4JX9A

Crystal structure of the complex of peptidyl t-rna hydrolase from acinetobacter baumannii with uridine at 1.4a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606 = cip 70.34
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 62
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4jx9A00
1RYBA 2Z2KA 4LWQA 4JX9A 4ERXA 4JWKA 4FNOA 4DJJA 4P7BA 4QBKA 2PTHA 4IKOA 2Z2JA 4JY7A 4Z86A 5IVPA 3TCKA 2NAFA 3V2IA 5IKEA 5B6JA 4ZXPA 3TCNA 4QT4A 1RYMA 4FYJA 4DHWA 4FOPA 3P2JA 5EKTA 3VJRA 2JRCA 3KJZA 3KK0A 4FOTA 4JC4A 5IMBA 1RYNA 2MJLA 4QAJA 4YLYA 2LGJA 4OLJA 4QD3A 3TD2A 3TD6A 2Z2IA 3OFVA 4HOYA 3NEAA
chains in the Genus database with same CATH superfamily
4C76A 4Y7DA 3DBLA 1VE9A 3WA6A 3KG2A 1MO3A 2CJWA 1GPUA 4P83A 5JFOA 4IOMA 3DE7X 5T8KA 1QIKA 3WTCA 1PSDA 4R2MA 1A96A 1ZNQO 4WNAA 3KQNA 3G59A 1MN6A 5I9NA 2HXYA 4IEFB 4J2OA 2CSXA 2ODBA 1OT5A 1JHVA 1Z7EA 1A69A 3ASUA 3KNZA 3ZW7A 4AIIA 3QEMB 5KSPA 2FWBA 2O8CB 3NPMA 3BKXA 3FZYA 4X1YB 5F12A 4AM8A 1U3FA 1K7YA 3IAS1 4YP6A 3DFUA 4B3CA 2H2GA 5LD2C 3EHDA 1RXYA 1FSFA 3OCZA 2K6GA 4QWWA 5IVKA 3FOEC 1Y6FA 5EQFA 3GDGA 5JAMA 4G36A 4B5KA 1RFLA 1Z2OX 3TI7A 1L4GA 4FYYA 3RU3A 1KR2A 2V0CA 4JIMA 1SURA 2QNRA 4HUTA 5KOHB 3UHPA 5L9AA 4IMIB 3EF3A 4JL6A 4U0JA 2RGNA 1DI0A 1S2DA 4RTSA 2QG9A 1NBME 3DDUA 4LXIA 3K9CA 4JJGA 2PKXA 2WKSA 1U04A 1G6KA 4B6OA 3EMVA 1J90A 4TLDA 1D0SA 2ZUBA 1HV8A 4D97A 1CZUA 4N8SA 3EH2A 2R1VB 2PYIA 3EVEA 3SYTA 2O6LA 1KOFA 4IFTA 5LQKA 3FOFC 1E0JA 4D82A 2P77A 3AL0C 3OUUA 4LJKA 3E5NA 3BZWA 3SE0A 3F7OA 1SVMA 3KLPX 4B87A 5KVCA 1I94B 2XB2A 1SVLA 3PEWA 4RUKA 3S2GA 2C82A 4FZVA 2IDMA 1GPH1 4H1HA 3E23A 4J9UE 3Q4GA 2UYHA 2RJNA 2XXJA 3UHAA 4DR6B 4A15A 5REQA 1HETA 3IMGA 3BD7A 5TJHA 3FJ1A 3MTIA 4H9GA 5IAJA 1VI6A 3TL2A 4G0YA 4H18A 3S2UA 3UF0A 5AW7A 4MUGA 2A1TS 2WVGA 3EEOA 5SY9A 2GBPA 2JANA 4LISA 1EQ2A 2OHVA 3E61A 1VKNA 4KVFA 1F06A 2XXBA 4NAVA 1CRWG 4YIKA 4ZO6A 2R00C 1OBOA 3ABSB 3GRYA 5IW8A 1JFVA 2QTVA 3CO0S 4HDSA 4QXMA 5F78A 5AOVA 1BCSA 2B3TA 5K0CA 2VCHA 2X2PA 1NIJA 4MKHA 4N5DA 1BX1A 2ZIXA 5LXTA 3BHMA 4B33A 1SHKA 2DVMA 4IAOA 1OA0A 4UNQA 1U2RA 3EA5A 1H6AA 2DKNA 2A94A 5C8YA 5F3WB 1VJ5A 1WG8A 1WXQA 1FFAA 4N7MA 2IQ5A 16PKA 1AT1A 2EJWA 4UCFA 2O5CA 1OGYA 1Z0DA 1UBUS 2VBIA 2V6IA 3IKJA 4RHTA 4CV2A 1OT3A 1GAQA 4MUJA 1YC5A 1BO6A 4DEXA 4NY1A 1SXJC 2IYZA 4OK3A 4MQ6A 1XLUA 2R85A 1V26A 3GFOA 3R0VA 1PCXA 2AIRA 1ESZA 5BSRA 1BXKA 3WWOA 3W9BA 4DRZA 2XEDA 4MCJA 4R7ZA 4B2IA 1APBA 2FZVA 3VPBA 1J7KA 3HKBA 3IB6A 2OP0A 4MW1A 5DE3A 3H8VA 2R79A 1ONPA 3CUWA 5A4KA 2IF0A 1NP7A 2V9ZA 4FGLA 1GTL1 1V8PA 2DKFA 3H1FA 1ADFA 1NIPA 3ANLA 2JFQA 1R6BX 3F4LA 3F6PA 3H0KA 3MCZA 1RLUA 2PRYA 2VPTA 2I3BA 3MXTA 4MVJP 1TU4A 1A7KA 2P9EA 4UTXA 5FX2A 1D1SA 1PDOA 1YZNA 4PNEA 1WLYA 1D07A 1EVZA 1MQ8B 3CN7A 4I7EA 7REQB 2VYVD 3GJTA 3K2BA 5EYPA 5GY7A 3KFVA 1PL7A 4NYJQ 2QYSA 5SY4A 1QHYA 1E2NA 2BLLA 5EIEA 2BGUA 3UN1A 1L1RA 2PJUA 3L7IA 1TPZA 3QU2A 1X7GA 1OY1A 3G2JA 1SUCA 4IV5A 3TJRA 5LUAA 3OP4A 4RQTA 2X0RA 3KJFA 3VO1A 5LDHA 3KX2A 4DVJA 3ZJ5A 4U2EA 1XMQB 1WXWA 1E96A 3L7MA 4DQ0A 2Q9AA 3KR1A 4G0ZA 4QPCA 2X40A 4AYXA 1TUBB 2HX1A 3QYJA 3SJZA 5FIUA 4LZAA 3V6MA 3A3YA 5I5EA 3ELUA 3D8SA 4R5HA 1D6NA 3A4IA 4QICA 4WOKA 2ICAA 4RC9A 1MVOA 3TZHA 3DP7A 1TCAA 5BYAA 1PD0A 2QTZA 4G97A 5JYCA 2G06A 2OXTA 4OQQA 3V34A 3VC1A 1ABBA 1QF7A 2QVGA 3CLSD 1F2TA 4OP2A 5DIFA 2YXNA 3LAWA 3RT1A 1IWOA 2F4NA 1P91A 5EMJA 2JASA 4XWGA 4I9UA 1DBRA 1M1YA 4I50B 2VDVE 4K0KB 5BQOA 2NP7A 1L8OA 4DYDA 5ESWA 2PUHA 5JNSA 4FDAA 1VHJA 3OE1A 3PPWA 4DC0A 1R66A 1AKRA 1M6EX 3OQVA 3H5TA 3V33A 3BOSA 1VGQA 2C2XA 4LBWA 2GS9A 3OWHA 4EYOA 4TM8A 3HL4A 4MIEA 4XXHA 3QX9A 3LSTA 2IXAA 1SVIA 1T1IA 3FVQA 1V8ZA 1Q16A 3DUFA 1V1MB 3WX0A 3P71T 3ZYZA 4B3FX 2HO4A 2F43B 2PS3A 1Q19A 1NBHA 3LHKA 4A03A 5JFTA 4O1IA 1FS6A 1MC5A 2PLRA 3EIWA 4IJUA 1B2RA 5CHEA 3VR2A 3TW8B 4MV3A 2A0YA 1GTJ1 4UASA 5SZJA 3E35A 4NOLA 1FDSA 3HU3A 3BORA 2I2CA 3SBOA 1JKXA 3L9XA 2CV1A 1DWOA 2WJ4A 3I61A 4HRXA 2I91A 5DHFA 2JNWA 3C48A 3MSCA 3PI7A 1UAAA 5ILQA 1KY4A 3SEAA 2RK6A 5D00A 1R5JA 2W6NA 3IO3A 5JPDA 1KJWA 1RPNA 2LWIA 3EDMA 2WYOA 1WVGA 3OQIA 3D4LA 3H2YA 4FFDA 4E5UA 1TB4A 1L5NA 1QORA 4C22A 3WGOA 5KIAA 1EB8A 1XF1A 1WEHA 1L5ZA 2DGDA 3Q2IA 4IHJB 4FWTA 2XXAB 2Q28A 3GLTA 1BFDA 3F49S 1UBLS 3QXJA 4OQMA 3IPYA 1R4ZA 4UW9A 3V8NA 4DKJA 3GRFA 2RMKA 5JATA 1M10A 1DIHA 3O74A 3GMDA 1PVOA 721PA 1J70A 4K6OA 4LRYA 3SBDA 2V3VA 1LJLA 1U6KA 3TLCA 3EB9A 4ARVA 1M6WA 4G3XA 4NS1A 3CZ4A 2PKWA 3EFOB 2ONCA 4IX9A 2NTYC 4CNQA 4U00A 4OGGA 4D8UA 5NLLA 4DLZA 4HC4A 3CLTC 4Q6BA 1YQGA 2KWIA 1G0NA 1NE7A 2OB1A 2XDQB 3TSOA 3OICA 1RCFA 4C7VA 1P7WA 4Y2VA 4GYJA 5I4KA 1P5ZB 4HF7A 4UHCA 4F9TA 3L8FA 1X7DA 5BWMA 2J9FB 1JG6A 2HA6A 2HGZA 4M9QA 5K8TA 1XP8A 1IMOA 1UWKA 3PV0A 1W5EA 5GGYA 2IH5A 1XRSB 5F21A 5P8WA 5ENZA 1TOAA 1HFKA 1OX4B 1JUDA 3N0WA 4LNAA 4Z0TA 3VJRA 4FMCF 1B73A 1FNCA 1Q0ZA 1SHUX 2G9RA 3FAKA 3ZVNA 1PUJA 1WDTA 1K4YA 2JA1A 5F2KA 3H8WA 1C30A 4PONA 5E7IA 4HAYA 4YXWA 1OFHA 5KQSA 4DV3B 1KMHA 2I67A 1XRQA 4GQIA 4IYRA 4K9LA 3GX1A 4OKNA 1N3LA 5A4IS 3FGOA 4K0RA 1SCQA 5K3BA 1SHJA 2IYPA 3USES 