4JXIA

Directed evolution and rational design of a de novo designed esterase toward improved catalysis. northeast structural genomics consortium (nesg) target or184
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
410
structure length
410
Chain Sequence
SHMEVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTAMIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLCAGQTLVLIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASIVKSSYYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFLPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHPMTTSPYFLDWQIWSLFLDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMRGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution and rational design of a de novo designed esterase toward improved catalysis. Northeast Structural Genomics Consortium (NESG) Target OR184
rcsb
molecule keywords design cystein esterase
molecule tags Structural genomics, unknown function
source organism Synthetic construct
total genus 135
structure length 410
sequence length 410
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jxiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jxiA02
2I4CA 1Y1ZA 2I0CA 1SI0A 4KQPA 4M4GA 5FHMA 3FJMA 5I59A 5L9MA 2F36A 2F7BA 1DTZA 2X7PA 5A5XA 4R9FA 5AA1A 3QUJA 4EQ7A 1FQAA 3T9UA 1JVXA 4HCYA 4QFLA 3E3KA 1T0KA 3TTRA 2YPNA 1Y4TA 5I58B 3H03A 2HAUA 4OFLA 2DXRA 3OSRA 4IO5A 3G3KA 4QSCA 5DYHA 5TP9B 1AH5A 2DVZA 1A55A 2DWAA 4F39A 4RXLA 3V89B 3H4ZA 3DELB 1MRPA 3SESA 1MXZA 3OEMA 3G3FA 3Q26A 4DE8A 2D3IA 4NF8B 5HPQA 4Q0CA 1MXWA 3VLUA 4O3CA 3VLWA 4IB2A 2RF1A 5H8SA 4RYAA 4EF2A 5H8QA 1CE2A 4KYDA 4XKRA 5ISUA 4GL8A 1B05A 1N04A 3MWBA 5JK4A 4RJZA 4QSEA 1US5A 1OLAA 3GBAA 3M3FA 1RYXA 2ONRA 4R6HA 3HO7A 2Z8FA 1J1NA 1JEVA 4POWA 1DTGA 4KFQA 3TKDA 4KCDA 4G77A 3HN0A 5CMKA 4RPOA 2O51A 4PFTA 5CC2A 3LR1A 1LLSA 3QSLA 3VV5A 3OD7A 4H0WA 2YJPA 2XXVA 2XXXA 3SDFA 3HPIA 1P99A 3CFZA 4FORA 3TMGA 2Q9TA 4R75A 1FTKA 2F78A 1LFHA 4MLQA 4F3BA 3W15C 4AQ4A 3KJ7A 1ZLQA 4F19A 1NNFA 4F3SA 4KPTA 2RINA 1Q1KA 1JETA 3K4UA 1NFTA 1SDXA 2H99A 1JNFA 3SEYA 5DEXA 3KG2A 4F2QA 1URSA 4YKPA 4GLIA 3K2DA 2DSFA 1GR2A 3IOVA 4EQ9A 4ELQA 2FA7A 2A5SA 4LZ7A 2ZXTA 2QSXA 1OMPA 4OEUA 1Z7ME 2HAVA 3LSFB 3CI8A 4Q30B 4YB6A 4PP0A 1ZJLA 5TU0A 3FUZA 4U2RA 2XX8A 5CMCA 3KOSA 5F7VA 1OLCA 2ZYNA 3Q27A 4BDLA 5AE4A 4OWDA 2QMXA 3LC8A 3WAEA 3PD8A 3CFXA 2UVIA 3TYHA 2V3TA 1B1XA 4ZS9A 4NE4A 1Z7NE 3G7WA 1MY2A 3MBPA 2GFEA 4JBZA 1BTJA 4DLDA 3FVOA 3A3CA 4ZE9A 5I58A 2Z22A 3CG3A 5KDTB 1IITA 1ZBMA 4IO7A 1B6HA 3PUZE 2PT2A 2AYSA 4FJPA 3R6UA 1M5BA 4WKMA 3ILTB 1VE4A 2QS2A 4MBPA 2D5WA 1USYE 5TP9A 4F1UA 3ZSFA 4ZEFA 5CM6A 1ELJA 1I6AA 3C33A 1PEBA 1XT8A 1YCJA 2Z8EA 3IO6A 2Z23A 3FVKA 3I5OA 1Y4CA 3BFTA 2QS4A 3OELA 3VVFA 4BDNA 2OBGA 4DZ1A 3C4MA 3KSJA 1QUKA 4NF8A 4AB6A 4ESXA 5KZTA 3OXNA 2Q88A 4KR5A 3TTKA 4I1DA 4LVQA 1XVYA 4OMBA 1O63A 1WVJA 4XKNA 2LAOA 1IXIA 1USYH 3KN7A 4NF6B 3RN8A 4IO4A 4GXSB 5AA4B 1MY4A 4NF5B 3SEWA 4PQJA 3U72A 4G8HA 4MF3A 4POXA 3O29A 2UVGA 3K6VA 3TTNA 3GXAA 4TOZA 4DXBA 1LCTA 3PUWE 2F8DA 4WEDA 3MZBA 3DP8A 3B6QA 3TELA 3OO8A 2XHDA 1DMBA 3B6TA 4C0RA 2ZYOA 3PPPA 1UIUA 3FVNA 4TLMB 4EF1A 2DWJA 1EZ9A 3QUFA 3MAMA 1P1UA 3TDJA 4EQBA 4YMBA 1L5TA 3ILUB 4QFOA 5JEIA 1PBQA 4YKKA 5I2KB 3FXRA 3PV0E 2VD2A 1M5CA 3L6HA 2OJTA 4OYVA 4Z7EA 3G3IA 2H98A 1POTA 1SVXB 4OVJA 3PMXA 4U1ZA 2DWHA 3EHSA 1XS5A 4XXUA 4ONYA 4ZZAA 1B3FA 4N13A 3G3JA 4FE8A 3CG1A 1LAHE 3KOTA 2W7YA 1B7UA 2O68A 3S9LC 3KFMA 1TT1A 3EN3A 3O97A 1VFDA 2XX7A 3LUYA 5F1QA 3S9EA 1MQDA 4K3FA 4OXVA 1ZU0A 3SKPA 1Y20A 3HSTA 1N3XA 4FEDA 2BJJX 1Q35A 4HW8A 2OWTA 3IOTA 4TLLB 2REJA 1B3EA 4LZ8A 2PT1A 4FIMA 4EXKA 1PB9A 2F7AA 1UTHB 1TFAA 1LGBC 4MH5A 3T66A 4DIGA 3RTFB 4P0IA 2HZLA 2WKYA 1OIBA 3A3UA 4PFUA 3O6HA 4LATA 1PB8A 1DPPA 4H6DA 1FQDA 2H5YA 5CMMA 5KDTA 1WODA 2HFBA 2HQ0A 3FXQA 2FNCA 2OLBA 4QFNA 4YB7A 1A8FA 3UIFA 2H9BA 2ANJA 1LCFA 4ND9A 3ZS6A 4LONB 2I0BA 1HSEA 1LBBA 1MXXA 2F7CA 2QRYA 5DTBA 4R74A 4KYSA 1OQGA 4NTLA 3DLNA 1P1NA 5H8FB 2NVUB 5H8NB 3O2AA 3MP8A 3TAJA 4DCYA 5H8HB 2UYFA 1P1WA 4IO6A 3VXCA 2RKMA 4I62A 1D9YA 4JSDA 3K1MA 2RCAA 3QIMA 4R6YA 1LAGE 2ZYKA 4GFRA 5I56B 4NF6A 4XIGQ 5AA4A 1AOVA 2XXPA 4NF5A 4ZECA 3C31A 3IAZA 4E0XA 1LB8A 1GGGA 3R26A 4YB5A 3GBBA 2O7IA 2VOZA 4RK2A 3EF7A 5AA2D 1QKBA 1HSJA 4GOTA 3PMVA 3HHFA 4M1VA 1KWHA 2REGA 5TPAB 2HZKA 1EZPA 4YKIA 3D4CA 1XVXA 1R6ZA 4EUOA 5EHMA 2O69A 3CFLA 3KJTA 2HXWA 2IEEA 3PPNA 5I2KA 3LBSA 2UXAA 3MP6A 3KGCA 4Z0IA 3MUQA 5ICTA 2CZLA 1NNPA 1ZTYA 1FTMA 1PDAA 3H6TA 1I69A 4ELPA 2XXQA 4U22A 3UK4A 3UGWA 1M5EA 3KSXA 5L8DA 1FCKA 4OQOA 2O6AA 3TQWA 2UVJA 3B6WA 1MXUA 3VFJA 1BIYA 3CR9A 4G68B 4H5FA 1H3DA 2I3VA 3IR1A 1GVCA 3RPWA 3S9MC 4F29A 1A40A 1A54A 1MM7A 3MC2A 1B1HA 3SERA 1VR5A 2AIXA 2DS9A 2Y84A 1LFGA 3MVXA 2V25A 3Q25A 4DDDA 3TUSA 4G8NA 1UTHA 4MFIA 3O28A 1GV8A 3MQ9A 1I6QA 4JSOA 3ONMA 2F35A 4R72A 4IO2A 3F11A 3K6XA 1BKAA 2R9JA 4U1OA 3IX1A 4H8JA 1JW1A 1SYHA 4Q5TA 3O66A 4RPNA 1FQEA 4ZEIA 3MW0A 3FJ7A 2ZNUA 3FXUA 3CVGA 4LUBA 5H8FA 1B9JA 3OENA 5H8NA 4H8IA 3RUMA 2O84X 4GRKA 5H8HA 3TODA 1HSLA 3CRBA 4X48A 4DXUA 2OK2A 3RY3A 4DXCA 5B7DA 2B3BA 2ZNTA 3U1OA 1MY3A 1R1NA 1UQWA 1Y3QA 5I56A 2ABHA 4OENA 3TZAA 4GWOA 3USDA 4EDPA 1B0HA 2XD3A 4XKPA 4GD5A 2I3WA 4OERA 4X9TA 4PETA 3C32A 1QW0A 4OESA 2M8CA 3UORA 3BFUA 2Q2CA 2DWIA 1IXHA 4JXIA 3QYTA 4IY6A 3IJXB 1NH7A 1OVTA 4F22A 3H3GA 1IXGA 3PPOA 3N6UA 2XXIA 1B0LA 1SW2A 4KYEA 4OZ9A 5TPAA 4KCCA 1GTKA 2ZMBA 1B32A 2ONSA 1SW4A 3IK6B 4IGTA 4C1UA 4G8MA 1NH8A 1URGA 2DE3A 3U93A 2O7UA 1FW0A 3N94A 1RKMA 1SBPA 1B52A 3VXBA 3MVYA 2PVUA 1MPBA 4U23A 2ZYMA 2PBWA 5IAIA 3KEIA 2X7QA 4JWYA 3V83A 1N7XA 4F31B 4BDRA 1MQGA 1CB6A 2IA4A 3M3KA 4BLAA 2XXTA 3U94A 1NKXA 3MJNA 2GHAA 2O1LA 2I58A 3H6VA 4O3AA 2Y7KA 3SEXA 1NL5A 1O64A 4JWXA 4G68A 1TXFA 2DOJA 4AB5A 1YTVA 1B51A 2VGQA 2KLFA 3PUYE 1YPNA 4GVOA 4R6KA 3HV1A 4DCXA 3EPEA 4TQUQ 1SI1A 3IL1B 2I6EA 4R9GA 4G68C 1P1QA 1FQFA 2E0SA 3IOWA 4NWCA 1R9QA 5FHOA 3T9XB 3CSGA 3LSLA 3TTLA 1SQYA 3UP9A 3MPKA 4RA1A 1ZMGA 3DP4A 2RC9A 3SETA 4PE5B 1NNKA 1XOCA 5FTIA 1EZOA 4BDQA 1A99A 1NNTA 1M5DA 1DOTA 2QL3A 4QFPA 4F1YA 2NOOA 5J1DA 1AMFA 4I9DA 2AL5A 3EHTA 5IKBA 4LZ5A 1SYIA 3BKIB 3VE1B 3TQLA 2DE2A 3K0VA 3FJGA 1WDNA 5EYFA 1IUDA 1VFEA 1R9LA 1O7TA 3ECRA 3EQ1A 2RCBA 1N76A 5JTYB 4NF4B 3OMBA 1N0TA 1EU8A 4O3BA 2V84A 5ITPA 1LFIA 3OO6A 1H45A 1EH3A 4WXJA 1FTLA 1N7WA 2DQVA 1QJMA 4XTCQ 5HM4B 1VSOA 2R6GE 4BDOA 3OSQA 2P2AA 1SW1A 2V3QA 2ESNA 2ZNSA 3MVWA 1DSNA 3T9VA 4F2OA 5M2VA 1MG1A 3RT8A 4JWOA 4MLVA 3PUXE 1NMUA 3MZ9A 2P1SA 1JVYA 3K1NA 4HTGA 1POY1 3PU5A 1IIWA 2O1MA 3IOUA 4LA9A 1B3GA 4LQ5A 3T9HB 4G4PA 5L9OA 2QS1A 4N6PA 4PFYA 1RYOA 1OVBA 2B3FA 2YLNA 1IZ1A 1LAFE 1OQHA 3QAXA 3RNNA 3PD9A 1Y3PA 3QK6A 3PPRA 4N07A 1UTBB 3H6UA 1A8EA 3IB2A 1LBCA 5ICQA 3Q28A 2B65A 1JQFA 3JZJA 4GXAA 4HCWA 1MDP1 5CMBA 3TCGA 5I2NB 1LB9A 1B46A 4HS7A 5CI5A 1MY1A 1MPCA 4RK9A 3LSXA 3S9NC 1B58A 5DT6A 2GHBA 2G93A 1QULA 4RNSA 3V8XB 3H06B 2Q89A 3EHUA 3K01A 3E13X 3SEVA 3RT6B 4GQOA 3TPAA 4NWDA 2PMSA 3FV1A 5DVJA 4IGRA 3TCHA 1SD3A 2V93A 1MQIA 3I3VA 5AA2B 1M5FA 4WEPA 4KI0E 4LP2B 2I48A 3PPQA 4QRZA 4EXLA 5ITOA 2VD3A 1B2HA 4JB7A 4OFOA 3IORA 2H25A 2F6GA 2P0SA 1MS7A 2XXUA 4KHZE 3C34A 1B3LA 3FATA 2OCUA 4R2FA 1MH3A 1DPEA 1N3WA 1ZIUA 4ZDMA 3HHGA 2XD2A 4U4XA 2E1SA 4Q8RA 3A09A 4LQ2A 4ELOA 5JTYA 1US4A 4NF4A 3VDFA 5KCJB 3O6IA 3O6GA 3ZKLA 3SEUA 4FAJA 1SW5A 4IO3A 2QMWA 3IJOB 2FYIA 2QPQA 5I84A 2XX9A 3U8QA 4QHQA 1QUJA 4IY5A 4H5GA 1PBPA 2R71A 1QUIA 2CMOA 2PYYA 1IEJA 3E4RA 5CBSA 2V3UA 3MPLA 3BBRA 2NWJA 2UVHA 4YZZA 1B5JA 3JYRA 2XXHA 3GLBA 1MPDA 3GZGA 1JW5A 3FGSA 3V5AA 3HCQA 2RC7A 3RGYA 4U4SA 3ZKKA 5FTHA 4OHNA 2NUVA 1AIVA 3FD3A 2Z8DA 4R73A 1TFDA 3RLFE 4ECFA 3N26A 1LSTA 2A5TB 2PX1A 3TFLA 3K6UA 4JDFA 2DP8A 4U21A 2X26A 4ZE8A 3L6GA 3I6VA 3FASA 4QF9A 1QVSA 1B40A 3M8UA 5BWJA 3KZGA 