4JX9A

Crystal structure of the complex of peptidyl t-rna hydrolase from acinetobacter baumannii with uridine at 1.4a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606 = cip 70.34
molecule tags Hydrolase
total genus 62
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4jx9A00
4JX9A 4Z86A 4JY7A 4QT4A 4JC4A 4OLJA 3TCKA 4FOPA 4IKOA 4LWQA 4DHWA 3TD2A 2Z2JA 2Z2KA 3KJZA 5IVPA 1RYBA 4JWKA 5EKTA 3KK0A 4FOTA 4YLYA 3V2IA 2LGJA 3OFVA 4FNOA 2Z2IA 5IKEA 4ZXPA 4FYJA 3VJRA 2PTHA 2NAFA 3NEAA 2JRCA 3TD6A 3TCNA 4ERXA 5IMBA 2MJLA 4HOYA 4QAJA 5B6JA 4P7BA 4DJJA 4QD3A 4QBKA 3P2JA 1RYNA 1RYMA
chains in the Genus database with same CATH superfamily
2W6OA 5DISB 4I1PA 5BWLA 3QPVA 5L7YA 5J47A 2G6TA 4KH0A 3QVUA 3ANTA 3C7DB 1R6DA 4RK4A 3NGLA 3A37A 3DE7X 1W96A 2AEMA 2YWDA 1EVLA 2GJ4A 2LWIA 3VPDA 3UAOA 8LDHA 5K6AC 4Z7NB 5F77A 2OMEA 4B4WA 1PJ2A 3GGDA 1QS0A 1V48A 4P4GA 2NOAA 1ZISA 2FLWA 3B70A 2W6JA 4XX0B 5KTTA 1H2FA 1O4VA 1WB5A 2ZDGA 4OD0A 2G63A 3IX7A 3OTQA 2PSHA 3UANA 3OD1A 2CHFA 4FMPA 4G4JA 5ELXA 1K88A 3OQ1A 3ZG6A 5C8ZA 4E5UA 3MJSA 1W0JD 5DIFA 1FB5A 2ISSD 4ZAZA 2R66A 4BIIA 1W48A 4FKZA 4XWOA 3NPAA 2PM8A 2FZLA 4Q9AA 1SBHA 1AKNA 5AKGA 2DFKB 3SI7A 1YZVA 3LC2O 3HI6A 2C4KA 4FCWA 4TKLA 5AHRA 4EUNA 1XVTA 2W2NA 1LD3A 4YP0A 3U13A 4XTCS 2FSVC 4FB5A 2GR9A 2XOKA 1QIDA 2AFRA 5GPBA 2XB9A 3IDFA 2PX2A 4MQFA 1ZVVA 5GV8A 4PPFA 3CX4A 4A03A 1BVYF 6ADHA 5BWNA 3G2IA 4WZZA 1I2BA 2OBNA 3B6MA 4BECA 1W2HA 3U09A 1ZCZA 5JZ9A 1WPQA 5C51B 2ID9A 4DRZA 1BS2A 2GN2A 2Q9CA 3OICA 1KYYA 3VPGA 4AMZA 1TC2A 2UUPA 1G3RA 1WS6A 4Y7CA 3JQQA 3U7JA 1U7HA 1E2NA 5E6UB 3JZIA 2JFPA 3L0OA 3OHMA 3RC9A 4BE4A 4L1KA 5DM4A 5KHAA 2E1RA 2BR4A 1U8YA 4G09A 2QPOA 4LJAA 1QRTA 1OD6A 3KRTA 1LWOA 1X7DA 4BO0A 1WOYA 1G7CA 5EVJA 1XYGA 4O8ZA 4EX7A 1QX3A 3LA8A 4OXKA 4Q3BA 5DK4A 3HL4A 3MTAA 3V4LA 1P80A 4C29A 1I5EA 1P0MA 4CLHA 1ZGBA 5FBQB 4FR0A 3NVKI 3L7YA 4M8NE 1XZCA 4UDNA 4XB6B 1SH7A 1T4MA 1PF7E 2XLCA 4E1VA 5FPKA 2WFMA 2JAXA 4JGGA 1KDOA 3VV2A 4ZT6A 3EXFB 1Y6JA 3WMXA 3C0KA 2CBGA 1F8XA 1I4EB 3DMTA 3MJCA 4WERA 1CZRA 2NM0A 4BMSA 1HO3A 3G5MA 4DDTA 5IF3A 2HLDD 4G1FA 4AQYB 3A3KA 4LZOA 3K1AA 4KQ2A 4BQSA 3PQEA 1HORA 3NCTA 4ZVTA 3N53A 2XWPA 4YLGA 4C4AA 4DNXA 5LSAA 5LYJF 1I8TA 3KSBC 3CUUA 2O7SA 1EVZA 3AL2A 1NI4B 1NXPA 4EENA 2N42A 2QE6A 2VPIA 2XUOA 1TM4E 3DUFA 3HG7A 3JWGA 1AGPA 1KBQA 4PS1A 3Q7QA 1C0LA 1MJNA 4Q3LA 4PO3X 2V45A 4GEGA 1R0YA 3KALA 1Z63A 1MG5A 3M6WA 1HTBA 4IIVA 1J97A 1FJHA 2BEUB 2GK7A 2HMAA 3BK2A 3BWBA 4E5VA 5A9TA 3KDPA 3TQQA 1L8OA 2AKYA 2BFDA 4FLFA 1EKXA 2R8ZA 3ESCA 4ETWA 2Q6VA 2PD3A 5JISA 2PVPA 1TO2E 4KXMA 1DBWA 2C2KA 2FPKA 3L8GA 4PANA 4EB6A 3IBTA 4Y0NA 3GRCA 4W1QA 1FDTA 4EB8A 4YGXB 3BMCA 3PGJA 3MS7A 5ABPA 3DPSA 4MS1B 4C2TA 2G4CA 2R8BA 1U0RA 3IKJA 3PWSA 3VNUA 3EBPA 1FLAA 2VJBA 4M0EA 1T13A 1PQWA 3HYCA 4JEUA 4NEGA 4PLFA 3V9PA 3I9V6 3KIPA 5HKOA 3VGJA 3PIRA 1YV9A 3PFKA 2OTCA 5FX2A 4KXWA 2W48A 3JQ8B 2VI5A 2Q99A 1VRVA 1IZ9A 2P1ZA 3P9CA 4HQ6A 4F8YA 3ZDEA 3HPRA 3ADOA 1OFGA 4JODA 4B33A 5GZ3A 3GJSA 3R41A 2GT1A 2ORVA 3TW6A 1XLTA 1QB8A 1OR8A 2C58A 3AM3A 2ISQA 1A27A 6REQB 4X0EA 1V7CA 4UBIA 3KQUA 1P44A 3O4FA 2WTUA 3SWWA 1XZNA 4KUHA 3HDGA 2VJYA 4NP6A 3STWA 3EF3A 5B58T 4B74A 2A0YA 3E23A 4G37A 3RB8A 2HYDA 3L77A 3A3OA 4ZEMA 4F4FA 2GO1A 1PDVA 2VUUA 1L5FA 3QWFA 1RIIA 3AOEC 3NYWA 4JBWA 4BVFA 3TNLA 1BQEA 4HX9A 3I61A 2NSHA 1E1QD 3JTMA 5T5QA 2NQTA 1QFZA 5G0SA 2CNWA 3WKCA 1WCIA 1DUSA 4FIZA 1QGZA 3I9KA 4TMTA 3P9PA 4BB9A 3SOZA 1T15A 5FEUA 3C6QA 1L4FA 3C1AA 1CR4A 4JBIA 4AG6A 2DWCA 3C6MA 4EJSB 4AS1A 4ND1A 1KZHA 1FIUA 1PZXA 4MCHA 2AI2A 3KAKA 1XA3A 2NPIA 2ZOSA 5B36A 4LS3A 5CFRA 1V16A 3FDZB 3PYMA 4NBRA 1AKQA 5A5FA 1R7RA 1N7JA 2CLMB 3BA6A 4MSUA 1XC7A 2R7AA 4ME6A 4D1YA 1KH2A 1CEQA 2IZ6A 1U9ZA 3Q88A 4QQNA 4RHUA 5ENZA 4DQXA 1MQ8B 2CV0A 2NO1A 4ZOBA 4AW9A 1KMNA 2Q0SA 4JU8A 4HRVA 2HQ1A 5HOQA 2GBPA 4AMGA 4LFAB 1UXKA 4LI3X 5EJIA 2YV3A 3WNDA 3ZXXA 4BUCA 1GSHA 2ZSDA 3CQ9A 4PZUA 1I2MA 2I29A 4HYQA 4KOEC 2AXQA 3ER8A 2AFIE 1TZJA 1RWOA 1SGWA 2NTVA 4X7BA 5JLJA 1E3WA 2Y6UA 2NYUA 3C87A 3Q3CA 3ZUGA 3F1LA 1TVCA 4O2AB 2A5YB 4QQRA 3HB0A 2O54A 1YRQA 2ESRA 3E82A 3PR1A 1T5SA 1RBYA 1RPNA 2YRFA 2DP4E 2G4LA 3I5UA 5LKRA 2FZ5A 4FBLA 1Z38A 1KK0A 4AKGA 1ZW1A 1PL7A 5EKTA 4GUAA 2JIOA 3IBGA 5JXWA 1UDRA 5K01A 5TVKA 5JVDB 1A4RA 4NZ9A 4NU5A 1X2BA 1YA4A 4HHEA 3SBDA 3N9IA 4E08A 5AW7A 4D3FA 1KPIA 4NDZA 2O3JA 1U2GC 1ZAKA 2BVNA 1LSOA 3FPHA 4AC9A 1XJ5A 1H0RA 4U2DA 4D25A 421PA 3OQNA 4D8UA 2IF0A 3OPNA 1UAYA 3PE3A 3QNUA 1T0BA 1TJ5A 2YH2A 4DA9A 4YYEA 4L95C 5DNYB 1JFSA 4G84A 4N3NA 3EIUA 5EGSA 2J3QA 5DT9A 4Q7KA 4R98A 1E1RA 1RLIA 5JZSA 3FPBA 4ALLA 4BJ6A 4Z8YA 4P80A 2A1IA 1C3VA 5DLEA 3ORHA 2EIXA 2GHRA 1K08A 2P4QA 4ZVKA 3UMFA 4ZRMA 3KSAC 4RA6B 4ED9A 1NR1A 2Y9PB 1UJ6A 1F17A 2DZDA 2X8JB 4I9FA 3BH6A 3HE3A 2I3GA 4H7IA 3K9WA 4HDNB 3GCDA 1JAHA 1SVLA 3P2EA 5DGXA 3ROQA 4LC9A 4CM4A 5A0TA 1PIWA 1Q2UA 2VF4X 2XVZA 2PGOA 2VIIA 2MCFA 4YAIA 4C6TB 1Z2AA 4M1EA 2B78A 2KMLA 1GWNA 1ND6A 2QTBA 3CLSC 4DIEA 1ZJYA 4XD2A 4LTMA 2W2TA 5BW4A 5TE9A 1P62B 4YT5A 2NXWA 1W36D 5I7UA 2ZULA 5HQTA 3IA7A 3IB3A 