY 1WPGA 1U1GA 1DEHA 1ABFA 1IONA 1EAMA 1H5QA 2YFYA 5A5VA 3VPHA 3MWEB 2ZRDA 5BSHA 2PGAA 3C8DA 4LQDA 1G6KA 5C7IO 4YYEA 5I9LA 3N2ZB 2JFPA 2HLPA 1GZ6A 1EUQA 3GLKA 4D3ZA 1FXWF 3ELUA 3ZN2A 2KSQA 1PEYA 1IM5A 3HO6A 2B35A 9ABPA 2VHTA 2CFSA 2H11A 2XE8A 3EW9A 4JGIA 3OPQA 2BCGY 3DDZX 1G8MA 3EQ7A 3GFRA 3O47A 4RD1A 3S6JA 5KYYA 4DR1B 3VZRA 1BQ3A 3E58A 1QAQA 2Q4DA 3HPRA 3T41A 1S1CA 3FNEA 1VIAA 2CDCA 3AR9A 4FQ5A 2O6HA 2H29A 4HPXB 2P9ZA 3KPYA 2NU7A 4CDMA 5C35A 3AIKA 2HWYA 1IQ0A 3HGMA 4TTJA 4YRCA 3HZRA 4BFCA 2UYQA 4GM0A 4EY5A 1QIFA 1MG0A 1ODIA 5FULA 1GAWA 5IVIA 3USES 3A4NA 4P8RA 5BYAA 1H3EA 4IV0A 4F06A 2B78A 5DHQA 4TLLB 1XMSA 2PV0A 2PGOA 4K8RB 3ZI0A 1N5IA 4PFJA 3WLQA 2JIMA 3IEIA 5B58T 5FA5A 2G80A 3WB2A 3WB1A 3ZHZA 2VT7A 3DH0A 1PWYE 1Y8RB 3I9V1 1TE2A 3HVHA 4Q19A 3S5UA 2HRBA 3IBSA 4FW8A 5DDIP 4DLTA 1RZRA 2UXCB 2CLKB 2FNAA 2G40A 3NHUA 1W93A 4KGXA 2L18A 3TDNA 1SKUA 1VXRA 1WXXA 1I4DD 4RDCA 3K31A 2G9VA 3AUFA 3MTEA 3RUHA 3NBYC 1XALA 4OPMA 5IBRA 4WN3A 4JDUA 4W6ZA 1UT8A 1GCOA 4FSDA 1L8AA 2YZ7A 4XSHA 1ZNZA 1IG0A 4JUIA 5BORA 1TZKA 5JD6A 2WT9A 5JNLA 3NHYA 4YN3A 2NLOA 1D1TA 2YV1A 1H4VB 2XGOA 3M6WA 7YASA 4EI7A 4TVKA 5CB4A 2A4KA 3BIJA 1EZZA 2EZUA 3R2JA 4IXMA 1QYXA 4XUCA 3WB9A 3WRXA 3ZE2B 3DWIA 3P9XA 2LR0A 4QIHA 5TQ2B 4L16A 4ANFA 1R4ZA 2Z4SA 5CH8A 4AP6A 2HIAA 3VKFA 4QDZA 5EHXA 2B3TA 2OP0A 4F71A 1XQ9A 1NY5A 5AW8A 3SLGA 3REGA 1KJYA 4GX0A 4N7MA 1GPMA 1WXFA 1CBUA 3CCFA 4UHKA 4W6QA 2ZTUA 3MXTA 1WW2A 4ESEA 2D13A 4V3BA 2QRJA 2C4UA 2WF5A 3NHRA 2GCOA 2H08A 1A5BB 2H7VA 4LMRA 4NH0A 5D3KA 5DHAA 4XYLA 1OXBB 4KQWA 2B4QA 5GMOA 1Q77A 4B83A 4ARCA 1ABEA 2PLWA 3H5VA 4ZXPA 4FKBA 1M5TA 3H65A 3QLVA 3S0JA 2II6A 2OHHA 3MJVA 4OXNA 4V1CA 1XZQA 1Z0AA 3B3FA 3IT1A 3QVMA 5AVOA 5CD1A 3PDIB 4F2DA 2WIGA 5CVDA 3KB2A 3KJEA 5HTKA 2Y9PB 1T5TA 2P4SA 3AC0A 4B6SA 4JV5B 3AW8A 3S8MA 1U02A 3DL2A 4NHOA 4OLAA 4HADA 1ECBA 5ELXA 2COKA 3TIFA 4UM7A 1ZGZA 1U2RA 4REQA 3HH8A 1JNXX 2JGMA 1NJFA 1QMPA 3I42A 2GEVA 1QIJA 4NQZA 1NNI1 1RXUA 4ZI7B 3BERA 1ILWA 5TJ9A 2WMOB 4MVWA 5JCPA 2HMSA 3JD2A 2GF2A 1CB0A 1X87A 3ZX5A 4LZJA 3EIFA 2I3ZA 4O0LA 4U1RA 5C4IA 3K9NA 5DVZA 1XNQB 4KFTA 1VGVA 1LTQA 4MQLA 3IBCA 5DNUA 4BVAA 4EPTA 4HG2A 5JPDA 4XCQA 1IEVA 1W5EA 4M0UA 1S7CA 1Q20A 1TK9A 2O50A 3ONEA 2WWXA 4OMCA 4WZZA 4YCDA 3DBRB 5DSTA 4O4IF 3TPCA 4DSOA 5FWNA 3H2GA 3ZW9A 4RHTA 4TKVA 3VMFA 2XTMA 1Z29A 1QV6A 4OHRA 2OZLB 3NWJA 1PK8A 1SCBA 1GNTA 3VPDA 1MG5A 5HNKA 4MW5A 2B0CA 1GEEA 521PA 2IELA 5BSGA 3U6KA 4M87A 1L8LA 1XVUA 3VTFA 3C6KA 1HGXA 4AD8A 5CB6A 1KDYA 2YW9A 4YV1A 3EGXA 3UWKA 3IJPA 2WA2A 2IP1A 3VKHA 2OMEA 3GLIA 3VV3A 2ZWOA 1U2DC 2WJZB 3NG1A 3W4KA 1I2BA 2C5FA 1U8AA 3KWJA 3HRKA 3K8YA 1HE8B 4KXQA 3S7ZA 3EXAA 3PSHA 2WF7A 1P2VA 2O7SA 3HDGA 4GLBA 4XGNA 5KVSA 1K7EB 1T4BA 2Z95A 4NBLA 4KIWA 4B6JA 2YWBA 1ONPA 2O8EB 4LVOA 4D9JA 3NVMB 4ZK6A 3EVDA 3A25A 1CDZA 4GEKA 1G9SA 1P19A 1QFSA 2ZUEA 3QIVA 2V7EA 4Y7CA 4YI3A 4BFUA 1E62A 3VSCA 5KVCA 1P0CA 2I87A 2GT1A 4NCXA 5IZ4A 1CLEA 4WLFA 2M6RA 3GFQA 2JCSA 5TB5A 3RS0A 5D51S 4F4CA 4C07A 4D74A 1W76A 4XGIA 1CY0A 4DC1A 1ZKMA 5AIAA 3FHOA 1BVHA 2HOQA 3U3KA 3TW4A 2JZNA 5BV8A 2XOKA 4M9CA 1N9GB 3X1WA 3MZ0A 3VZBA 3ASYA 4D4KA 4NTZA 1R0KA 3KU4A 3ZWKA 2ZBRA 2OXIA 1RAIA 4I4TB 1YOVA 3O31A 2OUKA 1KI8A 1YR9A 4A1OA 1SBNE 3JASB 3H17A 3ULKA 4AXBA 5E8JA 4RKYA 4F2GA 1CUGA 4GVXA 2VUIB 3H13A 4MQEB 2B92A 2QYHA 