4GF8A 4NMYA 2I49A 1UTBA 3D4GA 1F9BA 4FECA 3AXFA 1I6BA 4PFWA 2QJEA 1S9TA 2GH9A 2F6PA 2THIA 1II5A 3MVZA 5I2NA 1UIVA 4OFJA 2Y7WA 1D9VA 2Y7IA 4E0WA 1FTJA 3E9XA 2I4BA 5AA3A 1BP5A 5L9SA 3KN3A 1D4NA 3CIJA 3C36A 5DVFA 5K2XA 2OWSA 5HBCA 1MQHA 4OTEA 1P1OA 3Q29A 4F3PA 5I57B 4OEVA 4THIA 4GL0A 1PB7A 3S2VA 2Q8JA 1MH4A 1Y9UA 3N5LA 3ODBA 2VHAA 1ATGA 2XXRA 4ZEBA 1FQBA 4YU0A 3W9VA 5AA2A 4GIZA 4YKJA 3K02A 1B5IA 2DXYA 1YAEA 4FEBA 1MDQA 1MQJA 3MZ1A 4FATA 1IQ7A 1TWYA 1MY0A 5B70A 3T93B 3MP1A 3K6WA 5DVIA 1H43A 4C1TA 3THIA 1AL3A 3WAFA 1B7ZA 4BDMA 4KD5A 5I59B 2UYEA 4X1BA 4YMAA 1FQCA 4H1XA 4YICA 1B4ZA 4UACA 5KCJA 1A7LA 3OEKA 4ESWA 4ZEDA 5A5XB 2QS3A 1N84A 5BUUA 4P11A 4OETA 3OOAA 1FTOA 1Y1MA 4QSDA 4X1DA 3LSWA 3G3GA 1S50A 3FIRA 3RTWB 1B7HA 1PC3A 1B5HA 3OO9A 2VP1A 4H65A 5CRYA 1B4HA 3FV2A 3PUVE 3VVEA 3DM0A 3P7IA 3UA8A 3T96B 3R7XA 3TCFA 3S4UA 1S7YA 3B7DA 1MXVA 5ELVA 4RY1A 3KBRA 4NEDA 2DYXA 2G29A 1QKAA 1URDA 2F5XA 2A5TA 3PGFA 3O9PA 4QFKA 4P0GA 3H7MA 2AL4A 3K1PA 1XC1A 4L17A 3OO7A 5FHNA 1BLFA 2DE4A 1JW4A 4G2ZA 3C35A 3QXMA 3PMWA 2DVCA 2HEUA 1H76A 5H8QB 3N6TA 3K00A 3UN6A 3JV9A 2NXOA 5LOMA 3FVGA 3G3HA 4I8CA 3KN8A 3TEPA 3T22A 2F34A 2RC8A 3M3LA 4H67A 1Y3NA 3U92A 1D3KA 1LAXA 3FZVA 2ONKE 5CBRA 1MM6A 4ELRA 4YAHX 1JEUA 2XXYA 4ZEKA 3IB1A 4R2BA 4F3GA 2H4IA 3W9WA 3VLVA 5I57A 2HCAA 3IB0A 2Y7RA 1ANFA 2D21A 3H6WA 2Y7PA 2XXWA 5K2YA 3DP6A 1MXYA 3C9HA 1IXCA 4UA8A 4XKQA 1B3HA 2ALUA 1ZKBA 2GRVA 4ISUA 4F1VA 3TTMA 2OZZA 1XHYA 2Q2AA 5EHSA 3IO4A 5DEXB 3VVDA 2F97A 4F18A 3CSBA 3RQTA 4ZZEA 1H44A
chains in the Genus database with same CATH superfamily
2I4CA 1Y1ZA 2I0CA 1SI0A 4KQPA 2F3BA 4M4GA 5FHMA 3FJMA 3NOHA 5I59A 5L9MA 2WYPA 2F36A 2F7BA 1NI9A 1DTZA 2X7PA 5A5XA 4R9FA 1QGXA 5AA1A 3QUJA 4PDHA 4EQ7A 1FQAA 3T9UA 1JVXA 3ROJA 4HCYA 4QFLA 1NV7A 1EYIA 4MJOA 3E3KA 3GYYA 4HE1A 1T0KA 3TTRA 2YPNA 1Y4TA 5I58B 3H03A 2HAUA 4QBAA 4OFLA 2XWVA 2FVZA 2DXRA 3OSRA 4IO5A 3G3KA 4QSCA 2CZHA 4PAKA 1LBXA 5DYHA 5TP9B 4DI4B 1AH5A 2DVZA 1G0HA 5ET8A 1A55A 2DWAA 4F39A 4RXLA 3V89B 3H4ZA 4PF6A 3DELB 1MRPA 3SESA 1MXZA 3OEMA 3G3FA 3Q26A 4DE8A 2D3IA 3LV0A 4NF8B 4AS4A 5HPQA 4Q0CA 1MXWA 3VLUA 4O3CA 1FBGA 3VLWA 4IB2A 3CHGA 2RF1A 5H8SA 4RYAA 4EF2A 5H8QA 1NUYA 1CE2A 2VPNA 4KYDA 4XKRA 5ISUA 2OX3A 4GL8A 1B05A 2PFYA 1N04A 4PBQA 3MWBA 5JK4A 4RJZA 4QSEA 1US5A 1OLAA 3GBAA 3M3FA 1RYXA 5ET7A 2ONRA 4PTKA 1FPBA 4R6HA 3HO7A 2Z8FA 1J1NA 1JEVA 4POWA 1DTGA 4KFQA 3TKDA 4KCDA 4G77A 3HN0A 5EQ9A 5CMKA 4RPOA 2O51A 4PFTA 5CC2A 2XA5A 3LR1A 1LLSA 3QSLA 3VV5A 3OD7A 4H0WA 2YJPA 2XXVA 2XXXA 3SDFA 3HPIA 1P99A 3CFZA 4FORA 3TMGA 2Q9TA 4R75A 1FTKA 2CZKA 2F78A 1LFHA 4MLQA 4F3BA 3W15C 4AQ4A 3KJ7A 1ZLQA 3ISPA 4F19A 5ET6A 1NNFA 4F3SA 4KPTA 2RINA 1Q1KA 1JETA 5IZ3B 3K4UA 1NFTA 1SDXA 2H99A 1JNFA 2PFZA 3SEYA 1EYKA 5DEXA 3KG2A 4F2QA 1URSA 4YKPA 4GLIA 3K2DA 2DSFA 5FBPA 1GR2A 3IOVA 4EQ9A 4ELQA 2FA7A 2A5SA 4LZ7A 4PFIA 2ZXTA 2QSXA 1OMPA 4OEUA 1FBPA 1Z7ME 2HAVA 3CI8A 3LSFB 4Q30B 4YB6A 4PP0A 1ZJLA 4N8YA 5TU0A 3FUZA 2BJIA 4U2RA 2XX8A 5CMCA 1FSAA 3KOSA 5F7VA 1OLCA 2ZYNA 3Q27A 4BDLA 5AE4A 4OWDA 2QMXA 3LC8A 3WAEA 3PD8A 3CFXA 4N91A 2UVIA 3TYHA 2V3TA 1B1XA 4ZS9A 4NE4A 1Z7NE 2Y5KA 1MY2A 3G7WA 3MBPA 2GFEA 4JBZA 1BTJA 4DLDA 3FVOA 1IMDA 3A3CA 4ZE9A 5I58A 2Z22A 3CG3A 2CZIA 4MCOA 5KDTB 1IITA 1FBDA 1ZBMA 4IO7A 1B6HA 1BK4A 3PUZE 2PT2A 2ZZVA 2AYSA 4FJPA 3R6UA 1M5BA 4WKMA 3ILTB 1VE4A 2QS2A 4MBPA 5EQ7A 2D5WA 1USYE 4PAFA 5TP9A 4F1UA 5J16A 3ZSFA 3KBZA 2QVUA 4ZEFA 5CM6A 1ELJA 1I6AA 3C33A 1PEBA 1XT8A 1YCJA 4NHBA 2Z8EA 3IO6A 1FBHA 2Z23A 3FVKA 3I5OA 4N8GA 1Y4CA 3BFTA 2QS4A 3OELA 3VVFA 4BDNA 2OBGA 4DZ1A 3BIGA 2FHYA 3C4MA 3KSJA 1QUKA 4NF8A 4AB6A 4ESXA 5KZTA 2R8TA 3OXNA 2Q88A 4KR5A 3TTKA 4I1DA 4LVQA 1XVYA 4OMBA 1O63A 1WVJA 4XKNA 2QVRA 5EQAA 2LAOA 1IXIA 1USYH 3KN7A 4NF6B 3RN8A 4IO4A 4GXSB 5AA4B 1MY4A 4NF5B 3SEWA 4PQJA 1CNQA 3U72A 2WYKA 4G8HA 4MF3A 4POXA 2KR0A 3O29A 2UVGA 3K6VA 4I3EA 3TTNA 3GXAA 4PGNA 4TOZA 1LCTA 3PUWE 4DXBA 2F8DA 4WEDA 3MZBA 3DP8A 1RDXA 3B6QA 3TELA 3OO8A 2XHDA 1DMBA 3B6TA 4C0RA 2ZYOA 3PPPA 1UIUA 3FVNA 4TLMB 2Q8MA 4EF1A 2DWJA 1EZ9A 3QUFA 3MAMA 1P1UA 3TDJA 4EQBA 4YMBA 1L5TA 3ILUB 4QFOA 5JEIA 1PBQA 4YKKA 5I2KB 3FXRA 3PV0E 2VD2A 5I3SA 1M5CA 3L6HA 2OJTA 4OYVA 4Z7EA 3G3IA 2H98A 1POTA 1SVXB 4OVRA 4OVJA 3PMXA 4U1ZA 2DWHA 3EHSA 1XS5A 1NV4A 4XXUA 4ONYA 1KA1A 4ZZAA 1B3FA 2WX9A 4N13A 3T1BA 3G3JA 5IZ3A 4FE8A 3CG1A 1LAHE 3KOTA 4JVDA 2W7YA 1B7UA 2O68A 3S9LC 3KFMA 1TT1A 3EN3A 3KC1A 3O97A 4IR8A 1VFDA 2XX7A 3LUYA 5F1QA 3S9EA 1MQDA 4K3FA 4OXVA 1ZU0A 3SKPA 1Y20A 3HSTA 1N3XA 4FEDA 2BJJX 1Q35A 5EYGA 4HW8A 2OWTA 3IOTA 2ZZXA 1FRPA 5EQ8A 4OVSA 4TLLB 2REJA 1B3EA 4LZ8A 4PDDA 2PT1A 1FPKA 4FIMA 4EXKA 1PB9A 2F7AA 3FXBA 1UTHB 1TFAA 1LGBC 4MH5A 3T66A 4DIGA 3RTFB 4P0IA 1LBVA 2HZLA 2WKYA 1OIBA 3A3UA 4PFUA 1IMEA 3O6HA 4LATA 4X8RA 1PB8A 1DPPA 4H6DA 1FQDA 2H5YA 5CMMA 5KDTA 1WODA 2HFBA 3E79A 2HQ0A 3FXQA 2FNCA 1INPA 2OLBA 4QFNA 4YB7A 1A8FA 3UIFA 2H9BA 2ANJA 1LCFA 4ND9A 3ZS6A 4LONB 2WBBA 2I0BA 1HSEA 1LBBA 4HXVA 1MXXA 2F7CA 2QRYA 5DTBA 1FJ9A 4R74A 4KYSA 1OQGA 4NTLA 3DLNA 3SZPA 1P1NA 5H8FB 2NVUB 4N6KA 1DBZA 5H8NB 3O2AA 3MP8A 3TAJA 4DCYA 5H8HB 2UYFA 4MHFA 1P1WA 4IO6A 3VXCA 2RKMA 4I62A 1D9YA 4JSDA 3K1MA 2RCAA 4G61A 3QIMA 4R6YA 1LAGE 2ZYKA 4GFRA 2FIEA 5I56B 4NF6A 4XIGQ 4N4UA 5AA4A 1AOVA 2XXPA 4NF5A 4ZECA 3C31A 3IAZA 4E0XA 1LB8A 4NX1A 1GGGA 3R26A 4YB5A 3GBBA 2O7IA 2VOZA 2XWKA 4RK2A 3EF7A 5AA2D 1QKBA 2HXRA 1IMAA 1HSJA 4GOTA 3PMVA 2DDKA 3HHFA 1YYZA 4M1VA 2XXKA 1KWHA 2REGA 4GWYA 5TPAB 2HZKA 1EZPA 4YKIA 3D4CA 1XVXA 1R6ZA 4EUOA 3B50A 5EHMA 2O69A 3CFLA 3KJTA 2HXWA 2IEEA 3PPNA 5I2KA 2QVVA 3LBSA 2UXAA 3MP6A 3KGCA 4Z0IA 1AWBA 3MUQA 5ICTA 2CZLA 1NNPA 1ZTYA 4HE2A 1FTMA 1PDAA 3H6TA 1I69A 4ELPA 2XXQA 4U22A 3UK4A 3UGWA 1M5EA 3KSXA 5L8DA 1FCKA 4I40A 4OQOA 2O6AA 4MNCA 2OWZA 3TQWA 2UVJA 3B6WA 1MXUA 3VFJA 1NV3A 1BIYA 1DCUA 3CR9A 4G68B 4H5FA 1H3DA 4OVPA 2I3VA 3IR1A 1GVCA 3RPWA 3S9MC 4F29A 1A40A 1A54A 1NV6A 1MM7A 3MC2A 1B1HA 3SERA 1VR5A 2AIXA 2DS9A 2Y84A 1LFGA 4P9KA 1DK4A 3MVXA 2V25A 3Q25A 2FBPA 2F3DA 5IZ1A 4DDDA 3TUSA 4LN5A 4G8NA 1UTHA 4MFIA 4GX6A 3O28A 1GV8A 4NN3A 3MQ9A 2B4MA 1I6QA 4JSOA 3ONMA 2F35A 4R72A 2VT5A 3RPLB 4IO2A 1LEVA 3F11A 3K6XA 1BKAA 2R9JA 4U1OA 1LBYA 2Y5LA 3IX1A 4H8JA 1JW1A 1SYHA 4Q5TA 4RPNA 3O66A 4PFRA 1FQEA 4ZEIA 3MW0A 3FJ7A 2ZNUA 3FXUA 3CVGA 2L5VA 4LUBA 5H8FA 4XEQA 1B9JA 3OENA 5H8NA 4H8IA 3RUMA 2O84X 4GRKA 5H8HA 3TODA 1HSLA 3CRBA 3D1RA 4X48A 2JJKA 4GBVA 4DXUA 2OK2A 3RY3A 4DXCA 1YZ0A 5B7DA 2B3BA 2ZNTA 3U1OA 1MY3A 1R1NA 1UQWA 3EKIA 1Y3QA 5I56A 2ABHA 4OENA 3TZAA 4GWOA 3USDA 4EDPA 1B0HA 4N81A 2XD3A 4XKPA 4GD5A 2I3WA 4OERA 4X9TA 4FBPA 4PETA 3C32A 1QW0A 4OESA 2M8CA 3UORA 3BFUA 2Q2CA 2DWIA 1IXHA 4JXIA 3QYTA 4IY6A 3IJXB 5IM2A 1NH7A 1OVTA 4F22A 3H3GA 1IXGA 3PPOA 3N6UA 2XXIA 1B0LA 1SW2A 4KYEA 4OZ9A 5F24A 5TPAA 4KCCA 1GTKA 2ZMBA 3RYDA 1B32A 2ONSA 1SW4A 3IK6B 4IGTA 4C1UA 4G8MA 4P1LA 1NH8A 1URGA 2DE3A 4GBWA 3U93A 2O7UA 4PAIA 1FW0A 3N94A 1RKMA 1SBPA 1B52A 3VXBA 3MVYA 2PVUA 1MPBA 4U23A 2ZYMA 1NUWA 2PBWA 5IAIA 3KEIA 2X7QA 4JWYA 3V83A 1N7XA 4F31B 4BDRA 4O94A 1MQGA 4XFEA 1CB6A 1K9ZA 2IA4A 3M3KA 4BLAA 2XXTA 4PBHA 3U94A 4P3LA 1NKXA 3MJNA 2GHAA 2O1LA 2I58A 3FBPA 3H6VA 4O3AA 2Y7KA 3SEXA 1NL5A 1O64A 4JWXA 4G68A 4UABA 1TXFA 2DOJA 4GX3A 4AB5A 1YTVA 1B51A 2VGQA 2KLFA 3PUYE 1YPNA 5A5LA 1FJ6A 4GVOA 4R6KA 3HV1A 4DCXA 3EPEA 4TQUQ 1SI1A 3IL1B 2I6EA 4R9GA 4P47A 4G68C 1P1QA 1FQFA 2E0SA 3IOWA 4NWCA 1R9QA 5FHOA 3T9XB 3CSGA 3LSLA 3TTLA 1SQYA 3UP9A 3MPKA 4DI3D 1NV5A 4RA1A 1ZMGA 1EYJA 3DP4A 2RC9A 4MX6A 3SETA 4PE5B 1NNKA 1XOCA 5FTIA 4O7IA 1EZOA 4BDQA 1A99A 2HHMA 1NNTA 1M5DA 1DOTA 3RPLA 2QL3A 4QFPA 4F1YA 2NOOA 3U65A 5J1DA 1AMFA 4I9DA 2AL5A 3EHTA 5IKBA 4LZ5A 1SYIA 3BKIB 4N6DA 3VE1B 3TQLA 2DE2A 3K0VA 3FJGA 1WDNA 5EYFA 1IUDA 1VFEA 1R9LA 1O7TA 4JVIA 3ECRA 3EQ1A 2RCBA 2XWOA 