4U6SA 4W4TA 3U1BA 4A23A 3UXMA 3EVTA 1AUOA 5K1ZA 1KVRA 3BXOA 1EB9A 4INZA 3Q5EA 4TL8A 2C7BA 2OV1A 1IN1A 1E2FA 3P8ZA 1MW8X 5TDHA 5FI5A 4AF7A 5AQ1A 2N47A 2FCRA 3CJRA 2FN4A 4C08A 1FQKA 1QM5A 2B83A 2BM9A 5HA5A 3RRYA 3K2QA 5AJUA 2NUPA 2FPUA 1D4FA 1Y42X 4JCOA 2OBMA 4BATA 1FYXA 2FEXA 2BEVB 2YWHA 2ZRMA 3DAPA 4HDKA 3NWPA 4EEZA 2NNLD 3VR0A 4X8LA 4PR0A 3P45A 4D57A 5KYUA 4ZDJA 3T06B 2WSIA 2BTEA 5F1KA 3FNGA 3MTGA 1CJVC 1JLSA 1XL1A 2J3MA 1KE1A 4J75A 2A1UA 4KR2A 5LA6A 1JJVA 1J4AA 1EP3B 2R96A 3C8ZA 4KTVE 5GZ6A 3GLIB 1QCYA 2VQFB 3V4VB 2YXBA 4KXLA 1ZJ6A 1L4KA 1RACA 5FF9A 3H3FA 2F1JA 1V6AA 4DLTA 5JDIC 1XWWA 2GCOA 3NONA 1UEJA 2GF0A 4AICA 3AWDA 1KQ3A 2C1XA 4QHSA 3BQ9A 1EHIA 2H7CA 3MM4A 4CM3A 1P91A 3ASVA 5CP8A 2Z6AA 2IEBA 1GPKA 1ZW6A 2QAJA 4X3CA 1QGDA 4QEZA 4QQKA 3EXIB 4PCAA 1JB1A 1K7EB 4EF6A 2R8YA 3CRW1 2FK8A 3IVMA 4I4NA 4GP9A 2HZ7A 1Q50A 1RFLA 2VSXA 3L8HA 4JA0A 1JKXA 2I7CA 4EYGA 3FZNA 1HZZC 2CMDA 1GZ4A 2DLNA 3ZXIA 4ZO8A 2C2OA 3R23A 4LZNA 3AF3A 2X5OA 1UKBA 3UY4A 3WRYC 4AKSA 2AJ8A 4XVCA 5KJ6A 4AJ1A 5KNLA 4S1NA 2Q7OE 1LQ2A 1QWOA 2VDKB 3JQAA 5ED0A 3LZCA 1DPGA 3NLLA 1QNLA 4NPAA 1SUWA 5IZCA 2ZUCA 1YRLA 1YZLA 3E0XA 4QT0A 1D2RA 3HCWA 3WBJA 1H9CA 1E3DA 1IK4A 3HVKA 1RLMA 2QRQA 3K1JA 3TUJC 3FIJA 4JJ4A 3HK2A 1EBUA 5CJ2A 2GRJA 3S1AB 4CMHA 4YXFA 2O0MA 4OH1A 3AESA 2C5AA 5JD4A 1EVEA 2RB5A 3PX7A 3NFYA 1I10A 1K86A 2Y1OA 1XTPA 1Y7TA 5H1YA 4E22A 2XCLA 1Q1GA 1DJPA 1ZGAA 1TKCA 1KERA 3GVCA 2PKCA 3NVMB 2GWHA 4TKUA 2XUJA 3IAUA 4KGVA 4EUHA 4JIGA 2WTXA 4H3VA 2CSUA 4TUYB 1QHFA 3L6RA 5T4HA 2X4GA 5AIAA 3ZLJA 3WLJA 2PA3A 1Y8CA 5DTMA 4FI3C 4AO7A 2A3NA 2PKXA 2PRIA 3WGQA 2O1EA 5IT9A 1P6UA 3ZW9A 1SHUX 4MKXA 2CNLA 1YJ5A 4KHPB 2YJ6A 4HDSB 4IUYA 2XVAA 3VJRA 4JJ7A 3UZUA 4M8SA 2DVMA 3ZHTA 5F78A 2A1TR 3GDHA 4WK2B 4GL2A 1GG2A 3RDPA 2V7WA 4ERXA 3PUJA 1O95A 2ZYAA 2ZUVA 1U0TA 3BQMB 4FJ1A 4O4JF 1H1TA 1P81A 2EZ4A 4A2PA 4J07A 1SD2A 3IURA 3QBDA 3LDUA 2VPYA 4QUKA 3UMBA 3WV5A 3VDNB 1SA0B 1PV1A 4IDDA 3T5DA 1KH1A 2CV1A 1C3JA 1GV0A 2AG5A 1D2MA 3P4XA 4I5EA 5SYAA 2XWBF 3CB4A 2LD4A 3X1JA 5ALEA 4DR5B 2VPZA 1W52X 3HWRA 1GCIA 4JT2A 1GN8A 4LWQA 4FC6A 3U4IA 3TD2A 3TRIA 3NASA 4YMGA 1GD1O 4CCWA 4G5YA 1KWKA 2HHHB 3P0FA 1ZA2A 3NHYA 2XZDA 4WGFA 1KJNA 2HPVA 4PG8A 1ZC3A 2ACKA 1J23A 3DSRA 1Q1BA 3MWKA 3VI3B 3I1IA 2ZCVA 4UD2A 2D4HA 3KLOA 3I8OA 3KCQA 3LYAA 3SSOA 3UVEA 5FUWA 3DZKA 3I2KA 4G81A 4KI0A 3SX0A 4UU1A 1B74A 3RHFA 2Z58A 3W2EA 4WRRA 5KDOA 4GPAA 1VCIA 2GSWA 3BS4A 3VR3A 2OGUA 2X0RA 3GNTA 4HWGA 2JFQA 5T64A 1FE8A 1XDWA 1WSAA 2IYTA 4IZIA 2AVDA 1CVLA 1RBMA 4K87A 3W9BA 1TD1A 4OQNA 3H8VA 2QLLA 5HE9A 2O8BA 2ARKA 1CY0A 4ZI7F 1FUKA 1IBMB 1UBMS 2ZSAA 1BW9A 1ZD3A 3AZOA 3I1FA 4HGPA 4MVJE 4XCVA 5JMPA 3T7EA 2HADA 3U9LA 8AT1A 1KDTA 2VYND 1B0PA 2P35A 2CMGA 2XUFA 3A1DA 2C3PA 1DDIA 3DULA 1OLXB 5DASA 5ECWA 5FV4A 4O08A 4LKOA 4MAFA 1R4MB 4XGIA 3ZD9A 4BYGA 1G8JA 3HZOA 1HE5A 5HF9A 4P5DA 3OBBA 4UHCA 3O4GA 3ZH9B 3CC8A 1OROA 4P7BA 5AJYA 5L45A 1UP7A 2N1MA 1C0IA 3TGWA 4QBKA 1W5BA 4J0HA 3RBZA 1ONOA 4EHLA 5L9AA 1XXLA 3EVGA 3CZ4A 1EWYA 3F9CA 3UJ7A 3OZIA 2CF6A 2PZMA 3SLRA 1FDUA 3BZUA 3H6KA 4TRNA 4RH3A 4QYTA 1YZ3A 2FB9A 3GNLA 1N1EA 3BFXA 3Q8LA 1OH7A 1LBSA 3U4QB 4KN9S 4ARZB 5DX1A 3RTCA 1CRWG 5FLXA 1MC4A 4BFXA 3I9FA 5EXDA 4BNFA 1YBFA 3NUGA 2HRZA 4B85A 4EFLA 5ILOA 4QYSA 2XRYA 4F0JA 1P5HA 1A77A 1WA5A 4CCAA 1JFFA 1QGYA 3LL4A 1D3AA 5EZYB 1MOSA 4ER6A 5M3BA 4U9IS 1E9EA 1GPNA 2XAAA 3MWYW 4XPZA 2AN1A 1T1IA 4RGQA 2WM8A 3R40A 5FUYA 5FA8A 3CEMA 5K20A 4ZKDA 5BSHA 1KXZA 4EAQA 2FHPA 3K9NA 3VR5A 4PRZA 1BJRE 3CVVA 1R5JA 5A05A 4Q21A 1WSWA 4TKVB 1VLZA 1GA4A 4X45A 2VPXA 3UOAB 4ZGGA 3PEYA 1RYBA 3Q41A 1IDOA 1N2CA 2EYQA 4HAYA 3L05A 2PR2A 3NAGA 5KX5B 3DNPA 1N6OA 4ZRDA 4KK3A 3DMTC 5JNRA 5LD2B 1Q77A 2JLYA 2D2EA 1VP9A 4PZ9A 4QVGA 1RZ3A 2CB9A 5JMOA 1RTTA 3PQ5A 4EATA 5JVDF 1QQBA 2D7JA 4IDNA 3OMXA 3WGUA 1JMYA 4FWBA 4MWTA 3SZLA 1Q3TA 2IL1A 2XGGA 5FTKA 1L4HA 3B6ZA 3WDMA 2C04A 2J9YB 3LECA 2WTMA 4KO4S 4L02A 4TV9B 3EIHA 2AHRA 4DBVO 2VLIA 4NXMB 3RU2A 4E5MA 2I62A 1QGUA 1EK6A 5HIJA 5EJ8A 1ODJA 3UQYS 5IKXA 1YQXA 2BLNA 2EKDA 4ALIA 5AW6A 2W2LA 4ZOEA 1HT2E 1P19A 5IYZA 2WYWA 1DTWA 2GAJA 4TOIA 3SIPA 2QWXA 2XUAA 3AM4A 2JJ2A 4OJKA 1FRZA 4WY2A 3VYRB 4BV3A 1ADBA 4DCMA 3CRQA 1B14A 5JO0A 2JL1A 1U2SA 4ENSA 2HQSA 3DBIA 4DCGA 4KDFA 1DINA 4TRMA 1OILA 2D1FA 3MQ4A 2VH1A 1IN5A 3ECAA 5B1HA 2GDJA 4P7KA 3TPFA 4X44A 3VZDA 2X7XA 1OLUA 3L7LA 3KXIA 1BFKA 1ZD4A 2VAMA 3TJMA 1FJ2A 3DV9A 2XEXA 4KAXA 1XDZA 3QPCA 2RK6A 1XLTC 3LT0A 3SNHA 4UEJA 4UM9D 4QUHA 3QJYA 3FTCA 3W5AA 1B42A 2ZSBA 1PL0A 1U0NA 3GJYA 4MZDA 4XSGA 1JG6A 4Y8VA 2HM7A 3N2NA 4Z7OB 2Q4OA 4RDXA 4FT2A 4JBGA 1KNQA 3AVOA 1M76A 3PTLA 5EJAA 2EARA 4AZ0B 3SR3A 1D5WA 5JRZA 3CCCA 1ZM2A 2Q4DA 1YI1A 2NN3C 4MRMA 4O1IA 1EBBA 2DPLA 2YNMA 4HBGA 3FRHA 3LQ4A 2PGJA 1RU3A 2NZ8A 4LV6A 4YECA 5CK5A 1IG0A 3BB1A 4N82A 4V0RA 1GUDA 4BLRA 4KPUA 1MVOA 3U7FB 5LNK1 4KQCA 1EP9A 4U3JA 4Z5XA 1WMBA 4NMHA 3RYCA 3CUYA 4FILA 1XRPA 3A9UA 2F8LA 1TYDE 2RH9B 5AKHA 1Q1EA 4ZVVA 5C5EA 2DXIA 3O3NB 4BVHA 5KPJA 2PS1A 3O75A 5A6SA 1VE6A 3NHFA 2L69A 1XMOB 3EIXA 1HLDA 5BNWA 