5LBUA 1JR3D 4WXPA 4JC5A 3TUZC 3VRHA 4AY2A 2YXEA 3QNUA 2HRQA 1DVRA 4JVOA 1QPBA 2EJCA 3MCTA 1O87A 2X4LA 4FJ0A 1E3IA 2EGUA 5CGZA 1AF4A 2L69A 2ZP1A 3H8JA 5ARDA 1KXJA 3QLVC 5ALWA 5H3HA 4J8PA 4OLJA 4C0LA 5EESA 5FLEX 3QFTA 5HIKA 1UOOA 2D4AA 2PM8A 4GMKA 4D4MA 3AEYA 4ONEA 1SKBA 1BVYF 2G04A 4QLAA 1EFPB 1N2XA 3RRFA 5AVKA 1GPJA 1NW7A 2BGMA 3IEIA 1GO2A 2P75A 3OEHA 2QXUA 1U1DA 4ZPJA 1ZH2A 2HMUA 1B1CA 2XUAA 1XLTA 2H57A 4O4LB 1L5YA 3BXXA 1SKMA 4OYYA 1QO0A 3BGDA 3PQCA 4YJ2B 4EHNA 2QOEA 1OREA 3NATA 3VSEA 2R62A 1EHYA 4I8DA 3M6FA 4YCSA 1Q0TA 4AJ4A 5JS1A 2HRRA 3DEAA 5CEJA 5CFNA 4A0RA 2X9VA 1WZIA 3UJBA 5FPYA 2GILA 4Q15A 3EIUA 4Q9IA 5EJAA 3U0BA 4C06A 1RJWA 1HNZB 5E0KB 2NTNA 2PH5A 4N0PA 3TDNA 1Z4IA 4R4JA 4X7MA 3U3DA 2P6MA 1U3GA 1XZCA 2MU1A 2EL7A 4PZAA 8ABPA 3K1AB 2V7GA 1NYTA 1FUKA 2JIMA 4MPTA 1KI6B 3OX4A 4F5WA 3AR9A 3NM6B 1CS0A 1T91A 4GOND 5HBRA 3U3RA 1QZTA 1RI5A 3G9TA 4JJ6A 4LNUB 4ZWNA 3OLXA 3AJEA 4UUPA 1QGUB 4X91A 1X87A 1RBQA 2GZMA 2PS0A 3LC1O 4XUDA 4GLLA 4BO6A 2PLNA 2WBLC 3CB2A 4TTRA 3EPLA 5KI6A 2A6PA 3FCXA 1WB5A 1WL8A 2OG2A 3BB4A 4BEBA 1YJ5A 2YRXA 1JSRA 3QIAA 4JKIA 5SZKB 3ROPA 4MITA 3V4ZA 3ECSA 2B8EA 2L42A 4FGWA 1E9BA 4CQLB 4X71A 2MJLA 4RGVA 3OLQA 2EG5A 1SH7A 5E6UA 2Y2VA 3CC8A 3ED5A 3AVOA 1S2MA 1ZUWA 2RHTA 2QNBA 3B6ZA 1ZRHA 3OFSA 4J90A 1D8AA 4EHKA 4TTIA 2H29A 3U1VA 1MO5A 4UZSA 3DMPA 1NJ5A 4Y2YA 3PD7A 3L7BA 3TKLA 4EFMA 5CA1A 2O50A 2QZ9A 3DKVA 3UT5A 1BDIA 4PX3A 4P0TA 3DGEC 2PAFA 3HUDA 5F73A 5MGNA 3GG2A 1KK1A 2MYNA 5HIAA 2X8BA 5JNVA 1WB6A 3PL5A 1M83A 4MUYA 1DC5A 1TADA 1YAJA 1YMQA 1MZVA 1ABEA 2LTAA 3NOOA 4Q4CA 3KV3O 4MRNA 5H70A 3M5PA 4I6JA 4BLQA 3WLHA 1RRKA 1Z63A 1IJKA 2EX4A 2R7KA 5AKJA 1XMPA 5EIWA 3SYNA 3NASA 4GEGA 5U1PA 4UOZA 3FLBA 4ZEOA 3QEOA 4QBKA 2JLWA 1M7BA 3VXKA 3PUIA 4HGRA 1MC1A 1OWLA 4KL8S 2QE7D 2VTBA 4OMFG 1KI3A 1Y9DA 2XX3A 1AQUA 3BK1A 2R00A 3VMMA 2PKQP 3P2YA 4C20A 2XWSA 1JU4A 4X94A 2ZJ2A 4EFLA 3IVXA 2C2MA 1GQRA 4DXDA 2PLFA 1N5IA 3ABIA 5JNWA 1MHPA 4BP9A 1R64A 2QL6A 3ES9A 4C1BA 3LUBA 3A1UA 2G1KA 4X6UA 3A4VA 4JLBA 2H2DA 1UPUA 4A36A 2P67A 3MLAA 3HRKA 5IBQA 1ESNA 1NT2A 3OQ1A 4NOMA 1US8B 5EKDA 4NYJR 4YX9A 3NEJA 4YDQA 4BFXA 1XA4A 1B16A 1L7MA 4ER6A 3AP2A 2VRCD 4B75A 4P31A 5AUQA 1ZK0A 3VYUB 5E2BA 5I8PA 2EP8A 4RYLA 1XDUA 2ZQ5A 5J4LA 4A0QA 2HMYB 4DFDA 4ZN6A 4BQQA 3GEGA 3QKIA 4G1EB 4YCBA 1W2GA 4GD3Q 1M2HA 4PRKA 2P8SA 3PXEA 1YS4A 1Y8QB 4XIGS 2RJOA 3NIBA 5SICE 1A27A 1S2LA 2XITA 4XOIA 5JR3A 3T3NA 4BMDA 1BHQ1 4U5QA 2X8JB 1G5TA 4FD3A 5JSHA 4YT8A 2W2QA 3LUFA 2QYHA 1KZ1A 2P7IA 3OP1A 4PFQA 2A7QA 4C4YA 5JNTA 4IJVA 4KACA 1XNGA 4INZA 3RAGA 4EPTA 4Y3UA 2JLUA 2O3SA 3CNOA 2H6EA 5EHQA 1ILEA 1E5LA 2RG1A 1WXXA 4INOA 4H7EA 2O8BA 4F04A 1C14A 1BVUA 3OOHA 3ORRA 1T9GR 5HR5A 1TF5A 2OCYC 3QV1A 1UIMA 2DR2A 1Q0PA 4BRZA 3GOQA 5LQSA 3SBEA 4DUPA 1HE1C 3HK2A 5K3OA 1NR5A 1SMKA 3QY0A 3W4JA 3Q8MA 5JS6A 3C7TA 4IIJA 4LZPA 2YNMC 3N2ZB 3I6BA 4EPXA 1VSUA 5JY6A 2O2GA 3RKSA 3WK8A 5DP1A 4BGEA 1T2DA 3P19A 3E27A 4PWYA 5KOJB 2PIAA 1Y8AA 4S1NA 4U5XA 2POCA 4KITB 2C5GA 2WLSA 2BGRA 1DXHA 4F86A 3KFXA 3O2QB 3WYCA 5DO9A 3U4QB 4H3HB 1G17A 3OCWA 4WZBB 4FK8A 4ZVKA 2HK8A 4LSZA 1JSZA 4JZYA 1RABA 2OPHA 4F91B 3C3DA 1U1GA 1KO7A 4EBBA 2HK9A 1VMIA 2ZI4A 3G0HA 2V0NA 5DBHX 2ZBFA 2IWHA 3R9XA 2VHTA 3PQ6A 3JZAA 4G0UA 3F98A 4M0UA 5KYUA 5A5DA 1TM3E 3RS3A 3KYCB 1L5HA 3VR4H 1CQZA 1DIOB 4MP8A 1NSTA 4GKVA 1NN3A 2C78A 3AJAA 5CXQA 1ULSA 3MOGA 1N6PA 2PYDA 2PNFA 4HWTA 5DI9A 1X1AA 2R5FA 5EFZA 2MCFA 4G1FA 4Q19A 1NJ1A 2HFJA 2J5XA 2ZTMA 1X7YB 3IALA 2YJTD 3KK0A 3AF0A 4PYQA 1YCDA 4RMNA 4JYCA 2XGJA 1NKVA 2WU0A 1RLJA 2ZYWX 3GEBA 3DE1X 3OU2A 3LT2A 5HMLA 2W8BA 2EX0A 5EHZA 4ZQHA 4HT3B 3M0EA 5FWXB 5KREA 5A7HA 1N2HA 4TS4A 1NF8A 3BMOA 4OV6B 4RKWA 3NKLA 1S8AA 4HX9A 3VH4A 1II0A 3ZVRA 1YQUA 2VAWA 2IKSA 2NT4A 2BIFA 1MD9A 4E30A 5CLFA 1FS4A 4BX0A 3QEJA 3EQ7A 4MW0A 3W3ZB 1V0JA 2UYOA 3BSSA 1Z5NA 3KKOA 5KTYA 2QTGA 4RPCA 3CKLA 2Z8YA 3C1OA 2IS2A 3BL5A 2GPNA 4XB6B 2F8SA 1RWWA 4WESB 3LPCA 2OO5A 3CFYA 2IRWA 1WZCA 1NSYA 4LVCA 3SAJA 3VKHA 3KOUA 1QK4A 2MWMA 4G25A 4AZWA 1AUPA 2UVQA 3EVTA 2IXFA 2A86A 4D3ZA 2ODWA 3P1JA 2R2GA 5C8VA 5KNBH 5DM1A 4QGAA 4FNGA 1J42A 3K94A 3CEMA 1W75A 4LWOA 1L4UA 4C2TA 3QJ5A 2AMJA 2JDIA 3TIVA 4EIWA 1GQOA 4EF4A 3IKTA 5EXTA 4QYWA 5KQRA 5K0BA 1OI2A 1UPTA 4JXZA 2N1BA 1EXNA 1SA0B 3IIEA 2FPPA 2H7YA 4K40A 4JBLA 4MQMA 4PO9A 1XDGA 4LG1A 1R4AA 3R6DA 3HE3A 3GLQA 1B76A 1C3VA 1V7CA 4QUHA 3DMGA 3ENVA 3IVAA 1FLVA 1HXHA 2J9YB 3DJYA 4CTMA 4CR7A 4OO3A 4CE6A 4ZA2A 1G5HA 1TF7A 5KUTA 1BYUA 1YBHA 1JJIA 1S3IA 2Z9DA 3STUA 1ODJA 4HBGA 5SV2A 3LC7O 3KT3A 5KEIA 3U6BA 1ZU4A 1KK0A 3WRYA 1F0KA 2FWMX 1LDNA 5DRYA 2RK4A 4E7OA 1OH8A 3UWPA 5IXSA 2VDJA 1CR1A 2KJQA 3HH8A 2VQ6A 4TL7A 4DXAA 3FETA 5BSVA 4OHXA 4D0RA 3TEFA 5CVCA 2G0AA 3A28A 3SY8A 4PE5B 4OLAA 2Q1TA 2VDMB 4JP1A 1C3XA 1YACA 4IF6A 2UYYA 4LVUA 4OQ4A 2ZWOA 5PGMA 4EHHA 2QIOA 2WF6A 1V95A 4XM1A 3EDCA 3I09A 2E5FA 2JD0A 5FL7A 1OX5A 1SOMA 4RVUA 4A1FA 3JVVA 3IAS6 4XD7D 3UO8B 5E7MA 3ZXXA 1KC3A 3TIGA 2BM1A 4D8VA 5A06A 4RHYA 3R7AA 2HRDA 2QD5A 3UMYA 3ECAA 1YB7A 3EIHA 3SE7A 4WGFA 4ITRC 1HDZA 2YOGA 