1N76A 5JTYB 4NGUA 4NF4B 3OMBA 1N0TA 1EU8A 1KZ8A 4O3BA 2V84A 2PCRA 5ITPA 1LFIA 3OO6A 5I5PA 1H45A 1EH3A 4QXDA 4MMPA 4WXJA 1FTLA 1N7WA 2DQVA 1QJMA 1FPDA 4XTCQ 4P1EA 5HM4B 1VSOA 2R6GE 4BDOA 3OSQA 2P2AA 1SW1A 2V3QA 2ESNA 2ZNSA 3MVWA 1DSNA 3T9VA 4F2OA 5M2VA 1MG1A 5ESYA 3RT8A 4JWOA 4MLVA 3PUXE 1NMUA 3MZ9A 4GWUA 2P1SA 4MEVA 1JVYA 4X04A 3K1NA 4HTGA 1POY1 3PU5A 1IIWA 2O1MA 3KC0A 4HE0A 3IOUA 4LA9A 1B3GA 1JP4A 4LQ5A 3T9HB 4G4PA 5L9OA 2WEFA 5IZZA 2QS1A 5LDZA 4N6PA 4PFYA 1RYOA 1OVBA 2B3FA 2MKZA 2YLNA 1FPJA 1IZ1A 1LAFE 1OQHA 3BIHA 3QAXA 3RNNA 3PD9A 1Y3PA 2ZZWA 3QK6A 3PPRA 4N07A 3E78A 1UTBB 3H6UA 4KXPA 1A8EA 3IB2A 1LBCA 5ICQA 4N15A 3Q28A 2B65A 4AS5A 4GWXA 1JQFA 3JZJA 4GXAA 4HCWA 1MDP1 5CMBA 3TCGA 5I2NB 3PTYA 1LB9A 1B46A 4HS7A 2P3NA 1NUZA 5CI5A 1MY1A 1MPCA 4RK9A 3LSXA 3S9NC 1B58A 4PFBA 4O8MA 5DT6A 2GHBA 2G93A 1QULA 4RNSA 3V8XB 3H06B 2Q89A 3EHUA 3K01A 3E13X 3SEVA 4JVCA 2CEYA 3RT6B 4GQOA 3TPAA 2V4CA 4NWDA 4O7MA 2PMSA 3FV1A 5DVJA 4IGRA 5T3JA 3TCHA 1SD3A 2V93A 1MQIA 3I3VA 5AA2B 1M5FA 4WEPA 4KI0E 4LP2B 2I48A 3PPQA 4QRZA 4EXLA 4NF0A 5ITOA 2VD3A 1B2HA 4JB7A 1K9YA 4OFOA 3IORA 2H25A 2F6GA 2P0SA 1MS7A 2XXUA 4KHZE 3C34A 1B3LA 3IFAA 1NV1A 5LTCA 3FATA 2OCUA 4R2FA 1MH3A 1DPEA 4MIJA 1N3WA 1ZIUA 4ZDMA 3HHGA 1FTAA 2VPOA 2XD2A 4U4XA 2E1SA 4Q8RA 1IMBA 3A09A 4LQ2A 4ELOA 1IMFA 5JTYA 1US4A 4NF4A 1VDWA 3VDFA 5KCJB 3O6IA 3O6GA 4OANA 3ZKLA 3SEUA 4FAJA 1SW5A 4IO3A 2QMWA 3IJOB 4P8BA 2FYIA 2QPQA 5I84A 2XX9A 4PC9A 3U8QA 4QHQA 1QUJA 4IY5A 4H5GA 1PBPA 2R71A 1QUIA 4PCDA 2CMOA 2PYYA 1IEJA 3E4RA 5CBSA 1RDYA 2V3UA 3MPLA 3BBRA 2NWJA 2UVHA 4YZZA 1B5JA 3JYRA 2XXHA 3GLBA 1MPDA 3GZGA 1JW5A 3FGSA 3V5AA 4GWSA 3HCQA 4GWWA 2RC7A 3RGYA 1G0IA 4U4SA 3ZKKA 5FTHA 4OHNA 2NUVA 1AIVA 3FD3A 2Z8DA 4R73A 1TFDA 3RLFE 4ECFA 3N26A 1LSTA 2A5TB 2PX1A 3TFLA 5DW8A 3K6UA 4JDFA 2DP8A 4MNIA 4U21A 2X26A 4OVQA 4ZE8A 3L6GA 3I6VA 3FASA 4QF9A 1QVSA 1B40A 3M8UA 5BWJA 4OVTA 3KZGA 4GF8A 1FPEA 4NMYA 2I49A 1UTBA 3D4GA 1F9BA 4FECA 3AXFA 1I6BA 4PFWA 2QJEA 1S9TA 1FPGA 2GH9A 2F6PA 2THIA 1II5A 3MVZA 4I3YA 5I2NA 1UIVA 1D9QA 4OFJA 2Y7WA 1D9VA 2Y7IA 2KQZA 4E0WA 1FTJA 3E9XA 2I4BA 5AA3A 1BP5A 5L9SA 3KN3A 1D4NA 3CIJA 5EYHA 3C36A 1RDZA 5DVFA 5K2XA 2OWSA 5HBCA 1MQHA 5I7IA 4OTEA 1P1OA 3Q29A 4F3PA 5I57B 4OEVA 4THIA 4GL0A 1PB7A 3S2VA 3A29A 2Q8JA 1MH4A 1Y9UA 3N5LA 3ODBA 2VHAA 1ATGA 2XXRA 2HPGA 2WBDA 4ZEBA 1FQBA 4YU0A 3W9VA 5AA2A 4GIZA 4YKJA 3K02A 1B5IA 2DXYA 4H46A 1YAEA 4FEBA 1MDQA 3T0JA 1MQJA 3MZ1A 4FATA 1NV2A 1IQ7A 2QFLA 1TWYA 1MY0A 5B70A 3B8BA 4NQ8A 3T93B 1LBWA 4GX4A 3MP1A 3K6WA 5DVIA 1H43A 4C1TA 3THIA 1AL3A 3WAFA 1B7ZA 4BDMA 4KD5A 4PE3A 5I59B 2UYEA 4X1BA 4YMAA 1FQCA 4H1XA 4YICA 1B4ZA 4P56A 4UACA 5KCJA 1A7LA 3OEKA 4N17A 4ESWA 4ZEDA 5A5XB 1Q9DA 2QS3A 3LUZA 1N84A 5BUUA 4P11A 4OETA 3OOAA 1FTOA 1Y1MA 4QSDA 4X1DA 3LSWA 3G3GA 1S50A 3FIRA 3RTWB 1B7HA 1PC3A 1B5HA 4MNPA 3OO9A 2VP1A 4H65A 5CRYA 4GWZA 1B4HA 3FV2A 3PUVE 1FBEA 3VVEA 3HFUA 4NAPA 3DM0A 3P7IA 1FPFA 3UA8A 3T96B 3R7XA 3TCFA 3S4UA 1S7YA 3B7DA 1MXVA 5ELVA 4RY1A 5IGAA 1SPIA 3KBRA 4NEDA 2DYXA 2G29A 1QKAA 1URDA 2F5XA 2A5TA 2XWIA 3PGFA 3O9PA 4QFKA 1KA0A 1FPLA 4P0GA 3H7MA 2AL4A 3K1PA 1XC1A 4L17A 3OO7A 5FHNA 1BLFA 2DE4A 1IMCA 1JW4A 4G2ZA 3C35A 3QXMA 3PMWA 1FBFA 1LBZA 5ET5A 2DVCA 4NG7A 2HEUA 2GQ1A 1H76A 5H8QB 1FBCA 3N6TA 3K00A 2Q74A 1YXIA 3UN6A 3JV9A 2NXOA 3MYUA 5LOMA 3FVGA 3G3HA 4I8CA 3KN8A 3TEPA 3T22A 2F34A 2RC8A 3M3LA 2B4LA 4H67A 1Y3NA 3U92A 1FPIA 1D3KA 1LAXA 3FZVA 2ONKE 5CBRA 1MM6A 4ELRA 1XI6A 1NUXA 4YAHX 4PGPA 1JEUA 2XXYA 2FIXA 2P3VA 4OA4A 4ZEKA 3IB1A 4R2BA 4F3GA 2H4IA 3W9WA 3VLVA 5I57A 2HCAA 3IB0A 2Y7RA 2CEXA 1ANFA 2D21A 3H6WA 3IFCA 2Y7PA 2XXWA 5K2YA 3DP6A 1MXYA 3C9HA 1IXCA 3MSTA 1NV0A 4UA8A 4MAGA 4XKQA 1B3HA 2ALUA 1ZKBA 2GRVA 4ISUA 4F1VA 3TTMA 2OZZA 1XHYA 2Q2AA 4H45A 5EHSA 3IO4A 5DEXB 3VVDA 2F97A 3QMFA 3CSBA 4F18A 3RQTA 4XF5A 4ZZEA 4PF8A 1H44A
chains in the Genus database with same CATH topology
2I4CA 1Y1ZA 2I0CA 1SI0A 4KQPA 4M4GA 5FHMA 3FJMA 5I59A 5L9MA 2F36A 2F7BA 1DTZA 2X7PA 5A5XA 4R9FA 5AA1A 3QUJA 4EQ7A 1FQAA 3T9UA 1JVXA 4HCYA 4QFLA 3E3KA 1T0KA 3TTRA 2YPNA 1Y4TA 5I58B 3H03A 2HAUA 4OFLA 2DXRA 3OSRA 4IO5A 3G3KA 4QSCA 5DYHA 5TP9B 1AH5A 2DVZA 1A55A 2DWAA 4F39A 4RXLA 3V89B 3H4ZA 3DELB 1MRPA 3SESA 1MXZA 3OEMA 3G3FA 3Q26A 4DE8A 2D3IA 4NF8B 5HPQA 4Q0CA 1MXWA 3VLUA 4O3CA 3VLWA 4IB2A 2RF1A 5H8SA 4RYAA 4EF2A 5H8QA 1CE2A 4KYDA 4XKRA 5ISUA 4GL8A 1B05A 1N04A 3MWBA 5JK4A 4RJZA 4QSEA 1US5A 1OLAA 3GBAA 3M3FA 1RYXA 2ONRA 4R6HA 3HO7A 2Z8FA 1J1NA 1JEVA 4POWA 1DTGA 4KFQA 3TKDA 4KCDA 4G77A 3HN0A 5CMKA 4RPOA 2O51A 4PFTA 5CC2A 3LR1A 1LLSA 3QSLA 3VV5A 3OD7A 4H0WA 2YJPA 2XXVA 2XXXA 3SDFA 3HPIA 1P99A 3CFZA 4FORA 3TMGA 2Q9TA 4R75A 1FTKA 2F78A 1LFHA 4MLQA 4F3BA 3W15C 4AQ4A 3KJ7A 1ZLQA 4F19A 1NNFA 4F3SA 4KPTA 2RINA 1Q1KA 1JETA 3K4UA 1NFTA 1SDXA 2H99A 1JNFA 3SEYA 5DEXA 3KG2A 4F2QA 1URSA 4YKPA 4GLIA 3K2DA 2DSFA 1GR2A 3IOVA 4EQ9A 4ELQA 2FA7A 2A5SA 4LZ7A 2ZXTA 2QSXA 1OMPA 4OEUA 1Z7ME 2HAVA 3LSFB 3CI8A 4Q30B 4YB6A 4PP0A 1ZJLA 5TU0A 3FUZA 4U2RA 2XX8A 5CMCA 3KOSA 5F7VA 1OLCA 2ZYNA 3Q27A 4BDLA 5AE4A 4OWDA 2QMXA 3LC8A 3WAEA 3PD8A 3CFXA 2UVIA 3TYHA 2V3TA 1B1XA 4ZS9A 4NE4A 1Z7NE 3G7WA 1MY2A 3MBPA 2GFEA 4JBZA 1BTJA 4DLDA 3FVOA 3A3CA 4ZE9A 5I58A 2Z22A 3CG3A 5KDTB 1IITA 1ZBMA 4IO7A 1B6HA 3PUZE 2PT2A 2AYSA 4FJPA 3R6UA 1M5BA 4WKMA 3ILTB 1VE4A 2QS2A 4MBPA 2D5WA 1USYE 5TP9A 4F1UA 3ZSFA 4ZEFA 5CM6A 1ELJA 1I6AA 3C33A 1PEBA 1XT8A 1YCJA 2Z8EA 3IO6A 2Z23A 3FVKA 3I5OA 1Y4CA 3BFTA 2QS4A 3OELA 3VVFA 4BDNA 2OBGA 4DZ1A 3C4MA 3KSJA 1QUKA 4NF8A 4AB6A 4ESXA 5KZTA 3OXNA 2Q88A 4KR5A 3TTKA 4I1DA 4LVQA 1XVYA 4OMBA 1O63A 1WVJA 4XKNA 2LAOA 1IXIA 1USYH 3KN7A 4NF6B 3RN8A 4IO4A 4GXSB 5AA4B 1MY4A 4NF5B 3SEWA 4PQJA 3U72A 4G8HA 4MF3A 4POXA 3O29A 2UVGA 3K6VA 3TTNA 3GXAA 4TOZA 4DXBA 1LCTA 3PUWE 2F8DA 4WEDA 3MZBA 3DP8A 3B6QA 3TELA 3OO8A 2XHDA 1DMBA 3B6TA 4C0RA 2ZYOA 3PPPA 1UIUA 3FVNA 4TLMB 4EF1A 2DWJA 1EZ9A 3QUFA 3MAMA 1P1UA 3TDJA 4EQBA 4YMBA 1L5TA 3ILUB 4QFOA 5JEIA 1PBQA 4YKKA 5I2KB 3FXRA 3PV0E 2VD2A 1M5CA 3L6HA 2OJTA 4OYVA 4Z7EA 3G3IA 2H98A 1POTA 1SVXB 4OVJA 3PMXA 4U1ZA 2DWHA 3EHSA 1XS5A 4XXUA 4ONYA 4ZZAA 1B3FA 4N13A 3G3JA 4FE8A 3CG1A 1LAHE 3KOTA 2W7YA 1B7UA 2O68A 3S9LC 3KFMA 1TT1A 3EN3A 3O97A 1VFDA 2XX7A 3LUYA 5F1QA 3S9EA 1MQDA 4K3FA 4OXVA 1ZU0A 3SKPA 1Y20A 3HSTA 1N3XA 4FEDA 2BJJX 1Q35A 4HW8A 2OWTA 3IOTA 4TLLB 2REJA 1B3EA 4LZ8A 2PT1A 4FIMA 4EXKA 1PB9A 2F7AA 1UTHB 1TFAA 1LGBC 4MH5A 3T66A 4DIGA 3RTFB 4P0IA 2HZLA 2WKYA 1OIBA 3A3UA 4PFUA 3O6HA 4LATA 1PB8A 1DPPA 4H6DA 1FQDA 2H5YA 5CMMA 5KDTA 1WODA 2HFBA 2HQ0A 3FXQA 2FNCA 2OLBA 4QFNA 4YB7A 1A8FA 3UIFA 2H9BA 2ANJA 1LCFA 4ND9A 3ZS6A 4LONB 2I0BA 1HSEA 1LBBA 1MXXA 2F7CA 2QRYA 5DTBA 4R74A 4KYSA 1OQGA 4NTLA 3DLNA 1P1NA 5H8FB 2NVUB 5H8NB 3O2AA 3MP8A 3TAJA 4DCYA 5H8HB 2UYFA 1P1WA 4IO6A 3VXCA 2RKMA 4I62A 1D9YA 4JSDA 3K1MA 2RCAA 3QIMA 4R6YA 1LAGE 2ZYKA 4GFRA 5I56B 4NF6A 4XIGQ 5AA4A 1AOVA 2XXPA 4NF5A 4ZECA 3C31A 3IAZA 4E0XA 1LB8A 1GGGA 3R26A 4YB5A 3GBBA 2O7IA 2VOZA 4RK2A 3EF7A 5AA2D 1QKBA 1HSJA 4GOTA 3PMVA 3HHFA 4M1VA 1KWHA 2REGA 5TPAB 2HZKA 1EZPA 4YKIA 3D4CA 1XVXA 1R6ZA 4EUOA 5EHMA 2O69A 3CFLA 3KJTA 2HXWA 2IEEA 3PPNA 5I2KA 3LBSA 2UXAA 3MP6A 3KGCA 4Z0IA 3MUQA 5ICTA 2CZLA 1NNPA 1ZTYA 1FTMA 1PDAA 3H6TA 1I69A 4ELPA 2XXQA 4U22A 3UK4A 3UGWA 1M5EA 3KSXA 5L8DA 1FCKA 4OQOA 2O6AA 3TQWA 2UVJA 3B6WA 1MXUA 3VFJA 1BIYA 3CR9A 4G68B 4H5FA 1H3DA 2I3VA 3IR1A 1GVCA 3RPWA 3S9MC 4F29A 1A40A 1A54A 1MM7A 3MC2A 1B1HA 3SERA 1VR5A 2AIXA 2DS9A 2Y84A 1LFGA 3MVXA 2V25A 3Q25A 4DDDA 3TUSA 4G8NA 1UTHA 4MFIA 3O28A 1GV8A 3MQ9A 1I6QA 4JSOA 3ONMA 2F35A 4R72A 4IO2A 3F11A 3K6XA 1BKAA 2R9JA 4U1OA 3IX1A 4H8JA 1JW1A 1SYHA 4Q5TA 3O66A 4RPNA 1FQEA 4ZEIA 3MW0A 3FJ7A 2ZNUA 3FXUA 3CVGA 4LUBA 5H8FA 1B9JA 3OENA 5H8NA 4H8IA 3RUMA 2O84X 4GRKA 5H8HA 3TODA 1HSLA 3CRBA 