4BVBA 3MTDA 1OC2A 3E7DA 1YVEI 3HY3A 3FUXA 4FR5A 5CUQA 1X9IA 3HYSA 4PZYA 1H6BA 4AT1A 3DNFA 4J6EA 3VKWA 4G1CA 2QTLA 1ULZA 4Z9BA 3U9TA 5EXXA 3ROXA 5BMVA 4B6OA 4OREX 4LDQA 4DTCA 1WLYA 4JLDA 3RBAA 3OQ6A 2JAQA 3L6CA 4R3NA 3OFND 3I3SR 1F0KA 1IFXA 2Q9BA 4AJEA 1JGTA 2KE5A 2R1UA 9ATCA 1PGJA 1E6KA 2GEDA 2FF5A 3I72A 3RD5A 1KARA 2YFQA 1EA5A 1POXA 5AHWA 2ZUTA 4RQUA 4YUYA 1T0HB 2FW0A 2V96A 3BTVA 2GCEA 2MMCA 4JQYA 1AMNA 4RV5A 4Z7QB 4YALA 1V7QA 2FEOA 4V03A 3BB4A 3FM9A 1E6CA 2FG7C 1UK7A 2Z3ZA 3KZCA 4YI3A 3FB1A 1SHJA 3R0JA 1JTFA 5BNIA 5BVHA 1P17A 1ZNZA 2QGNA 5D51S 2ZYTX 3WNVA 1GKKA 2XIJA 2I71A 1DRJA 5LBTA 2QQ0A 4GR4A 2FEKA 2YY5A 4EO4A 1VL1A 1WPRA 2VHTA 1BG6A 4EJ6A 1H5NA 1NJSA 4EJ2A 2P3QA 1OY1A 4CN8A 5JARA 4NYMQ 3K09A 3ZGVA 3EH1A 1VM6A 1SVKA 3EN0A 2CVFA 1CY7A 3EC2A 3K4PA 1QIMA 4JL8A 3O93A 1DWQA 3E2IA 2P68A 2H5IA 3I9LA 4MR8B 3VR1A 4L8FA 4DM3A 5MN4A 1OXXK 2ZPUA 2NZYA 1ZNXA 2VJCA 1XG5A 4Q1VA 4BWGA 2M32A 4UREA 1NA5A 3GEEA 5G3ZA 1KEWA 3IT0A 1CQJB 1BXGB 4XD7D 4PYMA 1OXBB 1PTJA 3RF6A 3U19A 2AWNA 2NP7A 3H4MA 1DAIA 4IPTA 4P83A 3TOVA 2NU6A 1B8PA 1SIOA 1HBJA 3GNSA 3HVJA 3IQDB 3R7LA 3QBTA 3H19A 4KWTA 4Y2HA 5TT1A 3SLKA 4AU1A 2MINB 4E2FA 1ZXBA 3IQFA 3AEYA 4RD3A 2ETXA 3ZDBA 3KJZA 1NUTA 3JALB 1SC6A 3B9RA 3RYHB 3HHEA 2ZZMA 5L6LB 1YGYA 3A06A 1N9ZA 1NF2A 2WM9B 3G5TA 3P27A 3R0QA 5DH9A 1RLUA 2W43A 3SK0A 3VH2A 3ZHOA 4BLQA 3EWNA 1JPUA 2PH1A 3ZQ4A 3YASA 1P3DA 1DQNA 1RMTA 6CHYA 1F2VA 2VP4A 3WISA 2VK1A 4J8PA 5A3VA 1E6MA 4BKPA 3EA4A 2XBUA 3VKGA 2PD6A 1L3CA 1ONNA 3HZZA 3MPOA 1Z62A 1OWMA 2YJZA 5FLEX 3RAJA 1GSIA 3EMDA 4WKNA 3S6JA 2QY6A 1Q22A 1R66A 3AG5A 2I7TA 5I9IA 1U8EA 4RTNA 3NT5A 1T9DA 1BA2A 1QYRA 4E4RA 2EWMA 1WHSA 4CCSA 2ZJ6A 5J2TF 4RIEA 1W4RA 4L08A 1U3VA 1N5OX 1ND5A 1RVDA 1ZFNA 3UWOA 5BV8A 1NQUA 2VHZA 3THYB 4ENUA 1XQYA 4Y3UA 5JPCA 3VVCA 5K8IA 3ID6C 2DKOA 5F9FA 1CIJA 5GIPE 4KN6A 5TIIA 3W7VA 1JLRA 1TVMA 3ZZUA 3N6VA 2F00A 1VPVA 1XU9A 2V7EA 4IUCS 3WK5A 1DC7A 1T35A 5KJFA 3T4XA 2WUFA 3W9YA 3U7RA 3A3NA 3TMAA 1IIBA 3ROKA 4GHWA 4OHPA 2H2GA 4H4DA 3X2SA 3P9SA 4GBJA 4IDQA 4BRSA 5IHPA 1YHZA 1SOUA 1CUWA 3ELUA 4HB2A 2Q2VA 4QPDA 3ZY4A 2IBSA 1QGAA 5D5QA 2O8CB 4AM8A 4Y2QA 1QHEA 3FW1A 3MZ0A 1RQXA 4UPEA 3ZDRA 2OENG 4DCVA 1ESEA 1T6BY 2A30A 3GN1A 3HBMA 3MWGA 5A3QA 1FLVA 3DAHA 4CJXA 5JSFA 2C95A 3MWDA 2C5HA 1Y5IA 1NLUA 1GRCA 3I39X 2VQSA 2WPDA 4BO8A 5LM3A 3HACA 1NF3A 1U3GA 2V4ZA 1YR3A 1DC5A 1JLLB 2OEPA 1E92A 1VJ0A 5JHGB 2FQ1A 5E1OA 4IXWA 4LPSA 1YL7A 1PP4A 2FLKA 3OZTA 4RZSA 1LB1B 4URHA 2PSJA 2QTTA 1N78A 1NXTA 3ZC3A 2NWQA 2ZM6B 4P92A 2AR7A 5IZCC 4IGIA 5EVCA 3LT5A 5K45A 2AUMA 2PH3A 4WNAB 1LZLA 1H8HD 3KEOA 5B30A 3GUZA 3LQ2A 2IXAA 3EY9A 1W0CA 2WSYB 1Q7GA 2A94A 4ZHQB 2KBEA 2J3DA 1X8KA 2HU5A 3CR7A 4PO8A 3SP1A 4FWTA 5CT6A 2H3HA 2QRLA 4TSFD 2OXIA 1XZAA 4CKWB 3N8DA 1QH8B 3EQ8A 4MWBA 4PXAA 2IP2A 2EQAA 221PA 2BGMA 3M1YA 3KLNA 4G65A 4QTZA 4ZZ2A 3TG8A 3BPSA 5KCMA 4D0NA 1VKZA 2W58A 1T1SA 5IYZF 3PUKA 4TS3A 3TZQA 1E5LA 2RARA 3CZPA 2EAUA 3ETCA 4DYDA 1P8AA 1OWOA 2BP7A 4IIGA 4KI7A 1V4VA 2HZBA 1V45E 5I01A 4C88A 3Q6NA 1K75A 4D45A 4F3TA 3UV6A 3H84A 3NC1C 5M2QA 2ACWA 3PT5A 5HQ3A 1WF6A 2BHRA 2JBAB 4NBWA 4PPGA 2VNJA 3O4RA 1P1JA 3K5HA 4PZEA 1UMDA 2NGRA 1FUEA 2H48A 3KAQA 3SC2A 2QAGA 1O95C 1TRHA 2QX7A 2QG4A 2IYUA 2R2AA 3I34X 4L74A 2B1RA 4IHJA 4R2LA 4TV9F 1JT9A 1JEJA 2J9RA 1YS2X 3BA1A 1KYQA 1F4PA 3KYCB 4KQKA 2I8LA 1RWWA 2A1TS 2ZBUA 5JYDA 3COPA 4MGEA 4AY3A 1LTQA 3MGBA 1R4AA 1SJ9A 1VPLA 4UW9A 5CGZA 1XVIA 2IU0A 3P0EA 4G5GA 1E2QA 2WTBA 3RLFA 3TRFA 2XCUA 3N8IA 1A9YA 1FU4A 2ZRAA 1E9DA 3QXHA 1YRYE 1J90A 3EVEA 3UJAA 1GL6A 3OX3A 4US1R 4PEVA 4ZMSA 5AVXA 2P9BA 1CF2O 5AKKA 1ENPA 5L3ZA 3JVEA 2QN2A 3LWBA 1NT2A 2AEEA 2WZDA 4A2QA 1RM3A 1KYVA 4RGVA 2G67A 5F1OA 3IAXA 5CYPA 3QVGB 3F73A 4FMDB 5EKDA 4YH1A 1EX6A 1X7GA 1LV7A 1RBQA 3W6OA 1A7AA 1BIFA 3M6MD 5F2EA 4CZ2A 4HK4A 1T8WA 4NTZA 4N3AA 4OU4A 1CTQA 1GTL1 2SCUA 2VSOA 3LHSA 1JTEA 3PC4A 2VWGA 4KCGA 2IPAB 4ND8B 1KDZA 3CXRA 4YAOA 1JAIA 2VP2A 4XYEA 4Z99A 3NC0C 4F6CA 1PT7A 1VZ2A 5DHFA 2CXPA 4EKEA 3LCUA 1ADYA 1U6JA 3ES9A 1QP0A 3IAHA 1GGHA 3DDWA 3G0GA 2I67A 4UPDA 4PCVA 1M8GA 3EULA 5KYNA 3H9UA 1T43A 1F0PA 2WM2A 1E98A 4LQCA 3L92A 3MUEA 4DREA 5ESRA 5A06A 1RRCA 2BMDA 5TGZA 1LPAB 3PKIA 5BSEA 1E58A 1BYIA 1YWGO 1YKGA 3HP1A 4V0KA 5GOZA 5H81A 3S0JA 4DDKA 5B7PA 1IOWA 2PIDA 4NECA 1LI5A 4S24A 3ADBA 2OM6A 2WTNA 2ZYHA 1UMCB 2Q46A 1E1QA 3F96A 5CB4A 1LS6A 5DHPA 2SECE 1GZ3A 2YDXA 3NHMA 5LQCA 5KTPA 1EVKA 1K8ZB 3ZHVA 5I7EA 2ZQYA 4U8GA 5FOWA 2RH8A 3HB9A 4CG0A 2PBZA 3DDHA 5TPZD 5AVYA 5DN9A 1K92A 3IBFA 2FDCA 2FAXA 1Q15A 2C42A 1J6UA 2JKYA 3V8RA 1CC1S 2C4TA 2QRMA 3QEOA 2Q3LA 2NT3A 4AXBA 4MQBA 4EGSA 3G0DA 4XTRA 5FKJA 5L51A 2EJWA 1RCTE 5JQWA 4AN4A 4F6LA 3EXHA 3TTSA 1FNSA 1LRJA 2B82A 1B16A 3ESRA 5K3CA 5TQVA 2B5OA 3SLGA 2R6JA 5I48A 1U7TA 3ENNA 4GFDA 1JIKA 2D2FA 3WSTA 4CKZA 3T5AA 2NAFA 4HEQA 4AWXA 1L4YA 1AKVA 1O58A 2IEZA 1UBJS 1VJ5A 5JY6A 2XKKA 3DC2A 4A0SA 4AQ7A 2V7TA 1MHPA 4DR6B 3A6EA 3JU3A 3JAMA 1O6FA 4QFCA 4JJZA 4YAWA 5CXUA 4PLZA 3ZLVA 3OG9A 2I1QA 4Q4CA 1WUTA 3GJTA 4LGMA 1S96A 1W34A 4PC2A 4DC9A 3K6SA 