4JX9A

Crystal structure of the complex of peptidyl t-rna hydrolase from acinetobacter baumannii with uridine at 1.4a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606 = cip 70.34
total genus 62
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4jx9A00
2NAFA 3TCNA 2MJLA 2LGJA 3TD6A 4ZXPA 3P2JA 5EKTA 4JY7A 4QD3A 4YLYA 5IMBA 3TCKA 4QT4A 4JX9A 3NEAA 2PTHA 3TD2A 4HOYA 4QAJA 3VJRA 4FOPA 2Z2KA 1RYMA 4IKOA 5B6JA 4FOTA 3OFVA 4P7BA 3KK0A 5IVPA 4FYJA 4JWKA 4DJJA 4DHWA 3KJZA 5IKEA 2JRCA 4FNOA 4LWQA 3V2IA 4JC4A 4OLJA 4QBKA 2Z2IA 2Z2JA 4Z86A 1RYBA 1RYNA 4ERXA
chains in the Genus database with same CATH superfamily
4GHWA 1U8YA 3SK0A 1XWWA 4UD2A 3GRKA 2JPDA 3IAM1 2GEUA 4Y9RA 4EA9A 5AJVB 2NXNA 2X2OA 1I33A 1RM3A 2VDWA 1UKZA 2GTHA 4DA8A 3LUGA 2NX2A 3WNDA 4GF5A 3FPJA 3WNBA 1EGQA 3A05A 4XH9B 2XCIA 3QSGA 1KHTA 1ZL0A 1RQRA 2DSNA 2AF3C 4TVKA 3VVLA 3WB2A 1TAGA 3OY7A 4BB6A 1ISSA 3TSZA 4E5KA 5KHOC 3HA2A 4BNMA 2VJBA 3D3WB 2PGJA 3K94A 3R6TA 6REQB 4L27A 2XD4A 3D4NA 1L7DA 4ZQHA 4I8DA 4WZAB 1DZ3A 4AMZA 4BNXA 4YPOA 2Q2QA 2GTPA 3D7MA 4UTOA 1Q7TA 1XRJA 2WNIA 3F47A 3NTXA 1F48A 4QYIB 5K0BA 4NXMB 1T4CA 1CSEE 3U4QB 1NPYA 1B3BA 1B14A 5GV8A 4CHTA 4GYJA 3WRXC 1IZ0A 4H31A 2H2WA 2W8BA 3B6IA 1DC4A 2JH3A 4LTNA 4TS9A 4W63A 1E5QA 4HTFA 1WB6A 3FFTA 3IP8A 4LAFA 4RDIA 3TFQA 1NGSA 3TCKA 2HC9A 1J97A 2B5VA 1RHQA 3GDGA 4IKPA 3E82A 4OTZA 1P3JA 3HB0A 4MI1A 1H5QA 3NORA 5DGTA 1PK8A 5AW1A 4MPTA 1Y9JA 4GRAA 2FSHA 2PQ2A 2P1RA 2BISA 2DQYA 2J0QA 2FZLA 4FB4A 2DPGA 2SNIE 3TEMA 2IHNA 4QXMA 4G0OA 4WK0B 1NXSA 3PHGA 2VQ6A 1AMUA 2P2SA 2IU4A 2XSZD 1JEAA 3Q0EA 4BZZA 3X2EA 3TECE 4BLWA 1E2QA 3H8SA 4EBBA 3PTAA 1TTPB 1XTVA 4D3ZA 5CR9A 1IVYA 4C7MA 1COWA 5KSOA 1P0IA 1T5BA 1LI4A 1FLAA 1KNXA 3FRHA 4MRAA 4XW2A 3SFVA 4DB2A 3VHLB 1J99A 1OKKD 3IXQA 3MAAC 3AJAA 4M54A 1R4AA 1BX0A 1RMQA 3IGFA 4EGJA 1A5SB 2ZSHA 4WK2B 5JNUA 4H7FA 3S8EA 2CVHA 2FKAA 4HLQB 3B1ZA 3CKKA 5FUWA 2J7PA 1J5EB 1M2JA 4RDCA 1U98A 4ZRMA 3RK4A 4DLAA 2F9MA 4Z4GA 1B6TA 3UMVA 4BOYA 1REQA 3AJ8A 3SWWA 3EB9A 4AZVA 4XB6B 1CQIA 5JIBA 5L7TA 4KIWA 5FB3A 3KSDO 4X6XA 3PEUA 2REQA 4HDOB 4TZTA 5JMTA 1RJEA 4LJ7A 2NU7B 3VO8A 4G9EA 1G3RA 5B4VA 3FG9A 1D2CA 4Q9AA 4HNAB 2X7XA 3DWIA 2AMYA 1CUWA 3S99A 1APBA 4DR7B 1JKXA 4MROA 3PYMA 2ATEA 2J9RA 3ZQKA 1B43A 4IUCS 5LSAA 1G8JA 3TKAA 2CXRA 4E31A 3UUEA 1II8A 2XUAA 1ZJ5A 3DYBA 3CO5A 4FGZA 4PYNA 4P3XA 3EUAA 4GEKA 3DMGA 3DAHA 3ITNA 3K0AA 2VKQA 4WXPA 4CU2A 2HNAA 2ZBRA 2FCRA 2V97A 4NOKA 3ZZUA 5EZQA 1AZSC 3CZPA 1QYVA 3PWSA 2Z04A 3WYNA 4X3OA 1VSQA 4LS3A 4X1OA 3TTWA 4C6SA 1QHIA 5KPJA 4Q4CA 1UPFA 1NXQA 3ZWBA 5G1PA 3VNUA 3DYIA 4CM9A 2YWEA 4P31A 2EWMA 2VDVE 5H81A 1W29A 1O9BA 3RLFA 5BWNA 5IS2A 4RTNA 2UVPA 4PPGA 1JKIA 4QEZA 5ADVA 4PHGA 4R1TA 1USVA 3RIYA 4CF7A 1GQQA 1ZN7A 3TM4A 3BGOS 1HE8B 3IKLA 3HCFA 3I6IA 4UZFA 3T1NA 3AY0A 3TD2A 1FMFA 2JLSA 3U81A 2H18A 1K4KA 1Z4JA 1W1IA 2EJUA 3ASYA 4OUKX 1JFSA 2JARA 1NLFA 1IDOA 2A86A 3CEMA 4HX9A 1XRRA 4U0JA 1JVNA 2GHRA 5CD1A 4OATA 4GUAA 2XB6A 3M1IA 2WBLC 1TYEB 5JHHB 4QGGA 3VZPA 1IK4A 1E92A 2I4TA 4UHCA 3P9XA 5K3AA 2JJMA 1Z4NA 2QRGA 3B9PA 1PTJA 5BRNA 4RPLA 5HKKD 1UMKA 2UUPA 5COQA 3DZKA 1JTVA 3NS7A 2PD4A 1F06A 4DEXA 1T8PA 3AESB 1CS0A 1UODA 4RYLA 4C0LA 2W6PA 4MV8A 1GTJ1 2QYHA 3VNQA 3HBJA 4MUAA 4GP7A 4BO6A 5BMVB 4ZC8A 3BZUA 3GG2A 1I4DD 3DV0B 3I4CA 2IXBA 3LX8A 2IEBA 2JVKA 5JS7A 5KWSA 2NVUB 1M66A 3SXJA 3QE2A 3W1VA 1KYQA 1GZSA 3WLFA 2A7XA 4HBZA 4IOMA 4XWKA 5IKMA 3IVAA 1N32B 1EA7A 1KSGA 4ZICA 3ZKAA 4GRDA 2JEZA 2DMRA 2YXNA 3B3GA 5JXJA 2BLLA 2W0SA 3CGGA 4YAJA 1SCJA 4JUAA 5T41A 3SAJA 2PUJA 5DN6A 4WOPA 2EJVA 3QLUC 2J5BA 4ZI2A 3IV9A 2Q1UA 3O83A 3WDMA 2NN3C 2AMVA 2LV8A 2NU8B 1PT5A 5DSTA 1UZMA 4D02A 4G4GA 3BXFA 1XEAA 4OLAA 2D4AA 1MPTA 1VE7A 2LWIA 2PIDA 2ZKLA 3HUUA 4NWIA 1SU7A 2J67A 4DUYB 1TAUA 1I9CA 3QMMA 1M2WA 1V9CA 5FPTA 1PGQA 4HSGA 1U31A 1T9GR 3AERA 3CMCO 4LJAA 4A73A 1F0KA 4E1BA 5I01A 4CL2A 4JODA 1USIA 1QH9A 1N0VC 3O2NA 4IJVA 4F5EA 2AZXA 2H1LA 3JYHA 1JHYA 3E70C 4JLDA 4NNOA 1DEHA 4O5AA 4Z0PA 3SZRA 3ZEIA 4EZIA 4RULA 4FDAA 1JWBB 4NL4H 2VT7A 5JCOC 2YWCA 2MYTA 2WJAA 3AIMA 4PYKA 5H4HA 4E4TA 4UPEA 4E2FA 1QRDA 1DL5A 2BGJA 4AJ9A 4HRAA 3PVZA 1M76A 2A88A 1XPJA 1QS0A 2NUPA 4J16C 5K51A 1QVAA 4P32A 3RYFA 2JLUA 2JK1A 1EFRD 1HQYE 1H1LA 3IV7A 4OGWA 2W2KB 4V2IA 1U8EA 2VXOA 3A3OA 1DVRA 4PX5A 2LDXA 4KR0A 2ZAMA 1MENA 1OJ7A 4DJTA 1JQ3A 4H1UA 4NDAA 1XZMA 4JENA 3KK0A 4ZYWA 3ZBPA 2VQ3A 4U6NA 1E3MA 2OFWA 5BWLA 3V4RA 2IS6A 4D3YA 1YRLA 1XRLA 3E8SA 4H1VA 4P7KA 2JHPA 3T6KA 3V8RA 3UHJA 4ARSA 5ITSA 4UHBA 5JZ9A 4P22A 3UTCA 1OX4B 3DZ8A 2F43A 1YQTA 2MR6A 4IYJA 1MVLA 2H1OA 3QXSA 4Y1RA 1Q17A 1RJ9B 3K1AA 4UVHA 1Z4QA 2ID4A 1MOSA 3Q9UA 3EAQA 1HQDA 1KKLA 2XZTA 1JZQA 1ZI9A 1NZDA 4YQYA 1LLQA 4ZVKA 3WQQA 1CHNA 2FXIA 3KQMA 1LS1A 3SQOA 4M9XA 2DHEA 1E60A 3GAAA 4DHEA 3H84A 1EK1A 2QQFA 1QZ3A 5KKNB 1XD2B 4URFA 1SC9A 4X93A 5C1PA 5SYNA 3ZDAA 4MGHA 2HJRA 3IEMA 1LK0A 1JDUA 5FWAA 4ZVVA 4Q24A 3VU9B 1XIVA 4YCBA 3MWYW 4GOKA 5FTLA 1EGAA 4QOHA 1HO3A 2ORVA 4RD1A 1YHZA 4N5HX 3HA5A 4QBIA 2EATA 2JKVA 2RONA 2YXLA 1BQ3A 1M10A 2DP4E 3ASZA 