4X48A 4DXUA 2OK2A 3RY3A 4DXCA 5B7DA 2B3BA 2ZNTA 3U1OA 1MY3A 1R1NA 1UQWA 1Y3QA 5I56A 2ABHA 4OENA 3TZAA 4GWOA 3USDA 4EDPA 1B0HA 2XD3A 4XKPA 4GD5A 2I3WA 4OERA 4X9TA 4PETA 3C32A 1QW0A 4OESA 2M8CA 3UORA 3BFUA 2Q2CA 2DWIA 1IXHA 4JXIA 3QYTA 4IY6A 3IJXB 1NH7A 1OVTA 4F22A 3H3GA 1IXGA 3PPOA 3N6UA 2XXIA 1B0LA 1SW2A 4KYEA 4OZ9A 5TPAA 4KCCA 1GTKA 2ZMBA 1B32A 2ONSA 1SW4A 3IK6B 4IGTA 4C1UA 4G8MA 1NH8A 1URGA 2DE3A 3U93A 2O7UA 1FW0A 3N94A 1RKMA 1SBPA 1B52A 3VXBA 3MVYA 2PVUA 1MPBA 4U23A 2ZYMA 2PBWA 5IAIA 3KEIA 2X7QA 4JWYA 3V83A 1N7XA 4F31B 4BDRA 1MQGA 1CB6A 2IA4A 3M3KA 4BLAA 2XXTA 3U94A 1NKXA 3MJNA 2GHAA 2O1LA 2I58A 3H6VA 4O3AA 2Y7KA 3SEXA 1NL5A 1O64A 4JWXA 4G68A 1TXFA 2DOJA 4AB5A 1YTVA 1B51A 2VGQA 2KLFA 3PUYE 1YPNA 4GVOA 4R6KA 3HV1A 4DCXA 3EPEA 4TQUQ 1SI1A 3IL1B 2I6EA 4R9GA 4G68C 1P1QA 1FQFA 2E0SA 3IOWA 4NWCA 1R9QA 5FHOA 3T9XB 3CSGA 3LSLA 3TTLA 1SQYA 3UP9A 3MPKA 4RA1A 1ZMGA 3DP4A 2RC9A 3SETA 4PE5B 1NNKA 1XOCA 5FTIA 1EZOA 4BDQA 1A99A 1NNTA 1M5DA 1DOTA 2QL3A 4QFPA 4F1YA 2NOOA 5J1DA 1AMFA 4I9DA 2AL5A 3EHTA 5IKBA 4LZ5A 1SYIA 3BKIB 3VE1B 3TQLA 2DE2A 3K0VA 3FJGA 1WDNA 5EYFA 1IUDA 1VFEA 1R9LA 1O7TA 3ECRA 3EQ1A 2RCBA 1N76A 5JTYB 4NF4B 3OMBA 1N0TA 1EU8A 4O3BA 2V84A 5ITPA 1LFIA 3OO6A 1H45A 1EH3A 4WXJA 1FTLA 1N7WA 2DQVA 1QJMA 4XTCQ 5HM4B 1VSOA 2R6GE 4BDOA 3OSQA 2P2AA 1SW1A 2V3QA 2ESNA 2ZNSA 3MVWA 1DSNA 3T9VA 4F2OA 5M2VA 1MG1A 3RT8A 4JWOA 4MLVA 3PUXE 1NMUA 3MZ9A 2P1SA 1JVYA 3K1NA 4HTGA 1POY1 3PU5A 1IIWA 2O1MA 3IOUA 4LA9A 1B3GA 4LQ5A 3T9HB 4G4PA 5L9OA 2QS1A 4N6PA 4PFYA 1RYOA 1OVBA 2B3FA 2YLNA 1IZ1A 1LAFE 1OQHA 3QAXA 3RNNA 3PD9A 1Y3PA 3QK6A 3PPRA 4N07A 1UTBB 3H6UA 1A8EA 3IB2A 1LBCA 5ICQA 3Q28A 2B65A 1JQFA 3JZJA 4GXAA 4HCWA 1MDP1 5CMBA 3TCGA 5I2NB 1LB9A 1B46A 4HS7A 5CI5A 1MY1A 1MPCA 4RK9A 3LSXA 3S9NC 1B58A 5DT6A 2GHBA 2G93A 1QULA 4RNSA 3V8XB 3H06B 2Q89A 3EHUA 3K01A 3E13X 3SEVA 3RT6B 4GQOA 3TPAA 4NWDA 2PMSA 3FV1A 5DVJA 4IGRA 3TCHA 1SD3A 2V93A 1MQIA 3I3VA 5AA2B 1M5FA 4WEPA 4KI0E 4LP2B 2I48A 3PPQA 4QRZA 4EXLA 5ITOA 2VD3A 1B2HA 4JB7A 4OFOA 3IORA 2H25A 2F6GA 2P0SA 1MS7A 2XXUA 4KHZE 3C34A 1B3LA 3FATA 2OCUA 4R2FA 1MH3A 1DPEA 1N3WA 1ZIUA 4ZDMA 3HHGA 2XD2A 4U4XA 2E1SA 4Q8RA 3A09A 4LQ2A 4ELOA 5JTYA 1US4A 4NF4A 3VDFA 5KCJB 3O6IA 3O6GA 3ZKLA 3SEUA 4FAJA 1SW5A 4IO3A 2QMWA 3IJOB 2FYIA 2QPQA 5I84A 2XX9A 3U8QA 4QHQA 1QUJA 4IY5A 4H5GA 1PBPA 2R71A 1QUIA 2CMOA 2PYYA 1IEJA 3E4RA 5CBSA 2V3UA 3MPLA 3BBRA 2NWJA 2UVHA 4YZZA 1B5JA 3JYRA 2XXHA 3GLBA 1MPDA 3GZGA 1JW5A 3FGSA 3V5AA 3HCQA 2RC7A 3RGYA 4U4SA 3ZKKA 5FTHA 4OHNA 2NUVA 1AIVA 3FD3A 2Z8DA 4R73A 1TFDA 3RLFE 4ECFA 3N26A 1LSTA 2A5TB 2PX1A 3TFLA 3K6UA 4JDFA 2DP8A 4U21A 2X26A 4ZE8A 3L6GA 3I6VA 3FASA 4QF9A 1QVSA 1B40A 3M8UA 5BWJA 3KZGA 4GF8A 4NMYA 2I49A 1UTBA 3D4GA 1F9BA 4FECA 3AXFA 1I6BA 4PFWA 2QJEA 1S9TA 2GH9A 2F6PA 2THIA 1II5A 3MVZA 5I2NA 1UIVA 4OFJA 2Y7WA 1D9VA 2Y7IA 4E0WA 1FTJA 3E9XA 2I4BA 5AA3A 1BP5A 5L9SA 3KN3A 1D4NA 3CIJA 3C36A 5DVFA 5K2XA 2OWSA 5HBCA 1MQHA 4OTEA 1P1OA 3Q29A 4F3PA 5I57B 4OEVA 4THIA 4GL0A 1PB7A 3S2VA 2Q8JA 1MH4A 1Y9UA 3N5LA 3ODBA 2VHAA 1ATGA 2XXRA 4ZEBA 1FQBA 4YU0A 3W9VA 5AA2A 4GIZA 4YKJA 3K02A 1B5IA 2DXYA 1YAEA 4FEBA 1MDQA 1MQJA 3MZ1A 4FATA 1IQ7A 1TWYA 1MY0A 5B70A 3T93B 3MP1A 3K6WA 5DVIA 1H43A 4C1TA 3THIA 1AL3A 3WAFA 1B7ZA 4BDMA 4KD5A 5I59B 2UYEA 4X1BA 4YMAA 1FQCA 4H1XA 4YICA 1B4ZA 4UACA 5KCJA 1A7LA 3OEKA 4ESWA 4ZEDA 5A5XB 2QS3A 1N84A 5BUUA 4P11A 4OETA 3OOAA 1FTOA 1Y1MA 4QSDA 4X1DA 3LSWA 3G3GA 1S50A 3FIRA 3RTWB 1B7HA 1PC3A 1B5HA 3OO9A 2VP1A 4H65A 5CRYA 1B4HA 3FV2A 3PUVE 3VVEA 3DM0A 3P7IA 3UA8A 3T96B 3R7XA 3TCFA 3S4UA 1S7YA 3B7DA 1MXVA 5ELVA 4RY1A 3KBRA 4NEDA 2DYXA 2G29A 1QKAA 1URDA 2F5XA 2A5TA 3PGFA 3O9PA 4QFKA 4P0GA 3H7MA 2AL4A 3K1PA 1XC1A 4L17A 3OO7A 5FHNA 1BLFA 2DE4A 1JW4A 4G2ZA 3C35A 3QXMA 3PMWA 2DVCA 2HEUA 1H76A 5H8QB 3N6TA 3K00A 3UN6A 3JV9A 2NXOA 5LOMA 3FVGA 3G3HA 4I8CA 3KN8A 3TEPA 3T22A 2F34A 2RC8A 3M3LA 4H67A 1Y3NA 3U92A 1D3KA 1LAXA 3FZVA 2ONKE 5CBRA 1MM6A 4ELRA 4YAHX 1JEUA 2XXYA 4ZEKA 3IB1A 4R2BA 4F3GA 2H4IA 3W9WA 3VLVA 5I57A 2HCAA 3IB0A 2Y7RA 1ANFA 2D21A 3H6WA 2Y7PA 2XXWA 5K2YA 3DP6A 1MXYA 3C9HA 1IXCA 4UA8A 4XKQA 1B3HA 2ALUA 1ZKBA 2GRVA 4ISUA 4F1VA 3TTMA 2OZZA 1XHYA 2Q2AA 5EHSA 3IO4A 5DEXB 3VVDA 2F97A 4F18A 3CSBA 3RQTA 4ZZEA 1H44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I4C A;  1Y1Z A;  2I0C A;  1SI0 A;  4KQP A;  4M4G A;  5FHM A;  3FJM A;  5I59 A;  5L9M A;  2F36 A;  2F7B A;  1DTZ A;  2X7P A;  5A5X A;  4R9F A;  5AA1 A;  3QUJ A;  4EQ7 A;  1FQA A;  3T9U A;  1JVX A;  4HCY A;  4QFL A;  3E3K A;  1T0K A;  3TTR A;  2YPN A;  1Y4T A;  5I58 B;  3H03 A;  2HAU A;  4OFL A;  2DXR A;  3OSR A;  4IO5 A;  3G3K A;  4QSC A;  5DYH A;  5TP9 B;  1AH5 A;  2DVZ A;  1A55 A;  2DWA A;  4F39 A;  4RXL A;  3V89 B;  3H4Z A;  3DEL B;  1MRP A;  3SES A;  1MXZ A;  3OEM A;  3G3F A;  3Q26 A;  4DE8 A;  2D3I A;  4NF8 B;  5HPQ A;  4Q0C A;  1MXW A;  3VLU A;  4O3C A;  3VLW A;  4IB2 A;  2RF1 A;  5H8S A;  4RYA A;  4EF2 A;  5H8Q A;  1CE2 A;  4KYD A;  4XKR A;  5ISU A;  4GL8 A;  1B05 A;  1N04 A;  3MWB A;  5JK4 A;  4RJZ A;  4QSE A;  1US5 A;  1OLA A;  3GBA A;  3M3F A;  1RYX A;  2ONR A;  4R6H A;  3HO7 A;  2Z8F A;  1J1N A;  1JEV A;  4POW A;  1DTG A;  4KFQ A;  3TKD A;  4KCD A;  4G77 A;  3HN0 A;  5CMK A;  4RPO A;  2O51 A;  4PFT A;  5CC2 A;  3LR1 A;  1LLS A;  3QSL A;  3VV5 A;  3OD7 A;  4H0W A;  2YJP A;  2XXV A;  2XXX A;  3SDF A;  3HPI A;  1P99 A;  3CFZ A;  4FOR A;  3TMG A;  2Q9T A;  4R75 A;  1FTK A;  2F78 A;  1LFH A;  4MLQ A;  4F3B A;  3W15 C;  4AQ4 A;  3KJ7 A;  1ZLQ A;  4F19 A;  1NNF A;  4F3S A;  4KPT A;  2RIN A;  1Q1K A;  1JET A;  3K4U A;  1NFT A;  1SDX A;  2H99 A;  1JNF A;  3SEY A;  5DEX A;  3KG2 A;  4F2Q A;  1URS A;  4YKP A;  4GLI A;  3K2D A;  2DSF A;  1GR2 A;  3IOV A;  4EQ9 A;  4ELQ A;  2FA7 A;  2A5S A;  4LZ7 A;  2ZXT A;  2QSX A;  1OMP A;  4OEU A;  1Z7M E;  2HAV A;  3LSF B;  3CI8 A;  4Q30 B;  4YB6 A;  4PP0 A;  1ZJL A;  5TU0 A;  3FUZ A;  4U2R A;  2XX8 A;  5CMC A;  3KOS A;  5F7V A;  1OLC A;  2ZYN A;  3Q27 A;  4BDL A;  5AE4 A;  4OWD A;  2QMX A;  3LC8 A;  3WAE A;  3PD8 A;  3CFX A;  2UVI A;  3TYH A;  2V3T A;  1B1X A;  4ZS9 A;  4NE4 A;  1Z7N E;  3G7W A;  1MY2 A;  3MBP A;  2GFE A;  4JBZ A;  1BTJ A;  4DLD A;  3FVO A;  3A3C A;  4ZE9 A;  5I58 A;  2Z22 A;  3CG3 A;  5KDT B;  1IIT A;  1ZBM A;  4IO7 A;  1B6H A;  3PUZ E;  2PT2 A;  2AYS A;  4FJP A;  3R6U A;  1M5B A;  4WKM A;  3ILT B;  1VE4 A;  2QS2 A;  4MBP A;  2D5W A;  1USY E;  5TP9 A;  4F1U A;  3ZSF A;  4ZEF A;  5CM6 A;  1ELJ A;  1I6A A;  3C33 A;  1PEB A;  1XT8 A;  1YCJ A;  2Z8E A;  3IO6 A;  2Z23 A;  3FVK A;  3I5O A;  1Y4C A;  3BFT A;  2QS4 A;  3OEL A;  3VVF A;  4BDN A;  2OBG A;  4DZ1 A;  3C4M A;  3KSJ A;  1QUK A;  4NF8 A;  4AB6 A;  4ESX A;  5KZT A;  3OXN A;  2Q88 A;  4KR5 A;  3TTK A;  4I1D A;  4LVQ A;  1XVY A;  4OMB A;  1O63 A;  1WVJ A;  4XKN A;  2LAO A;  1IXI A;  1USY H;  3KN7 A;  4NF6 B;  3RN8 A;  4IO4 A;  4GXS B;  5AA4 B;  1MY4 A;  4NF5 B;  3SEW A;  4PQJ A;  3U72 A;  4G8H A;  4MF3 A;  4POX A;  3O29 A;  2UVG A;  3K6V A;  3TTN A;  3GXA A;  4TOZ A;  4DXB A;  1LCT A;  3PUW E;  2F8D A;  4WED A;  3MZB A;  3DP8 A;  3B6Q A;  3TEL A;  3OO8 A;  2XHD A;  1DMB A;  3B6T A;  4C0R A;  2ZYO A;  3PPP A;  1UIU A;  3FVN A;  4TLM B;  4EF1 A;  2DWJ A;  1EZ9 A;  3QUF A;  3MAM A;  1P1U A;  3TDJ A;  4EQB A;  4YMB A;  1L5T A;  3ILU B;  4QFO A;  5JEI A;  1PBQ A;  4YKK A;  5I2K B;  3FXR A;  3PV0 E;  2VD2 A;  1M5C A;  3L6H A;  2OJT A;  4OYV A;  4Z7E A;  3G3I A;  2H98 A;  1POT A;  1SVX B;  4OVJ A;  3PMX A;  4U1Z A;  2DWH A;  3EHS A;  1XS5 A;  4XXU A;  4ONY A;  4ZZA A;  1B3F A;  4N13 A;  3G3J A;  4FE8 A;  3CG1 A;  1LAH E;  3KOT A;  2W7Y A;  1B7U A;  2O68 A;  3S9L C;  3KFM A;  1TT1 A;  3EN3 A;  3O97 A;  1VFD A;  2XX7 A;  3LUY A;  5F1Q