3WLRA 1EGAA 3D7LA 4UMDA 3IE1A 4LXXA 4Q47A 1GPMA 1ZL2A 1E8NA 2FR8A 4L9SA 4KACA 4HLCA 4RC9A 4XM1A 1OLOA 3P7MA 4YASA 1SVNA 2YRWA 3O3CA 3VC7A 4BO4A 2BZGA 3RUCA 4DEXA 3I9OA 4E4YA 2PUDA 3NYIA 4PWZA 2G8LA 4BCBA 2D2IA 3HUDA 3JSXA 4HFNA 5CAEB 4UTVA 2CV2A 1R3DA 5A4FS 3DOUA 2LV8A 1Y1TA 2A9RA 2Y68A 4CMIA 5JBIA 1N6RA 3U9SA 1B6TA 3ZN2A 3TLAA 1YE8A 2HREA 2GD6A 4PYOA 1O5IA 3F7OA 5C52B 4WZAE 1XMXA 1XZDA 3FCAA 5K0TA 3GD5A 1FNDA 4C7OA 1QU3A 2DX7A 3TEFA 1CULC 1ZZEA 3FMOB 3HBJA 4IGAA 2Q0XA 2FN3A 3G3EA 4M54A 2R87A 3TXYA 2WVGA 3H9GA 4OIMA 4TVKA 3HB5X 3LBAA 4GDMA 2IVZA 3FYHA 2QLFA 1JILA 4K6FA 1HT1E 2JGDA 2A9OA 2P2ZA 4OQPA 3O4HA 2XYVA 3D3JA 5HYVA 1DV2A 3QVMA 2I7DA 5JAZA 2VRNA 3PBKA 5ALLA 5EJ4A 3U3ZA 1M2HA 2J07A 5ETJA 3ZWYA 5JATA 5DV9A 1Q1ZA 2AN5A 4OI0A 3FBGA 4IIBA 3VOTA 4KWIA 1N5JA 1TYZA 3QYFA 4HWOA 4UNQA 5E6SB 1OAKA 1L4BA 2VF7A 4US2R 4AYWA 3U44B 2AC2A 3U61B 1GTG1 4KVAA 4HDMA 1DBSA 1WUIS 1G5FA 1UDBA 1Y81A 1DBRA 3IDSA 4JUFA 4LVNA 4ZAGA 1SCNE 3WIUA 1TU0A 5LWQA 2M9MA 3TO5A 4RY8A 4QPNA 3AEZA 1NVBA 1L4GA 3ND9A 1N5MA 1BAPA 2YNMC 3HA3A 1NPYA 4FLMA 3RAPR 1U0HC 3DZBA 5CB6A 1W94A 1S2MA 4E70A 3IVCA 5GAJA 1C8BA 1RXWA 4G89A 4JT4A 2ZRBA 1SBCA 3LCVB 2WYVA 1T6ZA 2B69A 1SU8A 1UJNA 2Q28A 2VAXA 3KTFA 1EP1B 3N70A 5EHXA 3UK2A 3WLOA 5KOIA 3QSYA 5F1YA 1Z6QA 2JGIA 2YVQA 4RX1A 3I52A 1R50A 4V38A 2IXDA 2IYEA 3GPBA 4HWPA 5EEGA 1TYCA 2JZCA 3UBMA 3ZI0A 3W79A 2P8SA 4RTJA 4ZVOA 2Q45A 3A05A 4RTSA 1PFKA 3GJ0A 1ZH0A 1MOZA 1Z6ZA 2YJ3A 3GCWA 2IY8A 4I9UA 3SXUB 4PM4A 3QVTA 1DEKA 1O3YA 3EVBA 4TPKA 2BGKA 3OUUA 1U7DA 3KZVA 3O8BA 4KDCA 4WLUA 4KO1S 1E1MA 1Z7GA 2O2GA 5AW2A 1B15A 2EV9A 2IYAA 2YUTA 4ZI5A 4RK0A 4ZCMA 5K05A 4EZIA 2XDYA 1A5BB 1NBME 4WZBB 3W05A 2IXEA 2GUGA 3HSSA 3PI7A 4Y2JA 5LJLA 3WGTA 4BNNA 1VBNA 2BIFA 2UDPA 1DFGA 2BC9A 4QWMA 2QEQA 4B1FA 3HTXA 4OEHA 1Z4IA 2HCBA 4Z7JA 3GDGA 4B7UA 1QCZA 1GU1A 1PW7A 1ZD9A 4L0CA 2WT8A 2JPDA 3QE2A 5G2OA 3RV4A 2EEPA 1L5LA 1X14A 3E9CA 4F8JA 4RZ3A 3D4OA 1VECA 1H1LA 4ZQEA 2PRJA 4DQ0A 2CWWA 4R1OA 5F64A 2PBFA 5IW8A 1C29B 2MYUA 1Z2DA 4NCBA 3D3EA 4Q1DA 1U4SA 1QZ3A 1POWA 1RRVA 4POAA 4BN5A 3B38A 3KQQA 4ZHQF 3ONFA 4LGVA 3JR3A 4YJ2B 3Q9UA 4NZYA 5CT8A 4DPMA 2ZTMA 3B89A 3P5SA 1AS0A 5C8YB 2RHGB 4DZZA 2W6ID 2EYUA 4EG3A 2XQKA 5B1SA 2G7ZA 3K09C 3R5KA 3VU9A 3I28A 1OWLA 2D0IA 1JG7A 1XKXA 5BOSB 3E22A 1VC2A 2RAFA 1EVYA 4JX9A 2ZU0C 4RM3A 4X1KA 3FYCA 3ZWXA 4PNPA 1XTVA 1SB8A 3CF6R 2XUDA 2ZVPX 4TQUS 5LJIA 1JEOA 3R5FA 4CF6A 1TMKA 4J0DA 5DHUA 1Z0AA 2CKMA 3A9VA 4HNVA 2PEYA 1PTJC 3AF2A 3JQDA 4NJMB 4O4IA 5GJCA 2P7IA 3PHJA 1F12A 1WPGA 1A98A 3OKCA 4LJ7A 4XJXA 2OV4A 5CH8A 2JFGA 4NENA 1PX2A 2X76A 2XQJA 1S01A 2I4IA 3BWDD 3MMSA 1FSFA 4MB6A 2WG2A 2CLKB 4ITVA 3UK0A 2R8PA 4L16A 3K6RA 1QZZA 1FQJA 4C5AA 5DO9A 3STTA 2CF5A 3LU1A 4ZD6A 2JNWA 4DANA 4AJHA 4TYWA 1B41A 3BZBA 1JIXA 3VVMA 3NAMA 1ZU5A 3T1HB 2VXYA 4C3ZA 4HEJA 4KFSA 3O84A 1RP7A 4M6WA 3THSA 2PUAA 3PX3A 2AR9A 2F1HA 4AJ4A 1TQHA 1GRRA 2A0UA 2H5LA 1DXQA 3HL0A 2GZSA 3PR2B 3G9TA 4UNPA 4XOUA 1T5OA 1J9EA 2BBTA 5JTUA 5LP6F 1REQB 2QN7A 4CL2A 3ZGOA 1EQ2A 2ZBDA 3MF4A 2F9MA 5LZ4A 3IV7A 3ZCSA 3KQYA 2ZRPA 3KSDO 4ZQGA 2IFTA 1JLKA 3LDFA 5REQB 1ZUIA 2UUOA 4GF5A 4OLHA 1H4TA 1ODCA 2JFOA 3R9KA 4DMLA 4EY5A 1EWVA 2FZEA 3R0IA 4MQ4A 4XIJA 1Y1SA 3C74A 4Y98A 1X7ZA 2WMDA 2XUKA 3TOZA 3K0HA 1CJCA 2HJRA 3KPVA 3H3JA 4FMDF 3ZXUB 4F3CA 3ZWBA 2I4NA 4JC8A 4X7MA 5U4QA 3OU6A 1KO8A 3Q7IA 1M2NA 3HLYA 3UT5A 1PFVA 2E21A 1WY5A 1HEUA 4H0CA 4C2UA 1U94A 4RPJA 4TXHA 2CLSA 1SPXA 3TI7A 4QYXA 1UZAA 5IAKA 2IE0A 2BMAA 3K0AA 1KJQA 5AQEA 1V11B 3V2IA 3QUTA 5IBRA 4INJA 4MWDA 4M0PA 1GGEA 2XCQA 4MVYA 1TM5E 4JR1A 4DEYA 5JCPA 2QZJA 2NTNA 3AHCA 2EZUA 5C18A 3AUJB 4MYSA 4EYSA 1ZEJA 1GPBA 3L1VA 2IIVA 2B8NA 2LCFA 3KEFA 4LRSB 4LXGA 5JR3A 4GI5A 4HX2A 4X84A 4XDZA 4GKJB 4X85A 5EUBA 4F06A 4OAOA 5JSKA 5E4FA 1F8YA 2GBCA 1E59A 1SY7A 5AI6A 4A8PA 1P9OA 4P33A 5F35A 4YCMA 4C7XA 3H5NA 5HRAA 4BMDA 1QKIA 3B6IA 3GDOA 1AKUA 3SFZA 2CUTA 3H16A 4GICA 3VR4A 1TAQA 5JCJA 1P4RA 4A2CA 4A6XA 3DOJA 3EXEB 2B4RO 4ZA2A 1EWKA 2P2DA 5FWXB 1FDSA 3K70B 4EY3A 3QOFA 2B3DA 5ADUS 1TT5A 2H65A 1NBEA 1TD9A 3DE6X 3T1OA 3AIMA 1OAAA 1RWNA 1WDWB 1M1NB 2YV4A 3LP6A 1UL1X 4Y6QA 5HIKA 4KFCA 2PVSA 4D9MA 4OJYA 3NATA 4URYR 2FW8A 2QAIA 2FUG6 2Y77A 1JYSA 2NZJA 4QDTA 3TIIA 4M9XA 5A9RA 3RR2A 4HEA6 3W6ZA 3BVPA 3V4PB 2HRBA 3QBJA 5BQFA 2F8TA 1U11A 3VTAA 4NY1A 3PVSA 4RVFA 1L8XA 3O3MB 1OI3A 1XOIA 3FR7A 3R7WA 5E0KB 3LPCA 2DBYA 2UXCB 2H1HA 3R6LA 4RO0A 3WI7A 5JI2E 3F7NA 4NNPA 4QDXA 2OHXA 2XEDA 2WSSD 2D5CA 1R6XA 4HNAB 4LQLA 5COAA 3AVWA 3ZW7A 3FUVA 2Y4OA 5FQNA 4GR9A 1OC4A 3BTSA 2D5AA 4FFRA 5BWCA 2PZJA 1B76A 4YIKA 4CTMA 621PA 4OP1A 5JUWA 3CVOA 3I8XA 4MO2A 4K9QA 3OIGA 2AW3A 1YSCA 3NHBA 3NHKA 4MV6A 3OE1A 1FP4A 2QAGC 4OA8A 3NM4A 1LKZA 2FI1A 4MUNA 1FK8A 3DWFA 2WRZA 3E05A 2BFAA 3G8AA 3WHPA 3IAM6 3DCJA 3S28A 1OYWA 2I87A 3TDMA 2DJ5A 3T12A 3UMYA 2Z2KA 4JP3A 3X2EA 1K0FA 2VUSA 1AKWA 3Q7SA 4MQ5A 3AEKB 5BVGA 5DXJA 5JW6A 3W1WA 1ENZA 3UAZA 2AOUB 2FJ0A 2TMKA 1AN0A 1IXKA 1DKRA 3RS3A 2GN1A 2D6FA 1A5TA 2G36A 2Z09A 2BFFA 2HHAA 2QD4A 3EEYA 4XSHA 2O0HA 4M99A 