2H7YA 4ZA2A 1W96A 1G6OA 1M5UA 4BZXA 5FL7A 5D01A 1X19A 2F3UA 3GI1A 3JQGA 4A6PA 4ZHSA 1ST2A 4MS4B 5KTTA 3BZBA 3TW6A 1FSGA 3OTIA 2J48A 4L72A 2FSUA 3DEJA 2ZT5A 3RJ9A 4GMDA 4NK5A 4OBBA 3ZDZB 2ZEJA 2YJ4A 3AK4A 4S12A 4Z1MA 6YASA 5EVCA 3U4QB 1IBLB 2YVUA 4MQBA 5KX5F 1N7IA 1YR8A 3UC5A 2PMFA 4C3OB 4EP1A 4X1KB 6AT1A 5H7XA 3W3AA 3WXMA 2VBIA 3LK6A 3I2KA 4X8LA 2ZI6A 4K9PA 3HXMA 1O8CA 2EW1A 3B78A 3GARA 2YWEA 4Y2XA 5THQA 4D80A 4XIJA 2I54A 1T0PA 1LW6E 2XECA 3L04A 1MUUA 3IQXA 1X1CA 2H1HA 2NACA 3JQEA 3CHYA 1KFEB 2K2QB 1K8YB 2QMOA 3NIBA 4GM1A 5JWHA 4OQPA 3LQFA 1FVFA 3ZGXA 3ZLTA 2ZZMA 1GTZA 1IOZA 1Y7PA 4G1CA 4R9RA 1FFEA 3PWKA 2GYVA 5K3BA 4BB6A 2VSFA 1HQDA 4WOPA 5J58A 2FR8C 3PP8A 1MF7A 2DBVO 2XUQA 1TYCA 4FMDB 1WQ1R 3D2LA 4H6VA 4J0KA 4AVYA 3UPDA 1C0IA 5E9QA 3IMCA 1RKBA 1VA5A 4E33A 5FI0B 1X92A 1GRQA 5HSGA 4PX5A 4Y98A 5IANA 2VDJA 3H86A 3LKBA 3PXGA 1XMPA 3X1KA 1ZEJA 2MDTA 1U7WA 4I8XA 4M3NA 4EI8A 4AWBA 1XELA 3EQ6A 3C4QA 4QUIA 5IWAB 2JFHA 4CW7A 2WVHA 2FEPA 4BVGA 1T6ZA 2JJ2D 3GJRA 1J8DA 2X8BA 1NI5A 1Z37A 2C8KA 3NI2A 5F77A 5T4BA 3W6ZA 5B30A 2WHYA 5GONF 3HYSA 5C0OE 3SXUB 1I4LD 5DE3A 3H42B 1K88A 3OUTA 2QI9F 5BN4A 1QHHB 5LMZA 1CUJA 1CX9B 2X8JA 4HDNA 1KJWA 4KWTA 2OBLA 5K0TA 4YBRA 4FCTA 5J2TA 1MJGM 1G8KA 2VJPA 4JX9A 5DKFA 5CLJA 2I2CA 2IYZA 3E15A 2I4MA 3MYYA 3VZSA 3EVGA 4BMOB 1NMEA 3E5MA 1A7UA 5HBRA 4WZAA 1CY1A 3GZNB 2ZU0C 3OCWA 4YJKA 4RFSB 3L84A 4ZCQA 3W34A 2IZ5A 2FPPB 3EEYA 3M6LA 2Y3IA 4CQJA 3K71B 3KQSA 1FMLA 1SVKA 2G5CA 2INGX 2WYHA 4JX8A 4X71A 3TZCA 3L8CA 1XA4A 4XEHA 1VLJA 4N3GA 5HIMA 5EIWA 1A2BA 1VHWA 5FFFA 5GIOE 1I3LA 1NDHA 1QCDA 4FHZA 3WAJA 4JQZA 1TQHA 1EUZA 1JHPA 4WKGA 4D4JA 4P81A 1A9YA 1M7BA 1EB9A 2QIOA 3UCFA 1YJQA 1AQ6A 2B2NA 3AZQA 3BCHA 5HQ3B 3GLGB 2YXPX 2B7BA 3ZNNA 1XUOA 1SXIA 2P4QA 4XJXA 5CYGA 2R2AA 3NAZA 5IEBA 4Y67A 1EKXA 4UU8A 4GECA 3EZFA 2LW7A 2QN7A 3EODA 3W8DA 4OBXA 2JLUA 1TT7A 1VFPA 3AVWA 2FGJA 2X1MA 2ORWA 1VLZA 3AQIA 2P0YA 3E9QA 1TJ4A 1VTKA 2IXBA 4LYYA 3WQSB 2EJCA 1NXSA 3PGJA 4WOCA 2WSBA 2I71A 3UJ7A 1R8JA 1REQB 4MEBA 5FH9A 3JQFA 4XLZA 7MDHA 2OXTA 5JHGB 2B94A 1YQXA 1VIVA 3AM1A 4NLLA 1ZLXA 3OE7A 2ZZNA 4N82A 1HTTA 1UC4B 1G6HA 2I03A 4OQQA 4MSUA 4B3DA 3MIZA 2V0GA 1YKSA 3Q2OA 1MOZA 4JJZA 3AESB 4MK4A 1OAOC 3LZ6A 1H1LA 1R10A 3AUAA 4F8YA 1OYOA 3IOCA 1YWGO 1OA1A 4XVHA 1CFZA 1JT9A 4NHEA 2GA9A 2WTAA 3CGGA 5DBEX 4JJGA 3H9GA 4RK5A 2E6UX 1A5SB 3YASA 2B4YA 4BC1A 4E12A 1YVUA 2EFYA 3AP3A 4HWPA 3LX8A 1ZOSA 2AFIB 5MGBA 2NVOA 3WBKA 2ARKA 1DG3A 1XZBA 4YCLA 3MLBA 1NJ1A 1ZQ9A 4I19A 3LUCA 4O4LB 3H4VA 5C31A 2JLVA 2IU3A 4UUQA 4R01A 1DNPA 1Y7LA 3QU2A 4GI7A 3F46A 5FWYB 3EH1A 1U0TA 3C3YA 1CUHA 1MFZA 2HB6A 2O1SA 2VP3A 4E2WA 4X3CA 4EWLA 1NJGA 1U0LA 2XRZA 2F9FA 3HZOA 1UQUA 4UTNA 1KQFA 1O9HA 2I2XB 3NBZC 5F5NA 4RIEA 3KT0A 5SZKB 4RTOA 3WFIA 1BFDA 1HDRA 2IA5A 4WOKA 3UH0A 2XGGA 3ODPA 5IJ9A 4XWAA 1IY1A 3A4TA 4HXEB 1OGJA 4MR8B 4QLBA 1FNCA 5J4YA 3VSBA 4P4TA 2WAYA 2JS7A 4UBOA 1P1BA 1RYZA 4WXYB 4CKBB 3I6YA 4DLLA 4QJIA 3W6UA 5JH7B 4ETWA 1E2KA 4I1YA 1YMUA 2XYVA 1E3WB 4LF6B 1EI9A 1IL0A 2P9YA 3DONA 2IHJA 4LXUA 2EBHX 4MINA 2C5GA 2V65A 2Y1XA 5EJEA 1B15A 1P1RA 4G2TA 4FS3A 4L9WA 1L4EA 2GD1O 5AKZA 3VDXA 1Z16A 2FMXA 2J67A 2RK4A 4WGFA 3ZCTA 4I66A 3URMA 3K9QO 1J09A 1RC0A 4Q3CA 2IW1A 3SOZA 1N6HA 2FPXA 1LKZA 2AUTA 3QPAA 4L7VA 3ZDXB 4C4SA 2P65A 2YOGA 4M8IA 2X58A 3H1BA 1P6XA 4LSGA 