A;  3S9E A;  1MQD A;  4K3F A;  4OXV A;  1ZU0 A;  3SKP A;  1Y20 A;  3HST A;  1N3X A;  4FED A;  2BJJ X;  1Q35 A;  4HW8 A;  2OWT A;  3IOT A;  4TLL B;  2REJ A;  1B3E A;  4LZ8 A;  2PT1 A;  4FIM A;  4EXK A;  1PB9 A;  2F7A A;  1UTH B;  1TFA A;  1LGB C;  4MH5 A;  3T66 A;  4DIG A;  3RTF B;  4P0I A;  2HZL A;  2WKY A;  1OIB A;  3A3U A;  4PFU A;  3O6H A;  4LAT A;  1PB8 A;  1DPP A;  4H6D A;  1FQD A;  2H5Y A;  5CMM A;  5KDT A;  1WOD A;  2HFB A;  2HQ0 A;  3FXQ A;  2FNC A;  2OLB A;  4QFN A;  4YB7 A;  1A8F A;  3UIF A;  2H9B A;  2ANJ A;  1LCF A;  4ND9 A;  3ZS6 A;  4LON B;  2I0B A;  1HSE A;  1LBB A;  1MXX A;  2F7C A;  2QRY A;  5DTB A;  4R74 A;  4KYS A;  1OQG A;  4NTL A;  3DLN A;  1P1N A;  5H8F B;  2NVU B;  5H8N B;  3O2A A;  3MP8 A;  3TAJ A;  4DCY A;  5H8H B;  2UYF A;  1P1W A;  4IO6 A;  3VXC A;  2RKM A;  4I62 A;  1D9Y A;  4JSD A;  3K1M A;  2RCA A;  3QIM A;  4R6Y A;  1LAG E;  2ZYK A;  4GFR A;  5I56 B;  4NF6 A;  4XIG Q;  5AA4 A;  1AOV A;  2XXP A;  4NF5 A;  4ZEC A;  3C31 A;  3IAZ A;  4E0X A;  1LB8 A;  1GGG A;  3R26 A;  4YB5 A;  3GBB A;  2O7I A;  2VOZ A;  4RK2 A;  3EF7 A;  5AA2 D;  1QKB A;  1HSJ A;  4GOT A;  3PMV A;  3HHF A;  4M1V A;  1KWH A;  2REG A;  5TPA B;  2HZK A;  1EZP A;  4YKI A;  3D4C A;  1XVX A;  1R6Z A;  4EUO A;  5EHM A;  2O69 A;  3CFL A;  3KJT A;  2HXW A;  2IEE A;  3PPN A;  5I2K A;  3LBS A;  2UXA A;  3MP6 A;  3KGC A;  4Z0I A;  3MUQ A;  5ICT A;  2CZL A;  1NNP A;  1ZTY A;  1FTM A;  1PDA A;  3H6T A;  1I69 A;  4ELP A;  2XXQ A;  4U22 A;  3UK4 A;  3UGW A;  1M5E A;  3KSX A;  5L8D A;  1FCK A;  4OQO A;  2O6A A;  3TQW A;  2UVJ A;  3B6W A;  1MXU A;  3VFJ A;  1BIY A;  3CR9 A;  4G68 B;  4H5F A;  1H3D A;  2I3V A;  3IR1 A;  1GVC A;  3RPW A;  3S9M C;  4F29 A;  1A40 A;  1A54 A;  1MM7 A;  3MC2 A;  1B1H A;  3SER A;  1VR5 A;  2AIX A;  2DS9 A;  2Y84 A;  1LFG A;  3MVX A;  2V25 A;  3Q25 A;  4DDD A;  3TUS A;  4G8N A;  1UTH A;  4MFI A;  3O28 A;  1GV8 A;  3MQ9 A;  1I6Q A;  4JSO A;  3ONM A;  2F35 A;  4R72 A;  4IO2 A;  3F11 A;  3K6X A;  1BKA A;  2R9J A;  4U1O A;  3IX1 A;  4H8J A;  1JW1 A;  1SYH A;  4Q5T A;  3O66 A;  4RPN A;  1FQE A;  4ZEI A;  3MW0 A;  3FJ7 A;  2ZNU A;  3FXU A;  3CVG A;  4LUB A;  5H8F A;  1B9J A;  3OEN A;  5H8N A;  4H8I A;  3RUM A;  2O84 X;  4GRK A;  5H8H A;  3TOD A;  1HSL A;  3CRB A;  4X48 A;  4DXU A;  2OK2 A;  3RY3 A;  4DXC A;  5B7D A;  2B3B A;  2ZNT A;  3U1O A;  1MY3 A;  1R1N A;  1UQW A;  1Y3Q A;  5I56 A;  2ABH A;  4OEN A;  3TZA A;  4GWO A;  3USD A;  4EDP A;  1B0H A;  2XD3 A;  4XKP A;  4GD5 A;  2I3W A;  4OER A;  4X9T A;  4PET A;  3C32 A;  1QW0 A;  4OES A;  2M8C A;  3UOR A;  3BFU A;  2Q2C A;  2DWI A;  1IXH A;  4JXI A;  3QYT A;  4IY6 A;  3IJX B;  1NH7 A;  1OVT A;  4F22 A;  3H3G A;  1IXG A;  3PPO A;  3N6U A;  2XXI A;  1B0L A;  1SW2 A;  4KYE A;  4OZ9 A;  5TPA A;  4KCC A;  1GTK A;  2ZMB A;  1B32 A;  2ONS A;  1SW4 A;  3IK6 B;  4IGT A;  4C1U A;  4G8M A;  1NH8 A;  1URG A;  2DE3 A;  3U93 A;  2O7U A;  1FW0 A;  3N94 A;  1RKM A;  1SBP A;  1B52 A;  3VXB A;  3MVY A;  2PVU A;  1MPB A;  4U23 A;  2ZYM A;  2PBW A;  5IAI A;  3KEI A;  2X7Q A;  4JWY A;  3V83 A;  1N7X A;  4F31 B;  4BDR A;  1MQG A;  1CB6 A;  2IA4 A;  3M3K A;  4BLA A;  2XXT A;  3U94 A;  1NKX A;  3MJN A;  2GHA A;  2O1L A;  2I58 A;  3H6V A;  4O3A A;  2Y7K A;  3SEX A;  1NL5 A;  1O64 A;  4JWX A;  4G68 A;  1TXF A;  2DOJ A;  4AB5 A;  1YTV A;  1B51 A;  2VGQ A;  2KLF A;  3PUY E;  1YPN A;  4GVO A;  4R6K A;  3HV1 A;  4DCX A;  3EPE A;  4TQU Q;  1SI1 A;  3IL1 B;  2I6E A;  4R9G A;  4G68 C;  1P1Q A;  1FQF A;  2E0S A;  3IOW A;  4NWC A;  1R9Q A;  5FHO A;  3T9X B;  3CSG A;  3LSL A;  3TTL A;  1SQY A;  3UP9 A;  3MPK A;  4RA1 A;  1ZMG A;  3DP4 A;  2RC9 A;  3SET A;  4PE5 B;  1NNK A;  1XOC A;  5FTI A;  1EZO A;  4BDQ A;  1A99 A;  1NNT A;  1M5D A;  1DOT A;  2QL3 A;  4QFP A;  4F1Y A;  2NOO A;  5J1D A;  1AMF A;  4I9D A;  2AL5 A;  3EHT A;  5IKB A;  4LZ5 A;  1SYI A;  3BKI B;  3VE1 B;  3TQL A;  2DE2 A;  3K0V A;  3FJG A;  1WDN A;  5EYF A;  1IUD A;  1VFE A;  1R9L A;  1O7T A;  3ECR A;  3EQ1 A;  2RCB A;  1N76 A;  5JTY B;  4NF4 B;  3OMB A;  1N0T A;  1EU8 A;  4O3B A;  2V84 A;  5ITP A;  1LFI A;  3OO6 A;  1H45 A;  1EH3 A;  4WXJ A;  1FTL A;  1N7W A;  2DQV A;  1QJM A;  4XTC Q;  5HM4 B;  1VSO A;  2R6G E;  4BDO A;  3OSQ A;  2P2A A;  1SW1 A;  2V3Q A;  2ESN A;  2ZNS A;  3MVW A;  1DSN A;  3T9V A;  4F2O A;  5M2V A;  1MG1 A;  3RT8 A;  4JWO A;  4MLV A;  3PUX E;  1NMU A;  3MZ9 A;  2P1S A;  1JVY A;  3K1N A;  4HTG A;  1POY 1;  3PU5 A;  1IIW A;  2O1M A;  3IOU A;  4LA9 A;  1B3G A;  4LQ5 A;  3T9H B;  4G4P A;  5L9O A;  2QS1 A;  4N6P A;  4PFY A;  1RYO A;  1OVB A;  2B3F A;  2YLN A;  1IZ1 A;  1LAF E;  1OQH A;  3QAX A;  3RNN A;  3PD9 A;  1Y3P A;  3QK6 A;  3PPR A;  4N07 A;  1UTB B;  3H6U A;  1A8E A;  3IB2 A;  1LBC A;  5ICQ A;  3Q28 A;  2B65 A;  1JQF A;  3JZJ A;  4GXA A;  4HCW A;  1MDP 1;  5CMB A;  3TCG A;  5I2N B;  1LB9 A;  1B46 A;  4HS7 A;  5CI5 A;  1MY1 A;  1MPC A;  4RK9 A;  3LSX A;  3S9N C;  1B58 A;  5DT6 A;  2GHB A;  2G93 A;  1QUL A;  4RNS A;  3V8X B;  3H06 B;  2Q89 A;  3EHU A;  3K01 A;  3E13 X;  3SEV A;  3RT6 B;  4GQO A;  3TPA A;  4NWD A;  2PMS A;  3FV1 A;  5DVJ A;  4IGR A;  3TCH A;  1SD3 A;  2V93 A;  1MQI A;  3I3V A;  5AA2 B;  1M5F A;  4WEP A;  4KI0 E;  4LP2 B;  2I48 A;  3PPQ A;  4QRZ A;  4EXL A;  5ITO A;  2VD3 A;  1B2H A;  4JB7 A;  4OFO A;  3IOR A;  2H25 A;  2F6G A;  2P0S A;  1MS7 A;  2XXU A;  4KHZ E;  3C34 A;  1B3L A;  3FAT A;  2OCU A;  4R2F A;  1MH3 A;  1DPE A;  1N3W A;  1ZIU A;  4ZDM A;  3HHG A;  2XD2 A;  4U4X A;  2E1S A;  4Q8R A;  3A09 A;  4LQ2 A;  4ELO A;  5JTY A;  1US4 A;  4NF4 A;  3VDF A;  5KCJ B;  3O6I A;  3O6G A;  3ZKL A;  3SEU A;  4FAJ A;  1SW5 A;  4IO3 A;  2QMW A;  3IJO B;  2FYI A;  2QPQ A;  5I84 A;  2XX9 A;  3U8Q A;  4QHQ A;  1QUJ A;  4IY5 A;  4H5G A;  1PBP A;  2R71 A;  1QUI A;  2CMO A;  2PYY A;  1IEJ A;  3E4R A;  5CBS A;  2V3U A;  3MPL A;  3BBR A;  2NWJ A;  2UVH A;  4YZZ A;  1B5J A;  3JYR A;  2XXH A;  3GLB A;  1MPD A;  3GZG A;  1JW5 A;  3FGS A;  3V5A A;  3HCQ A;  2RC7 A;  3RGY A;  4U4S A;  3ZKK A;  5FTH A;  4OHN A;  2NUV A;  1AIV A;  3FD3 A;  2Z8D A;  4R73 A;  1TFD A;  3RLF E;  4ECF A;  3N26 A;  1LST A;  2A5T B;  2PX1 A;  3TFL A;  3K6U A;  4JDF A;  2DP8 A;  4U21 A;  2X26 A;  4ZE8 A;  3L6G A;  3I6V A;  3FAS A;  4QF9 A;  1QVS A;  1B40 A;  3M8U A;  5BWJ A;  3KZG A;  4GF8 A;  4NMY A;  2I49 A;  1UTB A;  3D4G A;  1F9B A;  4FEC A;  3AXF A;  1I6B A;  4PFW A;  2QJE A;  1S9T A;  2GH9 A;  2F6P A;  2THI A;  1II5 A;  3MVZ A;  5I2N A;  1UIV A;  4OFJ A;  2Y7W A;  1D9V A;  2Y7I A;  4E0W A;  1FTJ A;  3E9X A;  2I4B A;  5AA3 A;  1BP5 A;  5L9S A;  3KN3 A;  1D4N A;  3CIJ A;  3C36 A;  5DVF A;  5K2X A;  2OWS A;  5HBC A;  1MQH A;  4OTE A;  1P1O A;  3Q29 A;  4F3P A;  5I57 B;  4OEV A;  4THI A;  4GL0 A;  1PB7 A;  3S2V A;  2Q8J A;  1MH4 A;  1Y9U A;  3N5L A;  3ODB A;  2VHA A;  1ATG A;  2XXR A;  4ZEB A;  1FQB A;  4YU0 A;  3W9V A;  5AA2 A;  4GIZ A;  4YKJ A;  3K02 A;  1B5I A;  2DXY A;  1YAE A;  4FEB A;  1MDQ A;  1MQJ A;  3MZ1 A;  4FAT A;  1IQ7 A;  1TWY A;  1MY0 A;  5B70 A;  3T93 B;  3MP1 A;  3K6W A;  5DVI A;  1H43 A;  4C1T A;  3THI A;  1AL3 A;  3WAF A;  1B7Z A;  4BDM A;  4KD5 A;  5I59 B;  2UYE A;  4X1B A;  4YMA A;  1FQC A;  4H1X A;  4YIC A;  1B4Z A;  4UAC A;  5KCJ A;  1A7L A;  3OEK A;  4ESW A;  4ZED A;  5A5X B;  2QS3 A;  1N84 A;  5BUU A;  4P11 A;  4OET A;  3OOA A;  1FTO A;  1Y1M A;  4QSD A;  4X1D A;  3LSW A;  3G3G A;  1S50 A;  3FIR A;  3RTW B;  1B7H A;  1PC3 A;  1B5H A;  3OO9 A;  2VP1 A;  4H65 A;  5CRY A;  1B4H A;  3FV2 A;  3PUV E;  3VVE A;  3DM0 A;  3P7I A;  3UA8 A;  3T96 B;  3R7X A;  3TCF A;  3S4U A;  1S7Y A;  3B7D A;  1MXV A;  5ELV A;  4RY1 A;  3KBR A;  4NED A;  2DYX A;  2G29 A;  1QKA A;  1URD A;  2F5X A;  2A5T A;  3PGF A;  3O9P A;  4QFK A;  4P0G A;  3H7M A;  2AL4 A;  3K1P A;  1XC1 A;  4L17 A;  3OO7 A;  5FHN A;  1BLF A;  2DE4 A;  1JW4 A;  4G2Z A;  3C35 A;  3QXM A;  3PMW A;  2DVC A;  2HEU A;  1H76 A;  5H8Q B;  3N6T A;  3K00 A;  3UN6 A;  3JV9 A;  2NXO A;  5LOM A;  3FVG A;  3G3H A;  4I8C A;  3KN8 A;  3TEP A;  3T22 A;  2F34 A;  2RC8 A;  3M3L A;  4H67 A;  1Y3N A;  3U92 A;  1D3K A;  1LAX A;  3FZV A;  2ONK E;  5CBR A;  1MM6 A;  4ELR A;  4YAH X;  1JEU A;  2XXY A;  4ZEK A;  3IB1 A;  4R2B A;  4F3G A;  2H4I A;  3W9W A;  3VLV A;  5I57 A;  2HCA A;  3IB0 A;  2Y7R A;  1ANF A;  2D21 A;  3H6W A;  2Y7P A;  2XXW A;  5K2Y A;  3DP6 A;  1MXY A;  3C9H A;  1IXC A;  4UA8 A;  4XKQ A;  1B3H A;  2ALU A;  1ZKB A;  2GRV A;  4ISU A;  4F1V A;  3TTM A;  2OZZ A;  1XHY A;  2Q2A A;  5EHS A;  3IO4 A;  5DEX B;  3VVD A;  2F97 A;  4F18 A;  3CSB A;  3RQT A;  4ZZE A;  1H44 A; 