4Y30A 1WXWA 5I7RA 1I0LA 1ZRSA 2WJAA 2X0EA 4E3ZA 5L3SA 2QDXA 4KLRA 2AW5A 5TVGA 4DRXA 2AN3A 2GDZA 1KSHA 1V4BA 1SQ0A 1U9CA 3CW9A 1F4VA 1MU0A 2ODNA 3ZW8A 4NC9A 4EECA 4EZBA 3RYIB 1UT8A 1KFJB 3BGIA 4WA8A 2A6PA 1YI8A 1Q0UA 4ADSG 3HSKA 1KQFA 1HL3A 2IV3A 2HWYA 3OZVA 2C1EA 4GWKA 4IFIA 1DKUA 1K8YB 3TZBA 2AX4A 2H2HA 1FZQA 1NMSA 4YN3A 2XB6A 2BBWA 2DG2A 1G8KA 2VJMA 1JBKA 2W98A 1KFKB 1R27A 3BD8A 1IUKA 4JKIA 1J06A 4JB2A 1SVOA 1M0SA 1L7VC 2GCPA 2PD4A 1SN7A 2CVHA 2H2WA 2X86A 3GLTA 2PZKA 3HH8A 5FA5A 1NXXA 2RHHA 2VQ3A 3CKLA 3VNAA 1EU1A 1J1IA 1XZEA 3GEPA 4RY0A 4BJ3A 1R1DA 1BDMA 3OZFA 4Q4AA 5AVVA 3CRRA 4IG4A 4Y0AA 1KFBB 5DWQA 3GU3A 1GEGA 4FEGA 3ESBA 5LC1A 4LRTB 3DAFA 2Q3DA 4CFSA 3O3OB 2EJUA 4HLNA 1BKDR 1R88A 4CL8A 4MUHA 3QFCA 1GXSB 1YB6A 5K0EA 2PL3A 1QRSA 1P0QA 4UCFA 8MHTA 4MR7B 1GGVA 3UXYA 5CA1F 1V71A 3UJPA 1CR6A 4WUTA 1KU6A 2BDEA 2HF9A 3ROMA 1J8FA 1PT6A 3KZMA 3KUDA 5BV1A 4N54A 3EEQA 4QQ8A 4PPQA 4EKGA 3LY5A 2X13A 5E7QA 5CXQA 2QIPA 2BFEB 1HLGA 3MJDA 4V2IA 1DO0A 3WGZA 1O97D 4CM9D 2HQOA 4WNIA 2X40A 4EKIA 4CQLA 4W5HA 2XD9A 1HYHA 3DQZA 3EXHC 4JI1B 1Y9AA 4ARSA 4D0RA 4D3YA 3IBSA 4OQQA 2Q3BA 1E1NA 5JXIA 2PH7A 2E4ZA 2H2AA 3IOBA 3K31A 3MSCA 4MWZA 2POQX 3WRWA 2HUPA 3HJTA 3O8DA 4YQZA 1NQVA 1XI2A 4BGDA 3OFNA 3D02A 4LTDA 2AC4A 1H5UA 2XODA 3ROEA 5EIFA 4II7A 3FTQA 1JEQA 2UYGA 2FEWB 1FDOA 4K0KB 2P65A 1YOVB 4NCNA 4O4IF 5A4IS 5HGXA 1II8B 2CD9A 4XX0A 3Q9NA 4WBNA 4HH4A 3TRJA 4YJFB 2FR8C 1DX4A 1EXMA 1Y4ZA 1NX6A 1JLMA 4B40A 4PWYA 4JFRA 4R8SA 4Q93A 1ZMOA 4DR7B 3JRXA 5C8YF 3D8HA 1WEKA 3I2JA 4YCJA 3N2IA 4UUBA 3REQB 4JXZA 3PJFA 1SBTA 4ZU6X 3IEIA 4HDRB 5JQGF 4DM7A 3K94A 1E3JA 1D6SA 1EJ6A 1R0BA 2H0AA 1GSOA 2WJZB 3AILA 3F3MA 2RGCA 3WGJA 1KRWA 2R7LA 2JKVA 2YZNA 4OP2A 4JK3A 3R7DA 2AMFA 1JB9A 2RHCA 4QYMA 4DCCA 1UODA 3QXSA 3WLMA 3N0VA 3ZIAA 3T1NA 1DOHA 1NFRA 3ENQA 4D46A 3V9AA 3FDXA 3CYFA 2QSYA 3JQCA 4UM8B 3ZCTA 2WJWA 2JJ1D 4DSZA 3ZIDA 4F2DA 3GEHA 3GQBB 3TM5A 3NOQA 4GW3A 2XMGA 1JXAA 3QTBA 3KT6A 4NYMR 2VTDA 4P4UA 1BQ3A 2FZWA 1UWLA 2ZBPA 4EFDA 3EF0A 2C97A 3UT0A 3BFJA 4LHWA 4S12A 2B2NA 1KKUA 2B1JA 4EDFA 2XBLA 4N5HX 1WNFA 1GQRA 1IN8A 2HSJA 1JIUA 2ZB4A 2IPXA 2V74B 4B17A 3WYFA 1LJUA 1T5HX 3W5VA 1FQOA 2HUNA 3L8CA 3L6EA 1JYFA 5F5XA 2B4TO 5JLAA 4FJ0A 3RG8A 3FTNA 4W1PA 1NOKA 4LMAA 1N7GA 2ZT8A 4KXFB 3AJAA 3FSGD 5LLSA 2AE1A 1XTSA 2ZIWB 2XGJA 3PT9A 3P4YA 3PJEA 1PQPA 4V3CA 5F2KA 1EDOA 3TGLA 4LGCA 4TTQA 2ZWIA 3NRBA 4F1JA 1RE1A 2VQEB 1FFEA 4XJTA 1UCFA 1HF3A 2YJGA 3IDOA 3W2HA 3OZSA 4HMPA 2O23A 5LIRA 4W8OA 5L4SA 1YRWA 1NI4A 2FMXA 2E85A 1N3LA 5FWYB 1NE7A 4H15A 2EFDB 1C9DB 4WCVA 4WVFA 1X0VA 1NBHA 2CFCA 3F46A 4RMNA 1Y1QA 3PQ4A 2BEUA 3MMXA 1W29A 2C4VA 3C7KA 3I83A 3IPCA 4P4SB 3RASA 3S1SA 1UT5A 2V7XA 4D92A 3ON5A 1T6NA 1HV8A 3AXTA 2KM1A 4EH1A 3IEUA 4ZYUA 4F4DA 3RFUA 1RPZA 3K9LA 1P1FA 2XNJA 4MGIR 1U0JA 4MUXA 3WYAA 5IHXA 5JCXA 3GARA 1KA9H 1T1JA 3V7WA 3FUTA 3QX3A 1WUHS 1RI5A 1MF7A 4XW2A 4YI5A 3EMVA 1YONA 3TW0A 3AW8A 2IYWA 3NETA 4MWOA 4Q3KA 4S2UA 4YCAA 1WABA 4I1SA 5T67A 2BONA 3IMGA 5EPEA 2QTFA 2FX5A 1YZNA 2DFLA 3ZDFA 3PHIA 1UIRA 2MSWA 3U48A 3OQJA 1L8AA 2E4AA 2BELA 1VSUA 1DRWA 4W1SA 4LGYA 2Q8NA 3B78A 1FP7A 3M5CA 3D8TA 5L7WA 3VYSB 3QU2A 5DT2A 4XGKA 5TY0A 1GKLA 3B1VA 2ZRFA 1VYHA 3O21A 3CIOA 2WKRA 3GOHA 5CJJA 3ZQJA 3LT4A 1SUAA 1U1FA 2XZTA 3BRQA 5DJ5A 1PJLA 4JJFA 5NULA 2HKIA 4DWWA 4F1WA 5A1TA 1BX0A 3DE4X 1P39A 1TRKA 1WMDA 2QSUA 3BXPA 4CF3A 2CDRA 1CQWA 1JIJA 1P2DA 2QLNA 3ETEA 3N0RA 5IKMA 2VTBA 2CDBA 3BFVA 3NBFA 3QKWA 5KPDA 3UUEA 5HBRA 3DMRA 4A91A 2N3ZA 3PPVA 4HWKA 1KAGA 2OFXA 3WTBA 2VAWA 2AH5A 3VNVA 1MBZA 2QTNA 4A8JB 1JNXX 4ARIA 1GZDA 2ZCJA 3HFSA 3E7FA 4UHBA 1N6LA 4F3RA 1UFKA 4NQRA 2ACEA 2RJNA 3ZPXA 4ZCRA 1H42A 2YDYA 4Q4DA 1ZBQA 4QPZA 4X20A 4D9HA 1VPWA 1CY4A 3FCOA 4TSFA 1HFJA 1I7SB 4P32A 4Y6LA 2FSFA 3WGNA 3WGGA 3OQHA 5GADl 3O1IC 2WJ3A 3AR5A 1JQDA 3R0ZA 3FZYA 1HDGO 2X6QA 3A9SA 2ZRIA 2OG1A 3CZCA 3H8SA 3HP7A 3RW9A 4N48A 2B2XA 2LR0A 3AVUA 2WJHA 5K5EA 4FP9A 2WAOA 4Z3DA 5ALJA 3VFDA 1AM4D 5B5SA 2IS2A 4KR9A 721PA 1M9NA 4OSPA 1DKOA 1MX9A 3NBUA 4PLVA 1KOLA 5BNTA 4KIJA 2JCYA 1WQ3A 2Y66A 3FHCB 3GXOA 1FL9A 1VBKA 3JATA 1ILEA 4JOCA 4JYCA 2NVBA 2FSIA 3EJWA 5TEVA 1T2FA 3COWA 3NOOA 4B0PA 3ONVA 4NQZA 3ONWA 4MDFA 2OCYC 4KFRA 1UBRS 4FDVA 4RSMA 4ZXFA 5HFJA 2OP1A 1KMIY 2BSQA 1FC0A 5FTJA 4BC0A 1WZIA 4B87A 3UNXA 5ICEA 2HIAA 4CKCB 1VXOA 4KB5A 3K8OE 1B26A 1R9NA 2D2XA 3G68A 4OF4A 5K3FB 3F6YA 3U2QA 1ODTC 4HSGA 3FGZA 5ESDA 2B35A 2I4MA 4ZEXA 2O1WA 3DVQX 1CPYA 1EDBA 3GBSA 1OOEA 3L7KA 2RIPA 4HYTA 2PMBA 4Y0VA 4BDTA 4DCPA 3V1KA 1D2HA 3VRHA 3SXJA 2YICA 4CKXA 2XB4A 3AR3A 5HZHA 5IASA 4XARA 3DVAB 3DHWC 4H6XA 2ZM5A 1W0KA 1NUQA 5T57A 1TAUA 3B51X 5FTNA 4RANA 2NV0A 2HB6A 1Q7RA 2GF9A 3A9RA 1KYZA 3WA7A 4PYJA 4RXMA 4Z2YA 1AF7A 2WWIA 3B48A 1N9GA 4K2HA 3OE7A 1T5BA 3RRMA 4DSUA 2ZYWX 1IN4A 4PSKA 1PU2A 3ZHQA 3TBKA 4DV3B 4F9FA 3PEWA 3KHSA 4G63A 2ZITA 2VSNA 3ANNA 3IIJA 1DLIA 3AR2A 2O0JA 3MRTA 4HDNA 1OZFA 1QG0A 1ZSNA 1R8SA 1GYRA 1NLFA 2VHXA 2YXEA 4KQWA 3ZEIA 1EWQA 1C3XA 2FDRA 4UUMA 4C6TA 3UFXA 3V7NA 8ABPA 4LXTA 1UBGA 1XIVA 1YS4A 5LU9A 3IBCA 