1ONBA 2CCJA 1IK6A 1PJ3A 2J3MA 3M2PA 1FPMA 1EQ2A 1MHPA 1XAGA 1YE3A 2DHDA 2PNFA 2YJ3A 3KFVA 4BQEA 4QDKA 3PHCA 1EEHA 3DHEA 1MA0A 3DE0X 5JZVA 4R40A 1G16A 2ZUVA 4P2BA 1NV9A 3U4MA 3WLPA 3N7AA 1TW3A 3QUTA 4G8DA 3VJKA 1OCEA 3VU8A 3DAFA 2PWPA 1L1FA 3TNJA 2R6GA 1UXHA 4W63A 3AWIA 1ZW1A 3ZCUA 3IQGX 2G09A 3I1FA 3C5HA 3MPOA 4FQ7A 4OXRA 2QR5A 1Z8FA 4QA9A 4ZYVA 2R8YA 1IAVA 1D5WA 1TM2A 1EQAA 4ZARA 3GGCA 3UJ8A 1VGRA 3E7WA 3IMGA 5ENDA 5JY6A 3K92A 4LZLA 1FLAA 3GT0A 3VPCA 2RKOA 2H5EA 3JATA 4Q1FA 5ULLA 2BBOA 3VQTA 3QU7A 3ZU4A 5K2OA 4IHKA 1Z4NA 5HRAA 2DWQA 3JWIA 3HKEA 5AXCA 3ZYZA 2J0QA 2R1UA 3DB2A 2GPTA 2W98A 5CDYA 1FNNA 2HSJA 3INYA 3PRKE 1E61A 4FKMA 4WBNB 3CWCA 3NNDA 1M0TA 4BRUA 1PFYA 1LNSA 2MU1A 3D64A 1TNDA 2P11A 3L0BA 4UDOA 4DA6A 4UDYX 1NLFA 1QRUA 1ZISA 1N0IA 1U8XX 3LF1A 5CB0A 2R6DA 5I7OA 2ATXA 3ND9A 1YAHA 2DF8A 3SF0A 4O29A 1V9CA 3UJAA 1QF6A 1RKQA 3GOHA 2JKZA 2PRJA 4NFLA 2D06A 3HBJA 1Z35A 4XSVA 4C0SA 5E1MA 1RWOA 3NAGA 5IJAA 1F9EA 3ANSA 4BS9A 2G76A 3BULA 4FGLA 4JVSB 3BTVA 1WEHA 1DC6A 1Q7CA 3GGGA 2EC5A 3GP8A 1AQIA 4D82A 3KR1A 1C50A 1MZVA 1NVFA 3CNEA 4JXJA 4JSYA 4L1KA 2NSHA 1XAHA 2H7XA 4MUBA 5I47A 4QLOA 1ONSA 2FUG1 3M33A 4Z6KA 5EGNA 4PSCA 5CYPA 1QO0A 2WLSA 4BP8A 4ZV9A 3BDVA 1WM1A 1CQIA 1IXKA 3GJ8A 4JBLA 4X6LA 5G0UA 4P36A 3WMWA 1KFCB 1WULS 3HO8A 1NHGA 2QVLA 1HEUA 3KZVA 2BFBB 2ZWVA 4RHUA 1CW2B 1ZHOA 4RS4A 4RHCA 1KMHB 3FDJA 4PNEA 3QPVA 3NBKA 1LUAA 4HQOA 4FYIA 1XRPA 2J9FA 3I9FA 3INGA 1PAUA 4BU1A 1SKBA 2H4YA 5D5PA 1PL8A 1YL6A 4MICA 3RS9A 2VHEA 4HNAB 3SOPA 3Q8MA 3KB8A 1RRCA 1FZQA 3ICOA 2EU8A 3DUFA 2W70A 4EECA 4F21A 3SDZA 3VR1A 2BMWA 1KAGA 3OU2A 3U44B 1Q7TA 3O0DA 1OLUA 3P32A 4CIWA 1O58A 3IT2A 3LUHA 4GQIA 5DN9A 1I51A 2A59A 3H8VA 1D1SA 4JUCA 2X3UA 3GT7A 3TEMA 5ITZB 3LHDA 3BYZA 1SWVA 1R5OA 3P0JA 5EMHA 4HD8A 3K6SB 2Z83A 3SDBA 2HQRA 3DBHB 3EIWA 4RQTA 4LWPA 5AQ1A 4FCCA 3D4PA 1ZXLA 3L05A 2ASVA 3BBPA 3E84A 4D41A 3R5SA 3FWYA 5B1SA 1R5NA 3CNHA 4JJAA 3PF9A 3HC7A 5TC4A 3SSNA 3CBQA 4FE4A 4C2BA 1ZH2A 3EDQA 3RKUA 4EY3A 3K0EA 3RHZA 3GFBA 1P2SA 3OF3A 1YV9A 3ZBPA 1XTTA 3M0EA 2ZYWX 3E4DA 1E7RA 4UFNA 1XN1A 4RO0A 3N2LA 2A9RA 1X6VA 4JR0A 2Z8XA 4XWOA 5LDDC 3KXPA 3I23A 5TQJA 1H2YA 3ZVRA 5B7NA 1NNUA 2FN4A 5LYJA 3KQHA 3MHPA 4PINA 4MVCA 4EJFA 5LQNA 5AOCA 4RVSA 5C3MA 2R96A 3ENZA 4F7DA 3M6AA 5JAZA 4GXTA 1RRGA 2PZEA 1JDVA 2FP3A 1Q3HA 4GT1A 5CT9A 1FP7A 4LJAA 2A9OA 3FGNA 4LSMA 3PYLA 3WGVA 4AWAA 3NO4A 2G88A 1EFDN 2QJOA 5KTNA 3PHHA 3QG1A 1Y9EA 2Q6IA 1QU3A 3LBIA 1LDBA 4DNOA 4A03A 3ICPA 4KO2S 4FZRA 3OLCX 2EKLA 5ERGB 1Q2XA 3SQLA 1GQQA 2BT4A 2B4KA 5CFQA 3IXQA 1JS1X 3AT1A 4D43A 1EJ6A 3FFWA 3U3XA 721PA 5HDQA 4ZK2A 3CNNA 1OH5A 2QMQA 2ZIVB 5G53C 1KJNA 4B0OA 3LCRA 4FEAA 1XZNA 5D8DA 2ZRHA 4XFDA 5GQSA 2EFHB 4I8IA 2F8SA 1TUBA 5I9SA 3O8OA 3HNOA 4BZPA 4RLQA 4F38A 3HFJA 1BYUA 1XJCA 1KEKA 1N4AA 2O8BA 4Y6PA 4MVXA 3BS4A 4NRDA 1MJGA 3D3QA 4C05A 5ALVA 3B38A 2OHIA 5JI2E 1X74A 3AX6A 2ZE6A 3PX2A 3O9ZA 3QFCA 1AZSC 2DPMA 3B48A 3CRRA 4H18A 1JWAB 1SG9A 2ZYIA 4HDCA 2APJA 3SEQA 4M22A 3OKAA 5HZGA 3O8RA 1DWQA 3TL2A 3ZU3A 4EHNA 1U7TA 2YYYA 5KB3A 2RI6A 1XEWX 3KPVA 4JEUA 4EK9A 5M34A 1UFKA 3OKFA 1IM2A 3EFEA 1IUOA 1T2AA 3SNHA 1JJVA 3LS2A 1WG8A 1A2OA 1YIOA 1I01A 2OKCA 4X65B 2B4AA 2D0PB 3A26A 3VVBA 2HFKA 1CXZA 3BCSA 4L28A 4MIOA 3RF7A 4IIJF 1GZ7A 3RANA 1A9OA 1AF4A 1Z82A 3MIIA 1C7ZA 4Y9RA 3F8TA 2R6JA 3F73A 