1SRRA 2WZCA 3P4XA 4DVGA 2YVAA 3E05A 1PJLA 3I12A 1P6XA 2FSVA 2C4KA 1SXHA 1C9EA 4TUYA 5HCIA 1F9EA 1U2DC 5LA6B 3TQOA 4NBVA 3O2JA 4CCSA 2B82A 3LT4A 4EI8A 4YDSA 2W43A 1MBZA 4NH4A 2FG5A 4ZU3A 2RKOA 3E6AA 4N39A 2GHTA 4MCAA 4YJGA 2IUUA 4WZBE 2G82A 4ILKA 1O03A 3T94A 3DQQA 1CQXA 1P4AA 5CMLA 1QQTA 2BEVB 4D6PA 3KUKA 4Q9DA 3V97A 2IYXA 5DBGA 5F2OA 2XT6A 4OI4A 4LHVA 4A6PA 1JIVA 2VQEB 4U0KA 3IDQA 3QLUA 4U8HA 3R7DA 2J48A 1AKTA 3GCDA 4Q4LA 2QX6A 4MYRA 5I5GA 3ZTTA 1KI2A 1NVTA 1XR3A 3KUUA 2OK8A 4TV8F 4QOIA 4PCVA 3VNVA 1S7GA 4R6XA 1UZNA 1TEZA 2J59A 3NIWA 4KWEA 4QFDA 1U0BB 3WSTA 3AHGA 2YN0A 1VYTA 3JQGB 5AHKA 3HGMA 1B0UA 1SKAA 1VDMA 2VPZA 4ZQGA 1S1MA 1G8PA 2FW0A 2GXUA 1GCUA 2CK3A 4F8YA 1JHDA 1QONA 1E5TA 2AQHA 1HTBA 1NSFA 1O95C 1TRHA 4WCFC 5AP9A 5BV7A 2Y1WA 4UMVA 2B36A 3VTAA 3A27A 3RKUA 1M5UA 2JH9A 5E3IA 2QXTA 5I7UA 1P2SA 5AM3A 4I2NA 1NY6A 1JJBA 4ZQEA 4LYJA 1D7OA 2GA9A 3VVBA 2VT7A 4TT3A 5JAIA 4FS3A 2YS7A 3RJTA 3HJRA 3CRNA 1KNQA 2FB9A 2ZSAA 1D09A 5LXTF 4WLEA 3LF2A 2QA5A 3G6WA 4DW8A 4K6HA 1WZ2A 2ZQZA 5ENVA 3VU1A 3F71A 2ACWA 4W1QA 3ZNPA 3DAPA 3DE2X 4V24A 2YX1A 3DL7A 2R6ZA 4PG5A 4O2AF 2P4QA 1MIHA 4EVIA 1ZH0A 2I3ZA 4NCAA 3OIDA 1M66A 1EI9A 3IMEA 3QSGA 2C94A 2H9IA 5CDFA 1YZUA 4P80A 2G9NA 3CH5A 2XTJA 3ODPA 1C8BA 1YVEI 3BIXA 4DLVA 4C0QC 4A1OA 4TV8B 4G1CA 5BMVA 2ODEA 2PPVA 2NO0A 4C4OA 6Q21A 1EESA 1OPXA 4F0JA 3CNBA 3P27A 1FUIA 1UBHS 2YZ2A 1HGXA 4OHPA 3SQMA 4KIGA 1RQRA 3QLEA 5K4GA 1KWKA 4OY3A 1JTVA 2PUAA 2FE4A 1U5BA 3OVMA 5CX4A 1RM5A 1X7HA 2VPWA 1C4WA 1AN0A 1RRGA 2BN4A 2AUMA 3IDSA 1UDAA 4LOLA 4S0ZA 5ALFA 1EJ2A 1P4JA 4J1TA 4UHBA 4HUQB 2P4UA 4LHWA 4UBOA 5JDIA 5B30A 1YAHA 2CNDA 3G8CA 1RADA 4EO9A 4ZYUA 1E1QA 3EWNA 3Q85A 1TEHA 4J0GA 1XKTA 1MPTA 3GI1A 3O4FA 3ZHCA 2NVUB 2DUJA 3DLAA 1M0WA 4EY8A 3ZEIA 1FSGA 5IHPA 1AO0A 2QTNA 1C0EA 4IKPA 3KYIB 4BU0A 1XD2A 3C70A 3MBIA 5HKLA 1JPJA 2ZJ5A 1WMBA 1W4AA 3AEKB 2J7KA 3KHSA 5GOTA 1HE3A 4FHDA 4EA9A 5K45A 3AVWA 1TJ5A 1FZQA 1XELA 1CULC 4EHDA 1U0JA 4WBNF 2X77A 5KSYA 2J0SA 4CIBA 4MMZB 5H9VA 4K03A 1W46A 1WUJS 5FI0B 1RKBA 1GSOA 2AFHE 3C8MA 3TSYA 3T4EA 3PXGA 3AKDA 4RVSA 4EO4A 1IN6A 5J40A 4JLMA 2XOKA 2GAIA 1O5TA 1QANA 3B1VA 3ANXA 3OAAA 4DAOA 4NENA 4Z54A 4QOHA 4JK3A 2XUZA 4PANA 2D5IA 1HURA 1T2UA 1KFJB 3D02A 5FOXA 2YRWA 1XRNA 3I23A 1VIMA 4G65A 4KHPB 1KVQA 3LK7A 1FP4A 3BE6A 4UDYX 2YCLA 2FSHA 3VTZA 3ABOB 3D54D 5HE9A 3JU3A 4ND8A 4BX2A 4E21A 2I6XA 2XF8A 5I7OA 2JFNA 5EWMB 1RWPA 1RAFA 5AKEA 1IC6A 4HDCA 1E0SA 3T7DA 3OJOA 1SVKA 1P4GA 1XI2A 5EC8A 3V1TC 4JJZA 4Q24A 4JOCA 4JXKA 4RCYA 5JOQA 2CGEA 4CIWA 4INPA 3ZHUA 4F46A 1OYOA 3FZGA 3EJ6A 1E32A 4IV0A 1YH3A 1P1HA 3I6IA 1JI3A 2H06A 1WF6A 3OSUA 5J5AA 4MKXA 1FVOA 2B8TA 4M0KA 4DY4A 1G2OA 2G7MC 3CTMA 2H92A 3TUIC 4MRPA 2O4CA 3DAFA 4KMMA 4ARZA 4IKOA 4I55A 4MQLA 3VPHA 4MDHA 3HYCA 5A7GA 1LTQA 4N3AA 2VT2A 3MGGA 1A7JA 1RWNA 3V4LA 2ZITA 1X3SA 2FZGA 4KIUA 1KR5A 4A2CA 1NUAA 2N0SA 4KR6A 4FYJA 5JAUA 2R86A 4C5CA 4M60A 3HCWA 1IPEA 1JG4A 3L8YA 3Q6NA 2CHEA 5KTMA 2B6NA 1WUHS 1QRDA 4L27A 2RHGB 3NAQA 4NL4H 3D1VA 4U2BA 3GBSA 4MJXA 4N3BA 5AOBA 3SLRA 3OECA 3HVIA 3WWZA 4BFTA 4BKOA 3DBRA 2V9PA 3O31A 4KAFA 3L3BA 5D1HA 4BNDA 3G5MA 2O8EA 2ZCVA 3H1PA 3NVMB 1I4DD 1MB0A 4WZAE 1U9YA 1ZKMA 1KMCA 2V5UA 2X14A 1RXWA 2WIFA 5DNEA 1DFHA 1X7YA 5HBGA 2COEA 4GOKA 1DIBA 3KBBA 1LI7A 5FI3A 3RJZA 2WF7A 4KWTA 1XKQA 4H7PA 1C3OB 3L92A 1V4BA 3BWEA 2O0KA 1I3LA 1EUZA 1NR1A 1Z26A 4G01B 2BF4A 4PU0A 2G09A 3FFTA 4OXNA 3N2EA 2C84A 1DRJA 2YV1A 5MN6A 1ACJA 1SC6A 4IQ8A 3GPCA 1I51A 1SCUB 3GEHA 1D5WA 3P32A 4WK2B 1MQAA 1MPXA 1S4QA 2IP1A 2WUFA 3BMNB 4EENA 1DB3A 1I2ZA 1C29B 2HV8A 2VZLA 3BQNB 3DAOA 3QPVA 5KVVA 3T7KA 2CYCA 4WESA 4TKUB 1CUXA 3KZKA 5AKLA 4D3FA 3PC3A 1YXMA 1TXGA 3KZNA 4J6FA 5EQJB 4CL2A 2O3TA 3FIUA 2W42A 3D6NB 3PGA1 4JQOA 3WICA 4EFDA 1Q0RA 3D6AA 2BRUA 2IGBA 3U4IA 4MYHA 1R7RA 4PZ9A 2CDNA 3WQBA 3ZUGA 4MQBA 5KYWB 1NMEA 2RGDA 3E9QA 2P0AA 3F5SA 4L5IA 4NJOA 2GKSA 3L0BA 4LI0A 3N2NA 4CW7A 2C88A 3SIXA 3TZ6A 4KH1A 2X22A 2ZYAA 4U7PB 1YVDA 2CUTA 2ZI6A 4ZYLA 4TYNA 1B15A 1K8QA 3MQ2A 4G37A 1Q3TA 1LRJA 1UM8A 1U7PA 2Y1GA 4FHGA 4IIGA 3GEDA 4QREA 5CD9A 5C52B 3T3PB 4UXJA 1QFYA 4MHSA 4TTPA 5IT0A 4XGNA 2QRJA 1L7OA 1XTRA 4YI3A 2WPDA 2QWXA 3IELA 3H11B 1ISFA 1DTSA 1W49A 5EQDA 1N32B 1N0UA 4M9CA 3TOCA 1SXPA 2D62A 1R4NB 3I6QA 2CDCA 2IY9A 2C97A 3M6AA 2OY0A 3ZZMA 2RHMA 1GEEA 1FUEA 1GGVA 3RFTA 4CF3A 1NTRA 1BXRB 2B5WA 1TZBA 2HCRA 2RHCA 2IYTA 2DQYA 2Z57A 3ETGA 2BI8A 2VJAA 4UFPA 5LQCA 2WD7B 2WU1A 1OHHD 4EATA 1P60A 2WVAA 5CG1A 3RF7A 3NXKA 4MV4A 1ZJWA 4PGFA 1RYZA 5K6AA 4QHTA 1L1QA 4MARA 5AR1A 3W5UA 4AI6A 5C5IA 4HQRA 4WBNB 3FR7A 1H5NA 1Z5UA 2OL4A 3FGNA 3MTBA 3QUSA 4IBOA 3A9RA 2J6CA 2ZYHA 4GO1A 4JMPA 5CT4A 5E8RA 1HE2A 2Q4DA 1A5AB 3CSUA 3OJWA 4LK2A 4OJNA 2WWXA 1JR2A 3K53A 4CM3A 2JGNA 2HK6A 5AKIA 2HSZA 1G9TA 4A23A 2A92A 2UXDB 2C9YA 3UCEA 4KZPA 1ECFA 4NE9A 3UT6A 3WNZA 4CN9A 3VZQA 5KJ6A 3CLUC 3H83A 1RRMA 3I9LA 1RC0A 2BFBA 2OORC 3KE9A 4LXQA 1TVMA 4P2BA 2JBAB 5JZ9A 3OZSA 2PWPA 3NX4A 4DDVA 1EZ1A 1POXA 1N33B 4RY0A 2J9FA 3W5VA 1VYHA 4UUMA 1OLSB 1E3SA 2Y8EA 5KQGA 2D3WA 1OI7A 3MLBA 