3NIGB 5B3JA 4AUKA 3CLTD 5CFOA 1JKIA 1GNQA 1LI4A 5P21A 2RHRA 1WZ2A 2QRZA 3KT3A 1G7RA 5CX4A 5D2CA 1XEFA 4Q03A 1X8XA 1RAFA 2TYSB 1KI7A 2FN8A 2WSLA 4MV1A 2H1VA 1GT91 2VA9A 4BYMA 4HUTA 1Z7EA 4H0FA 4IMPA 5GJVC 4FOPA 4PFJA 1I51A 4HCJA 1ULAA 4CL3A 3K32A 4R3UC 5CDUA 1WXGA 2W4IA 4OHMA 1QDUA 4F7DA 1UADA 5F76A 3H17A 4FMBB 3C1OA 1T0PA 2XCIA 3PDUA 4ZXPA 5BR7A 5IJWA 2P2NA 1K5PA 1K68A 2I0FA 3ABOB 3MCZA 5KINB 5KWEA 3DP9A 4E15A 2Y27A 3FBWA 3HWX1 4ECEA 2GZDA 4QBGB 3EUWA 3TLJA 2BEVA 4NE2A 1SC4A 4XKJA 3QJGA 4K8OA 4HAWA 2FUKA 2H00A 2IOFA 3W9UA 1EFLA 2V1UA 2WJGA 2IZ0A 3OJXA 4JQSA 1J7JA 1TM7E 1WNTA 1D5CA 4JY7A 4DA8A 2HF2A 1DG1G 4CETA 5EMMA 3O91A 4WXRA 3J80A 4PGMA 4D74A 2V59A 1A8SA 3GLIA 3TCXB 2F3TA 2GYYA 1OVGA 3LPDA 4KL8S 4D0LB 2Z8YA 2AMLA 1JRLA 5GZ1A 1KFEB 3PQ6A 1PLLA 4WJLA 3P9YA 4ROSA 2BKLA 3UXEA 4QXAA 5KVVA 2BY4A 1WU7A 4KVFA 3T8YA 3AW9A 3FGOA 3GIWA 5DYGA 4E12A 4RABA 2R7NA 4HNSA 3ZV5A 4IIJB 4BX2A 5H68A 1I4WA 3C6KA 3EXIA 3EARA 3AHEA 2QZPA 3FB4A 4J4TA 4TTSA 5IXJA 2PMKA 1TJYA 1UMBB 2HGZA 2OYSA 1EJBA 3HDTA 3Q15C 1T3TA 5AMXA 3VH4A 3WK8A 1AD2A 3EVNA 8OHMA 5TR9A 2CVZA 3K6JA 2REQA 5HMLA 5CLHA 3G79A 1FXWF 3LUGA 1JXQA 3C48A 1UKCA 1N2XA 2CNNA 3MMPA 4JGBA 5EMJA 2HF8A 3PNLA 5MN5A 1XCMA 5JZVA 3I01A 2VHEA 3M5WA 4F46A 3KOUA 1W5AA 4QSHA 5LMUB 4OI4A 5ECDA 4PZAA 2VTVA 1Z0ZA 4X3OA 4GXTA 2O4UX 3ZE9A 3SU8A 2WFLB 2H9YA 1YS9A 4GM4A 1SZDA 4GZ3A 1N5LA 5AH0A 4A0FA 1CRQA 2FP4B 2FW7A 4IG9A 2HXSA 3Q8XB 3S1AA 4D26A 1M0WA 1C14A 1X7HA 5H80A 1E64A 5KIAA 4IDEA 4C5CA 1NURA 2B4AA 3KR2A 1UK8A 3S2GA 3ZD8A 2BAGA 2ECKA 3AF4A 2IH5A 4B47A 5JEEA 3DFKA 1MO5A 2CJWB 4XWGA 3DDNA 1COWD 2R65A 1W5EA 2G3YA 1NJFA 1DDOA 2OV6A 4XUCA 5E3JA 5CYGA 3GH3A 3I04M 3CPJB 4U0KA 4PFSA 4F7WA 3SAJA 1SELA 5LOVB 1T8SA 1CT9A 2PFKA 1WRBA 3DZ8A 3NBZC 3QA3E 5CR9A 1O87A 2UXBB 1G20E 1M2OB 5K7SA 1DTSA 4UHDA 3FF4A 1J20A 4BVGA 3U0VA 3R2JA 4HDSA 4C14A 1FS4A 3QU9A 3DXYA 1IN6A 4U9HS 3AUTA 1F60A 3G88A 4YP5A 2NZ2A 3KKQA 4OJTA 5D00A 4A6DA 4JL5A 4M88A 3EQ9A 3OIWA 4OMFG 3IP3A 4NV1A 5BOVA 4KWHA 1KDYA 3W5JA 2OO7A 1K3FA 3O8QB 1M6NA 4DWJA 3T1TA 1FJXA 2PRKA 1OX4B 2YCLA 4E2ZA 4CEHB 2RONA 1Y7LA 5DP2A 1YMUA 1XPUA 1QKJA 4NYJQ 3MHPA 5DHTA 2D54A 3AHDA 3CLRD 4YLEA 3A1CA 3KQSA 2VTEA 3VSEA 3ZXYA 4Q9LA 2QTGA 4BX3A 4YCCA 1A9XA 1OXUA 3K6KA 4XQGA 3NDJA 4INAA 5HCUA 3ZGZA 3TVTA 4YCBA 2WG1A 5KJ1A 1I2ZA 3RSZA 3T0FA 5BW6B 2A35A 3QU7A 3PGLA 3GLHB 4WDRA 4C03A 3I6BA 2H1SA 1OZAA 1DCTA 2PS3A 3D2CA 2ZSFA 4RTLA 1MP0A 4R0NA 2PZ8A 1YI0A 4JLPA 1ACJA 1WKVA 1XT6A 3VNQA 4ENPA 3KVRA 1D2GA 4I08A 1WV1A 4MARA 3DVSX 3KAPA 1MGOA 3MVEA 4G1UC 3D8BA 4LDNA 4RADA 1Z8NA 4RCZA 3ERCA 3QV1A 1OTHA 1T5DX 2QX6A 2R47A 3K35A 4B4DA 3AIIA 3OTIA 2KI5A 3FTDA 3H0CA 3T7JA 1U0GA 2D5BA 4BV9A 1U80A 1R4MA 3MK31 3OEEA 4QOHA 3JZFA 5JXHA 2BGWA 4IOLA 2NSLA 1A69A 1L7DA 3WE7A 4YFVA 4DLLA 1RC1A 4MV5A 4F91B 5IVHA 4BPBA 2XZPA 1V6CA 4BCDA 3S5UA 2VUHB 4KE6A 5JH7F 4FZVA 1KGSA 3ENKA 1BN6A 4ZOAA 1H0KA 1O94A 3R4VA 3KE9A 3TLGB 3K70D 1ODIA 4ZVQA 2J3IA 4EG5A 4ZK2A 4N7BA 4ARZA 4LYAA 2HU2A 2J6BA 3QITA 3FOWA 3L41A 4J7XA 3PGXA 4LY9A 2G82A 2E3JA 4QGAA 3BCRA 2NU7B 2GN0A 1M34E 3G23A 3NUZA 4P98A 4N8SA 5EXPA 1TPZA 5EZYA 1LV8A 1E9SA 5C1OA 4ECAA 2XDQA 1LFAA 2WKQA 1H22A 1ZKMA 3FNBA 3KQOA 3SD7A 4AP6A 4O3MA 3T3OA 1LK0A 4BFTA 4PGGA 1NUHA 1A9OA 1RYDA 1TF2A 2GNPA 2DBZA 1QZXA 1L5ZA 4B80A 4IP0A 1V3QE 2ONYA 4OIFA 1ZKDA 1UBFA 1B0UA 1FBNA 1W1IA 2IYSA 1NYLA 3JVVA 4GPIB 5F33A 3V2UA 4AWAA 3Q12A 4RF4A 4REQB 4W5WA 1WTCA 1FRVA 1TX4B 2TSYB 3KWFA 3RSCA 3SN6A 3IUJA 5J43A 2JJQA 3A26A 5ALNA 4TKVA 4D3DA 3LUCA 4TX1A 4Q48A 5CW1A 1PNOA 3RBVA 4M1MA 2JLVA 4K9RA 2ZRNA 1Y1LA 3LP5A 4PZDA 3EPKA 5IDQA 5KX5A 1Z2EA 1YK0A 4L4YA 4MVJA 1QIFA 2HJHA 3RVMA 1ML3A 3FX2A 1PWYE 5FFFA 3PF9A 5BSFA 3ILXA 5EOVA 1R10A 4MA4A 3QVVA 3PKJA 1E0KA 4GPZA 1CEYA 4OXYA 3FNIA 1FDWA 1KEEA 4I4TB 4KYUA 1C9JA 1L4LA 3M6FA 5KAMA 3ZYCA 5AJWA 4CIWA 1S3SA 2QMZA 1JG3A 4FVTA 3W5HA 5B6IA 3EFHA 4MGZR 4L51A 5TS3A 3L8EA 1FYWA 1GP2A 5H8WA 1GFWA 4CKEA 1SK9A 2WAYA 3HJAA 2JCBA 4J6FA 3DXXA 4NWIA 4Q19A 2WWHA 3W4JA 3W77A 4ZPJA 4NHOA 1H9BA 1J0BA 3CGWA 3KQPA 5DGIA 5G3YA 3UWPA 2GBIA 4C05A 4MPJA 1NKVA 1A4XA 3AEQB 2XXAA 4ZMRA 4YUWA 3MGKA 3TWOA 1D4OA 2VHQA 3ZZMA 4CMKA 3HLKA 3OA2A 1Y98A 2ZYSA 4MUJA 1XRNA 4L76A 2J45A 4JOBA 5JSQA 1GNRA 1SU7A 4IQFA 2FV8A 3RVNA 5H9WA 3LGAA 4KPEC 1PNVA 3IGFA 2BFMA 3NWEA 1HMPA 3I2GA 4Q7LA 3V46A 5FUMA 1W2GA 2BZSA 2FVXA 4PZ0A 2NQ2C 1FA9A 5HE8A 1NW4A 1T8TA 5DGCA 4E5DA 3MEQA 1SRQA 3QVOA 2UYHA 4B4UA 4EG4A 1EFRA 1XMJA 3VC2A 1HQDA 3STUA 3LZDA 2HPHA 4L9AA 3PCXA 2JH8A 2VEOA 1GA1A 4MK4A 2I9PA 4PCLA 4RGYA 4FQ7A 1BMFD 4O4HA 5EJGA 2GTIA 4MLZA 3I12A 4QZVA 3NTOA 4JUAA 1MQSA 1Q57A 3S8MA 1SUSA 2H9AA 4ZYLA 4RU1A 2OAP1 1I1HA 4I5GA 3GW8A 3AJDA 3VA7A 4W6QA 4E32A 1X92A 3QF7A 3VQTA 4TV8B 1JSLA 2RH5A 3QBEA 4NZPA 5FCDA 3BL8A 2IPLA 4K5QA 3WLFA 1S8FA 5AUPB 2XADA 3C3BA 4ID3A 1Q11A 2VXBA 4LG1A 2WWGA 1XFAA 1MB9A 3P32A 4TTJA 2D5LA 3W7BA 4B6FA 1O5OA 1ZIDA 1T9GR 3H8WA 3RT9A 4E2YA 2DHQA 2VUIB 1C0PA 3Q87B 5JS2A 2JFFA 2D5IA 1VOTA 1EPUA 2EDAA 4OK3A 4UE3S 1XRMA 4RTRA 4D4HA 1O54A 5ADVA 1YQ9A 3HJUA 