4V0KA 3HDQA 4A82A 3E5HA 4Q9JA 2NUBA 1YB5A 4TM7A 1JJBA 3FTNA 4BRSA 1GQFA 5BNTA 2HA3A 3H9CA 2H07A 1KO4A 1AKVA 4BNHA 1FJGB 3OPMA 4IJWA 3ZWDA 3R6WA 1VJCA 2RGDA 4BB9A 5KNDA 2VRCA 2AG6A 1ZVKA 3GC6A 5AI9A 4KE9A 2GA8A 2W6PA 4Y2YA 1WU7A 4RDHA 1NU6A 1Z2DA 3H0KA 2AVNA 4X97A 4L6CA 5I9NA 4BNFA 2RKBA 3EQZA 1Z0ZA 4BJ5A 2O7NA 3H18A 3QX9A 4EFKA 4MDHA 3G2PA 1NPDA 3C6BA 2XMDA 4TX1A 1FL9A 3LXRA 2AIRA 2VNJA 1C9DB 2P5UA 2QN6A 3IAAA 2OAP1 4QECA 1XYGA 3IA7A 1PQ4A 4NP6A 4DSAA 3T1TA 1R8YA 1P5ZB 1SQ6A 3LW7A 2IOFA 2E49A 1L7BA 4KREA 3LRXA 5JWOA 3OU7A 1QG4A 2IOYA 3EXEA 3JQRA 5GY7A 1IN5A 5FBKA 3JZMA 3L6EA 2I7DA 3QX3A 3H6HA 4BLQA 2O54A 3HU1A 3GAZA 3TH5A 3G13A 1FNMA 3I3SR 2ZBDA 3A06A 1AX9A 3MGKA 3Q9UA 4MCJA 4YWJA 5K3DA 5A5EA 2FZKA 4IOKA 1UEJA 5E2AA 1AQUA 3D4IA 1EXWA 2F3QA 3DE4X 2KW5A 4Q1VA 4RQBA 3GCXA 4I55A 5FEUA 4ZQIA 4L02A 3L8EA 4IF6A 3EUWA 4C89A 4MV9A 4QQFA 4B0PA 2J6BA 1NW3A 3K9HA 5DHTA 5FBZA 3VU1A 1T4GA 1QS0B 2VDPB 3D8TA 2C07A 4DLNA 3MRVA 3BH0A 2MT9A 3BPSA 1QF7A 4IG4A 2VOEA 4NPAA 2DQZA 4EDFA 1FRNA 1ZJZA 4N8DA 4J0QA 1EDEA 3JPWA 4RIFA 4Z4GA 5C8YF 2AVDA 4XYEA 1Q19A 3DMRA 3GNTA 3S2UA 1GWNA 2C00A 3HV0A 2BRUC 4IIDA 4IEIA 4LF8B 2ZJ0A 1M2OA 3Q6MA 4O6VA 4P4UA 4UEOA 1G5TA 3J81A 4UXHA 3RYIB 1QQ5A 1YVDA 4P0TA 4PG4A 4CL0A 4WCFC 2JBHA 2W6JA 5CW2A 4BQPA 1VHLA 3UG7A 2CMGA 1GQSA 1E2QA 1OX4A 3BRWD 5LSAA 1PGJA 2XUOA 2GM5A 1GZHB 1T8WA 3JTMA 4R2KA 2Q9BA 4B8ZA 3ZY2A 4BFSA 1UXGA 3E3NA 2NQ8A 4CR6A 2GKSA 3GVHA 4MKFA 4P4LA 2J33A 1ZY2A 2Q49A 5B6IA 2XADA 1R0SA 4QOJA 4BU0A 3ACBA 4N0DA 1DRJA 3L7KA 3OHSX 5AICA 1T6BY 4W9NC 2OBYA 5FT9A 1NZFA 3DFMA 3MUOA 4TV9F 5FTKA 1YZGA 2NVUA 3I2FA 5DTRA 3OIYA 5A06A 2OV8A 1N3LA 3KXDA 2QSYA 4Z7OB 2QMHA 1MAVA 3B2EA 1JAXA 1PWZA 1ULTA 1AB6A 3VR3A 1NI4B 2FUCA 4E5YA 1KBZA 3HJAA 5L51A 5LP6F 1MJNA 2A0UA 1SXJB 2P4UA 1PKEA 4YHHB 3MMZA 4DAOA 4ZZ2A 1UZUA 3NV7A 1W30A 2W83A 1J0CA 1MENA 1NLUA 1A8UA 3CZ9A 4TZTA 3D5TA 3OPYA 4JUAA 4NULA 3GPBA 3TTVA 3JQ7B 3MQ4A 4I0WB 2D2VA 1ZSYA 4N5LA 1KHHA 1PNOA 2ZUBA 3LY5A 5JT1A 1Z2OX 3RQSA 5BRJA 2RGUA 1QOPB 4ZEOA 3RTAA 3T5TA 4MHTA 3SYKA 4ZC8A 4U9UA 1E99A 1DO2A 4QOFA 3JALB 2CFTA 4RSMA 1QM5A 3ANLA 4TYPA 2RJOA 2WSSA 4CCAA 5BNZA 2QN2A 1M6EX 2JF0A 3PFIA 3GDFA 1MZPA 4GDFA 4YMGA 1RYHA 3A4MA 2X40A 4I1OA 2Y1LA 3BL8A 3DZJA 2WTXA 4RLSA 4RSRA 1DRKA 2A0YA 2PR7A 1WA5A 2P3OA 4MDYA 4O2AF 2NAPA 2QYSA 1TEXA 3DMFA 3FLEA 1V35A 5DM1A 3TGWA 1M72A 4CLRA 1YZHA 1RTKA 4G0YA 4PEVA 3JSAA 4AYXA 4MVJG 3DOEA 1T8SA 1NONA 4AKHA 3JRWA 3GJ4A 4JUBA 3U7QA 3V46A 4E3WA 3MJTA 1DS6A 2YR0A 2GKOA 4QHTA 1BFKA 5CIWA 3EXG2 5JIBA 2GXUA 1MIOA 5T4HA 3SBEA 5GV8A 3PEEA 2ZYHA 5DCUA 1PQUA 1QH9A 1GPYA 3GRVA 2WY2D 4CETA 2I8AA 1N2XA 4YMIA 2V7VA 5BYKA 2IU4A 4X3PA 3U26A 1EM8B 3AHEA 3IEXA 4EUEA 2C0QA 5BXYA 3RVDA 3RK4A 3KVNA 3KEOA 1E0JA 1ONNA 3NP7A 4NMHA 4J91A 2WUFA 2XVMA 3UJPA 1YJ5A 3CF2A 3TOCA 4IHJB 2R4UA 3W5VA 2ZIEA 1I2MA 2XCRB 3KEFA 3G2NA 4C6HA 2JH9A 3K9LA 4N54A 1ND5A 2HSGA 5ITSA 2A4MA 1DZIA 1UR5A 4KR0A 5EFZA 3O4IA 4D9NA 5AVUA 1U11A 5LOVF 1Z2EA 4NBNA 3ZX4A 1VYTA 3O1HB 5GM1A 1JP7A 3PEVA 221PA 5BV2P 2C1EA 5BSEA 2B1QA 2P35A 5HKKD 1F51E 1N1MA 2HIMA 1LJLA 1PI3A 4Y1GA 3WO0A 2GXQA 1E2FA 2RHRA 4OJNA 4PZAA 3WGHA 3E61A 4LZOA 3R75A 3DLCA 1EUCA 3RVQA 3SLRA 4EHJA 5I7SA 4EQZA 4U2KA 2Z5VA 4EF6A 4US0R 3CKLA 3DPUA 3WJ7A 4C3ZA 1VLQA 2XNKA 4K0RA 4H16A 1O96B 3OH8A 2JAOA 4D99A 4KFCA 4WN9A 