2XSZA 3SX2A 5KWEA 2CZCA 1X38A 2VNKA 3O8DA 5L3VA 4JI1B 4NYIQ 1TMGE 5CVVA 3WGNA 2VQ3A 1K9SA 5TGZA 5KYKA 3I6MA 1VIYA 2N3ZA 2FSVC 3OH8A 4E07A 3AQ4A 5JBIA 4DLXA 3FTEA 2XRMA 5F33A 5IABA 3Q8LA 4NCKA 3GD5A 3OZEA 2Z6VA 4IJMA 4FSXA 5CCBA 1A0OA 3PSHA 3SDSA 4FNMA 3VOSA 3GDOA 3M9WA 4NONA 1KY3A 1Z4JA 3OKFA 3CW8X 4FGUA 4FZRA 5L3RA 2NUAB 5B2EA 3AESB 4YMTA 1ESMA 2NO5A 3PE3A 1IN5A 4H35A 5CNJA 4WKNA 5DKFA 2R7NA 4YRTA 4XIYA 4KXXA 3LOQA 4GDFA 4MRRA 4GL2A 2AN3A 3QP9A 3SF8A 1DWUA 1GXSB 1LTKA 1SAYA 2NSDA 2EQ5A 4PSDA 2P6RA 4GRIA 1VMEA 1EX7A 1G6OA 1NRIA 1E2MA 2JA2A 3CT6A 4X5OA 3S55A 3N75A 2BR3A 3OT1B 1K7FB 4LF8B 1GGJA 2VJMB 3ZLVA 3VZBA 4LHZA 4RTRA 1H4TA 3FAZA 2VK4A 4YAJA 4CL3A 1DCKA 4CMBA 2ZBVA 5FHQA 5B55A 3R20A 5AI6A 4MQ5A 3TM5A 3WJ1A 5B5SA 5HK8A 1KKLA 4PM4A 1QYVA 2FQYA 4IEEA 3NOXA 1U63A 1EK2A 4LFBB 3BIFA 4L9RA 1FX0A 2CLDX 1L4MA 3KJGA 1BRTA 4O4LA 4R1LA 3MNFA 3UV7A 1C80A 3WKAA 4I81A 3DBOB 5BN5A 2VEDA 4TMXA 2BDUA 1ZINA 3WLQA 4BLTA 2FWRA 3GT3A 3FSRA 4DA0A 2IHTA 5EFOA 1VI5A 3VZDA 3EZFA 3VU9A 2AD1A 3KXKA 4HZUA 4ERNA 3EXG1 1E0DA 2XBLA 4EKYA 3PX3A 4F85A 1XKLA 2AG1A 1YOVA 4TWIA 2BMDA 3H87A 5JSFA 4BNJA 1GTZA 1UP7A 2GPTA 2WJYA 3FYSA 3O38A 4IO1A 1MGOA 3SVZA 1UMCB 4ER0A 3FMIA 2OV8A 5AHOA 4J0KA 4H6XA 1AGYA 2I33A 4IMRA 4PQFA 2AOTA 2R7MA 4QDUA 4ZVSA 5T4FA 3RFCA 3SZOA 1CLUA 2K7FA 1NNSA 3QX8A 2CXPA 2I22A 4Z4EA 1EEHA 4Q7EA 3NB0A 4M99A 5IEJA 1E5DA 5FL7D 5DP2A 3L8CA 3LT0A 4ITVA 3MTQA 3THOA 1QH9A 2YWRA 3GIWA 1SG9A 1IN4A 2LP4Y 2PKEA 3I9NA 2E4YA 3ORYA 2DQKA 1ZH4A 3N1UA 4FE4A 2QG4A 4OHKA 3RU9A 5BYBA 3JWEA 4OF4A 3M6LA 2ZS8A 3H9UA 4AWBA 3FOAA 1JVSA 3WDSA 1XYVA 5BUSA 3O93A 3PFGA 1QVAA 4WCFB 3TQFA 2YMPA 2J6IA 1PD1A 3NC1C 1QFJA 4N7BA 1V3UA 5KNBD 3C1UA 4RXTA 4ZVMA 1HNXB 3RI3A 2OBYA 4Y30A 2QTTA 2CE7A 4RSRA 3QG5A 2QVBA 4AZ3B 2FQ1A 2Q0QA 1T3LA 3T52A 2SKEA 1TGYA 4JIGA 2GAOA 3KXPA 5IU6A 5LPNA 2QJOA 3E5MA 2Y77A 3IA2A 4M1ZA 3K1ZA 1V37A 1VKRA 4YECA 1TYBE 3I2GA 2WHXA 4NZZA 4X64B 1WY7A 4F06A 2O5RA 1NQTA 5BN1A 4R2HA 3TAUA 2VDUE 1ZJYA 2F2TA 3TNDA 2GCGA 5HFNA 3TOXA 621PA 1MB2A 3E4DA 3C2QA 4FYIA 4ZANA 3IDZA 1NBAA 2ZUDA 4NYMR 2Y0DA 3S1AA 1J8DA 1W0KA 3FLEA 2EP5A 4FSDA 2GNOA 4RK0A 3W5JA 1S96A 1RI1A 1Y1SA 3PNYA 5AJHA 2UAGA 5JEEA 3PJEA 5HX7A 1EBBA 3M4NA 1CY8A 4MGEA 1U11A 1U4NA 2PCLA 1RAGA 3C39A 4BO9A 4DDUA 3I4LA 3MSXA 1XZNA 4KGZA 2RGCA 5JZSA 1SUDA 2OMKA 3MJDA 3BUSA 1PJ2A 4IGEA 4UOQA 5MFZA 2C96A 1HDCA 1NHGA 1F2UA 3GELA 1JNYA 1GG2A 1P6QA 2IP4A 4M0MA 5TPZA 3VDMA 5DHQA 5HJ7A 4MOWA 1DELA 2BDEA 5JHGB 1W5BA 4JBIA 2YS6A 1ZIOA 3S8MA 3Q1KA 2BYTA 5IM4F 1I7NA 1AZTA 3BX1A 3BT7A 3UIEA 1I5EA 3FKSD 3IBTA 4P0QB 1KZ4A 1EDEA 4QIHA 1RPAA 1V1RB 4DUYB 4HS9A 4LQ4A 1RRPA 3RVKA 2IU0A 3W34A 2YUIA 4LXXA 2JJ2A 3TBHA 5JRJA 1FTYA 5TE9A 1Q12A 5EOVA 4KPUA 3S99A 3ZIAA 1PJ3A 1AV6A 3E8MA 2B5VA 5SY6A 4YCAA 3VSBA 4NXMB 1K88A 5HDQA 1Z4QA 2BHNA 3KE8A 3TFOA 2FF7A 1DHRA 4QPPA 1AB6A 1T9GS 3IAM1 2BFWA 2QI9C 3PD0A 3WGMA 5C2JB 2PX4A 2AF4C 1EGAA 1PYGA 3CEHA 1F17A 3I92A 5T64A 2W2VA 2Z2IA 3MTJA 5JC8A 2VNAA 1X1QA 2UZ1B 3HCPA 1GGEA 4A3SA 3DTNA 1OA1A 1G5IA 5JCOA 5T6MA 1TYAE 2XTZA 5KNCH 1FBNA 1JLSA 5ALJA 1JDJA 2BW0A 4O5AA 4V0LA 1UC9A 3WLMA 5LWHA 5C8YB 5FEMA 1L5OA 1TO1E 3B8EA 2YFYA 1XCMA 3EPRA 4LQDA 1FJXA 2J4CA 3THSA 1I6MA 2OBLA 2WUEA 3R3ZA 5LZ5A 5CDFE 3IIJA 3B9PA 3KWLA 4HN2A 1RQPA 2B78A 4LJ9A 4K9DA 4TKMA 5LP6F 1CUIA 4AXBA 4TYYA 3KKEA 4OKIA 3F5DA 5AUNB 1HDGO 2GHRA 4E13A 3GJRA 1R10A 2HDNB 4MRVA 4KUEA 5FULA 5MN5A 3IAXA 5HILA 3DG9A 4J91A 1Y3AA 3O8QB 1M2OB 3FSGA 1B3RA 1X6VA 1C8KA 5ALGA 5EIAA 5FOTA 1GG8A 4MA5A 1U5CA 5BQPA 2Q9UA 2EGHA 3AB7A 3OJLA 3A2MA 2FPUA 4K8OA 3I62A 4RYDA 3RM3A 2WNSA 4KU4A 3CWCA 4Y1RA 3HZRA 4IUCS 1BWRA 1WETA 1Q0SA 1SN7A 2KBFA 1Z35A 5EYPB 1ZY2A 4DQUA 3GVCA 4HQNA 1MOPA 2QIPA 2AFIA 4IINA 4L50A 1BSVA 1DQZA 4W4TA 2P9TA 4YRLA 5FUBA 4BP8A 4EMBA 1RM4A 4WA8A 1ZAYA 5EJ5A 4N3CA 3RABA 2OHXA 2FHPA 4RD3A 3KS9A 4BMPB 3G1UA 1Q2XA 3C3KA 1IHYA 3FPFA 1Z0IA 1KO4A 1NLFA 1E2PA 2I1VB 4X20A 2BF7A 2W5UA 3IULA 1E7SA 1FTWA 3OQMA 5EY5B 4B6QA 4MR8B 2CNWA 2FPLA 3A04A 2PT9A 2IXBA 3LY7A 5FADA 1YBFA 3I2KA 3R76A 4JI3B 4CF6A 1JLMA 1HUQA 5KSWB 3WLFA 3W5IA 4NOJA 4WX2B 4AFNA 3UJ9A 2ISSD 1LC3A 4D5EA 4NBNA 3L0SA 3JQ9A 5I9MA 1N9KA 4NBTA 1QS0A 1EG2A 3CH7A 1OTXA 2DXIA 4WADA 4HL6A 1T4GA 1LNSA 1OXUA 3WGYA 4C7KA 1SQ0A 2H52A 4QYIB 1DDOA 4U3JA 2O3UA 3UFXA 2GVNA 3IOBA 3ZDXB 3U7HB 4IX1A 1X3LA 3SDBA 1YTLA 2RGGA 4AN0A 4GVLA 4UHDA 2JGKA 4RPLA 3AW9A 3JQRA 5G40A 3WKDA 4QHYA 3M1IA 2ZR9A 4H4DA 2ZCJA 2P68A 2OXEA 3LX4A 1IRXA 2Y3IA 5E7JA 3CEJA 3DL0A 4EEKA 1IEWA 1PEKE 3SIRA 1ECPA 1Z4LA 3H4TA 3JD2A 4WAUA 1V6CA 5I8ZA 4AWAA 4Q7QA 3B52X 4N0EA 1XQVA 4GFDA 3RARA 2FMFA 3Q3JB 3ZN2A 1GAJA 1LI5A 3BERA 3FLMA 1K8YB 1T4MA 2FX2A 3BFVA 3QUQA 5CA0B 1CQIA 1YIOA 4FFMA 1KJYA 4ENWA 2NPOA 5GGXA 2RK3A 1FEZA 3KRTA 4KSCA 1R6TA 4ABTA 5JNLA 2BTQB 2BELA 1PFYA 3KR9A 3TZQA 3AKZA 2X41A 2OORA 3LQ4A 2O3RA 1U7UA 1WOYA 5HF5A 2VK8A 4PS1A 3AP3A 2RGRA 5LC1A 1E3EA 3HZZA 3WLRA 1N8TA 1ENPA 4PNZA 3G1WA 1H69A 4GECA 1PL6A 1VXOA 1ZM3A 3BH6A 3K5HA 1XTJA 3G8BA 3HEMA 2YBDA 3DVLA 4A5OA 3V2GA 1NRXA 3GU3A 2JPDA 2QLLA 