#chains in the Genus database with same CATH topology
 2I4C A;  1Y1Z A;  2I0C A;  1SI0 A;  4KQP A;  2F3B A;  4M4G A;  5FHM A;  3FJM A;  3NOH A;  5I59 A;  5L9M A;  2WYP A;  2F36 A;  2F7B A;  1NI9 A;  1DTZ A;  2X7P A;  5A5X A;  4R9F A;  1QGX A;  5AA1 A;  3QUJ A;  4PDH A;  4EQ7 A;  1FQA A;  3T9U A;  1JVX A;  3ROJ A;  4HCY A;  4QFL A;  1NV7 A;  1EYI A;  4MJO A;  3E3K A;  3GYY A;  4HE1 A;  1T0K A;  3TTR A;  2YPN A;  1Y4T A;  5I58 B;  3H03 A;  2HAU A;  4QBA A;  4OFL A;  2XWV A;  2FVZ A;  2DXR A;  3OSR A;  4IO5 A;  3G3K A;  4QSC A;  2CZH A;  4PAK A;  1LBX A;  5DYH A;  5TP9 B;  4DI4 B;  1AH5 A;  2DVZ A;  1G0H A;  5ET8 A;  1A55 A;  2DWA A;  4F39 A;  4RXL A;  3V89 B;  3H4Z A;  4PF6 A;  3DEL B;  1MRP A;  3SES A;  1MXZ A;  3OEM A;  3G3F A;  3Q26 A;  4DE8 A;  2D3I A;  3LV0 A;  4NF8 B;  4AS4 A;  5HPQ A;  4Q0C A;  1MXW A;  3VLU A;  4O3C A;  1FBG A;  3VLW A;  4IB2 A;  3CHG A;  2RF1 A;  5H8S A;  4RYA A;  4EF2 A;  5H8Q A;  1NUY A;  1CE2 A;  2VPN A;  4KYD A;  4XKR A;  5ISU A;  2OX3 A;  4GL8 A;  1B05 A;  2PFY A;  1N04 A;  4PBQ A;  3MWB A;  5JK4 A;  4RJZ A;  4QSE A;  1US5 A;  1OLA A;  3GBA A;  3M3F A;  1RYX A;  5ET7 A;  2ONR A;  4PTK A;  1FPB A;  4R6H A;  3HO7 A;  2Z8F A;  1J1N A;  1JEV A;  4POW A;  1DTG A;  4KFQ A;  3TKD A;  4KCD A;  4G77 A;  3HN0 A;  5EQ9 A;  5CMK A;  4RPO A;  2O51 A;  4PFT A;  5CC2 A;  2XA5 A;  3LR1 A;  1LLS A;  3QSL A;  3VV5 A;  3OD7 A;  4H0W A;  2YJP A;  2XXV A;  2XXX A;  3SDF A;  3HPI A;  1P99 A;  3CFZ A;  4FOR A;  3TMG A;  2Q9T A;  4R75 A;  1FTK A;  2CZK A;  2F78 A;  1LFH A;  4MLQ A;  4F3B A;  3W15 C;  4AQ4 A;  3KJ7 A;  1ZLQ A;  3ISP A;  4F19 A;  5ET6 A;  1NNF A;  4F3S A;  4KPT A;  2RIN A;  1Q1K A;  1JET A;  5IZ3 B;  3K4U A;  1NFT A;  1SDX A;  2H99 A;  1JNF A;  2PFZ A;  3SEY A;  1EYK A;  5DEX A;  3KG2 A;  4F2Q A;  1URS A;  4YKP A;  4GLI A;  3K2D A;  2DSF A;  5FBP A;  1GR2 A;  3IOV A;  4EQ9 A;  4ELQ A;  2FA7 A;  2A5S A;  4LZ7 A;  4PFI A;  2ZXT A;  2QSX A;  1OMP A;  4OEU A;  1FBP A;  1Z7M E;  2HAV A;  3CI8 A;  3LSF B;  4Q30 B;  4YB6 A;  4PP0 A;  1ZJL A;  4N8Y A;  5TU0 A;  3FUZ A;  2BJI A;  4U2R A;  2XX8 A;  5CMC A;  1FSA A;  3KOS A;  5F7V A;  1OLC A;  2ZYN A;  3Q27 A;  4BDL A;  5AE4 A;  4OWD A;  2QMX A;  3LC8 A;  3WAE A;  3PD8 A;  3CFX A;  4N91 A;  2UVI A;  3TYH A;  2V3T A;  1B1X A;  4ZS9 A;  4NE4 A;  1Z7N E;  2Y5K A;  1MY2 A;  3G7W A;  3MBP A;  2GFE A;  4JBZ A;  1BTJ A;  4DLD A;  3FVO A;  1IMD A;  3A3C A;  4ZE9 A;  5I58 A;  2Z22 A;  3CG3 A;  2CZI A;  4MCO A;  5KDT B;  1IIT A;  1FBD A;  1ZBM A;  4IO7 A;  1B6H A;  1BK4 A;  3PUZ E;  2PT2 A;  2ZZV A;  2AYS A;  4FJP A;  3R6U A;  1M5B A;  4WKM A;  3ILT B;  1VE4 A;  2QS2 A;  4MBP A;  5EQ7 A;  2D5W A;  1USY E;  4PAF A;  5TP9 A;  4F1U A;  5J16 A;  3ZSF A;  3KBZ A;  2QVU A;  4ZEF A;  5CM6 A;  1ELJ A;  1I6A A;  3C33 A;  1PEB A;  1XT8 A;  1YCJ A;  4NHB A;  2Z8E A;  3IO6 A;  1FBH A;  2Z23 A;  3FVK A;  3I5O A;  4N8G A;  1Y4C A;  3BFT A;  2QS4 A;  3OEL A;  3VVF A;  4BDN A;  2OBG A;  4DZ1 A;  3BIG A;  2FHY A;  3C4M A;  3KSJ A;  1QUK A;  4NF8 A;  4AB6 A;  4ESX A;  5KZT A;  2R8T A;  3OXN A;  2Q88 A;  4KR5 A;  3TTK A;  4I1D A;  4LVQ A;  1XVY A;  4OMB A;  1O63 A;  1WVJ A;  4XKN A;  2QVR A;  5EQA A;  2LAO A;  1IXI A;  1USY H;  3KN7 A;  4NF6 B;  3RN8 A;  4IO4 A;  4GXS B;  5AA4 B;  1MY4 A;  4NF5 B;  3SEW A;  4PQJ A;  1CNQ A;  3U72 A;  2WYK A;  4G8H A;  4MF3 A;  4POX A;  2KR0 A;  3O29 A;  2UVG A;  3K6V A;  4I3E A;  3TTN A;  3GXA A;  4PGN A;  4TOZ A;  1LCT A;  3PUW E;  4DXB A;  2F8D A;  4WED A;  3MZB A;  3DP8 A;  1RDX A;  3B6Q A;  3TEL A;  3OO8 A;  2XHD A;  1DMB A;  3B6T A;  4C0R A;  2ZYO A;  3PPP A;  1UIU A;  3FVN A;  4TLM B;  2Q8M A;  4EF1 A;  2DWJ A;  1EZ9 A;  3QUF A;  3MAM A;  1P1U A;  3TDJ A;  4EQB A;  4YMB A;  1L5T A;  3ILU B;  4QFO A;  5JEI A;  1PBQ A;  4YKK A;  5I2K B;  3FXR A;  3PV0 E;  2VD2 A;  5I3S A;  1M5C A;  3L6H A;  2OJT A;  4OYV A;  4Z7E A;  3G3I A;  2H98 A;  1POT A;  1SVX B;  4OVR A;  4OVJ A;  3PMX A;  4U1Z A;  2DWH A;  3EHS A;  1XS5 A;  1NV4 A;  4XXU A;  4ONY A;  1KA1 A;  4ZZA A;  1B3F A;  2WX9 A;  4N13 A;  3T1B A;  3G3J A;  5IZ3 A;  4FE8 A;  3CG1 A;  1LAH E;  3KOT A;  4JVD A;  2W7Y A;  1B7U A;  2O68 A;  3S9L C;  3KFM A;  1TT1 A;  3EN3 A;  3KC1 A;  3O97 A;  4IR8 A;  1VFD A;  2XX7 A;  3LUY A;  5F1Q A;  3S9E A;  1MQD A;  4K3F A;  4OXV A;  1ZU0 A;  3SKP A;  1Y20 A;  3HST A;  1N3X A;  4FED A;  2BJJ X;  1Q35 A;  5EYG A;  4HW8 A;  2OWT A;  3IOT A;  2ZZX A;  1FRP A;  5EQ8 A;  4OVS A;  4TLL B;  2REJ A;  1B3E A;  4LZ8 A;  4PDD A;  2PT1 A;  1FPK A;  4FIM A;  4EXK A;  1PB9 A;  2F7A A;  3FXB A;  1UTH B;  1TFA A;  1LGB C;  4MH5 A;  3T66 A;  4DIG A;  3RTF B;  4P0I A;  1LBV A;  2HZL A;  2WKY A;  1OIB A;  3A3U A;  4PFU A;  1IME A;  3O6H A;  4LAT A;  4X8R A;  1PB8 A;  1DPP A;  4H6D A;  1FQD A;  2H5Y A;  5CMM A;  5KDT A;  1WOD A;  2HFB A;  3E79 A;  2HQ0 A;  3FXQ A;  2FNC A;  1INP A;  2OLB A;  4QFN A;  4YB7 A;  1A8F A;  3UIF A;  2H9B A;  2ANJ A;  1LCF A;  4ND9 A;  3ZS6 A;  4LON B;  2WBB A;  2I0B A;  1HSE A;  1LBB A;  4HXV A;  1MXX A;  2F7C A;  2QRY A;  5DTB A;  1FJ9 A;  4R74 A;  4KYS A;  1OQG A;  4NTL A;  3DLN A;  3SZP A;  1P1N A;  5H8F B;  2NVU B;  4N6K A;  1DBZ A;  5H8N B;  3O2A A;  3MP8 A;  3TAJ A;  4DCY A;  5H8H B;  2UYF A;  4MHF A;  1P1W A;  4IO6 A;  3VXC A;  2RKM A;  4I62 A;  1D9Y A;  4JSD A;  3K1M A;  2RCA A;  4G61 A;  3QIM A;  4R6Y A;  1LAG E;  2ZYK A;  4GFR A;  2FIE A;  5I56 B;  4NF6 A;  4XIG Q;  4N4U A;  5AA4 A;  1AOV A;  2XXP A;  4NF5 A;  4ZEC A;  3C31 A;  3IAZ A;  4E0X A;  1LB8 A;  4NX1 A;  1GGG A;  3R26 A;  4YB5 A;  3GBB A;  2O7I A;  2VOZ A;  2XWK A;  4RK2 A;  3EF7 A;  5AA2 D;  1QKB A;  2HXR A;  1IMA A;  1HSJ A;  4GOT A;  3PMV A;  2DDK A;  3HHF A;  1YYZ A;  4M1V A;  2XXK A;  1KWH A;  2REG A;  4GWY A;  5TPA B;  2HZK A;  1EZP A;  4YKI A;  3D4C A;  1XVX A;  1R6Z A;  4EUO A;  3B50 A;  5EHM A;  2O69 A;  3CFL A;  3KJT A;  2HXW A;  2IEE A;  3PPN A;  5I2K A;  2QVV A;  3LBS A;  2UXA A;  3MP6 A;  3KGC A;  4Z0I A;  1AWB A;  3MUQ A;  5ICT A;  2CZL A;  1NNP A;  1ZTY A;  4HE2 A;  1FTM A;  1PDA A;  3H6T A;  1I69 A;  4ELP A;  2XXQ A;  4U22 A;  3UK4 A;  3UGW A;  1M5E A;  3KSX A;  5L8D A;  1FCK A;  4I40 A;  4OQO A;  2O6A A;  4MNC A;  2OWZ A;  3TQW A;  2UVJ A;  3B6W A;  1MXU A;  3VFJ A;  1NV3 A;  1BIY A;  1DCU A;  3CR9 A;  4G68 B;  4H5F A;  1H3D A;  4OVP A;  2I3V A;  3IR1 A;  1GVC A;  3RPW A;  3S9M C;  4F29 A;  1A40 A;  1A54 A;  1NV6 A;  1MM7 A;  3MC2 A;  1B1H A;  3SER A;  1VR5 A;  2AIX A;  2DS9 A;  2Y84 A;  1LFG A;  4P9K A;  1DK4 A;  3MVX A;  2V25 A;  3Q25 A;  2FBP A;  2F3D A;  5IZ1 A;  4DDD A;  3TUS A;  4LN5 A;  4G8N A;  1UTH A;  4MFI A;  4GX6 A;  3O28 A;  1GV8 A;  4NN3 A;  3MQ9 A;  2B4M A;  1I6Q A;  4JSO A;  3ONM A;  2F35 A;  4R72 A;  2VT5 A;  3RPL