3W4IA 4EY6A 1GLGA 1GGVA 4YTEA 5AK0A 1L5GB 4Q3AA 2IDZA 3ZVKA 2ZTHA 4HLUA 2WTUA 3PUXA 3MBIA 4BQNA 1IY0A 1L7EA 1S2NA 2VK4A 2E18A 2IE0A 3TTYA 4UCWA 1O0BA 4RVOA 4BEVA 1XZEA 3EULA 5LP6C 5AKLA 4XR4A 4PAGA 1BQEA 1YS9A 1Z4PX 4G85A 3WLTA 3W3AH 1CIPA 1X7XA 2AYYA 3BL6A 2WE7A 4RH0A 5A1JA 1XXHB 1HEYA 1RI3A 5IN5A 2E4YA 1JR4A 1UMCB 2YZKA 5DLPA 3KRTA 4LF5B 1PT8A 2PMBA 3N2IA 4JL6A 5HZKA 4UD6A 4G8JA 4CNBA 1M54A 4RJJA 3DOUA 5LQMA 2BV3A 3CF4G 2X5XA 1Y3CE 3GJXC 4LDPA 3ZU5A 1C1XB 3E35A 1C3LA 2PQ6A 3W9BA 2B2XA 1G8AA 2A1UB 4P84A 2WWWA 1U9IA 3T1HB 4F97A 2HT1A 3LDFA 1VKJA 4EARA 3I2JA 4WNAB 5DYIA 2FSGA 3WADA 1NN0A 3ZQ6A 4DIFA 4ITRC 4L07A 2VHJA 3LDGA 2RDMA 3GAMA 3Q7EA 3DSRA 4X3OA 1V8ZA 4AS1A 3TW8A 3THXA 1L8QA 5K0EA 1U3FA 1WLYA 3QZUA 5CCDA 4J4TA 3WL4A 1GM5A 1D2CA 5C1OA 3OTHA 2UYCA 1G41A 3OIUA 2XMCA 4JASB 3DBLB 4S1VA 1UBCA 1ESDA 3GT3A 1L4BA 4ITVA 1IUPA 3ZWYA 3STVA 1ZCAA 3U4GA 1PF7E 1TQ4A 4I1SA 1KZHA 4WPGA 3TE6A 1HT0A 1Y1SA 2AOTB 3NANA 3ZV4A 1N78A 4JJ7A 2HYIC 3PQ4A 5HKLA 1A95A 3TRFA 1PS8A 1L7AA 3OURA 1JG6A 1I6LA 3VNVA 3T5CA 2VZLA 2PGXA 4MYUA 5KKNB 2COEA 4RH3A 1G5QA 2E1RA 3W8FA 3QIAA 3D3KA 4F2WA 1LJUA 2A9PA 3DA8A 1ZCBA 4EW3A 3ZTTA 4C7MA 2RB5A 4Z3OA 4PM4A 1ZM7A 2ZRKA 5EZ5A 2UZ1B 4LTDA 1JIKA 3C6QA 3R7BA 4EJSB 2A3RA 3MTIA 1N6OA 4FJ2A 4KMOA 4UHBA 5AHWA 3C3AA 3O75A 1SVIA 4DQUA 5ECWA 3ZGYA 4GRIA 2G4VA 2NVWA 3RKRA 1V4NA 3H2HA 3MMSA 5C37A 4AW9A 5LQAA 2QRLA 3HCNA 1O9GA 3OEEA 5DLQC 1IZYA 4AI6A 4JYPA 4GL2A 4PZYA 1NUUA 5KYGA 2VJDA 3NWEA 3D2CA 2QTGA 2J59A 4YV0A 4BNJA 2W6ZA 2ECQA 3IT0A 2PQ2A 2MYPA 3I6IA 1SG0A 5JO9A 2PAFA 2I78A 2JARA 3HCWA 2PZMA 2IYNA 4U7DA 2HYDA 1T5DX 2C4HA 1N2OA 2CD7A 3BFJA 3M5WA 1I1NA 4Z0TA 3S1AA 3VAYA 3VZPA 2B1GA 4GM4A 3OQJA 4LHYA 1VG8A 4RKEA 5ALJA 2FG7C 5KOJB 3D4NA 1OXMA 1PQPA 1V48A 3UWSA 5CDFE 4DA4A 3VKUA 3WRYC 3I8OA 3P94A 4QXPA 1AGYA 1PSWA 4BVKA 1DDGA 1BHJA 4D3SA 2H1WA 5DYGA 2CDAA 3NIGB 2IH5A 4QDTA 1Z38A 2O3RA 1FVXA 3O3CA 3ADOA 5AJWA 1UZNA 1X7ZB 4YROA 3ZGOA 3OKCA 1AKYA 2OECA 2YNMC 3RBXA 1WXHA 2H63A 4A8TA 1PIWA 2GH1A 3K6RA 3KXKA 4NSNA 5AKYA 4CNQA 4UDNA 4U0JA 3MHTA 3JZDA 3KP1A 2IEDA 4JYMA 2JAXA 2X4GA 5CVVA 5EA2A 1KDTA 2NU8A 1K8RA 1ESNA 2XT0A 1S0UA 1USUA 3HUFA 4OQXA 4PZ9A 4IX9A 4TN1A 4L22A 1WMBA 4JIGA 4U02A 3RUPA 4NJEA 3BVPA 3DMGA 4Z7JA 1X8JA 4FEYA 1TFRA 5HCUA 4TXMA 3ZJ4A 5C52B 4TLMB 1VJ1A 2ZQYA 4N0MA 5BSMA 5SYMA 2QV0A 5CA1A 1JDBC 4JI3B 3CO0S 1M9NA 3HR8A 4ILEA 4ZI5A 2EXXA 4B32A 1NVKA 1R6UA 4JBWA 4CV1A 1M83A 1ESCA 3NDJA 1ZUD1 5TNXA 2NTYC 4RD4A 1B3BA 2DPLA 2OKGA 2AW5A 3G1UA 3CUWA 4EYSA 3R7NA 3D6AA 4A6EA 1Q57A 4X00A 2I6UA 3PA8A 2J46A 3TLGA 5E2BA 5F1PA 2PPLA 3Q9SA 4F6CA 4MPPA 1U1EA 2BGGA 1P2TA 3BMNB 1XD2A 4H08A 5BVHB 3ZJUA 4ZVNA 4P32A 4FYPA 3PHBE 1SZCA 2I1LA 4KE8A 3WNZA 1G3QA 3LFUA 2JHPA 3AOGA 4L5AA 2H2GA 3QOYA 4RPJA 2EBWA 4QATA 2H65A 4O4HB 3RDPA 1B73A 3K53A 4ZU6X 2JJ2A 1LF0A 1OZHA 2BZ1A 2D1QA 5CVCA 4DT1A 4LQCA 4Q4JA 1FVOA 1F0YA 3GNLA 4RHEA 4ZMRA 3E7DA 4AKEA 3TLXA 1JECA 1JH8A 1YCFA 2DBYA 4S1OA 3I05A 4PG6A 1RDFA 3PLRA 3TIGA 2FF7A 1OKKD 2M6LA 4EMUA 1AGNA 4HLNA 4OM7A 1ELOA 3AVPA 2WRZA 5EC8A 5ALLA 1Z26A 2WJPA 1J2YA 5EKTA 3WBJA 1LPPA 3D6JA 3L6CA 1UDWA 3I4CA 4R41A 3VPXA 3SHFA 4P5EA 2WD7B 2PYDA 3PXUA 4HH3C 1PYDA 1XZCA 3D7RA 3ADKA 3M6UA 3KEQA 1KU0A 2PX3A 3KQVA 3K3PA 3DD1A 4RA6A 2WAOA 5HFNA 1IBMB 3ND7A 4BEWA 4E6PA 2PCLA 1L4FA 1OC4A 1GG5A 4DLYA 