4PLHA 4QBFA 4X63A 1ZIYA 4ZCMA 3TVTA 4TVSA 4BGUA 4NBUA 1A9ZA 2BE7A 4MUKA 1JIXA 1JEQB 1P19A 1SIUA 2D00A 1UBRS 3FFBA 4GYYA 4AN1A 4D8YA 1QH1A 3PNSA 4KK4A 4CMIA 3QV2A 4OX9B 2PJRA 4W9MC 1J33A 4GXTA 4B2LA 2WSYB 1IN1A 1UJMA 4G4SP 3RBAA 2ZT6A 1V41E 1XEWY 4YUAA 4M8LA 1IEVA 1VLHA 3WGUA 2VDPB 4ABYA 3CEPB 3KVYA 2H5IA 2JJ1D 1M2JA 4CG3A 3NHRA 1M6VB 2VNIA 3RVLA 4B81A 4R1PA 1CR0A 1LLQA 3SSAA 3DBLB 4WXMA 4XIJA 4H59A 2W7TA 3OO0A 1TC1A 5ESDA 2H8GA 4H77A 4JP8A 2ATVA 4CDGA 4H7FA 3RANA 3DC7A 3EYAA 1RZVA 1JKJA 3CZPA 3ONEA 2HNAA 4HDNA 4WNAB 1M0SA 3GUVA 3UMJA 2HW8A 2DRIA 1R6DA 3UC9A 1P9RA 2AEJA 5CTAA 2NTJA 1WXGA 2HJRA 3LX5A 4YCCA 2BMEA 1B3BA 2QTCA 3HFRA 4L57A 1SC1A 2AI3A 1U3UA 1UJBA 1EVLA 4Q39A 4RVHA 5DBEX 4TRJA 3ZHOA 2VHEA 3CLVA 2FR1A 1RACA 2GT1A 3EOZA 3KLOA 3KPUA 3HWSA 4GL4A 4TSFD 1PT8A 4WPGA 1L1EA 5G0WA 1RPTA 1Z8NA 4YPVA 1Y8RB 3UZUA 4FBMA 5KYTA 2NZJA 1XAHA 3S29A 3LY9A 2IS1A 3AXSA 3TSAA 1XVUA 5J4HA 2G67A 1SXIA 8LDHA 1NVVR 2AI1A 1NASA 1NW3A 3OWXA 5A3RA 2GO1A 3TLJA 2DOKA 4DCSA 4MCHA 3LT5A 3DP9A 1OWPA 1Y37A 2F1JA 2HT6A 1XFAA 3SEQA 1EU1A 4C6HA 4BCDA 3RKRA 3T7IA 3CLSC 4A0FA 5KYYB 5CNKA 1YQWA 1F3OA 1KMMA 4AJNA 3UPTA 3E9CA 1GU7A 4IILA 1I3KA 1LVGA 2Q46A 2IPNA 2XVMA 4I4TF 3U60B 3JD1A 1WOMA 4MEAA 5B58T 2GA8A 2Q6IA 2RKBA 4W5JA 1C2YA 1YS9A 1T8YA 3E22A 4JUBA 4K81B 1RWOA 4P3KA 4RV9A 1NXPA 4RE5A 5IZCC 3VYSB 2BM9A 4F60A 3RAEC 4OU5A 2YV3A 4EQ6B 1Y6ZA 2VYCA 4ZVTA 3SOPA 1WE2A 1YI8A 2VHWA 4RZSA 3AJ9A 4JJKA 3JTEA 4C0HA 1J8YF 1EZ4A 1CXZA 2PZ8A 3DMYA 3T12A 5IJ9A 2IY7A 1GTVA 2OYSA 4JYZA 2H48A 5COAA 5HJ5A 4EJ2A 5M5BA 1V2HE 1X19A 3FD8A 4JQSA 3V7FA 2AQ8A 2BLNA 1FRZA 2QTVB 2V98A 5ARCA 5AVJA 4UVEA 1BMFD 3BQMB 7GPBA 1RMYA 2A5FA 4ZOCA 1WULS 1XU9A 3GEEA 3GN1A 1O97D 3TG2A 3G6KA 2QDKA 2PS1A 3A06A 2GXAA 4RMJA 1GGKA 4TV8A 1SC4A 1XZFA 4WNYA 4XVRA 1CVIA 2A5JA 2WA1A 3CTPA 5G3ZA 3EZNA 3U39A 3VNQA 3R40A 2OV6A 2AXNA 4KLZA 1I24A 2VQFB 3T9AA 5A3QA 3LKBA 1ZHFA 2C1XA 1UAYA 4FMCB 3KSZO 1NVFA 1XB2A 1JIKA 3AERB 4BVJA 4DLSA 3QXGA 3PGXA 1X94A 2ZDGA 4N18A 1ZSNA 3IUPA 5FJIA 1Z7GA 1XHLA 3WLNA 2B83A 4OCZA 3TGLA 1Q1QA 2BZ0A 1RHRA 2H4JA 1SQ6A 2OV1A 3HJBA 4JLDA 4LNHA 1R18A 4RIHA 4UMFA 3ZHZA 2QB5A 4JS0A 1KSJA 2O1XA 1P1IA 3R5XA 2ZSEA 1R0XA 1YNSA 3CNQS 4R0NA 1Q5PA 2EYQA 3ZH2A 1OLXA 2VBFA 1QQ6A 2D2VA 3PU6A 4NMWA 5F51A 2OFFA 5CITA 2LNDA 3E1KA 4KO1S 2VPIA 5EE1A 5GJWC 4BQFA 3ITDA 4HNVA 5BV2P 1MW9X 3PPVA 5FORA 3IEVA 1H6DA 2O0HA 2VF2A 1VJCA 4RH1A 4H27A 2ZWAA 3OO1A 4BVBA 2XW6A 4CDRA 3CV3A 2O59A 2XZTA 1P7CA 2ACEA 4FOTA 4JLJA 3HY6A 4EG1A 1S7CA 4Z49A 1HM5A 5B2FA 3I2FA 3OU6A 4MA0A 5JECA 3I45A 3ZDYB 1JXAA 1YR8A 5TVGA 4AS1A 4C3OB 4NCNA 5B12A 1YJBA 4GXRA 5I7HA 3DHNA 3F1KA 5JAQA 4CUKA 5CLJA 3BN3A 4RJ2A 5ES4B 3OAAD 4ARIA 2AC7A 1Z2DA 3SR0A 3OA2A 3W1VA 3K71B 4HP8A 3ZWPA 3PA8A 4F96A 2JJMA 2BUAA 3WB2A 3PR1A 4D8XA 1PJQA 5E6SB 1RMTA 3DAYA 4LHSA 2Q2VA 2X6RA 3PHGA 4MVJA 1QZZA 1FQKA 3COZA 3DPIA 1QG6A 3L7DA 3VX4A 4DIDA 1C7EA 3PNPA 3LVBA 5BSHA 4Q66C 4G9EA 5EWMA 3TNFA 3WQHA 2GKOA 2I1QA 2ZVJA 3T3EA 3CA8A 3WZLA 5IDXA 4DNOA 3GGPA 1HEUA 2H0AA 2HJGA 3OPYB 4BWYA 1US8A 2PX2A 4BO0A 1THZA 2EYUA 3VDQA 3WR5A 4A82A 3ZWYA 4M76B 4FZJA 4K6GA 1J09A 3ZZ0A 1KBOA 3V00A 2G77B 3O21A 4C5BA 1Q7GA 5LQDA 3QOWA 2JFOA 2CLFB 2P6OA 4X92A 4BAZA 2IPLA 5EXSA 1V5FA 3NBZC 1VZ3A 2FOLA 3INNA 3HPQA 4HYTA 4AJ9A 4D98A 1OZAA 2PU7A 3K72B 3NHUA 4WLVA 2F48A 2IIBA 2Z5VA 1WD7A 3DCJA 2LCQA 4JLPA 2QN3A 5CFRA 2J5BA 3L1KA 3AXTA 3VHLB 4Q3LA 4B34A 2WKWA 4QDOA 4RKYA 4NCXA 4KLCA 4KQMA 4HV4A 4QA9A 2BOVA 4UDOA 3IODA 5T4BA 4E4RA 4C6TB 1UBGA 4Z4IA 4FILA 5JCPA 1JF8A 1DBWA 1O77A 1JG1A 1WW3A 2H5EA 3DBRB 1CPYA 2ZIXB 1XDDA 4OGKA 5ITSA 2ZAIA 5BMOA 3DEKA 1T9AA 2WFMA 1JA9A 1QFZA 2CFSA 3GJSA 4CLOB 1ZOIA 1ZK1A 2QM3A 1ZXLA 2OO3A 3Q5GA 1COZA 5CFPA 4RHUA 1D9XA 4OXXA 3MAAC 3PFBA 4TUYF 3OQIB 4J6EA 2FGKA 3U0VA 4YMLA 2D8AA 2NO9A 1LSSA 4AG3A 1F1BA 1T5LA 2CJWB 2CLSA 1H2AS 4MR8A 4P3OA 1WTCA 2C07A 1PGNA 8ADHA 1FRNA 4PLGA 3Q3GE 2G72A 1AQYA 1X7ZA 4DJTA 3K32A 1MX3A 3LLMA 2P2GA 4WGGA 3O2SB 4P4SA 2PA3A 4MB0A 5T8KC 3D8UA 3HB1A 1QE0A 4IIBA 5CH8A 2PUVA 1HYGA 3U17A 1P2DA 1GGMA 3LQFA 1E69A 3DVAB 2HDOA 3ZJUA 1CYEA 2PTHA 2IIQA 1FNMA 3P0RA 2CXHA 1GRRA 1GGNA 3I05A 4V0RA 3TRFA 2A3RA 1Z2EA 4ND7A 3D31A 3E9DA 3G0BA 5CHYA 1XSEA 4CKBA 3KQUA 5C5CA 2OKCA 3R9XB 2EKZA 5G1NA 1F48A 3AO0B 3NRCA 2Q5IA 1KWGA 4YUZA 3ITNA 3NHLA 4L7QA 1PVDA 1EE9A 3OOJA 2XHEA 4IYJA 4MVYA 3LI2A 4PF1A 1V7QA 4UUQA 3AHEA 3C6KA 4K1XA 1GG9A 1LK5A 5DTJA 5ADVA 1FYFA 3Q87B 5JWOA 3S5JA 2GFHA 3P2KA 1CU1A 1MO2A 2XZLA 1LX7A 4YDRA 3RCBA 3ND7A 1NQAO 3WJ7A 1M7HA 4JT4A 4J2TA 1OF1A 2F3TA 4BJ5A 4DIMA 1BXGB 3KJEA 1YR3A 1SU4A 1A8PA 1AUXA 1BGVA 1ZEMA 2CUZA 2SKCA 3AGPA 3I9KA 3JQAB 4KNWA 4PYMA 5CFQA 1AMOA 5JCJA 5C5DA 2L18A 1QVVA 3HV2A 2QP3A 3P4UA 5CPFA 2JFVA 4PQEA 4DZTA 2I4MA 1AKYA 4N54A 1G3MA 2HADA 1J7JA 2B2NA 3MJTA 3QYAA 1EGQA 5DX0A 3ZCPA 2GEBA 3FZEA 1P9OA 4Y2TA 3QYFA 2W37A 3QUBA 3UUWA 1XTSA 4B76A 1TRKA 4IRMA 2IYLD 1QGOA 2D7JA 2ZBQA 3I5AA 5ENDA 4FDMA 3F2VA 4NPHA 1LBHA 4JB8A 1ILWA 1I2MA 1RYEA 2LR0A 1ORTA 3IUNA 4PLTA 4U2CA 2XT9A 2H1OA 4F93B 2YY6A 3ZKAA 1PHPA 