B;  4IO2 A;  1LEV A;  3F11 A;  3K6X A;  1BKA A;  2R9J A;  4U1O A;  1LBY A;  2Y5L A;  3IX1 A;  4H8J A;  1JW1 A;  1SYH A;  4Q5T A;  4RPN A;  3O66 A;  4PFR A;  1FQE A;  4ZEI A;  3MW0 A;  3FJ7 A;  2ZNU A;  3FXU A;  3CVG A;  2L5V A;  4LUB A;  5H8F A;  4XEQ A;  1B9J A;  3OEN A;  5H8N A;  4H8I A;  3RUM A;  2O84 X;  4GRK A;  5H8H A;  3TOD A;  1HSL A;  3CRB A;  3D1R A;  4X48 A;  2JJK A;  4GBV A;  4DXU A;  2OK2 A;  3RY3 A;  4DXC A;  1YZ0 A;  5B7D A;  2B3B A;  2ZNT A;  3U1O A;  1MY3 A;  1R1N A;  1UQW A;  3EKI A;  1Y3Q A;  5I56 A;  2ABH A;  4OEN A;  3TZA A;  4GWO A;  3USD A;  4EDP A;  1B0H A;  4N81 A;  2XD3 A;  4XKP A;  4GD5 A;  2I3W A;  4OER A;  4X9T A;  4FBP A;  4PET A;  3C32 A;  1QW0 A;  4OES A;  2M8C A;  3UOR A;  3BFU A;  2Q2C A;  2DWI A;  1IXH A;  4JXI A;  3QYT A;  4IY6 A;  3IJX B;  5IM2 A;  1NH7 A;  1OVT A;  4F22 A;  3H3G A;  1IXG A;  3PPO A;  3N6U A;  2XXI A;  1B0L A;  1SW2 A;  4KYE A;  4OZ9 A;  5F24 A;  5TPA A;  4KCC A;  1GTK A;  2ZMB A;  3RYD A;  1B32 A;  2ONS A;  1SW4 A;  3IK6 B;  4IGT A;  4C1U A;  4G8M A;  4P1L A;  1NH8 A;  1URG A;  2DE3 A;  4GBW A;  3U93 A;  2O7U A;  4PAI A;  1FW0 A;  3N94 A;  1RKM A;  1SBP A;  1B52 A;  3VXB A;  3MVY A;  2PVU A;  1MPB A;  4U23 A;  2ZYM A;  1NUW A;  2PBW A;  5IAI A;  3KEI A;  2X7Q A;  4JWY A;  3V83 A;  1N7X A;  4F31 B;  4BDR A;  4O94 A;  1MQG A;  4XFE A;  1CB6 A;  1K9Z A;  2IA4 A;  3M3K A;  4BLA A;  2XXT A;  4PBH A;  3U94 A;  4P3L A;  1NKX A;  3MJN A;  2GHA A;  2O1L A;  2I58 A;  3FBP A;  3H6V A;  4O3A A;  2Y7K A;  3SEX A;  1NL5 A;  1O64 A;  4JWX A;  4G68 A;  4UAB A;  1TXF A;  2DOJ A;  4GX3 A;  4AB5 A;  1YTV A;  1B51 A;  2VGQ A;  2KLF A;  3PUY E;  1YPN A;  5A5L A;  1FJ6 A;  4GVO A;  4R6K A;  3HV1 A;  4DCX A;  3EPE A;  4TQU Q;  1SI1 A;  3IL1 B;  2I6E A;  4R9G A;  4P47 A;  4G68 C;  1P1Q A;  1FQF A;  2E0S A;  3IOW A;  4NWC A;  1R9Q A;  5FHO A;  3T9X B;  3CSG A;  3LSL A;  3TTL A;  1SQY A;  3UP9 A;  3MPK A;  4DI3 D;  1NV5 A;  4RA1 A;  1ZMG A;  1EYJ A;  3DP4 A;  2RC9 A;  4MX6 A;  3SET A;  4PE5 B;  1NNK A;  1XOC A;  5FTI A;  4O7I A;  1EZO A;  4BDQ A;  1A99 A;  2HHM A;  1NNT A;  1M5D A;  1DOT A;  3RPL A;  2QL3 A;  4QFP A;  4F1Y A;  2NOO A;  3U65 A;  5J1D A;  1AMF A;  4I9D A;  2AL5 A;  3EHT A;  5IKB A;  4LZ5 A;  1SYI A;  3BKI B;  4N6D A;  3VE1 B;  3TQL A;  2DE2 A;  3K0V A;  3FJG A;  1WDN A;  5EYF A;  1IUD A;  1VFE A;  1R9L A;  1O7T A;  4JVI A;  3ECR A;  3EQ1 A;  2RCB A;  2XWO A;  1N76 A;  5JTY B;  4NGU A;  4NF4 B;  3OMB A;  1N0T A;  1EU8 A;  1KZ8 A;  4O3B A;  2V84 A;  2PCR A;  5ITP A;  1LFI A;  3OO6 A;  5I5P A;  1H45 A;  1EH3 A;  4QXD A;  4MMP A;  4WXJ A;  1FTL A;  1N7W A;  2DQV A;  1QJM A;  1FPD A;  4XTC Q;  4P1E A;  5HM4 B;  1VSO A;  2R6G E;  4BDO A;  3OSQ A;  2P2A A;  1SW1 A;  2V3Q A;  2ESN A;  2ZNS A;  3MVW A;  1DSN A;  3T9V A;  4F2O A;  5M2V A;  1MG1 A;  5ESY A;  3RT8 A;  4JWO A;  4MLV A;  3PUX E;  1NMU A;  3MZ9 A;  4GWU A;  2P1S A;  4MEV A;  1JVY A;  4X04 A;  3K1N A;  4HTG A;  1POY 1;  3PU5 A;  1IIW A;  2O1M A;  3KC0 A;  4HE0 A;  3IOU A;  4LA9 A;  1B3G A;  1JP4 A;  4LQ5 A;  3T9H B;  4G4P A;  5L9O A;  2WEF A;  5IZZ A;  2QS1 A;  5LDZ A;  4N6P A;  4PFY A;  1RYO A;  1OVB A;  2B3F A;  2MKZ A;  2YLN A;  1FPJ A;  1IZ1 A;  1LAF E;  1OQH A;  3BIH A;  3QAX A;  3RNN A;  3PD9 A;  1Y3P A;  2ZZW A;  3QK6 A;  3PPR A;  4N07 A;  3E78 A;  1UTB B;  3H6U A;  4KXP A;  1A8E A;  3IB2 A;  1LBC A;  5ICQ A;  4N15 A;  3Q28 A;  2B65 A;  4AS5 A;  4GWX A;  1JQF A;  3JZJ A;  4GXA A;  4HCW A;  1MDP 1;  5CMB A;  3TCG A;  5I2N B;  3PTY A;  1LB9 A;  1B46 A;  4HS7 A;  2P3N A;  1NUZ A;  5CI5 A;  1MY1 A;  1MPC A;  4RK9 A;  3LSX A;  3S9N C;  1B58 A;  4PFB A;  4O8M A;  5DT6 A;  2GHB A;  2G93 A;  1QUL A;  4RNS A;  3V8X B;  3H06 B;  2Q89 A;  3EHU A;  3K01 A;  3E13 X;  3SEV A;  4JVC A;  2CEY A;  3RT6 B;  4GQO A;  3TPA A;  2V4C A;  4NWD A;  4O7M A;  2PMS A;  3FV1 A;  5DVJ A;  4IGR A;  5T3J A;  3TCH A;  1SD3 A;  2V93 A;  1MQI A;  3I3V A;  5AA2 B;  1M5F A;  4WEP A;  4KI0 E;  4LP2 B;  2I48 A;  3PPQ A;  4QRZ A;  4EXL A;  4NF0 A;  5ITO A;  2VD3 A;  1B2H A;  4JB7 A;  1K9Y A;  4OFO A;  3IOR A;  2H25 A;  2F6G A;  2P0S A;  1MS7 A;  2XXU A;  4KHZ E;  3C34 A;  1B3L A;  3IFA A;  1NV1 A;  5LTC A;  3FAT A;  2OCU A;  4R2F A;  1MH3 A;  1DPE A;  4MIJ A;  1N3W A;  1ZIU A;  4ZDM A;  3HHG A;  1FTA A;  2VPO A;  2XD2 A;  4U4X A;  2E1S A;  4Q8R A;  1IMB A;  3A09 A;  4LQ2 A;  4ELO A;  1IMF A;  5JTY A;  1US4 A;  4NF4 A;  1VDW A;  3VDF A;  5KCJ B;  3O6I A;  3O6G A;  4OAN A;  3ZKL A;  3SEU A;  4FAJ A;  1SW5 A;  4IO3 A;  2QMW A;  3IJO B;  4P8B A;  2FYI A;  2QPQ A;  5I84 A;  2XX9 A;  4PC9 A;  3U8Q A;  4QHQ A;  1QUJ A;  4IY5 A;  4H5G A;  1PBP A;  2R71 A;  1QUI A;  4PCD A;  2CMO A;  2PYY A;  1IEJ A;  3E4R A;  5CBS A;  1RDY A;  2V3U A;  3MPL A;  3BBR A;  2NWJ A;  2UVH A;  4YZZ A;  1B5J A;  3JYR A;  2XXH A;  3GLB A;  1MPD A;  3GZG A;  1JW5 A;  3FGS A;  3V5A A;  4GWS A;  3HCQ A;  4GWW A;  2RC7 A;  3RGY A;  1G0I A;  4U4S A;  3ZKK A;  5FTH A;  4OHN A;  2NUV A;  1AIV A;  3FD3 A;  2Z8D A;  4R73 A;  1TFD A;  3RLF E;  4ECF A;  3N26 A;  1LST A;  2A5T B;  2PX1 A;  3TFL A;  5DW8 A;  3K6U A;  4JDF A;  2DP8 A;  4MNI A;  4U21 A;  2X26 A;  4OVQ A;  4ZE8 A;  3L6G A;  3I6V A;  3FAS A;  4QF9 A;  1QVS A;  1B40 A;  3M8U A;  5BWJ A;  4OVT A;  3KZG A;  4GF8 A;  1FPE A;  4NMY A;  2I49 A;  1UTB A;  3D4G A;  1F9B A;  4FEC A;  3AXF A;  1I6B A;  4PFW A;  2QJE A;  1S9T A;  1FPG A;  2GH9 A;  2F6P A;  2THI A;  1II5 A;  3MVZ A;  4I3Y A;  5I2N A;  1UIV A;  1D9Q A;  4OFJ A;  2Y7W A;  1D9V A;  2Y7I A;  2KQZ A;  4E0W A;  1FTJ A;  3E9X A;  2I4B A;  5AA3 A;  1BP5 A;  5L9S A;  3KN3 A;  1D4N A;  3CIJ A;  5EYH A;  3C36 A;  1RDZ A;  5DVF A;  5K2X A;  2OWS A;  5HBC A;  1MQH A;  5I7I A;  4OTE A;  1P1O A;  3Q29 A;  4F3P A;  5I57 B;  4OEV A;  4THI A;  4GL0 A;  1PB7 A;  3S2V A;  3A29 A;  2Q8J A;  1MH4 A;  1Y9U A;  3N5L A;  3ODB A;  2VHA A;  1ATG A;  2XXR A;  2HPG A;  2WBD A;  4ZEB A;  1FQB A;  4YU0 A;  3W9V A;  5AA2 A;  4GIZ A;  4YKJ A;  3K02 A;  1B5I A;  2DXY A;  4H46 A;  1YAE A;  4FEB A;  1MDQ A;  3T0J A;  1MQJ A;  3MZ1 A;  4FAT A;  1NV2 A;  1IQ7 A;  2QFL A;  1TWY A;  1MY0 A;  5B70 A;  3B8B A;  4NQ8 A;  3T93 B;  1LBW A;  4GX4 A;  3MP1 A;  3K6W A;  5DVI A;  1H43 A;  4C1T A;  3THI A;  1AL3 A;  3WAF A;  1B7Z A;  4BDM A;  4KD5 A;  4PE3 A;  5I59 B;  2UYE A;  4X1B A;  4YMA A;  1FQC A;  4H1X A;  4YIC A;  1B4Z A;  4P56 A;  4UAC A;  5KCJ A;  1A7L A;  3OEK A;  4N17 A;  4ESW A;  4ZED A;  5A5X B;  1Q9D A;  2QS3 A;  3LUZ A;  1N84 A;  5BUU A;  4P11 A;  4OET A;  3OOA A;  1FTO A;  1Y1M A;  4QSD A;  4X1D A;  3LSW A;  3G3G A;  1S50 A;  3FIR A;  3RTW B;  1B7H A;  1PC3 A;  1B5H A;  4MNP A;  3OO9 A;  2VP1 A;  4H65 A;  5CRY A;  4GWZ A;  1B4H A;  3FV2 A;  3PUV E;  1FBE A;  3VVE A;  3HFU A;  4NAP A;  3DM0 A;  3P7I A;  1FPF A;  3UA8 A;  3T96 B;  3R7X A;  3TCF A;  3S4U A;  1S7Y A;  3B7D A;  1MXV A;  5ELV A;  4RY1 A;  5IGA A;  1SPI A;  3KBR A;  4NED A;  2DYX A;  2G29 A;  1QKA A;  1URD A;  2F5X A;  2A5T A;  2XWI A;  3PGF A;  3O9P A;  4QFK A;  1KA0 A;  1FPL A;  4P0G A;  3H7M A;  2AL4 A;  3K1P A;  1XC1 A;  4L17 A;  3OO7 A;  5FHN A;  1BLF A;  2DE4 A;  1IMC A;  1JW4 A;  4G2Z A;  3C35 A;  3QXM A;  3PMW A;  1FBF A;  1LBZ A;  5ET5 A;  2DVC A;  4NG7 A;  2HEU A;  2GQ1 A;  1H76 A;  5H8Q B;  1FBC A;  3N6T A;  3K00 A;  2Q74 A;  1YXI A;  3UN6 A;  3JV9 A;  2NXO A;  3MYU A;  5LOM A;  3FVG A;  3G3H A;  4I8C A;  3KN8 A;  3TEP A;  3T22 A;  2F34 A;  2RC8 A;  3M3L A;  2B4L A;  4H67 A;  1Y3N A;  3U92 A;  1FPI A;  1D3K A;  1LAX A;  3FZV A;  2ONK E;  5CBR A;  1MM6 A;  4ELR A;  1XI6 A;  1NUX A;  4YAH X;  4PGP A;  1JEU A;  2XXY A;  2FIX A;  2P3V A;  4OA4 A;  4ZEK A;  3IB1 A;  4R2B A;  4F3G A;  2H4I A;  3W9W A;  3VLV A;  5I57 A;  2HCA A;  3IB0 A;  2Y7R A;  2CEX A;  1ANF A;  2D21 A;  3H6W A;  3IFC A;  2Y7P A;  2XXW A;  5K2Y A;  3DP6 A;  1MXY A;  3C9H A;  1IXC A;  3MST A;  1NV0 A;  4UA8 A;  4MAG A;  4XKQ A;  1B3H A;  2ALU A;  1ZKB A;  2GRV A;  4ISU A;  4F1V A;  3TTM A;  2OZZ A;  1XHY A;  2Q2A A;  4H45 A;  5EHS A;  3IO4 A;  5DEX B;  3VVD A;  2F97 A;  3QMF A;  3CSB A;  4F18 A;  3RQT A;  4XF5 A;  4ZZE A;  4PF8 A;  1H44 A; 