1YRHA 4LY6A 4YRTA 4LRUA 4KNYA 1W5BA 2B8WA 3FZGA 3HUEA 5EXXA 2Q5IA 3CTPA 3PYLA 3LMKA 3DE7X 5AW4A 1OZAA 1PFUA 1C8LA 1JFFB 1U8CB 3MTIA 4V3BA 2OQVA 4B9EA 4JBYA 3KT8A 4OHFA 2BFBA 1WPXA 1JT9A 4NHEA 1V37A 3I1JA 5A4AA 5LZ5A 1TC2A 4MGKR 3L49A 3I1YA 1TXGA 2IIVA 7ADHA 1OFHA 1T5LA 1V1MB 4JQCA 2PRJA 3I8OA 1W6UA 5BV2P 1L8OA 1RAFA 3UYKA 2YWFA 2QIOA 4IIEA 4LTMA 1AA9A 4OXXA 4EY8A 4EG5A 1VFPA 5IJ0A 4JI3B 4EJSA 5LBUA 2XVYA 1NMSA 1UKVY 1FFXB 5I6DA 3H9GA 3U3JA 1KYTA 1JH9A 5DOZA 1ZC4A 3OQBA 5KOHB 4XD7D 3H4MA 4XGRA 4OG2A 4YI3A 5GAJA 5TPWA 1KC1A 4YMTA 3P71T 1VZ3A 2F3TA 1FRZA 4JLWA 4TS4A 3DDSA 1SIOA 2VP9A 1CJTC 1WTAA 2PD3A 3IAUA 3D59A 5JFTA 2CVPA 2FW7A 3P7MA 4OK3A 2CHVA 3QVSA 1JEQA 1V7QA 2XVMA 1KDPA 5DGDA 4ENUA 2AVDA 2ET6A 3NT2A 4E09A 2HNBA 3U7FB 1FNSA 1Z8DA 3VKFA 4UVIA 5IAAA 1YH3A 1IE3A 4M1KA 4M2LA 1UK6A 3FY4A 5EWLA 1KZHA 4TUYF 1CIJA 4I9UA 3X1DA 1OHHD 2PNFA 3IPRA 3NIFB 3WFJA 4OA8A 4H1WA 5JXWA 2I2FA 1DO2A 4LRXA 2FWJA 2B4QA 5LIPA 4HAZA 3IE0A 1RCFA 1EFUA 4G56A 1A7AA 2P8SA 3GJTA 2CKMA 2YFKA 2PXCA 1Z0AA 5A3RA 3GI1A 5K5EA 5KOYA 1RBYA 4F12A 1EJ2A 5CA0F 1F38A 2NZ2A 5SZKB 1B00A 1DCFA 4RW0A 3DZBA 4UNNA 4ED9A 1VRWA 1WV1A 4MI6A 4A7PA 1KWGA 1KI2A 2J5KA 3TF5A 4G0PA 2BMAA 4XJSA 4H7EA 4CUJA 2ZP1A 4W8OA 3RAPR 1SRQA 2HFJA 2VIIA 4D0LB 1AUVA 3EARA 4IV8A 3OU7A 3NHPA 4Y2HA 1F9AA 3QF4A 1GNLA 2QPOA 4PZ0A 3AG5A 5K0TA 2I7VA 1EUCA 1XRNA 2BHSA 3PXCX 1M0WA 3IHTA 3NIWA 3C24A 2C5BA 5F4BA 5KX5A 2D0DA 5EMLA 3EMKA 2HJWA 4JVOA 2V7QD 5FADA 2VH5R 4HEQA 2ATCA 2PAFA 3C6BA 4GS5A 4NBNA 4MQ4A 2FRXA 1OAAA 3E5HA 3CFYA 4AY5A 3VKGA 2IHJA 4D99A 4UNIA 2IEYA 3ODPA 1YJ5A 4XVHA 1WXIA 3ZWAA 5E6RB 4AN0A 1ZBQA 2J9XB 1Z5UA 3T4EA 4X1YA 4E51A 2P40A 1G59A 1Y8AA 4E46A 4D96A 1QF6A 3IUPA 3RH0A 1V8PA 1MOZA 3WKDA 3SEQA 3ESRA 4YLYA 2WAAA 2WFAA 4V39A 3GMDA 1AGRA 3RFFA 2EL7A 1NJ8A 2GI4A 1D1QA 2NSDA 2IYVA 4M1SA 5TT0A 3VHXB 3VYVA 1ISJA 2G17A 1RVDA 4BC1A 3K9WA 4QTYA 1BVUA 3B6KA 4D0RA 4YCCA 1RLTA 3FVWA 5JSZA 1Z17A 3OY2A 1KIMA 3QLEA 4RQAA 4WASA 1NZJA 4PS1A 4BCDA 4GFDA 3ULKA 1T6NA 1U3FA 2AE1A 1Z6PA 4CLHA 2E3JA 2BEUB 2VWHA 3LUCA 2VAMA 2I54A 4I1OA 2WYVA 4ZGGA 1G5PA 1E2BA 4K6KA 2H63A 3C98A 3N0TA 3VX3A 2YDXA 4JNCA 1GTMA 3DEJA 1F5SA 3T5MA 4S1OA 5A7FA 3BTUA 3PJRA 3M5PA 3V3KA 4BZXA 3O7WA 3E05A 4HF7A 1GDDA 4YGYA 1AB6A 3RI3A 4Z4IA 4TLBA 4GVPA 5FWXA 1J8MF 2H51A 3GROA 1CXZA 3OQIB 3VSAA 4ZYTA 1U0SY 1RXWA 4UD6A 3ZE6A 2D6FA 3TRFA 3GLIA 1HLDA 2YHIB 1F3LA 1MC8A 4V0ME 4QUDA 5KKCA 3EVBA 3UYLA 3ZV4A 4KGVA 4K03A 1U9CA 4KZPA 5K2OA 2SECE 3AF3A 2RH5A 4CMEA 4WEQA 1KQOA 3IXMA 3B2EA 4Q4HA 3BYZA 2XDAA 2ZRJA 3D5TA 4XGQA 5EE0A 5A1TA 2JD1A 3VO2A 1C50A 1YWGO 2AK2A 2FA9A 4WKCA 3SZGA 3P9QA 1QXSA 5KNDA 3R7SA 1T6BY 1PSWA 1G6Q1 4NI5A 2B69A 2NV2B 3A6FA 1DBSA 1ST3A 2EWVA 2HMVA 2W00A 3MGBA 3IMGA 4QDJA 3STHA 9LDBA 4YRJA 1XG5A 5G0UA 5CEJA 2NZ8A 1D2MA 2OVFA 3CZMA 1QIJA 3ND9A 5BPHA 2VDRB 2VP0A 3OZCA 1NN0A 3WK9A 1H2FA 3PXGA 3V97A 2FMTA 4N5LA 4F1WA 2CWWA 1PLLA 3KWFA 4MWBA 5HK8A 2J6BA 4MAFA 1GTL1 1B8VA 5AI4A 5TX7A 2BM8A 3DOUA 4COKA 2JKYA 3O0DA 4DLTA 4FLFA 3I8SA 4MVJF 4BNHA 4YY3B 1HRKA 1FSZA 1B4DA 1FLDA 2BMVA 3K2BA 3OP1A 4Y2PA 3L18A 1XLTA 1O96A 2PH5A 4L85A 4L5CA 1M6NA 3GP5A 2H0RA 1YNSA 2JJ1D 1ILWA 3GP8A 4PHCA 4URWR 1S4MA 2KB0A 4H4CA 5G41A 5EEHA 4AJOA 1GTRA 3RHFA 2ZRDA 3H5IA 2YKGA 5JS6A 4HAXA 2DGDA 3WMFA 2B4AA 1AE1A 3ZDYB 5KYUB 2PS1A 4A0QA 1I2MA 5CDYA 4C4YA 1SC3A 5D3QA 5JYDA 3STTA 1CVIA 3O84A 4MRVA 2QP9X 2HUNA 2FOIA 4GMHA 3W4KA 3NUQA 1IIRA 3AEKA 2EZTA 1KU0A 1QVWA 2IBMA 1FP2A 1ZRMA 3OETA 4RF5A 1OH6A 1SKYE 1DJLA 3PEYA 1PQ4A 3N1UA 1SZDA 1WULS 3R76A 3SLRA 3WZMA 4QG7A 5AVRA 3P1JA 3P96A 1JR2A 2NP7A 2IXEA 1LV8A 4MS4A 2ZRIA 3DMTC 1GPJA 1VG9B 4IQGA 4JQZA 4QIHA 1MGOA 4WFIA 2VKTA 4EELA 2JDIA 5E2IA 3RC9A 1U9YA 4DVGA 4OYYA 1CR2A 1HYQA 1SKQA 1JIJA 2P3OA 5IARA 2MINA 4O2AB 1TZKA 2NM0A 3GH3A 3NHLA 4YRCA 5BN4B 3SKXA 5K0JA 3N53A 3OZVA 4F9EA 5EQFA 1VLQA 5CLIA 2MR5A 3GMSA 5CLHA 3D8HA 4F3NA 2XCRB 2P9EA 2J3DA 3EZ6A 3FPKA 4XGKA 4F3CA 4Q18A 4KDCA 3D64A 3FTFA 3BZBA 3BSFA 2LIPA 1RXSA 1KYXA 4ZTZB 1E2UA 2P7IA 2B25A 5ECWA 3PUVA 1UANA 4F9GA 1CUVA 4KFUA 1SVWA 1QHHB 3AR8A 2F1OA 2ZIXB 3D43A 4O0MA 4BLQA 4BNTA 4ES6A 3WYEA 3V4PB 1NW9B 3JWGA 1XYVA 2HK7A 4AURA 5DEIA 5EMKA 4OBXA 1JG7A 5C8ZA 5JRDS 1Z63A 3QUAA 3GUCA 1UQUA 4DV2B 2R85A 1WXEA 1QO7A 3IR7A 5TQVA 2PVSA 2FEOA 3VTFA 2WP8J 3IDZA 4IBOA 1J2YA 2VSYA 4US2R 1V4VA 3BB1A 2VHWA 1O0CA 1FFGA 2EC5A 4FN4A 1DKPA 3H6KA 3EMVA 3ZQUA 2ZE6A 4FCCA 1M2OB 2QK4A 1OQAA 1PDWA 4JSYA 3KR9A 2LGJA 3V8VA 4E5UA 5AUOB 4Q3LA 1R9MA 2RAUA 2WTNA 3C3DA 3DV2A 4IGIA 4ENRA 1EUQA 2HY7A 2REXB 4I4TB 1KH3A 3IAFA 5LQJA 4HPJB 1KJYA 4H0CA 1T9DA 5IDVA 1AH2A 2DF8A 1A9SA 3QX7A 5D51S 3N7UA 4YJ3A 5G3ZA 3OZWA 4A0GA 5TMEA 1E0KA 5AVQA 4I1PA 3BS4A 4HNGA 4K8RB 4YUWA 1W36C 1XNQB 1UPBA 1WETA 2XMZA 5JATA 2BHLA 2QVXX 3AL2A 3MHTA 4GLBA 1U7UA 4N47A 4HQOA 1DJPA 2QYTA 2QJTA 4OLJA 1TMYA 2XMPA 4N54A 1ENYA 2B61A 3DAGA 4TMKA 1M67A 1A8UA 3DSRA 3GK3A 4ZI7F 2HRBA 3D1LA 2V6IA 4Q1AA 3UO8B 2IZ1A 2NSJA 2Z2ZA 3LX6A 4A27A 1NKVA 1GNPA 1VSUA 1HE3A 4ZP1A 4MUKA 2ZAOA 3PR2B 4C0AC 1T8YA 2O19A 2R4TA 