3NGLA 1VDZA 3VKFA 5GIOE 1MTOA 2GB4A 2H4HA 4Z1MD 1Z2AA 1W2WB 2O05A 3K0KA 3F9IA 1N4DA 2GM4A 1YVRA 3E03A 5LP6C 2QRMA 1G41A 1MJNA 4JHLA 3A1FA 5JW6A 3TSZA 2ODPA 3LGAA 4ZGBA 4DARA 2CMKA 1SA0A 4WZ6A 2XMGA 5HIJA 3AY7A 4HNAB 1HFWA 1SQ5A 3FUTA 1VBKA 3GNTA 3PCXA 4LQCA 3QY9A 5LP1A 1B74A 2IYSA 2QZ4A 3A6DA 5JV5A 3X1ZA 2GJSA 1UWLA 4ZVRA 1RWKA 4TV9F 3V9AA 2RHDA 4S1VA 2HLDA 4E2ZA 2Y71A 3AEUA 3AZQA 1TECE 3WK5A 4CEIB 4YRNA 1MB4A 4RJLA 2G80A 3CWZA 1JHQA 2ZJZA 2JCVA 3GJ0A 3OLWA 4KQ2A 4OFBA 5CB4A 3EZYA 4QUAA 5JIBA 3NONA 1JHXA 2VN8A 2ZIFA 2EDCA 1ODCA 2PZLA 3ZQ4A 2PGXA 3EN0A 1MRZA 1P2GA 1O94D 1T24A 1G6Q1 2R96A 3ZGOA 4ESOA 4EYKA 3N2KA 5D5QA 4Z0NA 4R0MA 5JT1A 4HGOA 5EIOA 5ITVA 2HUPA 4Q1DA 2AXQA 1I32A 5SZHB 2YXBA 3PQFA 2P40A 1XVIA 2YWXA 3TJMA 2AN1A 2AN4A 3NOVA 4KE7A 4I5GA 1YA4A 2HY7A 1SB8A 5FL3A 3L4SO 4YRSA 2OCLA 4RY8A 5JXHA 4B6PA 5CM9C 3HB5X 3X2EA 1TZ2A 2JRLA 3WNCA 1CK4A 1OWOA 1PSWA 1N2CE 2DPHA 2TS1A 3MT8A 2ORED 1NDHA 1NXXA 1V16A 3BCUA 4RZ3A 1J8QA 2C9BA 3V8VA 3FBGA 4DUGA 2WHRA 1XIVA 1OQAA 3FYUA 2SKDA 4R0VA 3ZNNA 1J00A 4M7OA 4I2VA 3ROGA 3AFGA 3VKUA 4B0OA 1L5LA 3SC6A 2PFKA 5A6SA 1H8HD 1PZMA 4OLFA 1BDHA 2Y68A 2CNNA 4PHTA 2V7PA 3X1MA 3IXMA 3O8NA 3R23A 5LBIA 5LB4A 1XPRA 2ZIWB 2IZ1A 1G2QA 1JQLB 3F4KA 3WV4A 4LVNA 4MS1B 4CN8A 4UMDA 2YHBA 1TM1E 2NZXA 4HI0E 4XDGA 1VKOA 5F9FA 4CKZA 4DJJA 1Z47A 2ERXA 5FAKA 3CVYA 4MGIR 5HRUA 3A6FA 1GILA 4RCVA 3N53A 4DSTA 1TVCA 1A9OA 3IT2A 3WWDA 5AK4A 4BCBA 1WJGA 1USVA 3MWLA 1W73A 3NZEA 6AT1A 1VE7A 3GPDG 3N59A 2IK8A 4Y2XA 3TEMA 3I0MA 1FRVA 1GN8A 1LBTA 1EZZA 3FDFA 1T2VA 1YU6A 3I8OA 5C31A 4QJ3A 4MYUA 1C7JA 3EUEA 3K8ZA 1ECGA 3JWIA 1L3IA 4FLFA 1U0GA 1HBJA 3L77A 4AMUA 5ALXA 4L95C 3IKMB 2W00A 3ROKA 3PDJA 3F0TA 4Q3BA 5FFNA 3DTYA 3TTXA 1UBJS 3T3IA 3WQRA 3FSJX 3KEFA 1DDGA 4JFAA 5EEGA 4ZREA 3OCCA 4OSPA 3W8DA 1Q91A 2W2XA 4OJQA 3TXAA 4FUQA 5JSQA 3OPVA 4Q9HA 2WAAA 1QIGA 3UMVA 1WEKA 2OSBA 2UXBB 5TB5A 2Y99A 4ROSA 3ZIDA 3RF6A 1MV5A 3MBOA 3NHWA 4P36A 4V1CA 5EIBD 2DBRA 2JF0A 4F4CA 1SWVA 1Z74A 4TTAA 5JDCA 3VV3A 1DAPA 2QX7A 2ZREA 3HB4X 1RM3A 1FXUA 2PGOA 2Z2YA 2D1QA 1VP3A 2CMGA 3FDIA 3N7TA 1PW7A 4FMPA 4HAVA 5AW9A 5LMNB 3WL5A 3VPXA 1B6RA 2MSLA 4Z9AA 4HZGA 2CC2A 2V7XA 4A26A 4B6JA 5C1IA 1JH9A 3U4CA 4KXWA 4BLPA 1B6GA 1FX1A 1WVMA 3HVJA 1ZJ5A 3IJRA 2J3IA 2JL1A 5E1MA 2GK3A 3EE6A 4URXR 4EF5A 5EXPA 1Z25A 4JSYA 2QZPA 3GLFA 2O8DB 2N75A 1XAGA 5FBRB 4QGFA 4MUBA 2PR7A 5TLSA 5FD8A 3VAYA 1RWQA 2ZJAA 2ZRCA 4OGWA 4MMYB 3DBVO 1T3SA 4I3HA 5K6RA 5H8WA 2C77A 4E46A 4ICIA 1EFLA 3HUEA 3GAFA 4FPXA 3FX2A 3BB3A 1LY1A 3L43A 5F3DA 4GLJA 3E1GA 4J3NA 3NAMA 3WLLA 1Q20A 4HPWA 3ZWNA 2YXPX 3NYQA 2KPOA 2PPLA 2ZSDA 2R8EA 3C16C 1W1IA 3EZXA 1HG0A 1PZNA 2COKA 4URVR 2ZRNA 5G2OA 3UJ8A 3BA6A 1X39A 1ICIA 2VRCA 3L8DA 4CETA 3QVJA 3AK4A 4AW9A 1VCNA 4HNSA 1XFDA 2B2XA 2JGIA 1EGVB 2EHJA 4Y0VA 4CFYA 3GEIA 4L5AA 4P81A 1ULAA 5L95A 5LLSA 3TQIA 4NCBA 1KORA 1QYWA 3BD6A 2HMWA 5JXGA 2QRKA 4EPWA 2WMNB 1K66A 3BXFA 3ADKA 5G0SA 4DMLA 3MF4A 3UB2A 2REOA 2O7VA 3TTVA 1NNEA 3LU1A 2R8RA 2EJUA 3AVTA 1KFBB 3H2ZA 5CH5A 4J16A 1NXVA 3DM9B 2QYOA 1WA5A 1PP4A 1AA9A 4MMXB 1EGMB 5EUCA 3ZV6A 1SCIA 1Q0HA 1VG8A 1W44A 4Y2SA 2XMPA 1CS4C 1U1IA 1JDTA 1Z3IX 2R84A 1NVAA 5BWCA 4MUFA 3H0EA 4QU0A 4CL8A 4OHYA 1CX9B 2UZ1A 3DOFA 2YHAA 5DW0A 3H2SA 2H3EA 3KC2A 3M6VA 4LCJA 2RGEA 3IQEA 5DTEA 1DGQA 1QDUA 2EL9A 4KXYA 3CZAA 3RV3A 1PKEA 3TW4A 1GPMA 3G5AA 5EZYF 1ISIA 3RK4A 4PO3X 2XWQA 4BFZA 1OKKA 1E1MA 2W6CX 3JZMA 1I3NA 1E2QA 3KAQA 4M0PA 4UEKA 1WCIA 3PBKA 1BYIA 3OTWA 2X3UA 1XMIA 5CP8A 2AWNA 1KEEB 1HRDA 4WNIA 3F78A 3CUTA 2CBZA 2AL7A 2IOFA 4EEZA 3DD5A 2PXHA 1FDUA 4JWKA 5BR7A 4RULA 3B1WA 1QRTA 3UTDA 4F1WA 2IH4A 3AC0A 3H65A 1KVTA 5FWYA 4PFSA 2PUGA 1N1GA 2WG2A 5HMMA 4AN4A 3VR6D 1TKRA 5HG0A 2JBHA 3I0ZA 3MPOA 3QU4A 3L8MA 1E9FA 2JFGA 4IW3B 1PI3A 1CUSA 1IHPA 3GZTB 4XQ9A 1ZFNA 5DMHA 4RPGA 3CBQA 4PNHA 1DEOA 4UM8B 2D6FA 1UBCA 1WX1A 4RABA 1GL3A 4WASA 4BXOB 1TO2E 2J3KA 3MPUA 3VX3A 4QRIA 3NM5A 4XB2A 3I1FA 3VUFA 5BN3B 2INGX 5HW0A 1P39A 2OFPA 2X8JA 4MAAA 2VP5A 1DX6A 3F90A 1DV1A 3WL8A 4LSMA 3DOOA 4LRQA 4UFNA 3JSXA 2XYVA 4IOKA 2XNSA 2FRXA 1BJTA 4ZI5A 1OWMA 4BO5A 3QX7A 4JLKA 5JD3A 3R74A 1GP2A 3V6LA 2DERA 1AGXA 1KEZA 2X86A 4EY7A 1KC1A 1JDBB 2NVOA 3K6KA 4ZKDA 1LJ8A 1YASA 1T4DA 4AULA 5IM5A 2ARKA 4BUCA 2IUTA 1NX6A 1GARA 2X0JA 4QXQA 3O8RA 4R3WA 4F1JA 1QLHA 2RAUA 2ZJYA 3D2CA 4RMHA 1SHTX 3IVRA 4TSRA 1RQ7A 1Y4UA 5CT8A 1VBFA 5IWCA 2P2YA 4OREX 1BE6A 2YQZA 3C5CA 5HM6A 3LVFO 5FWNA 1AOXA 3KAKA 2PNJA 3H2HA 4YALA 2QW0X 2XZDA 3R9WA 5E1OA 1PNTA 3LPLA 1KQOA 4ETNA 1GZDA 3LFUA 5JZBA 2P4EA 2PSFA 2KMLA 3U4QA 2DF8A 3QBVA 1ECLA 5F52A 2R47A 3TTUA 3ZBUA 3K70B 3NIGB 4BO2A 4GP6A 4HBZA 3WB1A 1IHOA 3ONFA 4KN9S 3HY4A 4EW2A 1DSSG 1TAHA 4MDFA 4YJ2F 3L7AA 5EJFA 5T5QA 2XDQA 3UKDA 3LYAA 2G9UA 3FF4A 5CFLA 1R0RE 3ZLBA 3VR4D 2YJ6A 4X8MA 4G0XA 2HL6A 4MVJE 1EXMA 1JHOA 1G8FA 4OI1A 5BSWA 5LN1A 3GFVA 4JXXA 4RDHA 2Y1XA 4UCWA 3ZK9A 3DZIA 4W5NA 3N8KA 4QJ4A 3RODA 3DDNA 2O57A 2I6SA 5TMEA 2PL3A 1QUFA 3H7AA 5FF9A 1S02A 3D2AA 3HDTA 3CXRA 1FLNA 2AKEA 5BSGA 4KXUA 2AZDA 2BR5A 3FNIA 3O0TA 3BAZA 4KKVA 