1H4QA 1VIYA 4EJFA 1U0BB 4C4RA 3KL4A 2WPNA 2O2ZA 2Q1WA 3GBVA 2C7QA 4C7MA 1Y34E 3HJRA 2Z2XA 1GPYA 2FKNA 5I7WA 1Z2NX 3MG9A 4O2RA 2J9GA 1AO3A 2WSSA 1MA3A 2IOHA 3RSFA 5BN1A 4JYZA 2WIFA 1QIKA 5DBGA 2A8YA 3DEJA 3LLCA 2HEGA 1L4MA 3DDUA 3L0CA 2JI4A 4CR8A 3K9FC 2C2WA 1NQ5A 3S81A 1JSXA 2Z4TA 2ZQZA 5E0OA 3GT7A 4CKYA 4IIJF 5IJ9A 1F14A 3N75A 5HZKA 3AB7A 4TT3A 3CBQA 2XMRA 4XQ0A 1XDUA 4FW8A 5H9VA 5KBYA 2JAWA 1YKSA 2VK4A 1XCPA 1M72A 4WVLA 1PS0A 1NDHA 3PGVA 2RI0A 4AF8A 4UVIA 3BJMA 1LNSA 1P0IA 3THOA 1A50B 1R4NB 1WBJB 4H77A 3O8LA 3E7WA 5GONA 4A5SA 5JI3E 3O9MA 1G1AA 3P0HA 1FNNA 4CNQA 2H5EA 3H5TA 5CDTA 1F9AA 3HVRA 3JVDA 1Z6YA 5H4HA 1AJEA 1ILWA 1OYYA 1KO5A 2EF1A 3CZRA 1FP2A 4JJ8A 1K5DA 1KJIA 2P4HX 3WIOA 2OP0A 2VCYA 2NNWB 5DW3A 5KOHA 3CO5A 1JDJA 3H5WA 5B3KA 1UWVA 4LX0A 4QTTB 4WCDA 3SICE 4BU1A 4CCYB 1O2DA 4C0LA 2JBHA 4YONB 3SF8B 4CIVA 1BX1A 1KO7A 3WK4A 1NJ6A 3D2BA 4QHTA 1TQ8A 3OZ7A 4UD6A 5FL7A 4AQDA 4P1ZA 4F92B 1FS6A 4UBJA 3UMRA 1P9LA 5HTKA 2PMWB 1GPUA 5JHHB 3K0BA 2VBCA 1TZ2A 3Q4GA 4DC1A 5I9BA 4EGQA 3GAAA 1Z0KA 3HU3A 4ZC1A 3ZWOA 3RWBA 4X66B 4AIRA 3EG9B 1IHXA 2FA9A 4MR8A 4AN1A 3ETLA 1MIOB 1NXOA 2IYRA 3CU5A 5LU8A 2KHZA 3MGCA 2W2VA 5LOVF 3FGPA 3RU7A 1NSFA 5ALOA 3TLEA 2PKQP 3A1WA 2PHZA 1EK1A 2L82A 4PG7A 3TNYA 1N0IA 4URVR 5B7QA 5BV2P 4QG3A 2BHNA 2FPIB 1ISHA 5TLSA 2F3QA 3MOIA 4B8WA 4KNVA 1K8XB 4YWJA 4UC0A 4D3XA 1SBYA 1TZKA 3C8HA 2R7KA 2EZ9A 2O8FB 2WWYA 4EI9A 4YRJA 3FGNA 3GVXA 3GGSA 1YVUA 2XCOA 2WWXA 3QF4B 4BTLA 5B3JC 3TZHA 5I7VA 4NBNA 3D81A 3LRPA 4BO7A 2YYYA 4DGSA 2A5GA 3RYHA 5JFOA 4RH1A 1FRNA 121PA 1SWVA 3H2BA 4W1RA 4B46A 3I4CA 4B4KA 4B3HA 5DEIA 1FPMA 3EFEA 5JS7A 3UJ6A 4ENQA 2CXRA 2X19A 4UEQA 1EM8B 2CVOA 1ZSYA 2P6OA 3K2BA 3QPWA 2KB0A 3VR5H 3WIBA 5HOEA 1NVXQ 2EERA 1ACMA 1CP3A 3VZRA 4KQEA 1EWRA 2HLHA 1NE2A 1PV2A 2BUBA 3B2EA 3ZS9A 4YROA 4CQMB 1RJWA 4B3SB 3DLBA 4RGBA 3BKXA 2ZANA 3RTDA 3S68A 4Z3KA 3COSA 1NY5A 2IDMA 4ZCQA 3KQLA 4EW2A 2VT3A 1XD2B 2H92A 4TQ9A 3GHYA 2A5DA 4LSMA 3IOMA 1XTZA 3QIAA 1MAWA 3EODA 3M5DA 2C4WA 1T1GA 2P3SA 4HZUB 4IUDS 3ZI4A 3PCTA 4GZLA 2CLCX 4FYWA 4G0XA 2H7XA 3M7IA 1V95A 3QG5A 4DUGD 3ULKA 4I1YA 2ZI4A 4M4SA 1LF5A 2ZKIA 4MQLA 4RPHA 1ES9A 5TQ2B 4NU8X 3X1YA 4BNDB 4XIIA 2C59A 1ML4A 1D8AA 1ZXXA 3AYXB 3H2KA 3G0IA 1VMAA 2HPAA 3BGDA 4OMUA 4HR7A 1A9QA 3C3PA 1IXRC 5BORA 2BMVA 1YBHA 2Q3HA 4M9UA 4GZ5A 4BNYA 3TBHA 3U7QB 2WAAA 2QZ9A 2GRUA 2H7VA 5EHQA 4AJNA 2REXB 4BWYA 3TLXA 2WHQA 2A0KA 1B6GA 2B1IA 1Y89A 2Q6TA 1ESDA 3HY6A 2AN9A 3DBRA 3OWHA 2FXIA 3G49A 3S4YA 3M0EA 1HL7A 2BCJQ 5DLQC 1E60A 3N2GA 1JLLA 4E51A 1U8UA 1J00A 1NWCA 1W1UA 3S8EA 1DC8A 3U3XA 3BJIC 4X90A 3KJHA 2WTAA 1N92A 3PB3A 1UPAA 5M34A 2R48A 5BN4B 5CNJA 5CDGA 4XM2A 3DOIA 1KO1A 4HWRA 1NONA 3QMMA 2YV1A 4YJHB 1DZIA 1XTKA 2FJUA 3P9NA 3T5GA 4D0SA 1NR7A 3LX6A 5BUZA 3H9BA 3L3BA 4RENA 5EP3A 3GZTB 3K1YA 4BNLA 2JJ1A 3X3HA 4P81A 5HK9A 3T3GA 2O5EA 4YIHA 1K5GA 2VDWB 3ZZNA 4E11A 4HZGA 4WESB 3KEGA 4M1YA 4JJIA 5LXTF 2JFXA 2WF5A 1QUFA 4UOQA 1JKJB 1WZEA 2SHKA 4FYJA 2DQZA 3JQPA 1JG1A 2I2AA 3HA2A 3NDPA 3DL2A 3O7WA 3M9LA 4DG8A 5IZ4A 1NHWA 4L3WA 2G07A 1FVOA 1MH1A 2C5EA 4AYTA 3AETA 4KUGA 2QDKA 3FHJA 5IFLA 4IQ8A 1TEXA 1XCLA 5AVQA 3BMQA 5KC9A 4A4DA 3KJXA 4YAFA 1RWMA 5K6RA 1R3UA 1C8KA 1Q16A 2Q5QA 4Y6SA 3CVUA 4RKWA 4V1CA 1W85B 3AO0B 1T2NA 5AJHA 3T41A 2OORA 3PDIB 1VTKA 3PVCA 3EZ2A 4H0NA 4EW3A 5BW5A 1JJ7A 4BNIA 1FYDA 1R74A 1T2CA 3MN1A 3LO5A 2JEZA 4A8HA 2J0SA 2NP6A 2EFHB 1MDFA 3S40A 2F17A 3HJHA 3QNMA 3QOYA 5DM2A 3VAYA 3CH5A 4WEQA 4TKZA 3RK0A 3KYCA 3R3HA 1QHHB 3F5FA 4P3NA 5K8CA 2BKAA 3B60A 4U2BA 4WFJA 2G17A 1ADJA 1Y3BE 4B3CA 5LLDA 4FS8A 3SX4A 4CIDA 3T1YB 4C87A 4F4IA 1C4OA 3A25A 1MGPA 2Y0CA 2D2VA 3TRDA 1DUIA 1QPZA 5DNEA 5EIXA 1GNLA 3EB9A 4HMOA 3DKPA 1D1PA 2AI1A 1SBZA 1WKBA 1Q20A 1YJCA 4M83A 3FD8A 4MUBA 4RCYA 4RORA 1N0WA 3E58A 4YDRA 3OURA 3GJ4A 2BJHA 2LDXA 4OL9A 3LUKA 4G1BA 4QTYA 5HKLA 2HT1A 1KJJA 4N4AA 3WXMA 1U7UA 1FBTA 4ZT5A 3QVGA 4R1NA 4QRDA 4IJ6A 5EMHA 1JS1X 3BYZA 1G6KA 2I6GA 5G4KB 2ZATA 3KR0A 3JWPA 4ZU3A 3CHYA 4J0JA 1KSGA 4BJHB 4ND8A 1RXCA 2PWBA 1G8GA 3PE6A 3WL4A 1J70A 1WQ1R 2ODAA 3NBAA 1IM8A 3JW8A 3T61A 2YKGA 1ORDA 3B1JA 2GBLA 1EUCB 5I9SA 1BCSA 2P6NA 4TV8F 1M1YB 4MVCA 4RD2A 3T7AA 4L7QA 3W34A 4BFUA 3JYNA 3KQVA 4DT1A 3CIFA 4EEXA 2FP3A 4JYAB 2V9ZA 3HKDB 4YLYA 1Y82A 1DRVA 3DF7A 4RS3A 2V4MA 1V39A 4AY2A 1FUIA 2FOIA 1DS6A 2XYQA 4XEHA 4TTVA 3D5EA 2AI3A 4OQFA 4LI0A 3LPMA 2BTQB 4X9XA 3N74A 1G291 1N2EA 2FEPA 3O03A 1AB5A 4C5BA 4CG1A 1CNMA 1UMCA 3HKCA 4ZQBA 1LBIA 2PPLA 1I3NA 2OV3A 2JBWA 5EKUA 2B30A 4N65A 4OYHA 5CW2A 3UAVA 4YR7A 3CEHA 1ZGGA 4N3GA 2GI4A 1NIJA 4A73A 5DGDA 1EUDB 4ZYXA 2ZYUX 3WL7A 1OTXA 2NYVA 4Q9NA 4Q1FA 3TLMA 5AW3A 2QR2A 4G0UA 1B7GO 2R1VB 4Q4HB 1V1MB 1BRMA 3BRWA 3LK6A 3N58A 4RLFA 1ZS9A 2H1CA 1KC1A 4RAOA 3CWQA 3I0MA 4UXIA 3GRAA 5FADA 2GN8A 2B5WA 3I6YA 3TIFA 4FYHA 2H1IA 4YR9A 1CCWA 1Y5NA 2XKJE 5DF1A 5KQRA 3PTZA 2I2FA 1LU9A 2QZ4A 2DJIA 3I4FA 4F5DA 1BVUA 1DL5A 3H1EA 2FHSA 3BL6A 1THMA 5EZSA 2DT8A 2Q4TA 1ABFA 1VIMA 3TAXA 4JXXA 2BMFA 3GYBA 4UFPA 1T36B 4PG5A 5EJ6A 2H85A 1RWQA 4Q3DA 3TX6A 4NBVA 4GVLA 