1KI8A 2IUSA 3K70C 4W5JA 1GFIA 1NE2A 3AL3A 4NBLA 1M34A 1NYTA 2FF7A 3NWEA 3PPYA 4HEJA 2Z9CA 4HWOA 4E5PA 4MJXA 4I8XA 1PSZA 1N2BA 4XWOA 1KXJA 3VI3B 4TTPA 3EBLA 2VXBA 1GN8A 2R7LA 3O3NB 4W5WA 4DY4A 2R65A 3JQPA 4KFCA 1GZ5A 3KXPA 3HO8A 1SXJC 4XQGA 3KZCA 3TKYA 3MT9A 4FBLA 1SBCA 2W2LA 4Y2XA 1IXKA 1PJZA 2BUBA 1Q2XA 1UIMA 3CVOA 3UV6A 3VO9A 4UOEA 4N9WA 5KREA 3RGGA 1OBOA 4K88A 3I9MA 1KDYA 2C2OA 1KP3A 3AI1A 4P53A 4OI2A 5ESDA 3KE8A 3O9VA 5FJIA 3UENA 4OQXA 4NG4A 1R0KA 2WABA 3MW8A 4GI3A 1H2BA 4L8YA 4P3PA 2JFHA 3CS3A 4DMHA 5JCXA 1PR3A 2BH2A 3QA3E 2LBPA 5G1OA 5KNBD 4FX2A 2HRQA 4PBRA 4TV8A 2JGFA 4IHAA 4E1VA 3C8DA 3U7HB 3VISA 4B1FA 3FCUB 4WLNA 2H1RA 3N2YA 1RTTA 2IGTA 4HAYA 2FHSA 2MYUA 3P9KA 4ZZIA 3ILSA 5BMOA 4RM2A 5ARDA 3L0SA 2P4SA 4ASUD 1K6EA 3GC6A 2PQMA 3EEOA 3QWAA 2WJ3A 1D8AA 2UKDA 4WCDA 1NUTA 1C7RA 3ZBQA 1T91A 4C0KA 1NLYA 1RACA 1J06A 2POQX 2PX8A 4B0PA 1EDZA 3QVWA 5HQ3B 1G41A 1VLJA 3B78A 2EKDA 3DR5A 4BEBA 1AG9A 1PX2A 4RELA 4UXIA 2I7XA 4Z0NA 2MSWA 3UC9A 5A9RA 5KQPA 1SHJA 3UWOA 2BFDA 1L4GA 1MDFA 3V9AA 3OKFA 3TPFA 1JDBB 1Y5NA 1JFVA 3ML1A 1XZPA 4Y7CA 3ED1A 4E2XA 3LNTA 4JR2A 4R5HA 3U80A 2WKSA 3E1SA 4IWNA 4LVNA 2V4ZA 4BATA 1PEYA 5DYIA 1JYSA 3RO7A 4CKYA 1K66A 2ZGVA 3FROA 2VDQB 1SOAA 1U99A 5TVKA 4ZALA 1XXHB 4DCOA 2BHNA 2IQIA 4FFNA 1WJGA 3DZDA 4CTJA 1CD5A 3AVPA 5K2MA 5H3HA 3UHOA 1HDYA 2C0QA 2GN8A 3LQ1A 3FDIA 4IINA 4NARA 1QHSA 2X1HA 1H4SA 1S2NA 3HVRA 3U4HA 4FR5A 4RTMA 1W6RA 3GARA 3O8QB 2I4IA 3CRW1 3PDWA 4X66B 1AQNA 4R1QA 4W8HA 3K5WA 4DYDA 2H2AA 5HDBB 1TI7A 1GPMA 1FB5A 1NUQA 1NU6A 1NI4A 2ODNA 4GP9A 4HB4A 1U5BB 4XLTA 4IYRA 2QRVA 3WMRA 4ZT2A 1HLGA 5JLAA 2Z2JA 4LZPA 3ORSA 3CZRA 4BMCA 4ZJUA 5I7FA 3NHBA 2P4QA 1XZHA 2ZJYA 5HIMA 1HORA 2H5IA 1KO7A 3ACBA 4Y2UA 4AQDA 1VIYA 2VSFA 1J9GA 3U9LA 1DPFA 2Z8YM 4AKHA 4DEYA 1ORTA 3WKBA 1HL3A 4JIGA 1X86B 4A16A 4BGEA 2QB5A 5LLTA 2VRCA 3KVYA 5CHYA 3TMKA 3MCWA 4TYMA 2REBA 3CY6A 2LR0A 3SSAA 4ZKDA 1TZMA 5HUQA 2B5OA 4FCTA 3S40A 3NDBB 3BXOA 4N48A 1M72A 1LWOA 4J07A 4DYHA 2A0FA 1G7CA 2H00A 2BI7A 3P45A 3H9EO 1A9ZA 1TYBE 1YC2A 1YZGA 2VYFA 3UM9A 4GL2A 5DTMA 2D0IA 5TSDA 2J45A 4J1TC 3TXXA 2ZJFA 2FZ4A 3LDHA 3M70A 4AIRA 4H0FA 4AECA 4RGQA 5BXQC 6CHYA 2FSSA 2ENUA 3CB4A 4J0KA 3PHBE 1Z75A 1EEHA 2AJTA 1E4VA 1WQ4A 3VPBA 1JHQA 1Z6YA 2Q5OA 3STXA 3AI7A 4ARBA 4LDPA 3CCFA 3KOMA 1ULAA 2JNWA 4MS1B 4UTPA 3FZEA 3L1UA 2ERXA 2IZ5A 2O7RA 1YI0A 1SVMA 2RG7A 5IWAB 1E79A 2BMWA 1A77A 1AQLA 2CMKA 5CFLA 4KBGA 5E1OA 4TMWA 4C3VA 1QFMA 2FPUA 4I6JA 5CPFA 2WU1A 1KEEA 3SHTA 2A84A 4Q82A 1O5OA 4BV2A 4BX8A 2P6UA 4B3XA 4BMZA 3TUJC 1Q83A 3DP7A 2NXWA 1J07A 1I3NA 2PPVA 1TMGE 2GA8A 1S89A 3VR2D 4XPIB 4RK5A 1W73A 3ZU3A 1OZHA 4TN5A 3UFXB 4CVNA 2EFCB 4AYWA 4YMVA 5I4CA 1FJHA 3ROKA 2Q99A 3K1TA 3TWOA 1RWWA 1KZYC 2R25B 3BVPA 3RVQA 3VC7A 3UBTA 1SMKA 2I7CA 1TJNA 3CV3A 1LJLA 4YRFA 4OXNA 1UJ4A 1V41E 4L5IA 3OT4A 2XT9A 1PJTA 1OXTA 1U11A 1GKKA 3G7NA 3GFTA 3UNXA 5DK6A 2VHVA 2XKAA 5LQNA 3TQIA 4MMZB 3MC1A 5LQSA 3WGYA 4UKDA 2I8AA 5LNK6 4IHKA 4IVRA 2F6RA 4G5FA 3HCPA 1X3SA 3LOUA 4B84A 2BTOA 3OECA 3RABA 4DABA 1DUIA 1YIDA 3DKKA 2OMEA 3E22B 5EIWA 4MOWA 1RM4A 1FA9A 1U3GA 2ZYHA 3EQ8A 4PN3A 4Z7OB 3PFWO 1R6BX 1BDBA 2VP5A 2Y2UA 1AQ6A 2C5SA 2OHIA 2A4KA 2XR1A 5IN4A 2JATA 1KSHA 3N2KB 1GCAA 1N3BA 5FXMA 3K9NA 4B6QA 4DADA 1EWYA 1W0JD 5BOSB 1MJGA 2A92A 1CRLA 4OHCA 1RZRA 2GFHA 1PW5A 5DVZA 5CX4A 3CB2A 5HOQA 4F3KA 4EL5A 1LPNA 4Q1DA 1MUUA 5HCNA 1P1RA 3DW1X 5T6MA 1NOKA 1VPWA 2OEPA 5CXSA 4ONEA 4HPWA 4NCIA 2C9BA 1C3EA 2Z43A 3H5NA 1O87A 2HT6A 3MJRA 4QU0A 1UIRA 2QNBA 3EY4A 3JX9A 4YT4A 2XCUA 2XNCA 1ZJZA 3I30X 4TVOA 5EHIA 2HLPA 1CUHA 2AMJA 1SVOA 2GCGA 1PL6A 1R5NA 2XMDA 3PRYA 1WCWA 1WPGA 3DT9A 4TTTS 1IHYA 4ZYZA 5TDHA 1XD9A 2QRUA 1NIPA 2P65A 2ZB8A 2HHAA 1DKMA 3IEKA 1U2ZA 3W5IA 1NQVA 1X7WB 3KAQA 3F6PA 3KLNA 3R5KA 1HMYA 3PICA 2HEIA 1NXTA 5EIXA 5KDDA 2HU7A 2PQ6A 1DP4A 2WM8A 1RHMA 5ALNA 5CPBA 3V4VB 1KORA 3GJZA 4TYWA 2X4DA 1WD5A 1MJFA 2NXEA 2B6HA 1V16B 4WMLA 2NO9A 2QPAA 4HQNA 2ATVA 2G80A 1R50A 3ZV6A 3PXUA 4QG3A 4FDUA 2NU6A 3KKZA 4D43A 3PUKA 1Q57A 4K9OA 2G36A 2XOKD 4YCAA 3BMCA 3I01A 5T4FA 4XR9A 3EQ7A 3NRJA 4YT2A 5KS2A 1QANA 3G0IA 4FD2A 1J49A 4BO4A 4CG3A 1LLFA 4E03A 1OWMA 2AE2A 8LDHA 5IKXA 4ESEA 2Q2VA 3IEXA 2JLXA 2QD1A 1W2GA 3HR8A 2PT9A 3I34X 1LC3A 2WWWA 2GF0A 3DMDA 3EZNA 4WGGA 4UBLA 5JMPA 3W78A 3WWOA 4EFDA 3L1HA 2PMFA 4DV0B 1KKUA 1XKXA 1TECE 1A2QA 2ZS7A 2HIHA 2IXGA 1EVYA 2OGSA 4XQEA 1WOMA 5CK5A 5DCYA 3SY8A 1P1KA 2XA9A 2PKCA 2HFKA 3R24A 4TT3D 3T94A 3TX6A 4BLPA 2EZUA 1MQ8B 1QHNA 1YU6A 2OCGA 3TNDA 4B81A 5LNK1 4BXOA 4EVIA 1VHDA 2E82A 4NR0A 4V2UA 3TLGA 3FPLA 4CGYA 2XMSA 3R20A 4FWIB 5LDDC 5KI6A 3AOGA 3W6NA 3S2YA 1G8PA 3K0KA 3KTAA 4TTVA 1Y37A 5JV5A 3RTBA 2B4RO 2QJFA 4E70A 1A8PA 3H9JA 4HYTA 1KYWA 2NXCA 2W98A 2K4MA 4ZT3A 1QK5A 4KRXA 5I51A 3CCBA 3EF3A 1L5VA 3TK1A 1NN3A 1ZO8A 3TTUA 4B48A 3V4SA 1VL0A 5FYDA 5FYQA 2ZRMA 1LC0A 4RJKA 4YALA 5FNZA 5AVYA 1E1YA 4A9AA 5K01A 1LS6A 1QVRA 5EJEA 4PR3A 3K09C 3LU1A 2YIJA 1ZFNA 3GGDA 1O6CA 1V3UA 3TD9A 5IXYA 1GDTA 2YY5A 1BA2A 4LKOA 2RC5A 2Y0EA 1QKKA 3GG9A 2P2NA 1VPVA 4G1VA 1I4EB 