1FC0A 3ESBA 3PLNA 4A2WA 4M8KA 2P6MA 3NJRA 1WQ3A 5A5GA 1G8JA 3T99A 5HRUA 4CEJA 3G9UA 5J1SB 1A3CA 4WACA 3WNCA 3UICA 2QTTA 3HUUA 4B2LA 1TM1E 2X3YA 3ETJA 1U0SY 3UJBA 3IE1A 4RZHA 2FPGA 3KQUA 3F67A 5TLSA 2R5WA 4PX2A 2PG3A 5F3DA 3SF8A 3RTBA 2F4NA 1U8EA 1QYRA 5TEVA 3U9TA 2J3KA 5CGZA 16PKA 2ZK7A 4RMHA 3EAGA 2O2YA 2GOYA 1IMJA 5CFPA 1RC1A 4BWYA 4LYEA 4Y18A 4CKWA 3I9NA 5KSYA 5FADA 4KQGA 4M8LA 4G0NA 3UXMA 3GPCA 2HFJA 5HM8A 1RYFA 2QDKA 3BE4A 2ZT7A 3PL5A 5D00A 1FEZA 3NEAA 3H2SA 4ZYWA 2Y0PA 2BD0A 2PD6A 2ZBUA 4U6SA 4EFMA 3UQZA 5FOXA 1VI2A 1Y3IA 1PUJA 1TL7C 1NMQA 1YZYA 5DXFA 5FIUA 4TWJA 3AHGA 4S35A 1AT1A 2B37A 2N0SA 4P1ZA 1EHIA 2Q6OA 3EMDA 3I92A 3PG5A 5A05A 5IHPA 2VDUE 3Q12A 3TM4A 1ZICA 4QBKA 4PRZA 3NHMA 2YMLA 2R1VA 2XR1A 4L5IA 4XIGS 3UK0A 1GVHA 4HNVA 1QHFA 1C4KA 1ZONA 3DTVD 3U49A 3N87A 1EXVA 3E48A 1IJFA 1GQOA 4PHHA 5B2EA 1JB9A 1HDXA 1L5HB 3I6BA 1QGOA 3QFHA 2Z2YA 1F2TA 1T36B 2C3MA 4GLFA 4F2HA 1BMDA 5CT5A 1QFZA 4WL0A 1SIOA 1MO2A 1ZNWA 2HDOA 3GCDA 4K2AA 3ZV3A 2X2EA 1G8SA 2AE2A 2FG5A 5TQ0B 3X44A 3F3YA 5AVRA 4YRSA 1KQGA 3O4JA 4JEHA 2F6RA 3ZGLA 3BKXA 3GLFB 4BGVA 1VSBA 1IY2A 4TYMA 2D54A 2IPXA 3UOAB 1H66A 1RXIA 1QV9A 2OHFA 1KZ4A 3AFGA 4LV8B 2VHYA 1FX0A 4KI0A 2WQ6A 3LKZA 5CIYA 3I5XA 1WU8A 3DV2A 3QKRA 4ZOQI 5ERYA 5EFOA 1TJPB 5D1NA 4DS3A 5HK9A 2BSAA 5KMGB 2C2GA 4F5ZA 2QTLA 4PR3A 1KYZA 3AZPA 1U3TA 4V39A 2G7ZA 4ZVUA 3T0IA 2WFMA 1H23A 3QEMB 1YBAA 3ZE8A 1B16A 2HD4A 3KV1A 2C92A 3TRHA 3MC1A 1A7AA 1ZR2A 2C4WA 4PLHA 4RUKA 3PWSA 2FZLA 3LT0A 3CFYA 4DB2A 4L8WB 2JIZA 3LRPA 5J4HA 1B8NA 1DHRA 3ZD6A 3EC7A 1QTNA 2PBRA 2K7ZA 1E1QD 3N6XA 3HSKA 5IT9A 1ODFA 5AM4A 2QRPA 2FSSA 3QW4B 3DE5X 5L40A 1I80A 2IYLD 3DVSX 4J90A 4RV4A 4CM8B 4C7OB 3U16A 3RYHB 3ZKWB 1A1VA 3LCUA 2W00A 3V7WA 5AKJA 9MHTA 1EUDB 2GBCA 3DDHA 1YI1A 1TM4E 3SQMA 1G7CA 3HUTA 4FSXA 3HBFA 1S1MA 4PSVA 1SURA 1BS2A 4FB5A 2OSVA 2YWCA 3GGJA 4C01A 2D6FA 2FN9A 2Y99A 3L5KA 4I50F 5DISB 3KZKA 4S1NA 3TLMA 1L7OA 2FN3A 2F1IA 2GTPA 4B74A 4D79A 5HX7A 3H97A 1C1DA 5GM2A 2DQYA 3SD7A 4M53A 1K4YA 5LM3A 2IBMA 2CT8A 2Y05A 1ZD3A 3IR6A 1PG0A 2I65A 1SOMA 3CN9A 4TL6A 3WSVA 1IQPA 2VQSA 3GJ7A 3V4VB 5DSXA 3GUUA 1XROA 2ZSAA 3CEHA 5HIJA 2IITA 1E9AA 1IPEA 3FR7A 4AQDA 4YAEA 1RMYA 1RI4A 1Y48E 1NBWB 3T3PB 2Q3HA 3VPGA 1H69A 1NSTA 3ELWA 3NT5A 2PMEA 1TJ3A 3RS5A 4B4DA 1DCTA 2C2ZA 1ZGGA 4F4JA 3NOOA 5ADWA 2FR0A 1J0XO 3TKLA 4M49A 1FFXB 2FAXA 4KLRA 1E2NA 1YE8A 2WZBA 2W22A 4FOTA 4NG4A 4JLVA 3P0RA 2OCLA 3J81k 1OI7A 1RR6A 3IGFA 4N7RA 1SD5A 3Q9LA 3H8JA 4LV6A 4PPGA 4WNIA 3V8PA 1E6UA 4AFNA 2HR1A 1VG1A 2ONKA 2X41A 3IILA 3N7UA 4G1FA 4TV8B 3QKIA 2FHSA 4X44A 1Q17A 4ZOBA 5F1OA 4A10A 1D3AA 1THZA 3MK31 3H87A 4LDJA 3RIEA 3JU3A 1FPQA 3KYCB 4Q37A 4G0PA 1DAKA 1ZAKA 2AFHA 4IOLA 2C94A 2N3ZA 1WETA 3IEMA 1D6NA 4LRUA 6Q21A 1HK7A 2VSOA 3UWMA 3I5YA 4LRXA 1U1IA 3ZHVA 2G70A 1SR8A 4O3MA 4HGNA 4XH9B 1A50B 2OO3A 3HABA 1BDBA 3PFHA 3QP9A 4G5HA 4OHWA 2YS6A 4YRKA 1D4ZA 1PR1A 2RHDA 4WQMA 4DBLC 1Y7IA 3ITEA 1YGYA 4OLJA 4GZMA 1S2GA 1YS7A 5ANRB 3BRSA 5IF9A 1JQ5A 1L5VA 2J3JA 1A8HA 2EYQA 3MGBA 1U2DA 1Z74A 5E4JA 5H82A 4H7KA 4EJSA 3OTOB 4MS1B 3I6MA 1S8FA 2P67A 4EG1A 1U31A 1TFUA 3WK6A 3WGGA 3PKJA 1RZ3A 1YRAA 1SHKA 2BEVB 4QBHA 4PQYA 4N3CA 4H31A 1XHLA 4Y1RA 3KTDA 1WSDA 1XJ0A 2FZ4A 2XSZD 4MWDA 2J4DA 4BKQA 1HBJA 3W8NA 1EJBA 3RVPA 4JROA 5CX1B 1BVRA 5C5IA 5KQPA 4XI9A 1ZJWA 2J0SA 