4QBHA 3B85A 3ZHTA 2FZCA 3L0OA 4MTCA 3CVXA 3H4IA 2W8BB 4F1KA 4AP9A 5AVUA 3OG9A 3OQHA 4ZCSA 4JBNA 1J8FA 2DR0A 1E1RA 1FQOA 4RSMA 2PUEA 3BYZA 4TLLB 4CEIA 5IDQA 1WNTA 1BE8A 4M21A 3LKVA 4FCCA 1ZUNB 4NWIA 4HYYA 5IAKA 3T54A 3ZE8A 1GCOA 2J0EA 1ZGAA 1H93A 1H2ZA 1TQ2A 3UJAA 3RUCA 1QR6A 1X80B 4BBZA 1NF3A 2YXDA 5JNUA 3NHMA 2WTAA 3GVHA 4XSVA 1ZR2A 3JAWA 4JD5A 2QU7A 4PHCA 4EEXA 3JAMA 5LSAA 2HTEA 5FPKA 1G4AE 1FU8A 2F00A 2Q4BA 4GBGA 4CV1A 1A7AA 2EKPA 2ZU0C 4DJEC 1MC4A 4R51A 2AE1A 3DFZA 2JARA 4WBNA 1G2IA 1A4RA 5HYVA 3HXMA 2FR8A 3NWEA 4HH3C 4OB8A 4MWOA 1EQAA 4NJMB 2ZIZA 4JJIA 4LWZA 4N5HX 2VJOA 3R3YA 4C0XA 2GFIA 3ACBA 2Q4EA 2PX8A 4S35A 2PL1A 4PN3A 1EK1A 2UYQA 2XECA 1IM2A 2XDWA 4G5GA 4US2R 3X43A 2VYFA 4Y6PA 1ENZA 3SVLA 1F0YA 3H84A 3KUCA 2P9JA 2Y93A 2JJYA 2OC4A 3C3BA 3E82A 3NYIA 4G4JA 1PWYE 4I1IA 3STHA 3UATA 1B8UA 4LA4A 4FINA 2Y9PB 4NU8X 1NPDA 2N9UA 4EDHA 5FO0A 2ZBUA 5L4NA 4YJKA 3KYDB 5HWSA 2GEDA 2FSUA 3F6BX 4I5FA 1L4LA 2CLMB 2V7BA 1OFUA 3VH1A 4PLFA 4ZEXA 3EGXA 4HX2A 4KPEC 1EAMA 2J41A 2YN4A 3RU7A 3DOHA 4MQFB 1NYLA 1H85A 1LWNA 4QPNA 4ITUA 3L6BA 2FEAA 4A8TA 5A6VA 121PA 3VKVA 4DBLE 3G2LA 5DT9A 3MWGA 2M32A 3NMUF 1GPKA 1QHGA 3UICA 3NT2A 2HRBA 2IHUA 4X61A 3P9YA 4KZKA 4NICA 2CLIB 4RQUA 1I9CA 4FM9A 3CPSA 3CCFA 2R25B 4YJFA 4D99A 2BKAA 1ZLYA 4YLYA 4IICA 3OEED 1M72A 4QFCA 3RUHA 2ZE8A 5BW8A 1HSZA 3IFSA 1SCBA 4US1R 4J43A 4PIVA 1RE1A 3MLEA 4PO8A 3R3JA 1Z7YA 2G1AA 1MR3F 1D8TA 3DWIA 2B0JA 4K88A 3N0TA 3RSOA 5IH7A 4LX8A 3AY6A 4Q7MB 1ORRA 4RGYA 3K15A 1FDWA 3R77A 4C3VA 4DY6A 1Z6GA 2JLRA 2XGGA 2NV2B 4BZPA 4WI1A 1GA1A 2VRWA 2B0CA 3OT1A 5BQ3A 1ECCA 2O3QA 2JGLA 5CA1B 1DEKA 1NBOA 5ULLA 2X0DA 2R6R1 2XJ9A 4HXGA 2G8LA 4ARSA 4MI3A 4FC6A 1BCRA 4MQUA 1OWNA 3OHPA 4XJSA 4CM5A 5LQRA 1DHTA 2AW3A 2UYGA 3VZPA 1OH7A 1XT6A 1YGPA 4GOOD 1NC1A 4QQKA 1FW8A 1ZEJA 3QXCA 4JJ8A 3KHKA 2C1EA 4A0SA 1QGYA 2QQ0A 1VRCA 3SG0A 3ELBA 2WZBA 5IKPA 1OBCA 2FP4B 2CB0A 2B37A 4PWZA 4TKVB 5FA8A 5C3UA 3EF1A 3W2EA 3G2HA 1P0IA 1NT4A 1RVV1 2FQWA 4OJKA 4XQEA 2I4OA 4FMDB 3TN7A 1XLWA 1VPEA 1B0AA 1HX7A 5BRNA 1OFVA 2EG9A 4I1SA 2B4RO 2ZYGA 4DHWA 2F1HA 3B1XA 2PZKA 4MW6A 4ZU1X 4CKXA 4F6RA 3F6RA 3TDKA 2P2DA 1HE8B 4F3NA 1UBMS 2IV7A 2VUSA 4KLAA 3TW0A 3VNSA 1JEOA 1QYRA 3KOWA 1Z83A 4YCJA 2WTEA 1W2HA 3WBFA 1I6KA 2H11A 4FU0A 4HMPA 2XNKA 1W85B 2DECA 5KWVA 2ISCA 1PG2A 4BY9E 1GAXA 4GMHA 5BNWA 5AD1A 4FOOA 1WW2A 4YAFA 2QMEA 3ASZA 5CVJA 1JQKA 4WKOA 1IWPB 5FHRA 1JRLA 4EA6A 2C9MA 2ZWPA 4UD2A 5E1DA 1N57A 1E20A 3TPCA 4KPYA 3QLVA 4Y8VA 3RYHA 2LE0A 3DDOA 2VH2A 4Q9KA 5EE3A 4XVUA 3CKYA 3A6PC 1OZHA 3B7PA 3LVRE 1PJRA 1ZQ9A 2WR8A 3B70A 4HQOA 2JFUA 1B4DA 1ZD3A 4I4TA 4C88A 5KNBA 3NPAA 2VH5R 3ZDEA 3W5BA 1A9TA 1ZGGA 2P5YA 3M34A 3GVXA 4RH3A 2F8MA 2PX6A 3AUSA 3EAQA 1ADJA 1GPDG 2QRLA 4ZOLB 3UUFA 4QLBA 4GH5A 1MLDA 4BKPA 1KU6A 2CNOA 2YFHA 5ALIA 4EUFA 4EG5A 3LUAA 3EBLA 4M89A 3LLUA 1R4MA 1KS9A 1JXQA 1P0MA 2O1SA 1UK6A 3AUXA 2L2QA 3MWEB 2WHPB 4K6KA 3V2IA 3IP6A 1WU7A 4PHGA 1L1FA 2WWGA 3DYIA 3P9RA 4F6CA 3TZKA 4P7GA 3A2KA 2ZJ8A 1NW8A 3AB8A 4BDSA 5KHOC 1Y3IA 3JPYA 1YRWA 5CYFA 2PJZA 5AH0A 5J5VA 2C4NA 2J6BA 2Y1OA 1QO9A 2YL2A 1TLFA 1IUPA 2XNDA 4G9BA 2NGRA 1Q22A 2ES4A 1KVUA 4RJKA 4EMTA 3FZQA 4X6XA 1F6WA 1YCFA 2P2SA 5AQ1A 2XCSB 4O4JF 5L7TA 1WVIA 1C1XA 2EU8A 5F7ZA 4KQHA 1EVYA 4N01A 4BIIA 2OQRA 4XASA 2O19A 4LJAA 2ONJA 1KI8A 2NUTB 1E62A 3EK2A 4HJRA 1UFQA 3SHTA 5AW0A 1DLJA 3URKA 4MUHA 4WLOA 5KJFA 1A2OA 1WP9A 1PV2A 1IY2A 3CCCA 4KQJA 4Q4HB 1F7VA 4S1TA 2H4ZA 4EGFA 2KBEA 5J63A 4B79A 2XUOA 4EJFA 2FK8A 2D59A 1JEYA 4OYHA 4TWRA 4WOCA 5CEFA 2LCIA 1EFRD 2O5EA 4BQIA 2PMCA 3AF3A 3ROEA 3PQEA 1UJ6A 3QLUC 4IDFA 1PT7A 5D6NA 4DWVA 5AJYA 1V4VA 1QHSA 1Y9JA 2Q4OA 4BIMA 3RC2A 3OFNA 1L7NA 1JWBB 3KHUA 4ZALA 2ZRFA 3W6OA 5M04A 3AOEC 4HDAA 4IVNA 3RO7A 5H5JA 1SXJB 5U4QA 2V7VA 2FHSA 1UJNA 2FW9A 1KQPA 2YDYA 3TOVA 1XTKA 2VDWA 1DBQA 1TM7E 4NMHA 1J0BA 1XPJA 5A3VA 2F4VB 1HWYA 1SPBS 3LA8A 4IOJA 5FTNA 2O2HA 2ASEA 3KQSA 4U7WA 4E5PA 5B57C 1KE2A 5JZVA 4FI3C 1TNDA 1CUEA 4MVXA 1RAHA 1ZDMA 2VR1A 3U7FB 1BXRA 1NMXA 1F14A 2ZUWA 1UODA 3IQIX 1FNDA 3U81A 3W9SA 1UK7A 3FCUB 1YK1A 3KOZA 3MIIA 2ECQA 1Z6AA 1REQB 1Z5PA 2IYUA 1DC6A 3QYPA 3R2JA 3NEAA 2NSLA 1WMDA 3R0IA 1WQ4A 1XXHE 3RB8A 1IOZA 3RVOA 4KO4S 4QPZA 3M3DA 3P96A 5BRJA 1E1YA 2J30A 4QG3A 5IXYA 1AN9A 4GGOA 5K01A 4H7DA 3HQ4O 1MOZA 4RSHA 1G8SA 3CS3A 5JRDS 5KHAA 5FT9A 4OGFA 4ZT2A 1E7WA 2AXPA 1A1SA 1H3NA 1FMFA 1IE3A 2OHFA 2X42A 3L7LA 1USUA 1CE8A 1MX9A 3PFNA 3ENKA 2J31A 1AU9A 1GCIA 4ARZB 3KWMA 4KQXA 1WDMA 5JASA 3LWBA 4B82A 4BX3A 3VNUA 3DZKA 1XZJA 3L1HA 2PBFA 3D5EA 1YRBA 4GR9A 1DNPA 3IERA 3NEPX 4GYKA 3NWOA 4C4SA 5I4IA 4UPDA 3WV5A 1M6NA 2O2SA 1HE4A 1KMNA 4YY3B 4NAHA 4YAUA 1SM4A 2IYOA 1XZQA 2VJDA 4YR7A 1RVDA 4YMHA 1O97C 5G0VA 3WZ2A 2J9ZB 2WKRA 4ZDIA 2DH6A 3EPJA 2AZXA 2E48A 3TMAA 1I2BA 1XTIA 1JU9A 4UJ3A 4G2TA 2CHGA 4BVKA 5KTRA 5ADWA 3UMSA 4EUHA 1HFJA 4LK3A 1GCAA 3KOMA 1B6SA 2H1HA 5L3QB 1VLQA 5F1KA 4Z3KA 2D0IA 2W6ZA 2FSPA 3DVQX 3HMQA 2NU7B 3GUCA 4R1SA 1CRPA 3GQBA 2PUWA 1PQUA 2Q6KA 1IVYA 3PQ5A 4GM0A 5FFFA 1Y5LA 2YNMA 2HHAA 2PX3A 1GAEO 3FNGA 3FOWA 4WUTA 