1RI4A 3H0KA 1MQAA 1TJPB 3N8KA 4MJ3A 5B3KA 2ZWOA 3DPIA 5A4IS 4L3OA 3L6BA 4EDFA 3TUZC 4M1OA 4MUFA 4OK5A 4ACAA 4U2FA 5CURA 3U3ZA 3SHOA 3EQ6A 5TPZD 3ABIA 1VIMA 3KLMX 5DTJA 2W2PA 5CDSA 4Z53A 2EFEB 5C5IA 4WNAA 2ZDHA 1X0VA 5F7JA 2QMYA 4JMLA 3FIUA 1YOVB 1C3LA 4Q05A 5E1MA 2WAOA 4B2YA 1Q12A 4E6EA 4U2CA 5FORA 1QMGA 2OZLA 2XMCA 1JJIA 4A91A 5C32A 4KDFA 3THXA 1WD7A 4MWOA 1IY0A 5FX2A 1YC5A 4MCJA 1CVLA 3GJ0A 4JR0A 4UUBA 1VIVA 5I7HA 3QU7A 4WWHA 2ZUFA 3CLSC 2YYSA 3HDHA 1E7RA 2FN7A 4Q1CA 4ARZB 3ND5A 1ZWLA 1LZKA 1MAAA 3VU1A 1VHJA 4RV5A 3HU5A 1SBNE 1QO9A 3FWZA 3KT6A 3G8DA 4JMPA 4GW3A 2DUJA 2WWFA 3AC0A 1E2IA 1ISFA 3R6DA 4WZ6A 3NYQA 1RXUA 1KI3A 3OM1A 3FOFC 4AI6A 1R4ZA 2PX2A 2ODQA 4G01B 1U7ZA 3RBXA 3RUHA 4LOAA 5G40A 3ZX4A 2VYVD 3GX1A 3UN1A 4L4ZA 1JSLA 4QRDA 3QVXA 5AM0A 1PLJA 3L7JA 4IEFB 4DM4A 2D8AA 4DNOA 1QWSA 4LJ4A 4RFSB 4D42A 1TU3A 4QVGA 3I5MA 1WWKA 1JKJB 1QAQA 3ABQB 4RK7A 3RREA 1S2LA 3CEAA 3HGTA 5HEKA 2IL1A 2DHRA 3IDQA 5HKKA 3WIOA 3BH0A 1IQPA 3ZBTA 4B46A 3A6ZA 3GD7A 4B3HA 6GPBA 1TW2A 3HC7A 3VR3D 4BKUA 5JAIA 1ZJ4A 2XYQA 4HHEA 4YT8A 4X97A 2WTAA 3D6TB 3THRA 4BP8A 4BECA 1H66A 2P9BA 3P52A 1WXFA 4PCUA 3SJBA 1XZAA 4DRXA 4IDGA 4B09A 1SVNA 2Q3DA 2W90A 2XB4A 4UTZA 1D4OA 3O95A 1E8MA 4NONA 3DNMA 3SICE 4NNJA 1I80A 2KWIA 1EGVB 1XN1A 3EVTA 3H4VA 4KSYA 1VDZA 1T4DA 2X58A 5K8TA 4RABA 1T3GA 2AN4A 1AKRA 5DNAA 4C5BA 4RANA 1EGHA 4EY5A 5C7LO 1SKBA 2EOAA 2M1ZA 4TLEA 3UCEA 3ZNNA 4Z7JA 4ND4A 2Q4BA 4KQCA 5AKKA 3DEAA 5FTJA 2JB9A 4P4GA 1B93A 1SHUX 1XZLA 2A9QA 5CM8B 5FA8A 4IWYA 3K70B 4KPGA 2GN1A 2VNJA 3QLJA 5IJXA 4B40A 1ZESA 3M9XA 2ZPTX 4LXYA 4CLRB 4PBTA 2B82A 3AW9A 1GCGA 3LFHA 1JPJA 3P0EA 1N5OX 1QOPB 1LVGA 2NUAB 3TQQA 1CP2A 1WPRA 3RK1A 1AHHA 4Q4JA 3UHPA 4CT5A 3PLAE 5FO1A 2F1KA 1EJ6A 1G7SA 2AW3A 2HUPA 1PG5A 3OQVA 2JVIA 2YVLA 5CW1A 1XZCA 4EHDA 2DWOA 3GZNA 3QYAA 4QVKA 4JX9A 2HBRA 4I1UA 4UW9A 3NEAA 4DMGA 3EIWA 1Y8QA 3C41J 3R3WA 3R77A 4YRGA 2V3CC 3WLJA 2I55A 1ZL2A 3STUA 1J1IA 4P33A 5CIQA 4L5YA 3HVJA 5KTMA 2UYQA 3ONDA 1Z8NA 2QBYA 2I80A 3ZWCA 1NJSA 3MILA 1N6OA 2XWSA 1XV5A 3OFNA 3RRBA 4FHZA 2V7TA 3H87A 3U9TA 1N6NA 1G38A 1FQWA 2JJYA 2SKDA 2YJTD 4MAAA 5JD4A 1MB0A 4XVCA 4RHFA 4MUYA 3EGXA 5EMMA 1KZ4A 4K9MA 1NVGA 4DMCA 1OWNA 3ICPA 4KRFA 4I5GA 1R8XA 2VHYA 2X8AA 4GE3A 2I3BA 5CM9C 1QP0A 1IUKA 5HMMA 3N87A 2QX8A 3NWBA 4GQIA 2AFHA 3PZBA 4L9SA 1NF2A 2FJPA 2V4MA 4GM4A 4AY6A 2YNMC 1XYYA 3LFUA 4FBMA 2CCGA 2CDAA 2E1RA 2EF1A 1Q6ZA 3G5AA 1BXKA 1QU2A 621PA 2ZPUA 3TRKA 3DFZA 3K2IA 1SCIA 2D2FA 3FB4A 4G5XA 2A78A 2ZE7A 4CM1A 2PZGA 2WMNB 3UMFA 2PEZA 1ZCBA 4RAOA 4I9HA 1RVV1 3IBGA 5A4DA 3ZLJA 3D7NA 2AVNA 5CG1A 5E8JA 2H5JA 1KOGA 3WP0A 2BEVB 3DJFA 4XX0B 5DGHA 2OYRA 2Z5VA 3CINA 4ZT5A 2LUOA 5ALDA 1ISRA 1EX9A 5D3MA 3I83A 5BUCA 1BHQ1 4TXLA 2FZGA 2JLCA 4M0FA 3RT7A 3U4GA 3VPXA 4OKNA 2EW1A 2V58A 2G9NA 4PY2A 5BSRA 5KVSA 2O5EA 2ZB7A 3GEPA 1EPUA 2G83A 5HJ7A 1E6CA 4JI4B 4KOEC 3JTEA 4FK8A 1U2TA 4BYMA 1LW6E 4AMUA 1VMIA 4QTUB 2QAJA 2O05A 4XUGB 1DU4A 1PK7A 3O74A 1P0PA 4JAVC 4QWMA 5JDIC 2X8BA 2PLAA 2VHJA 4TSFA 4WZBA 1J70A 3B3FA 1OXSC 2I1QA 1C4OA 1EG7A 2RGBA 3NATA 3JQ9C 2O7QA 3O0TA 2ZT5A 1Z2AA 4I5DA 4PPFA 4R69A 5KYVA 3UGQA 4C20A 3G2IA 1AVTA 2QW1A 2NO0A 3KYDB 2ZS9A 1NURA 5DI3A 5BQPA 5SY4A 5GIOE 1ABEA 2D1RA 2H07A 4J2HA 4MR7B 1B2LA 4LZOA 2JW5A 4LJ8A 5ELXA 3LUDA 4JELA 1YUMA 5A6SB 3VHQA 1AN9A 4Q9KA 1T34A 4KBYA 3GJ6A 3UWPA 2Y4OA 2YHAA 3EIEA 4CKXA 1TGVA 1XROA 2VF8A 2WA1A 2CXUA 5TV2A 4CQNA 3TDMA 3F6YA 4CHGA 4KW7A 1C30B 3KZMA 2RHOA 1PS0A 3NAMA 1Z0SA 3GYBA 1JDTA 1WDKA 3GFPA 5KYTA 2JGAA 5BYAA 2H29A 1QQTA 1IM8A 4WA8A 4ZU6X 1Z5OA 5C9ZA 3QWHA 4OJNA 1F2TB 4PTYA 2VDMB 1YR7A 5F1PA 4D4IA 5DSXA 5HOEA 3U44B 4MYCA 4JUCA 1X7XA 1LW7A 1DEKA 1ZK2A 3FF4A 2WNSA 4L4YA 4RZ2A 2IU0A 1IB0A 1KO8A 3U6BA 2Q2WA 4YRRA 1DFGA 1FUIA 1QOZA 5BNWA 2B7BA 3E5NA 4WNCA 1JDJA 3SE0A 3BKXA 3FMOB 2O3SA 1KQ3A 1ZIXA 2BM9A 3NZEA 2XNHA 2WE7A 2H8KA 2XLCA 4J0HA 4EF5A 4HS4A 3OJOA 1KQFA 3AI2A 4G85A 3ORFA 1AHPA 2R6HA 3A1SA 2OHOA 2OC9A 3EGDA 1SCNE 1T4MA 3G2KA 3HKDB 5H0IA 3T3IA 5K0GA 4MVJE 2IYRA 4U9UA 2V3WA 1ADCA 5KPDA 4LF9B 1DMRA 1C7EA 5A5GA 1N8NA 4AF7A 5BNZA 2HBZA 1QYXA 4IMRA 1NQXA 4D6YA 5KSWB 2C96A 4CLOB 1XEXB 3AJRA 2O7SA 2QIPA 1YCDA 4PQRA 2AXQA 3MWDB 4Y8VA 5CJJA 4LV5B 4WI1A 1B73A 1NMQA 3S2EA 1KNQA 1W75A 3TYXA 4BLRA 1DOHA 4R9UC 3WNVA 3IQHX 2G04A 4OKSA 2K5UA 4R8RA 3MJTA 2M6LA 3D3QA 3HPQA 2OAGA 2IEAA 3FUXA 4K6CA 5KDOA 1CG6A 2YMQA 8MHTA 3ZIAA 3THWA 1C9MA 1GPBA 2AG6A 4WESA 2AGVA 1Y42X 1G4HA 3C6QA 4QTTB 5EKXA 1BA3A 1UDAA 3E48A 4X65B 1S5PA 5TF0A 3TG8A 2OQIA 4UUQA 5EPUA 1SBYA 2XDYA 1TQ6A 3NPAA 4LNUA 1UWVA 1BQ4A 1RWQA 4RGYA 4YJKA 2V7QA 5MFZA 1N5IA 1VGQA 3HJBA 4RO0A 4PN7A 3E7DA 1GLNA 1I2AA 3BD9A 5K9ZA 4MDEA 5IM4A 1BAPA 1D4ZA 3DVQX 1C9EA 5D7NA 2GGSA 3H5LA 4KK3A 3VKUA 1Y0BA 2GD1O 1LTHR 1SXJA 3HY3A 4O4HA 3DDWA 3UMGA 2GZDA 1MXHA 2PKXA 1GR1A 4BLVA 1Q1AA 3IRUA 3WYDA 3EH1A 2JFZA 1ZIDA 3A1EA 3R44A 4URVR 1L5FA 2OORA 3BG5A 4DJEC 4FOTA 3ETJA 1PNOA 4QNNA 4K0KB 2ZI7A 1O58A 3MTGA 4LHSA 1RRKA 3F9CA 1P5ZB 5IVKA 4EB8A 4AZTA 4E32A 4XDGA 4DQXA 3OC0A 5AOBA 5ALUA 3ZU5A 1TM2A 1ZJ6A 