2DERA 1KEVA 3GFOA 1X8LA 2W6ID 1KK2A 1SHLA 1QP7A 5KNDH 4RANA 3R3XA 1B42A 1G98A 4URUR 4B2IA 2F64A 4I4CA 3GUVA 1SBQA 2W2VA 3VGPA 3OKPA 3VUFA 2WJJA 3ZEIA 4NYJQ 3ZW7A 4EG3A 4B3TB 2O2CA 3LUFA 3ROGA 1UBRS 1T2FA 3BK2A 3GRKA 4MUIA 3FIJA 4DCVA 3GVPA 3PCRB 1C8VB 1GQYA 1XEXB 3N8DA 4JYZA 1VLHA 3THRA 2W90A 4KQKA 1JIIA 4XTCS 3CX6A 4JDPA 3CWQA 5CG1A 2YYSA 1KETA 4DCGA 4L4SA 1DPGA 3IODA 1ML3A 3KQNA 4YAWA 3EPJA 3T4XA 3Q0IA 1HYBA 1G21A 2X1LA 4K26A 4R7GA 4EA7A 3WIDA 1DXOA 4IXDA 2GPBA 3CM0A 3DOHA 5JPCA 4Y6SA 5I4BA 1YUMA 3EWNA 3KLNA 3GGSA 2FX5A 1MGOA 4I9NA 1P61B 1RQ2A 2QAGB 3WBBA 3U61B 1AK1A 2HBRA 2MTBA 2R1ZA 4QU8A 3R7WB 3AVOA 4CCYA 3L6RA 1IN6A 4FIDA 3KQOA 2Y68A 1AHIA 1WLSA 3AL3A 1OR8A 4JBNA 3EPHA 3R9XB 3OVMA 3T8YA 2ZRJA 4W99A 3L46A 4Z86A 3USCS 1UT6A 3IVMA 1SKMA 3G2IA 1MAWA 2Z5GA 3EFHA 1Y33E 3LHIA 4FYWA 4OK6A 4QGHA 5DNWA 4UTXA 4LF9B 3Q1KA 1X8XA 5KQLA 1TT5B 1G3MA 5LU9A 4QEKA 1SK8A 2QOEA 2XXBA 4RK4A 3SFZA 5E3IA 3WTBA 1ZBDA 3NAMA 3B3JA 3R5HA 3EZ7A 2F8LA 1I4EB 1M8JA 3R5TA 5DK4A 4BQOA 4E5DA 4EJSC 5ARDA 4OO3A 2I62A 1VI5A 1TKCA 1JRLA 1XB2A 3BHIA 4MEJA 1ZMOA 4REOA 5ERXA 5I9BA 4AROA 1T9DA 3ABSB 1LLCA 4UHFA 2C9YA 2VJMA 2WA1A 4ARVA 3A6LA 3O8LA 1XTUA 3M70A 3FUUA 2IXAA 3IUNA 2FR8A 1UJ6A 4O4IA 1ZC4A 3VU9A 1WF6A 5KHAA 4DMKA 2G82A 3BC1A 3PUZA 3TNDA 5KTPA 4F8JA 1NBIA 2QDXA 2QKYA 3PEUA 3UHAA 7REQA 1SY7A 4WK0B 2R60A 1UK9A 3ZW8A 1KRWA 1PEKE 2QXTA 3QLUC 3ENWA 1YS2X 2PSJA 1QP0A 3KVOA 1DJNA 4AJJA 1HI9A 4ZVSA 2Q5HA 4I6GA 3LX6A 2QWXA 1RNLA 3SNKA 4QQKA 2ENWA 2ZWAA 3TLZA 4D6YA 2HEIA 2W43A 2P2CA 2UZ0A 1O87A 4DYDA 1UEXC 3DFUA 1AKRA 3M7IA 1EFHA 1DEKA 2JCGA 3KTAB 1B14A 2Q8NA 1SZPA 5FTJA 2Z8ZA 4CL3A 4ZCIA 4QJ3A 5D7NA 3IEVA 1GR0A 2AN1A 1N5LA 3NONA 4YHBA 1W7AA 3W05A 1A4XA 3C0KA 3ED5A 3NEJA 4AY2A 3B85A 3E5RA 4CMEC 4XM1A 4C0AC 4EA6A 4DIEA 4FI3F 1MKYA 3FVVA 5DCLA 3Q8WA 2G1KA 4FONA 3E9ZA 3QVKA 1E9RA 4E13A 4ZCLA 1TVMA 4YT2A 5HJEA 5JDIC 3N6RA 2QT9A 1HEIA 1ZGBA 1N0UA 1I5EA 2NTNA 4GPD1 3V6LA 5KYKA 3WYGA 1SWWA 2CL5A 5I7UA 1GTG1 1CY2A 1ZA2A 1U8TA 4QEDA 4OIFA 2WAXA 3AH8A 3AKDA 3HRHA 4IZHA 3IUYA 3MWGA 2A6PA 2FP4A 2AWOA 4AIRA 3GDHA 3HWSA 3NNSA 1CIJA 5FBQB 2QZJA 5GTDA 2GETA 1RMQA 4R69A 1ZD4A 3SSOA 2RGXA 2PEZA 3UHPA 5HJ5A 1YT5A 3G0BA 3U7FB 2FMFA 4O8ZA 5ALXA 4KR9A 5IUJC 1KSGA 2REOA 1K0UA 1QDUA 1Z7EA 2RI0A 4L8VA 5KUTA 2NUTB 5KOIA 2PA3A 2R4TA 3MRSA 3RIHA 2IV7A 3UGTA 4BATA 5JJBA 3B6KA 1PK9A 2Z0MA 4EMSA 3SYNA 4RH1A 4CIYA 1TTQB 4GPEA 4IFEA 2P9TA 5LZ2A 4DRXA 3FTFA 4HGQA 3BE8A 3PE6A 4ALJA 4DCSA 4IH9A 1E7SA 1NW5A 4GBED 1MRNA 2O0LA 1IG3A 4GX1A 5JD3A 3WLLA 1U28C 5JXGA 4NE2A 1OAAA 2O2DA 1VLMA 3WHLA 1Z4KA 3BOSA 4EHLA 4QVIA 4HGOA 2B8EA 3ROXA 3ZWWA 4DLWA 3TRIA 2VEOA 2AFHE 4IVRA 2DJIA 4DDUA 1RS0A 2A84A 2IF2A 3RUAA 1SJ9A 1N57A 1NW4A 2JA1A 1WABA 2DBQA 3SX2A 1Z4MA 2D7DA 2R1TA 3A05A 3NU1A 2RJNA 2RHLA 5FUBA 4R98A 3UA3A 4KR7A 2FUKA 1B6TA 3DEKA 4ETIA 3T3NA 4B76A 3M89A 1KGDA 3EUEA 4ACBA 4BNNA 1TPYA 4BKOA 2A7QA 1DEXA 3DXXA 2YX1A 1JBKA 1FSSA 3N6VA 2Q3LA 4JLUA 3VVMA 3P2OA 3GUZA 3O2QB 2ANBA 2FE4A 2NZVG 3NUGA 3N2GA 4PPNA 3BRWA 3BFPA 3WKEA 5EZYB 4MMZB 4PLWA 4DWJA 1E9SA 4HWRA 4IIVA 2CVQA 4O4JA 3FYUC 3OECA 4GQBA 2I9PA 3V32A 2PKRA 1CRQA 3SHWA 2BMAA 1FDWA 3GLHB 3AFOA 4G56A 1T4CA 2EYUA 1E2IA 1QH1A 2XYQA 2LNDA 3I39X 3QE3A 5CYOA 5E6SA 5B3KA 1VLVA 4EY4A 1DARA 4EUKA 4GOXA 4P7GA 4G97A 3AVQA 4QBIA 1U2GA 2V6MA 3WICA 