3BSYA 3MQFA 3UAYA 3ISJA 4ES6A 4NBKA 1JKFA 3DUWA 1CR2A 2EX1A 2CHQA 2OV2A 3P52A 1UKVY 2ZUSA 3NUZA 4F4DA 1BN6A 2ECPA 1AUQA 3GYBA 3FZNA 3NBKA 1PJZA 3O73A 3WNVA 3EVNA 1TTQB 3CX7A 3KKLA 3EG9B 3ZGXA 3VI4B 1H8HA 1Y6JA 1GGFA 2Q9BA 2WIBA 3IEXA 3PLNA 1WXDA 1VBNA 4O63O 2XF2A 4GU5A 1QTNA 5JXJA 2IOFK 1M9NA 1TO6A 3DLCA 1AJEA 5FFMA 3Q41A 4G9GA 1C7FA 4YRQA 4Z4FA 4HLQB 1FFGA 1G1AA 1RIIA 2E5WA 4FWIB 3FNHA 4GS5A 3GY0A 4MVJM 2D5BA 1IWBB 4K05A 2QRVB 4M88A 1YONA 1XL1A 1DARA 4MVJF 5ANRB 1KAMA 1I1OA 1ULBA 5A4JA 1H2XA 1N75A 1LA2A 4IRUB 2VAXA 4REMA 2V3CC 2GJ4A 1XWWA 1Q1NA 1E2BA 1U8UA 2EW8A 2IHJA 1ID8A 5KX5F 3IUSA 1C30B 2FUG6 2HGSA 1RHQA 5AXDA 3R0ZA 4MYDA 2NAFA 4MB2A 4U6QA 1ZIDA 2UUBB 3DYBA 2RB5A 1OBFO 4Q18A 4RV4A 4WT7A 3RRBA 4HZUB 4EKIA 1Y4ZA 3UKOA 3VKGA 4UULA 1RC8A 2F3SA 4Q3KA 5THKA 1W4ZA 4W5TA 2G5TA 3DAGA 3OT4A 3BIWA 3BK2A 3G7UA 3QQ5A 4LMBA 4Q00A 5TMBA 3TH5A 4ZZ1A 1QP4A 5I7EA 4QDZA 1NMZA 3LQYA 1E6CA 1MT3A 5BORA 2M98A 4KRGA 2LPMA 1O8BA 3A1CA 2I4TA 1YDFA 3GH3A 2CVHA 13PKA 3DL2A 3ZWXA 3RRMA 3CNEA 4FGSA 3KSAC 2H3HA 4J49A 1UBNA 4MWTA 4NV3A 2W22A 2G40A 4DA8A 2OO5C 2EATA 4JITA 4ZVNA 2B9EA 2JVIA 3IXLA 1IEXA 3A1TA 3ZY2A 1DLIA 2OFWA 2FJPA 2L17A 3G13A 3HVRA 3M4JA 4BC1A 4DR2B 1NW5A 1VP9A 2WMYA 4O02B 2RHRA 3TLXA 1O9HA 2E18A 2XUJA 1P80A 2UXCB 3JSAA 5DWQA 2BBOA 1YZHA 2H2WA 4YEDA 4CUJA 1ZSYA 1QSGA 5EWLA 2GUWA 1IPHA 3OTGA 4XD7A 5ECDA 2ACKA 4Z7QB 4UE6A 1HT3A 4TLEA 1Y1RA 2HIMA 1EXWA 2XMBA 1JV2B 3LBYA 5AVXA 4JYMA 1GNVA 3R7BA 4AY6A 2IHZA 3V46A 2C7PA 5C34B 4JEHA 1CZLA 4EJSB 5ALNA 3X1XA 1QFSA 1XZBA 4NF2A 4UKDA 1UR5A 3OQ6A 4OFWA 3ZPXA 5BXYA 1EYZA 4HDOB 1KZHA 4ZTZB 1N34B 1Z56C 4WHMA 2PX5A 4DQXA 1RQNA 5DGIA 2BFFA 2GBIA 2AKYA 4JT8A 4XWOA 3P94A 4YRDA 4EZBA 1ZW1A 3M6IA 3ORSA 3DM5A 3Q2KA 4KO2S 2UDPA 3L7YA 4FYMA 2VYNA 4ZVLA 5ELXA 1K7XB 1NJ6A 2WIJA 3QE3A 3GAZA 4H6PA 5AW5A 2QQFA 4LOAA 3A9UA 4R41A 3BWYA 4UJ5A 4BC0A 2RH9B 2H9AA 3DEYX 2OR3A 3TLZA 1G8HA 3KQQA 4P3PA 2PSSA 1GDHA 4IV8A 3A8TA 4DLYA 4F2WA 2BH9A 4NCIA 3GRUA 4XA8A 4XLZA 3K0CC 4LDJA 3RW9A 5JALA 1C9YA 2G1UA 2AFHA 4PCLA 2QM7A 2VBCA 2XCLA 3KPJA 4YO7A 2B4KA 4L51A 4YRRA 5JSUA 5U4XA 4KQIA 4XUEA 5D1NA 1CERA 2FDXA 4J0JA 4EPVA 1QFXA 4Q3DA 3YASA 4NBWA 2WF9A 4I14A 3H05A 1MXFA 4RL4A 1QFMA 3BTOA 5CLIA 1F2VA 3ONVA 4TGLA 4CR6A 3LWZA 1LPMA 2PSJA 2Q3EA 2ZBPA 3ZU4A 1M2WA 4CM7A 3LCJA 3BKWA 3B6MA 3GUYA 1OAAA 2A5DA 2VSXA 3ICWA 3S44A 4DSZA 5EHNA 1WDKA 3AONB 1G38A 1BMTA 2BDTA 1SOUA 4NARA 3U7JA 1IG0A 2H2HA 2XQGA 1IDN1 1I6WA 4W8HA 4F2PA 3EIQA 4UPVA 3I9FA 1VKZA 3OHMA 4ZZ0A 5F7XA 4I66A 3CONA 4BFLA 3IDAA 5DLEA 1K4MA 3OEHD 1MJ5A 2E6KA 4GX2A 4W1RA 5ERYA 3VU9B 2NLOA 4A2WA 3FCEA 3TRIA 2JLXA 1FFWA 2BPOA 3PDHA 4ZAGA 3ON5A 4ILEA 1ISSA 1TAQA 2ZTLA 3D3JA 1GWNA 2IU6A 3MWEA 3EULA 4C04A 2CKMA 3R0JA 4BFYA 1P0QA 1IIRA 2GR9A 1QMPA 3HA3A 1JFFB 4R8KA 5KCMA 4AMGA 1KAGA 2R97A 3VR6A 4H17A 4JJEA 3HC7A 2JI4A 4COKA 2EHDA 5CA0F 1RMQA 1NVBA 3B5EA 4KMOA 4Q93A 1CNMA 1JEAA 3GHYA 2PE5A 2GARA 2IYVA 4ND3A 4DWJA 3FHLA 1H9BA 2UZ4A 2MYPA 5A62A 3RUEA 4FB4A 3S70A 2HSEA 1U8FO 2XD9A 3OD5A 4FJ1A 4QTUB 1XD9A 2ZATA 3DE4X 1IM5A 1PJSA 1QP0A 3EA0A 3WI7A 3M6XA 3AQIA 1ZZEA 4JC0A 3THXA 4NHOA 3M81A 5EUQB 2JHAA 1RAAA 3WGJA 5L3SB 3EZ2A 3NC4A 2YJNA 1SUSA 1LBSA 3BGVA 2DLCX 2C8JA 1AB5A 4E15A 1E2KA 1MAHA 3HBFA 2BEUA 2D2EA 1GRQA 4Q16A 1F51E 2YWBA 2QKYA 1GZVA 2DLNA 1EQUA 1I1QB 1OZFA 2ZI7A 3HCAA 5FYQA 1UM9A 2ZT8A 4ZOLF 1NV8A 1VLMA 5JVDF 2PUFA 2Z04A 2ZUCA 3R75A 2IVFA 3RJ5A 3VOAA 3W79A 1EVIA 3JQBA 3JASA 1B7GO 1SK8A 5ADHA 1O9GA 1FL9A 1SUEA 2GPJA 2BHLA 1CHDA 4B9AA 1CQJA 3DOIA 3MGCA 5LA6F 5IAOA 4CEJA 4N12A 4CLRB 2CUNA 2OGSA 4MKIA 2JAUA 1DAKA 2DFNA 3L0PA 3QEMA 4MLPA 1E2UA 1WCIB 1I4LD 4Q3AA 3BGOS 5FLYA 1HKHA 1FX0B 4HGYA 1TQHA 2ZTUA 4B6RA 4P5EA 2EXXA 1NJGA 3HWX1 1CUVA 3N2IA 1XHEA 2BHRA 4WEQA 2VHZA 3MT0A 4RACA 1B93A 2IXEA 3FYCA 4YO8A 5EPEA 4QNRA 3UMFA 1T6XA 1OZGA 3HDJA 5FWYB 3T1HB 5KYUB 5H4GA 1JU3A 3GGGA 3NS7A 1PR4A 5H1YA 1Y9ZA 4Z53A 3DGFC 4L0QA 1BKSB 1PLJA 2JFXA 2A9QA 4RELA 2FN4A 4X8OA 5DYGA 3SJ7A 1L8LA 4EAAA 4XAQA 4JDPA 4IGIA 2WFLA 1D04A 2IUEA 1PZGA 2XKBA 3L4EA 5HUJA 3CF2A 3Q15C 5LJIA 1LH0A 2FETA 2WMDA 1GUZA 1CBUA 1TK2A 3NTOA 4WBXC 3Q7PA 1Y34E 1CEQA 1P5FA 2DBZA 4D6XA 1QQBA 1FNNA 1IFXA 2PFSA 4CTNA 1CUFA 1K08A 5LCXA 2RG7A 3KL4A 5PNTA 3UTCA 2GEJA 2JGJA 2QENA 2YWEA 4RZHA 4RTJA 2A0KA 1EFPA 2OD9A 1MQ9A 4IJKA 4URYR 4W5OA 5LMUB 4G84A 3PWTA 2VJKA 2SCUA 2XB6A 3L82B 4IDDA 5DV9A 4CODB 4EJ6A 1L8QA 4TS1A 1NW6A 2C5HA 5FLKA 4D5GA 1JILA 4JBGA 3QOFA 5F4BA 3RTDA 1IOLA 4DV0B 3JQQA 4REQA 3JZDA 3WNBA 1M1YB 4KQ9A 2D0PB 1A8QA 2DTDA 2EWVA 2NZVG 1P2VA 4MUAA 2P2CA 3JWPA 2PX0A 4UNRA 5LU9A 2P9HA 4PZLA 1CUUA 4FKBA 3USZA 1SY7A 4ZI2A 1WDLA 2B8WA 3H04A 3G9UA 4BO7A 4NQZA 4EX6A 1EP3B 2WDZA 1NBMA 1AA6A 2G5GX 2R8PA 3DBIA 3DEIA 4WD3A 3V1MA 3D2BA 3JD0A 4OH7A 4PW0A 5A03A 2WQ7A 5HZKA 3OZCA 3MC1A 1ZMTA 2MR6A 4CGYA 1OIVA 1GGHA 4RTLA 2WHYA 4AKHA 4P92A 3H97A 1M6VA 3M70A 3OX3A 4IDNA 4FYKA 1UZAA 2GMWA 3VBCA 4B4UA 2HWWA 3STYA 1AZWA 1DJNA 1P9NA 5DZSA 2WIAA 4YYEA 4DQVA 5B58C 2NMVA 1C4XA 4KYIB 2ZJOA 3JYPA 3HU5A 1VE1A 4R1MA 4M53A 3NO4A 4Q21A