2OO3A 1Q92A 4K81B 5G4KB 3AUAA 5CNIA 1M2EA 3RYHB 1RBMA 1Y48E 2X5NA 2H2FA 3NHKA 2F1IA 4PFJA 3IDSA 1P45A 4Q1EA 1XCBA 1SKYB 2BL4A 4BQFA 4OV6B 3QPUA 3CLKA 2FWNA 5FNVB 2P27A 2F00A 3CA8A 5CEEA 4EK9A 1OU4A 2P2LA 4C4AA 4H7DA 4CF5A 4I08A 4I1SA 2XI4A 4HX2A 4JI0B 3IA7A 2ESRA 2GCPA 3NBFA 3PC8A 3W9BA 3ZS8A 3FIJA 5EZYF 3SDBA 4IQFA 4QOSA 3RS5A 1L1EA 2ZAGA 3JWPA 2CSXA 4V3CA 4Y1FA 1PR9A 3AVWA 1PL0A 1EK2A 4JOSA 4KO8A 3QFSA 5IEBA 3UAVA 1UJMA 3GAMA 2CXTA 3JALB 3USES 4OHPA 1G16A 1GGEA 1F0PA 1XX6A 3LXRA 1XKLA 1ENPA 2GCOB 2MHCA 3HVHA 2GN6A 1HUQA 1E4EB 4TKZA 2IKQA 1GG8A 1Z07A 3IL2A 5EJAA 1EZ1A 2YJ5A 2G07A 1P0MA 1QX4A 4N4AA 3UHAA 1T5OA 1DAFA 5IHXA 2HQRA 2VDUE 3VR1A 1CC1S 1KYVA 2ZJ5A 4MQBA 4FDVA 2ORED 3LVQE 5CFOA 2A5DA 1J0AA 1STOA 2KW5A 3K0CC 3DEYX 3D0QA 3NHRA 3LZ6A 4R1NA 4P3NA 1CKEA 5KQMA 5D5QA 2VDPB 2FN8A 3GT3A 4XRGA 1SQFA 4C78A 4OUDB 2IXDA 3MGKA 4IAOA 4NATA 4NX2A 5FOXA 3H2YA 2BFMA 4CM5A 2YIDA 5JPCA 4EG4A 3DKVA 2O8CB 1W88B 4NPAA 1ZM9A 3LYAA 2AEFA 2JLBA 2NYAA 2QMHA 3KELA 2ORWA 2Q1XA 4JEUA 4Z8XA 1Y6QA 3VAAA 1FL9A 3OQOA 1C2TA 2AQHA 2W6NA 3KV3O 4TMYA 3ZW7A 3B70A 2A5GA 2YJ3A 1NR1A 4MP3A 1GKLA 2ACEA 5DO9A 4E08A 5BR7A 2Y6UA 1SWWA 5ICFA 2DY1A 4OQNA 1HDZA 1WA5A 2JIPA 5F76A 3RUIA 5JQGA 5C46F 1GOTA 5D6NA 2Q62A 4GX2A 1MH1A 3AUXA 3Q5DA 5C3UA 5CDFE 1E1CA 1FZQA 2QL9A 3K9BA 1JUDA 1OYOA 3J80A 3MTBA 3AZQA 4WXRA 1EXVA 4UAJA 3B12A 2XV1A 3EZ2A 3X2FA 2IVZA 2WPNA 4DC9A 2ZG6A 4LBYA 4B3BA 3HKEA 1K7EB 5B1DA 4P1ZA 4UXHA 2QY9A 4OHWA 3PHHA 3MBIA 2AIRA 4A3SA 2GPAA 3OP4A 1V5FA 1U0TA 1UBRS 1GG5A 5JU6A 4CR6A 3TTTA 2AOXA 3QX8A 2GX6A 1KOLA 2QW8A 1MN6A 5BNTA 3TCXB 2X4GA 3ER6A 2IZ7A 1L4EA 3S81A 4QDTA 1U8XX 4YDQA 1M2VB 4ZO9A 4A8HA 3IKMB 3NTUA 2J4CA 4QASA 2C9MA 4F4FA 3RFXA 4P6VF 1FFDA 2P0YA 3E9MA 2HMTA 1K2VN 2RH4A 4QQKA 3W6PA 5GZ3A 1YB5A 1Z0JA 3PF9A 1O6ZA 3LHSA 3FHCB 2JZNA 3AB7A 4RPCA 1WKBA 3IA2A 2DJIA 3FDZA 1RBZA 4O2RA 1ML4A 4XXHA 5H5JA 3E2PA 3F98A 3TL3A 4OHYA 1V96A 2NQ8A 4A0SA 1F9EA 4JYBA 1PQPA 1ACMA 2GN4A 3DF7A 3NBUA 3OEEA 1N6IA 2QLFA 4YCLA 1K98A 5C0OE 3BHNA 3GT0A 3QPBA 5BQ5A 2WJZB 2OQ2A 3MWEB 1JLLB 1Z62A 3JR7A 3NOVA 4G36A 5DNVA 3TZHA 4DWJA 5HPYB 1SKMA 4JP1A 4ARIA 4HH3C 1CZUA 2WM9B 1XP8A 2R7NA 3GLTA 5DXAA 3WTCA 4DCVA 4HUTA 1EVIA 3MUNA 5K7SA 1W4AA 4TM8A 1XEWY 4JP3A 5CFZA 1JQLB 2BGLA 3OX3A 3L84A 5A3QA 4K9DA 4QU8A 2G71A 4BRWA 1V5GA 2LPMA 1E6UA 3HWWA 1JSZA 2WZQA 1E2KA 2XQIA 4TV9F 3ZTTA 3NFRA 1D6JA 1Q7EA 4AJPA 5CK4A 3H2JA 3TLKA 4Z1OA 4HUJA 4NDZA 2JIQA 1XMSA 1DRWA 3OC6A 5KTTA 1ID8A 1M0EA 3N59A 1N0UA 1X77A 3UY4A 5TMBA 3ZKWB 3PHIA 1GL7A 2AXEA 2EP5A 3FMIA 1L6IA 4C6RA 3H75A 3BHMA 1QTNA 4N03A 5C37A 2PX6A 3HP1A 4CG0A 2J59A 4E94A 1QP7A 3QE3A 4KXXA 4RPKA 2VATA 1DBIA 2ZJ7A 2P1DA 1AXRA 4GGPA 3T3NA 4E5DA 1BRTA 1HT1E 1ZH0A 4DCSA 3MN1A 3KR2A 4P8RA 4FYWA 4JGBA 4GP6A 5DCLA 1K7YA 3WRYC 3ZZ1A 4C2TA 1FIUA 4QICA 3PR1A 5ICEA 3HVUA 1PEAA 3CWCA 5DXJA 3K6SB 2IEIA 4UXJA 3I92A 1WUKS 5FOUA 5C80A 1RLUA 3KSMA 3U4IA 5E2BA 4INZA 2O6LA 2WYHA 2Q4TA 1T8SA 4U2BA 3ZEAA 1W30A 3EGOA 3Q5GA 2QV7A 4QOGA 3SQXA 1UWLA 2WK1A 3RVLA 3G1TA 4H1TA 5BSEA 1K8ZB 3EDRA 3OLVA 4FEAA 4HPXB 2V6BA 4AJIA 4IV0A 3DE6X 1RQLA 2YW2A 3B1WA 3PF8A 4I9FA 3S70A 4DNQA 3OJXA 3EZGA 4NZNA 4I55A 2VO1A 2VF4X 4XUEA 3RS0A 3A2MA 1CDZA 1ICEA 4MRPA 5FDFA 4KPEC 3SIPA 1NVEA 1N92A 4BQIA 4FONA 3ADCA 2GJ8A 2Z3VA 1O97C 2R4UA 1GWNA 2J85A 4OSPA 3AT1A 5IYZA 3N2EA 1Q19A 2V5AA 4AKSA 4CTKA 4F86A 5IKPA 4HGRA 3FJYA 4UM9B 2OECA 1NQAO 1R0YA 3KJIA 4FYPA 4L5BA 2C8VA 1T36B 4MCHA 2OG2A 2QSJA 1OAOA 2GFIA 3V2GA 1PR0A 1VL2A 2WD9A 4LVOA 1MB4A 2JZOA 5BSMA 2FR8C 1QFXA 1ZJYA 2WSSA 4IM7A 4EQZA 5L6LB 4YAUA 4KJZA 4TYYA 1SU4A 3LX4A 3SF8B 3UG7A 3IMCA 3EFOA 3JRNA 1Z9BA 3E6AA 4J0DA 4L75A 2ZWPA 4RIGA 2RHMA 3VSBA 2Z5GA 1Z2EA 3CW2A 4IFEA 5AM3A 2FSIA 1J8VA 5KOJB 1ZUNB 1N1GA 3WWPA 4J6FA 2GNPA 3ILHA 3A0RB 3TRHA 3ZUGA 4DJ5X 2RGUA 2NUTA 1Z33A 4QXQA 4QODA 2FE1A 1Z6QA 1ODJA 1CE8A 3NKLA 4MV6A 4DIOA 4YJ2A 4QREA 3T0IA 2Q2OA 2ODPA 4Q0MA 1K7CA 3C85A 3MELA 5F9MA 2PSEA 2YVQA 3AEYA 4IZHA 2G9VA 1CR4A 4Z2AA 4ZVPA 5J47A 2ASEA 1MGPA 3TE6A 2IU6A 2WJ6A 1TOAA 1O9HA 4FD3A 4LYHA 3R8FA 1P0QA 3EY9A 1DAOA 1OVGA 5KHAA 4EY7A 4CR8A 1OWPA 5A1JA 3SIRA 1JILA 4PPNA 4L95C 3G1WA 3V3TA 2MSNA 3IEPA 1M75A 4BUZA 3TBFA 1WXWA 2FSVA 2JI8A 1A9TA 1PNTA 3PNSA 4M8KA 1SUFA 3OQHA 3K09A 5K6AC 1TYZA 1UPAA 3EBPA 4KXQA 2ZQ5A 4LSZA 2CNKA 4X61A 4G5QA 5EVJA 5DE3A 5HNKA 1QC5A 4HNTA 4ZRNA 5JAOA 2R48A 3A32A 4GGOA 3TSWA 5CFNA 5K8VA 1QIKA 3MRVA 3REQB 4A26A 2IP1A 4ZTUB 1V7CA 2PAAA 4F4CA 1NVVR 5FOVA 4LZJA 3S2ZA 4HEHA 4PAOA 4DOMA 4N01A 1SCAA 1NASA 2O2HA 2WWXA 3UAXA 2XGMA 3LDAA 3V7FA 1RS0A 2HMWA 3N2GB 3OM9A 1QNLA 3IP9A 5SICE 1ZRSA 2BZSA 3UC5A 1J90A 1EBBA 3DFUA 1E98A 3TLXA 3OWOA 3BMNB 4LPSA 1ZOIA 1SKAA 2JVJA 3MYYA 2PRIA 4IDNA 1OMOA 4FHCA 4M7WA 5EMNA 4DJJA 2XKKA 4H3HB 3DEIA 5J4LA 1B15A 2MMGA 2HI0A 4H59A 3K73O 1YVDA 2G1AA 2Q4RA 4JN6B 5TQ2B 1FMCA 3QQ5A 4Z9XA 3GLFA 1S6YA 1LBHA 4K6OA 1J4AA 2PT5A 1XBTA 4PHTA 2UYGA 5DNDA 4MHTA 4WBNF 1NYQA 1SIUA 1ZQ1A 3NLLA 1DXHA 4EFMA 3MPOA 4XFJA 1N34B 4YP7A 4GWGA 1Z47A 5A71A 3CRNA 3EJWA 4TL9A 4HNAA 3LGSA 1XI2A 3ND6A 