1F3OA 1QGZA 4MS3B 4AK9A 3IAFA 1TDJA 3U81A 3CXUA 5GONA 4ZKEA 2Q5IA 5BUZA 3TZ6A 2QP4A 1QTQA 1KEWA 4XAQA 3FTEA 1XCJA 2PT9A 4G1VA 4M0FA 3FNIA 4RTLA 3AFNA 2OHVA 3RVKA 4A0RA 5I7WA 2MMGA 2QT0A 4W8GA 3NHSA 4C4YA 3U4HA 3OUUA 1XKTA 3L4KA 4IS3A 3GROA 1V9SA 3L01A 3K9GA 1H2XA 1NVBA 1V8OA 1W49A 2JKYA 2PH1A 4G9EA 4K40A 3FZQA 3O21A 1WMEA 2CVOA 3FPSA 4W8OA 3RCBA 3RC1A 3VR4D 4BFXA 1YE5A 3MSXA 4IVPA 3LUBA 2PJDA 5GOTA 3WYNA 2G77B 4IQ0A 1OJ7A 4OB7A 3M3PA 3RIXA 2BHNA 3JQBC 5LLSA 3KOYA 3M5PA 1TXGA 1SIBE 1PNRA 1G1MA 4Y0NA 3G7UA 3TTWA 4DQ0A 3UXHA 5I01A 3LYLA 4RMJA 1R0WA 1WCV1 2OBXA 2GXSA 3KXLA 5K3CA 2WP0A 3BGWA 4BNLA 2VPPA 2BL4A 5F3RA 1JKJB 5D3MB 4FNMA 1QE0A 3RSFA 4DUZB 2K5UA 3FCAA 1AB5A 2GASA 3E9EA 4ODIA 3AR4A 5DYTA 2BMVA 2Q9UA 3VI3B 4GI5A 4B7UA 2PKXA 4TRRA 4BO9A 5FQOA 2H2WA 4BMXA 4MW1A 2HO4A 1MB4A 1PZHA 2C9DA 4HATA 5JNUA 5F21A 4G09A 4F9TA 1ZFNA 2C31A 2UU9B 1JQJC 1NN1A 3AM3A 4KAXA 3AHIA 1DEOA 4KK3A 2F43B 1Z62A 5J3JA 5DMXA 2JVIA 1XVAA 1W0KD 2IIPA 3QLJA 3V3TA 4D9EA 3FN4A 1H0HA 4YLGA 4N7BA 1PFQA 3GNSA 1KSJA 1L5SA 2FWRA 1UDBA 3BEOA 3F4BA 3IO5A 3LGAA 3PC7A 3QI7A 5KYVA 2IYTA 3ITNA 1WKCA 4MQ6A 1GRCA 1OLSB 3ETLA 3W1EA 4KMMA 2DWPA 3VC7A 3I4LA 3KU1A 4GE0A 1FJHA 4X60A 5KYXA 1DQZA 3Q1LA 2CL7X 2VP5A 1ORVA 1ZN8A 4ZEXA 2PMCA 3DEHA 5IJ0A 1I0IA 2Q4TA 4ZYTA 2JFWA 1D6MA 2NYAA 3HI6A 3JZFA 5FORA 4D2IA 1U04A 3OJXA 5BSUA 5J2UF 1BXZA 4IFIA 1KOGA 2VDLB 4D0SA 2F3TA 3UT0A 4XWTA 4UMDA 4EG4A 4FYVA 1ODSA 2DG2A 2G08A 3NXKA 1OFGA 1UXJA 1ZN7A 3N53A 1TAGA 2WUGA 2YVLA 3PDHA 2H4FA 3T12A 3TI7A 3W6PA 4E5VA 4AKIA 3L5OA 1MRSA 1QBGA 2JEYA 1OHHD 4KITB 2CYBA 2YV5A 1M34E 2PZFA 4Q9LA 2A0KA 4JR1A 3ZH2A 2E4ZA 1T9AA 3WNDA 4EHAA 3GDWA 1KSFX 3D8BA 3DYIA 3FPHA 3JYOA 2AL7A 5LMNB 1LBIA 2ZR0A 4MMYB 1GAEO 4WESA 5ALSA 4IWNA 4HJXA 1FU4A 4KVFA 8ATCA 1GGEA 1SO8A 1V7ZA 3UZUA 2JG3A 2EZTA 1D2HA 3ZWVA 1OAKA 1XRRA 3WGYA 4JHXA 4RPGA 4DWVA 1L4LA 1ZVJA 2W2OA 2ZYVX 2PM8A 5FOQA 1DBWA 3IAM6 3EUFA 2J08A 3IURA 3SC3A 1ENYA 1H9AA 2FPIB 4UAUA 3S44A 1LX6A 2BGJA 2OHOA 1E7MA 4FX2A 2HTFA 3VAZA 4TLEA 2JLSA 3NYWA 3SC4A 1PNVA 3QEAZ 1Y1RA 1JLLB 4AAYA 4OGKA 4X1IB 1RT9A 3NOXA 5B53A 3G9TA 1WPQA 2CZCA 5DEOA 3V4ZA 4N0QA 1Q1QA 1FTWA 1A97A 1Z4JA 3BSYA 3CRVA 4GSLA 1WUIS 5LB4A 3RH0A 1E66A 1ZW6A 5I7AA 3AF2A 4HAOA 3I9KA 2C7PA 1IN4A 3PHLA 5JRZA 2PXCA 2Y1EA 1V5GA 1K06A 3HYRA 5KOYA 2OZLA 5TVGA 1HA3A 3BT7A 4PXAA 1X42A 4BXOB 4KAJA 3WGOA 2UUCB 4MWBA 5L7YA 2XI4A 3O7MA 2HN9A 1JJIA 5CDGA 5BMVB 3KSMA 1S4QA 5REQA 4ZPJA 5DNYB 1VE5A 3W2FA 1YI0A 3UMGA 5KYWB 4AZWA 3PWZA 2PS3A 3R74A 4JI8B 3A2LA 5CDTA 1TAUA 1HQKA 2WE8A 5CIQA 2E7ZA 2QMYA 5ADVA 4NBSA 1JR3D 4YAIA 4CL2A 3INTA 2OA0A 3P9ZA 4X6YA 1QZ3A 2JHFA 5BURA 1PZNA 4UHJA 5EKSA 4OL0A 3V1YA 2I4TA 1HV8A 2PL9A 1K3UB 1QLHA 1Q22A 2CB9A 4EJ6A 4ZGWA 4PYLA 2QLBA 4UE2A 3OJOA 3QOXA 3I5UA 5JLAA 2DTEA 2YY5A 4ZAZA 4AZ3B 5EKUA 1FF9A 3DDOA 4I6JA 4S2UA 1VJTA 1ZVMA 1IOWA 5E6RB 4HVLA 4HXGA 4YQYA 4FOPA 5GP1A 3BAFA 3KR0A 4Q93A 3U7IA 3ADCA 4YXWD 4BLPA 3AXSA 1A9XA 3TWOA 3E3AA 2DXIA 5CTAA 3O90A 2IHTA 2AMLA 4ZFNA 2AW3A 3LDUA 4H7PA 4TWRA 2WOOA 4TTRA 1A88A 1WZNA 2XWBF 3DLPX 3HN2A 2IDKA 5CT6A 4A1FA 5KWSA 1Q21A 4A0GA 3ERCA 1GA6A 4NZMA 2AZ4A 3EBOA 1DFGA 3PDWA 5CLFA 5ALMA 4MO9A 3WGJA 3N8GA 4DR4B 3G0GA 2H1IA 4YJ3F 2OFWA 2IYWA 3IOEA 3THOA 1R37A 1E4EA 4AYTA 4DV1B 3UAVA 1IBKB 2BVNA 1WBJB 3SKXA 1CR2A 2JJMA 1FUIA 2C8JA 1O4WA