3UJBA 1ULSA 1CEEA 3VPFA 1ZN2A 2XHZA 1I3MA 1Q12A 1UBHS 1IUPA 2REBA 3QKRB 4EX6A 2AIRA 3A1UA 5ECGC 1T5IA 1JI3A 4JVSB 1NVFA 3CNEA 1M2VA 2FFBA 4JYBA 3M3HA 5CD1A 4FONA 1O0CA 2P5YA 3N6RA 3LNCA 1XZPA 1IG3A 3IP6A 1Z8FA 4JI8B 2MSLA 3E15A 2O5CA 1SCUB 4PY2A 3W8DA 5K3EA 3D59A 1DARA 4Y1RB 3VV3A 1LBEA 2JZOA 4LFCB 4M0LA 2IS1A 2KBFA 5LP1A 5LB2A 4YMHA 1TXGA 2B99A 3M89A 5AOCA 3IS3A 4I0WB 2AOWA 3SS9X 4I8XA 2C9CA 2ZJ3A 3LX5A 1QIIA 4HX5A 4N3BA 2I6TA 4CLOB 5KQMA 4MHOA 3DR3A 2ZJYA 5JZMA 3ZWDA 1YZQA 2HA4A 4YCLA 1RPJA 4DC0A 2O2YA 3KKLA 4N7JA 1OIVA 5BQPA 3FLMA 2XMQA 4KYVA 5ALWA 4WD3A 5LIPA 3DVLA 1JIQA 2X8LA 1E0SA 3K71B 16PKA 1U3TA 4PNZA 4FCTA 2ZIVB 3FIUA 5EUQB 4JB8A 5K3AA 3JRNA 3OC0A 4XJVA 4Z1MA 3WQSB 3BDIA 4MV0A 2AYZA 5DN6A 3S27A 2EDCA 2NG1A 2WD8A 4YEDA 4YRIA 3OE5A 2XNCA 2XUHA 1QFXA 4ARUA 5KVQA 4L8GA 3AVQA 2XKBA 4FYIA 3QFRA 5KUTA 1V5GA 2W22A 3D8RA 1VG8A 2C8VA 3H5AA 4FFDA 3CSSA 4QRIA 3RJ5A 4YBRA 4EGJA 1Z4QA 5FJIA 2XGMA 3HNPA 5JAQA 4Z54A 3N1UA 1PHRA 2AYXA 3MTIA 2V6JA 5CTJA 3OLYA 3T15A 3OQMA 3Q9SA 2UAGA 1A4IA 1CIVA 2P9ZA 3Q0TA 3U1TA 3UF0A 1Y3IA 3F3SA 5GINE 4GPBA 1PL8A 3U44A 4PIMA 1T34A 4DLBA 5EHNA 1NVGA 2ZRLA 4LDAA 1KMHB 2EG9A 1PBNA 2IU6A 3QH4A 1I4OA 3QU4A 4H08A 3K30A 2AG0A 3L7NA 3NOXA 1RZUA 1Z0UA 4HQKA 1H2EA 3W0LB 2W6PA 3H87A 4IFTA 4D9EA 2BFNA 2VNHA 5BURA 5L53A 1KHHA 2IGBA 4DBLE 3TQFA 1CQPA 3V33A 3IAS6 4M0UA 4L5JA 2VTKA 4DIOA 1YMVA 1GCUA 3RNOA 1MHTA 5FHQA 2HTFA 4RF3A 2FPOA 1GZSA 3WFZA 5H4GA 4B3GA 2QW1A 2C96A 4KQGA 2AQKA 1RDFA 2KQUA 3C24A 3FPFA 5FPTA 1E20A 2NACA 2QUKA 3W4KA 4DQKA 4LSWA 3UAYA 2H11A 1C4XA 1HPLA 4NBKA 4CF4A 1RYZA 2ZSKA 4WZAA 1Z0JA 3PC3A 4GGMX 2G0AA 5C1PA 2VNAA 3VOSA 4E03A 3SXUA 4BP9A 3HI4A 4KTTE 4KWEA 5LPNA 3BM5A 2C4UA 2H4JA 4FYPA 3VZSA 1Z34A 3UWKA 1H66A 2YWJA 4L4SA 3RS4A 3ZCXA 1PEYA 2CDCA 1THTA 5H7XA 4CT0A 2ZE8A 5SV2A 3SHFA 4GX5A 3T7RA 3DFMA 1XQWA 3OJ0A 1UOEA 2I2CA 1LDGA 2PUVA 3H42B 2UZ4A 4OV6B 1G59A 4X1IA 3OOWA 2XB2A 1F06A 9ABPA 2W4QA 3WB1A 1SOMA 1AGRA 2WKPA 5MHTA 3CVJA 2CC2A 1BYUA 2FRDA 1JR4A 3QHAA 1OIWA 4I14A 5EWLA 1BGVA 2HK7A 1F8GA 1XTUA 3IDZA 4C07A 5KNCH 2R8OA 2H1LA 1NZJA 1G3MA 2EFEB 2NAPA 1PEAA 3MXOA 3ND7A 4GE3A 4JH0A 5UKDA 2Z2IA 2P5TB 1QE0A 2HTEA 2J6CA 4FXOA 3D4NA 5BSTA 5K3BA 3RVOA 1EJ0A 1LDEA 3T3HA 3ZTWA 4MKIA 2WW8A 1T3LA 3Q3GE 4CF5A 3ZYZA 2GZ2A 4LDZA 2WEKA 4HG2A 4ES6A 3EVCA 3HRKA 2GCIA 5AJTA 4ASUA 1EK2A 3DQPA 3TFOA 4YJ2A 1MB0A 4IMJB 4HXYA 1EDEA 3VISA 1HXHA 2CL0X 2JZNA 1XXHE 4JBYA 1YR7A 1QVAA 3JD4A 1UJ2A 5D87A 4IVPA 1A7UA 3GO4A 3H5VA 4LE0A 3RAEC 1VE3A 4MTLA 1I6MA 3IEMA 4EQ6A 1X1EA 3K2IA 5ELLA 2NXJA 2O7QA 3IHKA 4IDAA 2F1RA 4EHIA 4ZZ0A 2O7RA 3EZ7A 2BLLA 4FHDA 4Q9IA 4DG9A 2GAIA 3NKVA 4EAAA 3H1BA 5GVSA 3CE6A 4R9NA 3B8HA 2JD0A 1LLQA 4DB4A 5K2MA 4NJMA 5COQA 2OT3B 1YO6A 3D3WB 1BCRB 5ALMA 3MCWA 1GT6A 1MAAA 3ZV3A 2OLJA 4NFLA 3NXSA 5JD5A 1NBMA 1QH1B 3R3JA 4KC0A 4ZAFA 3GLRA 1WBBA 2H2IA 5LQUA 3VMFA 3QUBA 1I36A 2Q7XA 3EFOA 3JRWA 4YWHA 1XZLA 1Q74A 2FOLA 4P4TA 3RHTA 2LZ0A 3T3MB 1X38A 4BQFA 1SCIA 2JGAA 2H8KA 2XA2A 3UBTA 3V4RA 4HVCA 2EP7A 5DNAA 5KMGB 1YQDA 1ZOIA 3ZWKA 3H1GA 4X8HA 3WBFA 1NG9A 1PFGA 1OPRA 3LXRA 4EW6A 3OQPA 5L40A 3GVPA 1F5NA 1K7FB 3IPYA 3AB8A 2PXHA 3KOYA 4L0QA 1XTQA 3D3QA 2RGUA 1Q1NA 2CJFA 5C32A 1QR6A 1U8AA 2A0WA 1E32A 2PWYA 3R5XA 2WIAA 4G0WA 1R18A 1D0SA 1NJGA 3T9EA 1E94E 2XR1A 1JJBA 3VMMA 2OLEA 1O97C 3THWA 5LR6A 5A0VA 1YIOA 3E2PA 1E2DA 5C3MA 4IRXA 4BVEA 3OX2A 3WLEA 3LLUA 2IEDA 5CLQA 2NVUB 2OZPA 4JHLA 3ZVNA 2Y1XA 4MA0A 2ENWA 3VNBA 2I3BA 1DGQA 4WOBA 1QYWA 4AMBA 2PLFA 3K5WA 4K6CA 2DTXA 5BSRA 3KXKA 4NYJR 4X3PA 4LK3A 4YO8A 4BAZA 4BOYA 4OHXA 1ZBDA 3JVIA 3L6OO 3HYRA 1X1QA 2FF7A 4FE4A 4RETA 3SGLA 4HWSA 2PL5A 3KDAA 1PJQA 1WVIA 2FUG1 4NARA 4PSUA 4TWZA 1NUSA 5HZMA 1E9BA 3MJEA 1VHWA 5ALDA 4B81A 1UOOA 3RIHA 4COOA 4D9CA 1F38A 3Q1LA 5C1BA 3FDIA 2CMKA 1HSOA 1L2TA 4RV4A 4X92A 5ESXA 4CTJA 3N87A 2JH3A 3ND5A 3EZ9A 2FSGA 2YTZA 4TS1A 3IUNA 2O2IA 3FNHA 4HADA 4MMXB 2FQYA 1SNYA 4IH1A 1ZR4A 4YX9A 1F1JA 1WMSA 1KR5A 1ZVJA 1HA3A 4B2IA 2XMBA 3KJGA 3WLHA 1C8VB 1W35A 5A2GA 1AU9A 3FNEA 4UEWA 3N7AA 4XB1A 2PT7A 2ACVA 3JTEA 3UMCA 1GL9B 3JARA 2IOQA 4GDFA 3AONB 1RWBA 4M1ZA 1C4KA 2I65A 4BQRA 5JAUA 4WCFB 4X62B 1KI6B 2XX3A 1H93A 4MRPA 5KKAA 1NUAA 4NCJA 4DLYA 1NXWA 1PR3A 3IAM1 4IFBA 4HB3A 4HOYA 2QROA 3RHSA 5EG5A 4LJRA 3SYMA 3AJEA 1X7YB 2Q1YA 4PBTA 4M8KA 4ZV7A 3QG1A 3PNOA 2J4DA 1S1CA 4PNHA 2GEFA 1PQUA 4YY3B 1XJ0A 3OCJA 1IIRA 2J5BA 4TRJA 3IEXA 3IULA 3DONA 2Z57A 4FOSA 4RJLA 2C7PA 2WD7B 2IITA 3MT8A 3JAWB 4M3NA 3TOCA 1PJBA 2HNKA 3AFGA 3QIVA 3T0GA 4CIAA 5IDXA 1IPEA 1EAYA 2WU1A 3JYOA 4U7FA 4I1UA 4DDWA 1AMUA 3Q72A 4IIUA 3NBYC 3OAAD 4MWSA 3RFTA 1DXOA 5HM8A 3I73A 1JEDA 1KGDA 4U00A 2ZZNA 2HNBA 6Q21A 5IWAB 5C35A 4HYEA 1QWSA 2HV9A 4L9RA 4Z6KA 3K0EA 1S9HA 4K26A 3QOWA 1ST3A 1FRQA 3T6KA 1NNEA 3VI4B 2PSFA 2WAMA 3GA5A 4QXRA 3CNOA 4TN5A 3V2HA 2OORC 5K09A 2XQFA 4Z8XA 2RE8A 2HSWA 2Y0PA 3BEOA 1PR1A 2QD5A 4E5NA 3WGIA 3VPXA 3NEJA 4I1RA 3T7TA 3IC5A 2CL7X 4ZMBA 3I23A 4P58A 2ZTHA 4KN5A 4ICIA 4TXLA 2R6GA 5E1BA 4D02A 4E94A 2A5FA 4P38A 4FK8A 5CLGA 1IJKA 3BCUA 4D6PA 5AW1A 4W5QA