4IZ6A 4Q7MB 4BUCA 2XMQA 3T7IA 3WLPA 4L7VA 4ZOLF 5EQDA 1JDPA 1MRZA 4GYKA 4KXVA 4YRLA 3OFJA 4EF6A 2P75A 3L7OA 4IJMA 1N5MA 5JC8A 4MB6A 5F9HA 1PR2A 3WZLA 5L3QB 4IHJF 3RSSA 4R1SA 1E20A 4D8VA 5JJIA 2RMKA 3ZS9A 1T3TA 1NVWQ 2V0NA 1KMIY 1Q44A 2IWRA 1JQ5A 2O2SA 3AJ9A 4MR8B 3RIEA 3QU2A 4AS3A 4BX0A 1UC5B 3OHPA 1X74A 3FLAA 2DY0A 4JHXA 2VHZA 2HMAA 3BQMB 4TS3A 4Z4FA 1U2DC 2WJJA 1FBTA 1PKXA 1IK6A 1AU9A 2FSPA 2QRKA 1EP1B 3BULA 4ILKA 4LISA 3D8RA 1WMFA 5FUXA 5J63A 1VI5A 4PRLA 2PUBA 3T3OA 4BZPA 1S2DA 1ZY2A 3H5AA 1NSYA 1YVUA 5DT2A 5CVDA 3UA3A 4DMRA 2BMJA 2PUDA 2CDCA 5BQOA 1AN0A 1UFOA 4PG8A 1KSJA 3N3AC 1ESZA 4QJ3A 3E5MA 3OOYA 4W9MC 1E7MA 4PZLA 4M8LA 3UA4A 3FPEA 1MU0A 1XZBA 4YMUA 2VVTA 3Q4GA 4NC9A 1I1NA 1AS0A 5IBRA 1R18A 3FFWA 4GLOA 3EA5A 5E8RA 1RZVA 3U37A 1ZHHA 2R7KA 5CCXA 2IYUA 1O95A 5TGDA 1PFGA 4O4JA 4DNPA 2PEYA 3R3YA 3HFJA 4B80A 4NZPA 1QG4A 2AJBA 4UULA 2Z8YA 1V35A 2IYEA 4FNAA 5EP1A 1EK5A 4ANFA 4HEA1 5HJ2A 3MWKA 3KS9A 5IAGA 5LA6B 4JBLA 4KQ9A 4A23A 4C07A 1BJKA 4OGFA 5CDGA 4B6GA 4RORA 4ERNA 2R6AA 4N5NA 4LF6B 1LY1A 1P4JA 3JD1A 3JW8A 4PWZA 5A4FS 5C5EA 5LR6A 2QMOA 4LNHA 2AG0A 2OCIA 3LOPA 3STWA 3G17A 3W6UA 3JQBC 1NVMB 3O90A 3DYVA 1W1WA 2YC2C 2WSYB 3NHSA 3OFSA 2BMDA 4X60A 5AM5A 2RIPA 3TW8B 5BMVA 3DCYA 2RHCA 4TTJA 4ALIA 3ZE0B 3DV0A 3UJ8A 4G84A 4CEJB 1IU9A 3OOHA 1QB7A 4CT4B 4IXMA 3U17A 2WEKA 2NVUA 2WZCA 5ICSA 1R12A 4TQAA 5JO9A 2OLJA 2M6KA 4D8XA 2IOYA 5BW8A 2XEXA 1SIWA 1BKDR 4GMFA 3G23A 2G1KA 5DN9A 2EP8A 2HHHB 3RSLA 1G1MA 1P2VA 3DJYA 1NR5A 3NHJA 3NPMA 4FMPA 4R40A 3HA7A 4P4NA 3UT5B 3OO1A 2C2KA 2O2ZA 3F6RA 3RSCA 3VR5D 4BX2A 1H0RA 3D8NA 1TO2E 4OSEA 3QKWA 1PJAA 4GXTA 5DZSA 3AF1A 5G0VA 4EZEA 2WD7B 4REQB 3KEQA 1PUIA 1FS5A 1QORA 1U80A 3PHCA 3BCSA 1YL6A 1N2SA 3FTNA 1E3JA 3RRMA 5K3SA 5L53A 1CUUA 2PX0A 4EVQA 1OT3A 3DEFA 3BA1A 4QGSA 4FFPA 4C7BA 2WUDA 4D3SA 2OGUA 3NRCA 4WCFA 2ZSIA 1E3IA 3A27A 3O2SB 2WKRA 2RB4A 4LWZA 3WL5A 1WW2A 3OAAD 1YONA 2FPPB 4N40A 5KMGB 1VBNA 2YYYA 3WA6A 3G0OA 1Y4ZA 3U0BA 3VQTA 1JIUA 1W96A 5B4UA 1OLUB 2WSBA 2R8PA 4DMMA 5BVHA 2C4WA 2O3TA 3A37A 3A9CA 4OLBA 4WOKA 2VAWA 1TZ2A 2DLDA 2Z30A 3IPXA 3TGWA 1ONPA 3VR6D 5LLDA 3RYTC 3AF5A 3CR3C 2P6PA 2ZJ4A 3KYCB 4MVJG 1SBTA 3ENZA 3T5CA 3JV7A 4EH1A 4KREA 2A59A 4KSBA 1P39A 5JWHA 4TXNA 2CN1A 3LZDA 5H82A 1GNTA 2CXNA 2CNWD 4NYMR 1LBQA 2GCNA 5ALXA 3TQHA 4CE6A 4AMVA 4EYOA 1OYYA 2CJFA 3U5ZB 2C3YA 1F4VA 5JNWA 1N6PA 1CF9A 3JQ9A 4P80A 1JKFA 3BAZA 4B6RA 4Z4HA 4JUIA 2OB2A 2CLHB 1G3QA 3B8EA 3SP1A 4C6HA 4E15A 4RVOA 1NJ1A 1YFKA 1P2SA 3BDIA 2WKPA 3CNQS 1IHXA 3L0DA 2XEDA 3QBTA 3V1TC 3W8NA 3C39A 4KE9A 1AF7A 1V3TA 4DDHA 4DUPA 2C29D 4QXRA 5AH0A 2OBBA 4MYTA 1UQRA 2X7HA 4U9IS 2EKZA 5KYWB 2C07A 3FNEA 2IFTA 1IG0A 2XT0A 3HCCA 3TW4A 1XHEA 5FWYA 3ZVLA 4ZHQF 4ZREA 3KZ1E 3RNOA 1GVHA 2J5XA 4AY4A 2ICAA 2DUUA 2QUZA 4LQDA 4QHSA 1RHRA 4TT3A 4EWLA 3A10A 3TZLA 4YX9A 5J2TB 3OWXA 1X0XA 3Q11A 2B1IA 1XCJA 2IHBA 4UCXA 4EKGA 1FZTA 4U0KA 3ONEA 4JBWA 5D6OA 4CN8A 1U6KA 1GTG1 2AT1A 2ZJ1A 5H02A 2UYCA 4KR2A 1JWLA 4A6PA 3L92A 5T4EA 3AIOA 3IJEB 5TIIA 3HN2A 4MUXA 3UMYA 2FOXA 3HNPA 1DWUA 1MEOA 2Y9PB 2ZQYA 5ALYA 4GI2A 3JYPA 1HYEA 4HZUB 4MUJA 4HAVA 4UPVA 3RYCA 4UMEA 4ZO6A 2RJOA 4KFRA 1ZPDA 3UOAB 1P2BA 2ZWVA 1C41A 3BSWA 3EWIA 1TQ2A 1YRYE 4P08A 3D6JA 4EAAA 2Q4DA 1N2EA 3RVSA 1NW6A 1P75A 5KJ6A 3MMSA 5LOVB 2UYHA 1MRSA 3BK7A 1Q0ZA 4TUYB 2NLOA 4TN1A 1KZ6A 5LB2A 3EPRA 3JZMA 3KOZA 3UKJA 1DIAA 2HKIA 1OW3B 2O9JA 1NRWA 2C2HA 1QJ4A 1KY2A 1G9XA 1QIIA 1L3IA 1CQJA 2R96A 3IT0A 1UINA 2H7VA 1OROA 2GEKA 3WB1A 3FKSA 4D4HA 5BSGA 2ZVQX 1FP4B 2GAFA 3HYSA 3FI9A 1FFXA 4TLDA 1H94A 3R0IA 4YDSA 5F1KA 5CA0B 2ES4A 3JU3A 4IS2A 1HDEA 4XCQA 1XWFA 3KJHA 3UGTA 3N74A 1LBEA 5KOHA 5HP4A 3SHWA 3CYFA 3SIXA 3FLBA 3U3MA 4DILA 1HQCA 3ZBUA 1YTUA 2XXJA 4OHZA 4PGHA 4JLNA 3E7WA 3F4KA 3JATB 1Z56C 1HDXA 4MW7A 4RH3A 2CL0X 3IQFA 1SOWA 1RYDA 2I76A 5D00A 5A05A 2UV8A 1SXHA 4WJLA 1JDSA 5JOQA 5IRCD 4MS3B 1J6UA 1G5IA 1RWPA 1IBKB 4NCHA 2RK4A 3DFKA 3KKQA 3MYRA 5EA2A 2IS1A 3VSCA 1T9ZA 2HK9A 1XZ8A 4ICIA 4RIEA 4ARVA 4I5IA 3VJRA 3BRWA 5F5XA 3C48A 2J07A 2A6PA 3P8ZA 1NF8A 3DVAB 3P9RA 3GEBA 4FJ1A 4I8IA 1LRKA 1QFSA 4NJMB 4OFZA 4D46A 1H65A 3EZ7A 2ERYA 2ZETA 1ZICA 3M5DA 2W2TA 2NACA 1NW4A 1QH0A 2VYVA 1VDMA 1IBSA 2SCUA 4PGAA 3UK2A 1FNDA 4URYR 2PJDA 5JJLA 1TPZA 1ONOA 3OLWA 1KDOA 3TINA 2EX4A 2BLNA 3NOOA 4YC7A 1XCMA 3DTYA 2BI8A 1RABA 2PH3A 2P9TA 1L4MA 2RAPA 2V0CA 1N2GA 1BWRA 3I5UA 3IJRA 4TKVB 3WIUA 4AB1A 1DIRA 2VJPA 1TO1E 3NC4A 1SCUA 2HMUA 4FHDA 3X3HA 1JF8A 3EEYA 4KQ6A 2GT1A 4O4LA 1KZ9A 4IVQA 4DCUA 1TVKB 5FPKA 1ZVKA 4OXRA 2PU7A 1R74A 1TQDA 3PBKA 2ZYTX 4GPD1 3HABA 4QAQA 2JGEA 3OX4A 3HVIA 4OIMA 3A9TA 3UTDA 2YOHA 3N6XA 5KCZA 2GCEA 1N5RA 2I2CA 3BKWA 3H19A 2RAVA 3PDHA 2H4YA 1UJ2A 3AKCA 4PXAA 3WLLA 4EHIA 5K3BA 2FX3A 5CB0A 3ZHOA 4EHJA 4IEIA 4DV4B 4TL7A 1Q77A 1P81A 2YCBA 3L4BC 1LI7A 1YR2A 3RJMA 4E30A 1UKEA 3ZV5A 5IDWA 2LW7A 2ZUBA 5TGTA 4N5MA 4R83A 4AY2A 4BYGA 4NMWA 3P19A 2CBGA 1ILEA 2HU8A 2OSBA 1RAEA 2XNSA 2DBVO 4IXDA 3H42B 4UDNA 1E5DA 3HXQA 1U9JA 5CTAA 2UXDB 5BV1A 4XDZA 1Y6FA 4N0EA 2EG5A 1IPEA 1TA4A 1U7PA 3HZHA 3LXMA 4Y2YA 2M98A 4DDKA 3SXPA 4TS1A 3V1NA 1QHEA 2C57A 4LZNA 4HO1X 4MQEB 3GLIE 2O8DA 3TJRA 1BJTA 3SYNA 4B6PA 4AWAA 3AH8A 3PNPA 1W7AA 3P9IA 2H8GA 3FOBA 3PD7A 4J9VA 5EJFA 3WLHA 3PKZA 3NTOA 1C1HA 2OTCA 1Z6GA 1JBKA 2QSYA 4DFDA 2IS4A 1RQXA 5IDXA 3PWKA 3LX5A 3R6LA 1JWAB 1XJ0A 3K0CA 4D45A 4RQBA 1B8UA 1MORA 3D3JA 5FL7D 1I7NA 3PU6A 1Q91A 2XIJA 1ZD8A 4R01A 1JHXA 2G1UA 1WZCA 3UUGA 2AN3A 2ZIUB 2Y1CA 3QE0A 1ZM2A 3HI4A 4JYCA 4CV1A 4QYMA 1IOWA 4QOEA 4CTOA 1WABA 4QATA 2WYIA 2D5LA 2MTBA 4EKDA 1VKZA 1SUPA 4D3DA 3I2GA 3OKPA 4XQ0A 5EJ2A 1IEXA 3QVGB 3RU3A 4LYJA 1DKQA 5FFNA 3RDPA 3B7PA 3F7MA 2FPGB 3BFPA 3A1WA 2FR0A 4QOJA 1KI7A 2F3PA 3P27A 4DJDC 2YHIA 4I1VA 1E2FA 3AY6A 2XQFA 1L5MA 1Z4LA 4JLJA 4INJA 4QOIA 1WCIB 3AR3A 4TZKA 5JD3A 5DHFA 5C8XA 3PFIA 4O3MA 2BP7B 3D2BA 2RGWA 3F5MA 3RVRA 4YAIA 1G4UR 4PYLA 4O3FA 3OQMA 2K2QB 1FFYA 2IHKA 3DTVB 3HYCA 4YO7A 2HSWA 3RC1A 1E89A 2I66A 2OOKA 3FFXA 4AD8A 3V8EA 4F7DA 1HTWA 3W5SA 4YASA 2YJZA 4EG3A 3HMQA 1DIGA 4RZIA 4WN9A 1JEJA 2OCAA 4HLCA 1YZVA 1OB5A 2FW6A 1JR3E 2YWRA 2GN0A 5IW8A 1PT7A 5DGIA 4KH1A 1M83A 4MI3A 5DX8A 1FRVA 4DYVA 4E4YA 3W2GA 3CLUC 3ZIUA 4DA7A 3BEOA 2EVWX 2PX3A 3C5WP 3TNJA 4RCVA 5K03A 1KA9H 1IN6A 3AUSA 5ESXA 1QR6A 3H1FA 3K35A 2ZREA 3DO8A 4ZQIA 5LYJA 3RVPA 1J1UA 1Y4UA 2E85A 2ZKIA 1J5XA 4H7JA 4Z0TA 5C7YA 1JSRA 5CMLA 1ZU4A 1VRVA 2NU9B 4B33A 4F9FA 1EVQA 3GH1A 2ISQA 3AB3A 2YIMA 1JW9B 3AIKA 4XWGA 3IMFA 1QFZA 3V7YA 2WJYA 3VO1A 5C31A 3ETCA 3AK4A 3R7WA 5BN3A 2QQ0A 3HA3A 4O59O 3F7NA 3QFRA 1VA5A 1YACA 5DHSA 4ZV7A 1ZI6A 1F4LA 5GONB 4YRAA 5I3ZA 1T35A 5IZCC 2R00C 3BGIA 2IP2A 3OI7A 4CF3A 2JRCA 4TXHA 4LG1A 2B21A 1G98A 1PDVA 4I36A 1YJCA 3CH4B 4A4DA 5IT9A 4D41A 3HXMA 3IIEA 4M7OA 1BW9B 4BV8A 2Q1TA 3QG1A 3DHEA 1TIPA 3IUQA 2Q6KA 5JYCA 3I2KA 1HNNA 2G63A 3TIIA 3ZGXA 1DBWA 4FHFA 1CZHA 2C88A 4L22A 2WUVA 4KR6A 3PJGA 5KWJA 5LPNA 1KAEA 2EIHA 3K0FB 2FQQA 5DLPA 4TLMB 4HQLA 1QCDA 1L7OA 1LJUA 1ZGZA 1ZOSA 2M1XA 3OICA 3HJHA 3WWCA 3GA0A 4YROA 3CLSD 5CAEB 3LOQA 4YJHA 1XDZA 4YP9A 521PA 5LP6A 1XNJA 1B23P 2A3NA 3G6WA 5BV7A 4BU0A 2Y1XA 4U2GA 2DHQA 1JFTA 1HDOA 4DNFA 2QTCA 4P93A 1AQYA 3P2KA 1VYTA 2JD2A 4R6XA 2V6GA 3JVVA 4KOAA 1ND5A 1X3LA 3T9BA 3FUCA 4YUYA 3B9RA 4S05A 3V48A 5CCEA 1XTIA 4KP7A 4JBHA 1XPRA 2BFFA 5B7GA 2P0AA 3RADC 1NVDA 3OESA 4R05A 3HMKA 3OT1B 1IZ7A 1GQRA 3DDUA 3O75A 4LJKA 1QE5A 5JRZA 2XAUA 4GR4A 4HQRA 2A1IA 1F8UA 2JLZA 1X7ZA 1SB9A 4S1NA 3N8HA 4IIVA 4PINA 5E38A 5FIUA 3CZ9A 3GMTA 4HC4A 3P4XA 4TMZA 1KBZA 4MYHA 4UTVA 3B7GA 4K28A 1IB6A 4BVBA 3KKKA 2OE2A 1YMVA 5IG2A 2WJHA 2X0DA 4MDFA 1TYAE 1W4LA 1CNFA 3MOIA 1T0PA 5JWOA 1XNGA 4MGEA 4RZUA 1E9DA 1FNNA 1Q1NA 2PX4A 3OPYA 4FKMA 3AETB 4EUKA 5E1DA 2D0PB 2BRUC 1Z8HA 3C6MA 3DO6A 1J8DA 4MUEA 1P7PA 1NSTA 4FILA 1X1DA 2CLIB 4RJIA 1HFJA 1IHPA 2RSLA 3DE4X 5LZ8A 3ROGA 3VVBA 4EPRA 2VAXA 1KK2A 3C7TA 2AW5A 2X3UA 3BCRA 1Z0KA 4FYVA 1N78A 2X2EA 4Q66C 5KTPA 2VI5A 4FGUA 1OH5A 3R8CA 5DHQA 5CVJA 5IVDA 3OURA 1Y1QA 4WIAA 3ZHRA 5C52B 3RVBA 2AOTB 1J2EA 4FX5A 1LV7A 1W44A 5PGMA 1QNFA 3V42A 1IN8A 2VJNA 3VM6A 1MAHA 5THQA 3VC1A 3ED5A 3ZXXA 4BHTA 3GRZA 2V45A 4FR2A 5ENVA 3MMNA 3VNBA 2ZDQA 1ZA2A 5CFRA 2GF9A 1WSWA 4G1MB 2Q4EA 1X9HA 2I29A 1J2RA 5A9SB 1SZPA 5JZMA 2D1SA 2ZUCA 1U7XA 2AJCA 3QKRA 4LDZA 3NUZA 1YA4A 3DR3A 3HWSA 3UFBA 1C8KA 1G8YA 1J8QA 2B1JA 2Z1NA 1X8XA 3P0IA 3FF1A 2XUDA 4F1JA 1KFEB 1DO8A 3EAGA 4HUQA 3X1KA 4B3IA 4RK6A 3D8UA 3G5TA 5DM0A 4C06A 1FC0A 3GQBA 3MCZA 4OQFA 3EFHA 1E4YA 2GRUA 4N49A 1OIWA 2OHXA 3C3AA 2O2XA 4AG5A 1Y34E 2VN8A 4ENPA 4CMIA 5GADl 1UR5A 3BUSA 2IYQA 3JQAB 5DLQC 3K8OE 3EXHB 3OJCA 4DKJA 3DLBA 3M5CA 5DTIA 5CA1B 4MWTA 4PLGA 4Q3NA 1AURA 1P2DA 4PS0A 3ZGOA 1XKQA 3PNKA 3DOCA 4UM9D 3T1TA 1LKZA 4KFTA 1VJ1A 1BXGA 1XQ1A 4MKFA 3VR4A 2C7PA 2FOLA 4ATNA 4UE6A 5K6AA 3IAHA 1XGKA 3SLKA 3CNHA 2YNMD 3N76A 4ZO4A 4Y3UA 1QGAA 3HRKA 1J25A 3MINB 3DPUA 3HDJA 3NKVA 4RKFA 1M5RA 3V4ZA 2ZWIA 2XB8A 1J56A 3DMPA 3NHZA 4MV3A 4C04A 2CHQA 5BSFA 4DV7B 1XCGB 3E1KA 4QPNA 1EQUA 1ID1A 1QQ5A 3O6VA 4FIDA 5FHRA 2P6NA 1BQEA 5IKEA 3NVKI 3DBRB 3HSSA 1MW9X 3BL8A 4Y9TA 3VYRB 3IT2A 5J40A 2ZQZA 3JCZA 4ENTA 1GTSA 5JNLA 3RE1A 2PUAA 2FH5B 4MW6A 1AKWA 1R5BA 2XGJA 2WINI 3KE9A 1QB8A 1C0LA 3DBLB 2CJXA 3QSYA 3LBHA 1M8PA 1MQ9A 1AGYA 2AI1A 4FTWA 4LN1A 4EKYA 3GLGA 4II7A 3L6CA 3OZBA 2O5RA 4WOJA 2F1RA 3FGPA 5KYNA 2C9YA 4KLCA 3SQNA 3JAWB 5J23A 2Q50A 3V33A 4TPKA 5H8WA 2REOA 1PIWA 2XECA 4XI9A 3M2TA 3WHKA 4Y9UA 1SJ9A 3GFFA 4FZ3A 1GA6A 2IE8A 3G82C 3W2EA 1O6GA 3VC2A 4LF5B 1H9CA 3Q9LA 2IWHA 3LS2A 4WXMA 2FWBA 2G4LA 2X3YA 4G8CA 5EWJA 2C2BA 2OQRA 3USZA 5GZ6A 1KJQA 2QT1A 3MK31 1P7CA 1XF9A 1ZEJA 2AZ4A 4ZAVA 3OLQA 1UMDA 4KQHA 4LCJA 1M1NB 4PXYA 2FPMA 1L5WA 2OCPA 4M89A 4NBVA 1JU9A 4BMPB 2QW0X 4B3FX 1U1FA 4W9NC 4RYDA 3ZJTA 4Q7LA 5C7IO 2C2MA 3T7DA 1QK3A 2DPLA 4OLFA 4QE3A 4UOZA 5MGNA 2ZWAA 1B0UA 1JA1A 2GXSA 3ROPA 5CT4A 2ZB2A 4UBJA 3GUZA 3ZI0A 4KPYA 4XDYA 2VQEB 3FNRA 3G89A 4C2BA 4KQIA 4P7BA 4EHHA 1R8YA 2QMZA 1H2XA 4IF4A 4H9GA 1EUDB 3RV3A 3TIFA 2JASA 5EIFA 2X8JB 3N7TA 3BHJA 2BFCA 1I2DA 2FG7C 5BNFA 4HDMA 2KHZA 3PLRA 5G02A 4CKEA 2ZBUA 3FOAA 3O8QA 1NOJA 2CK3D 4G0ZA 3TNLA 5D86A 3D7KA 3ICOA 1E3WB 1ZM7A 1U5BA 2UYYA 4IWXA 3ZY4A 1A4RA 4ROTA 5EC8A 1JQAA 1QH1B 3FGZA 2IPNA 2O2EA 4KQMA 4KUEA 4MVCA 2W6ID 1DARA 4D9IA 2HHCA 3MPUA 2PUVA 2W5UA 3BX1A 1FY2A 1KQGA 1IONA 3HR4A 1YS6A 4OKIA 3IURA 3BFVA 3PTZA 4MO9A 3RT9A 2ZJBA 3JZAA 3EXEB 3PTLA 3AWIA 3GB9A 3DZCA 1UDXA 4IUBS 2Z57A 3KEGA 4PC7A 4H08A 1K5GA 4KR9A 2VP2A 4IJ6A 4NZOA 1NVKA 1O7JA 2QU8A 4MQ6A 1KKMA 1N0IA 2CLSA 4C7OA 3E7XA 4BB0A 2OAEA 3JQBA 4FLMA 1P1CA 3BQ9A 3DONA 1P2TA 2AMFA 5DNYB 2PZ8A 3UPUA 1ZD4A 3DGEC 1WCXA 1F20A 2FLWA 4L2IA 4UPDA 3BTVA 3M4XA 3EGIA 4BMVA 5AMXA 3AFIA 3MIIA 3R3XA 1I32A 1AUXA 4YCDA 1EJ0A 2GFQA 4JI5B 3T3PB 4ZQBA 3F8WA 1FUUA 2OO5C 3WK6A 4CM3A 2C4NA 3E35A 4MS1A 3B6MA 1ONBA 3C0KA 3O5AA 5C4GB 1YJ8A 1PZXA 2WTUA 4AY3A 3NFYA 1A1VA 5I9TA 4JLOA 4DCPA 4M9SA 3TSOA 4R7ZA 1RQNA 1UFQA 2D1TA 1A0OA 2LKDA 3DOJA 4HFMA 1YRAA 5HF6A 3TZKA 5B58C 1LX6A 1UBCA 3QYFA 1LRJA 1EFTA 3EC2A 3W5AA 4WXYB 1PZMA 2Y68A 4CNBA 1FOEB 2XXAB 5I4IA 1Q1GA 3U7QB 2CFRA 1GV0A 1PD1A 1G2IA 3D8SA 4PNHA 4JKOA 4ZCSA 5KHLB 2FP3A 3UJ3X 2QXTA 4L5AA 4QBTA 2YHUA 2R1VA 3EVDA 5FR2A 1F8YA 2GM5A 5EINA 2RGNC 1OAKA 3ETGA 4EZBA 3AJEA 5GZ1A 4ID9A 1OLXA 1KH2A 1R10A 5J3JA 1CK4A 4QU9A 2Q8PA 1VL5A 2OB1A 2O7VA 4ER0A 1YD7A 2FB9A 2WIDA 3HL4A 5C8YA 1S8OA 2MCFA 2BF4A 4KC0A 4YT5A 5LVAA 2PH7A 4OH1A 3V34A 3PC7A 4NP6A 2P9CA 4Q6WA 4OY3A 4AFNA 1JFLA 1G7TA 1X7HA 5AICA 5EGSA 2XDQA 3ZHCA 3AYZB 3KQQA 1B16A 4R1LA 3Q3VA 1YU9A 4QSMA 4XOIA 2B2XA 1L6RA 4HX5A 1JEYA 2JIMA 4ZJZA 2IX9A 2JANA 4W99A 2RHRA 5KEIA 2JC3A 1RRGA 2XCTB 1X39A 3OHMA 2NSHA 2XWQA 3ON5A 3T4PA 2WDPA 3QBDA 4IFIA 5B1HA 4D6PA 5B3LA 1QYDA 2GBFA 2I2DA 3GCGA 3FNFA 1A72A 3C1UA 2M9MA 3O8OB 4Q4DA 3FAKA 3O1HB 1HTTA 2BONA 2AX3A 2C78A 2QOEA 1BWQA 2J31A 3ANMA 4S2EA 3T06B 3TQOA 4CLDA 9LDTA 1Q21A 5JD5A 4C6TB 1KEPA 1OBCA 3BF8A 2RHWA 3T9EA 2GPJA 3F90A 3EH2A 1T9BA 2IY8A 3L8ZA 5D84A 1IN4A 2R68A 1P9OA 4DDVA 2H59A 1ZZGA 1X1AA 1RHKA 5F1YA 4DQVA 3AHEA 3T7RA 2DR0A 1NMZA 1MX1A 2OCYC 2Q27A 2V7VA 4TZ0A 1FPMA 1ZVJA 3I8XA 3OIFA 4Z49A 3KYIB 1BX3A 2ZI5A 3LF1A 1N6LA 4KE8A 1NUPA 3RTDA 3T3DA 4B44A 4EYEA 5CFMA 1XKTA 3BXHA 3NU1A 2KPOA 2WHPB 1BH6A 4BBJA 1EK6A 2CEKA 3VYTB 5KOIA 4MPJA 2I9KA 1E2LA 2C59A 1IUNA 2JEOA 3B7WA 1QH8A 3BICA 4JHLA 4G4IA 3FCYA 3QPWA 4YR7A 4GG1A 4WN3A 1VXOA 2C8LA 4G26A 4P4SA 1PO7A 1YFLA 1EINA 4P5EA 4QELA 3GHHA 3WJ7A 2PL5A 1BD4A 5DHRA 2RGAA 4QBGB 1O9GA 1Q0TA 1YZHA 1DADA 2HHLA 4ZO7A 1MW8X 3FSJX 3PSAA 4XD2A 5BN5B 1JBQA 4ZAWA 1IJFA 4BAUA 1TL7C 3GLRA 3RTEA 3UG6A 2HNKA 2NT3A 5K45A 4DLYA 4O2AF 3ZU4A 1E6MA 5A5VA 2R8ZA 1N7GA 1ZVMA 2X6QA 1O03A 1KFCB 2R8YA 3EXIA 3IUNA 2HA5A 2QI9C 1IAVA 1MX5A 2ZU0C 1P4SA 4GBMA 4YQFA 3BK1A 2FVXA 3B20A 3LSTA 3WIEA 3DCIA 4X90A 4MI9A 1GFSA 2F2TA 1Q0SA 3N6RA 5DHPA 4NCBA 3VKHA 1ZGJA 5I4KA 1RRCA 5K6RA 1WCYA 1G2PA 3JAKB 4W1PA 4IX9A 2DQKA 3FBWA 4WDQA 3H1PA 3F5SA 2DPYA 2V9CA 2VHCA 5AW6A 4C7JA 2ATXA 4KUHA 4L8FA 1JIXA 1SHLA 4NE2A 4M1MA 1EZ4A 2Q5HA 3FPGA 3RAJA 4BJ1A 4DPKA 4R6WA 4TTAA 4C89A 3DBIA 3QMVA 5AHKA 5I9BA 1M74A 3ANLA 3LG2A 1NHWA 1RE0A 3OOEA 1W49A 2JGRA 1IY9A 3A4NA 2HEGA 5LXTF 2BFEA 3D1JA 4J1NA 4Q3CA 5FI1B 4KH0A 5FTMA 4C3OB 2GVDC 4AO6A 1U63A 2DVMA 3WGMA 2Q7OE 2W42A 3M1AA 2G6TA 3BL5A 2E37A 2P1ZA 3JWJA 4XB1A 2N0SA 3AFMA 3I64A 5JMOA 4NEGA 3OLCX 1CETA 2I6QA 2FHPA 2F48A 4F3TA 4JXKA 3L8MA 4I4TF 4ALMA 2CDRA 3DA8A 3TR5A 1Q0UA 1L7QA 3BDVA 5CDUA 5EHNA 1XSEA 3ZLVA 5AM4A 2EKPA 2BWJA 2FQ1A 3KO8A 1QYCA 1XU9A 1AV7A 2GZRA 2NTJA 3AV0B 3LCCA 3BMXA 2H7CA 1KEZA 1PZNA 3C15C 2AEMA 4CEIB 3H3XA 1U5CA 1NAHA 1ZM4A 5CX1B 5B6JA 3A6JA 1ZW1A 2FUKA 4MW0A 3W6OA 5KU1A 1C3XA 1HNXB 2NUBA 2X4LA 1YOVA 4PAQA 4A0FA 4DG5A 2YWDA 3CIOA 5JO0A 2FVYA 4B9AA 3DTNA 3LQYA 3GAZA 2TRSB 2JIDA 2ISCA 2ATIA 2KLHA 5AKIA 3ZWQA 3Q7RA 2E6UX 1CR6A 1GGVA 1CUJA 1ZU5A 3SCZA 3T7TA 2P9QA 5F98A 3MZ0A 5T5QA 3PEEA 4I50B 3C5EA 1C3JA 1Z45A 4CM4B 4IIJB 5EZSA 4DIDA 3MB8A 5TGZA 4Q4LA 4U7GA 5HYVA 2WG2A 421PA 1V11B 4DREA 5ECGC 2R8OA 3Q6MA 2H4XA 3SBDA 5FAKA 3HNOA 1W5TA 3L4BA 1GU1A 2ZRFA 4MUHA 1JIIA 4EA7A 1K97A 1WBBA 1DTWA 1OZGA 1IULA 1EI9A 1Q6YA 3KDAA 4YTEA 2GETA 3JAMA 1L4LA 1MV5A 4JZYA 1BX1A 4DC1A 5IJ9B 1ZD9A 1JXAA 1WEKA 2H4ZA 3O03A 4HXEB 3UK0A 3WWDA 1OD6A 4BUJA 1D03A 5I7SA 1JKJA 2BYTA 5IVIA 5GTDA 5JTTA 2GXQA 3C87A 1XF1A 5DBOA 1N1EA 1N9ZA 3GJ5A 3NVDA 1U0FA 3L43A 4JKYA 4X20B 2I71A 3ZHZA 4QDZA 1YASA 1EDDA 5EG5A 3I9OA 4OX9B 1XHLA 3DLCA 4TLLB 4V0SA 4IW3B 3U3RA 5GIPE 3T52A 2RDMA 4GH5A 1Z28A 2B8NA 3FW1A 1A5BB 2D0OB 4EW2A 2I3ZA 4ZDWA 2NTNA 4MWZA 4NZMA 4YCMA 4DA6A 5P21A 2CVZA 3F78A 4KMSA 1YVPA 1XRSB 3BJIC 1DHTA 4HDNA 4WACA 3RT1A 2F59A 3QWBA 3FUTA 3ZC3A 3IQXA 3QE4A 5B2ZA 2ZXFA 4JUDX 3SZMA 2HF2A 3JQRA 1FLNA 3AF2A 5JSHA 3ZVKA 1PR1A 1XJQA 2WIKA 2K7FA 2YV4A 1GXSA 1YQWA 1DWPA 1Y5RA 4GU5A 3W2HA 4XSVA 4B5KA 4C01A 1GZHB 1TEZA 1OREA 1SKUA 2AYZA 3IOMA 2X9LA 1KJWA 4M9UA 2E5WA 1N2CA 1WZNA 3ZHUA 4U7TB 5CCBA 1O94D 1MFZA 4ZI3A 1WAMA 1ECGA 5FI0B 3KEFA 3SFTA 1R8QA 2AOUB 2W71A 1YJAA 1E5XA 1N25A 1QHYA 1W9HA 2B4TO 2OV4A 1OA0A 3FYCA 4WXHA 1S96A 2W93A 3FVVA 3QQPA 4MVJM 2PRZA 4OLHA 3B53X 4RJJA 4LQLA 1H0SA 5G0SA 1ZH4A 4C4RA