#chains in the Genus database with same CATH homology
 2I4C A;  1Y1Z A;  2I0C A;  1SI0 A;  4KQP A;  4M4G A;  5FHM A;  3FJM A;  5I59 A;  5L9M A;  2F36 A;  2F7B A;  1DTZ A;  2X7P A;  5A5X A;  4R9F A;  5AA1 A;  3QUJ A;  4EQ7 A;  1FQA A;  3T9U A;  1JVX A;  4HCY A;  4QFL A;  3E3K A;  1T0K A;  3TTR A;  2YPN A;  1Y4T A;  5I58 B;  3H03 A;  2HAU A;  4OFL A;  2DXR A;  3OSR A;  4IO5 A;  3G3K A;  4QSC A;  5DYH A;  5TP9 B;  1AH5 A;  2DVZ A;  1A55 A;  2DWA A;  4F39 A;  4RXL A;  3V89 B;  3H4Z A;  3DEL B;  1MRP A;  3SES A;  1MXZ A;  3OEM A;  3G3F A;  3Q26 A;  4DE8 A;  2D3I A;  4NF8 B;  5HPQ A;  4Q0C A;  1MXW A;  3VLU A;  4O3C A;  3VLW A;  4IB2 A;  2RF1 A;  5H8S A;  4RYA A;  4EF2 A;  5H8Q A;  1CE2 A;  4KYD A;  4XKR A;  5ISU A;  4GL8 A;  1B05 A;  1N04 A;  3MWB A;  5JK4 A;  4RJZ A;  4QSE A;  1US5 A;  1OLA A;  3GBA A;  3M3F A;  1RYX A;  2ONR A;  4R6H A;  3HO7 A;  2Z8F A;  1J1N A;  1JEV A;  4POW A;  1DTG A;  4KFQ A;  3TKD A;  4KCD A;  4G77 A;  3HN0 A;  5CMK A;  4RPO A;  2O51 A;  4PFT A;  5CC2 A;  3LR1 A;  1LLS A;  3QSL A;  3VV5 A;  3OD7 A;  4H0W A;  2YJP A;  2XXV A;  2XXX A;  3SDF A;  3HPI A;  1P99 A;  3CFZ A;  4FOR A;  3TMG A;  2Q9T A;  4R75 A;  1FTK A;  2F78 A;  1LFH A;  4MLQ A;  4F3B A;  3W15 C;  4AQ4 A;  3KJ7 A;  1ZLQ A;  4F19 A;  1NNF A;  4F3S A;  4KPT A;  2RIN A;  1Q1K A;  1JET A;  3K4U A;  1NFT A;  1SDX A;  2H99 A;  1JNF A;  3SEY A;  5DEX A;  3KG2 A;  4F2Q A;  1URS A;  4YKP A;  4GLI A;  3K2D A;  2DSF A;  1GR2 A;  3IOV A;  4EQ9 A;  4ELQ A;  2FA7 A;  2A5S A;  4LZ7 A;  2ZXT A;  2QSX A;  1OMP A;  4OEU A;  1Z7M E;  2HAV A;  3LSF B;  3CI8 A;  4Q30 B;  4YB6 A;  4PP0 A;  1ZJL A;  5TU0 A;  3FUZ A;  4U2R A;  2XX8 A;  5CMC A;  3KOS A;  5F7V A;  1OLC A;  2ZYN A;  3Q27 A;  4BDL A;  5AE4 A;  4OWD A;  2QMX A;  3LC8 A;  3WAE A;  3PD8 A;  3CFX A;  2UVI A;  3TYH A;  2V3T A;  1B1X A;  4ZS9 A;  4NE4 A;  1Z7N E;  3G7W A;  1MY2 A;  3MBP A;  2GFE A;  4JBZ A;  1BTJ A;  4DLD A;  3FVO A;  3A3C A;  4ZE9 A;  5I58 A;  2Z22 A;  3CG3 A;  5KDT B;  1IIT A;  1ZBM A;  4IO7 A;  1B6H A;  3PUZ E;  2PT2 A;  2AYS A;  4FJP A;  3R6U A;  1M5B A;  4WKM A;  3ILT B;  1VE4 A;  2QS2 A;  4MBP A;  2D5W A;  1USY E;  5TP9 A;  4F1U A;  3ZSF A;  4ZEF A;  5CM6 A;  1ELJ A;  1I6A A;  3C33 A;  1PEB A;  1XT8 A;  1YCJ A;  2Z8E A;  3IO6 A;  2Z23 A;  3FVK A;  3I5O A;  1Y4C A;  3BFT A;  2QS4 A;  3OEL A;  3VVF A;  4BDN A;  2OBG A;  4DZ1 A;  3C4M A;  3KSJ A;  1QUK A;  4NF8 A;  4AB6 A;  4ESX A;  5KZT A;  3OXN A;  2Q88 A;  4KR5 A;  3TTK A;  4I1D A;  4LVQ A;  1XVY A;  4OMB A;  1O63 A;  1WVJ A;  4XKN A;  2LAO A;  1IXI A;  1USY H;  3KN7 A;  4NF6 B;  3RN8 A;  4IO4 A;  4GXS B;  5AA4 B;  1MY4 A;  4NF5 B;  3SEW A;  4PQJ A;  3U72 A;  4G8H A;  4MF3 A;  4POX A;  3O29 A;  2UVG A;  3K6V A;  3TTN A;  3GXA A;  4TOZ A;  4DXB A;  1LCT A;  3PUW E;  2F8D A;  4WED A;  3MZB A;  3DP8 A;  3B6Q A;  3TEL A;  3OO8 A;  2XHD A;  1DMB A;  3B6T A;  4C0R A;  2ZYO A;  3PPP A;  1UIU A;  3FVN A;  4TLM B;  4EF1 A;  2DWJ A;  1EZ9 A;  3QUF A;  3MAM A;  1P1U A;  3TDJ A;  4EQB A;  4YMB A;  1L5T A;  3ILU B;  4QFO A;  5JEI A;  1PBQ A;  4YKK A;  5I2K B;  3FXR A;  3PV0 E;  2VD2 A;  1M5C A;  3L6H A;  2OJT A;  4OYV A;  4Z7E A;  3G3I A;  2H98 A;  1POT A;  1SVX B;  4OVJ A;  3PMX A;  4U1Z A;  2DWH A;  3EHS A;  1XS5 A;  4XXU A;  4ONY A;  4ZZA A;  1B3F A;  4N13 A;  3G3J A;  4FE8 A;  3CG1 A;  1LAH E;  3KOT A;  2W7Y A;  1B7U A;  2O68 A;  3S9L C;  3KFM A;  1TT1 A;  3EN3 A;  3O97 A;  1VFD A;  2XX7 A;  3LUY A;  5F1Q A;  3S9E A;  1MQD A;  4K3F A;  4OXV A;  1ZU0 A;  3SKP A;  1Y20 A;  3HST A;  1N3X A;  4FED A;  2BJJ X;  1Q35 A;  4HW8 A;  2OWT A;  3IOT A;  4TLL B;  2REJ A;  1B3E A;  4LZ8 A;  2PT1 A;  4FIM A;  4EXK A;  1PB9 A;  2F7A A;  1UTH B;  1TFA A;  1LGB C;  4MH5 A;  3T66 A;  4DIG A;  3RTF B;  4P0I A;  2HZL A;  2WKY A;  1OIB A;  3A3U A;  4PFU A;  3O6H A;  4LAT A;  1PB8 A;  1DPP A;  4H6D A;  1FQD A;  2H5Y A;  5CMM A;  5KDT A;  1WOD A;  2HFB A;  2HQ0 A;  3FXQ A;  2FNC A;  2OLB A;  4QFN A;  4YB7 A;  1A8F A;  3UIF A;  2H9B A;  2ANJ A;  1LCF A;  4ND9 A;  3ZS6 A;  4LON B;  2I0B A;  1HSE A;  1LBB A;  1MXX A;  2F7C A;  2QRY A;  5DTB A;  4R74 A;  4KYS A;  1OQG A;  4NTL A;  3DLN A;  1P1N A;  5H8F B;  2NVU B;  5H8N B;  3O2A A;  3MP8 A;  3TAJ A;  4DCY A;  5H8H B;  2UYF A;  1P1W A;  4IO6 A;  3VXC A;  2RKM A;  4I62 A;  1D9Y A;  4JSD A;  3K1M A;  2RCA A;  3QIM A;  4R6Y A;  1LAG E;  2ZYK A;  4GFR A;  5I56 B;  4NF6 A;  4XIG Q;  5AA4 A;  1AOV A;  2XXP A;  4NF5 A;  4ZEC A;  3C31 A;  3IAZ A;  4E0X A;  1LB8 A;  1GGG A;  3R26 A;  4YB5 A;  3GBB A;  2O7I A;  2VOZ A;  4RK2 A;  3EF7 A;  5AA2 D;  1QKB A;  1HSJ A;  4GOT A;  3PMV A;  3HHF A;  4M1V A;  1KWH A;  2REG A;  5TPA B;  2HZK A;  1EZP A;  4YKI A;  3D4C A;  1XVX A;  1R6Z A;  4EUO A;  5EHM A;  2O69 A;  3CFL A;  3KJT A;  2HXW A;  2IEE A;  3PPN A;  5I2K A;  3LBS A;  2UXA A;  3MP6 A;  3KGC A;  4Z0I A;  3MUQ A;  5ICT A;  2CZL A;  1NNP A;  1ZTY A;  1FTM A;  1PDA A;  3H6T A;  1I69 A;  4ELP A;  2XXQ A;  4U22 A;  3UK4 A;  3UGW A;  1M5E A;  3KSX A;  5L8D A;  1FCK A;  4OQO A;  2O6A A;  3TQW A;  2UVJ A;  3B6W A;  1MXU A;  3VFJ A;  1BIY A;  3CR9 A;  4G68 B;  4H5F A;  1H3D A;  2I3V A;  3IR1 A;  1GVC A;  3RPW A;  3S9M C;  4F29 A;  1A40 A;  1A54 A;  1MM7 A;  3MC2 A;  1B1H A;  3SER A;  1VR5 A;  2AIX A;  2DS9 A;  2Y84 A;  1LFG A;  3MVX A;  2V25 A;  3Q25 A;  4DDD A;  3TUS A;  4G8N A;  1UTH A;  4MFI A;  3O28 A;  1GV8 A;  3MQ9 A;  1I6Q A;  4JSO A;  3ONM A;  2F35 A;  4R72 A;  4IO2 A;  3F11 A;  3K6X A;  1BKA A;  2R9J A;  4U1O A;  3IX1 A;  4H8J A;  1JW1 A;  1SYH A;  4Q5T A;  3O66 A;  4RPN A;  1FQE A;  4ZEI A;  3MW0 A;  3FJ7 A;  2ZNU A;  3FXU A;  3CVG A;  4LUB A;  5H8F A;  1B9J A;  3OEN A;  5H8N A;  4H8I A;  3RUM A;  2O84 X;  4GRK A;  5H8H A;  3TOD A;  1HSL A;  3CRB A;  4X48 A;  4DXU A;  2OK2 A;  3RY3 A;  4DXC A;  5B7D A;  2B3B A;  2ZNT A;  3U1O A;  1MY3 A;  1R1N A;  1UQW A;  1Y3Q A;  5I56 A;  2ABH A;  4OEN A;  3TZA A;  4GWO A;  3USD A;  4EDP A;  1B0H A;  2XD3 A;  4XKP A;  4GD5 A;  2I3W A;  4OER A;  4X9T A;  4PET A;  3C32 A;  1QW0 A;  4OES A;  2M8C A;  3UOR A;  3BFU A;  2Q2C A;  2DWI A;  1IXH A;  4JXI A;  3QYT A;  4IY6 A;  3IJX B;  1NH7 A;  1OVT A;  4F22 A;  3H3G A;  1IXG A;  3PPO A;  3N6U A;  2XXI A;  1B0L A;  1SW2 A;  4KYE A;  4OZ9 A;  5TPA A;  4KCC A;  1GTK A;  2ZMB A;  1B32 A;  2ONS A;  1SW4 A;  3IK6 B;  4IGT A;  4C1U A;  4G8M A;  1NH8 A;  1URG A;  2DE3 A;  3U93 A;  2O7U A;  1FW0 A;  3N94 A;  1RKM A;  1SBP A;  1B52 A;  3VXB A;  3MVY A;  2PVU A;  1MPB A;  4U23 A;  2ZYM A;  2PBW A;  5IAI A;  3KEI A;  2X7Q A;  4JWY A;  3V83 A;  1N7X A;  4F31 B;  4BDR A;  1MQG A;  1CB6 A;  2IA4 A;  3M3K A;  4BLA A;  2XXT A;  3U94 A;  1NKX A;  3MJN A;  2GHA A;  2O1L A;  2I58 A;  3H6V A;  4O3A A;  2Y7K A;  3SEX A;  1NL5 A;  1O64 A;  4JWX A;  4G68 A;  1TXF A;  2DOJ A;  4AB5 A;  1YTV A;  1B51 A;  2VGQ A;  2KLF A;  3PUY E;  1YPN A;  4GVO A;  4R6K A;  3HV1 A;  4DCX A;  3EPE A;  4TQU Q;  1SI1 A;  3IL1 B;  2I6E A;  4R9G A;  4G68 C;  1P1Q A;  1FQF A;  2E0S A;  3IOW A;  4NWC A;  1R9Q A;  5FHO A;  3T9X B;  3CSG A;  3LSL A;  3TTL A;  1SQY A;  3UP9 A;  3MPK A;  4RA1 A;  1ZMG A;  3DP4 A;  2RC9 A;  3SET A;  4PE5 B;  1NNK A;  1XOC A;  5FTI A;  1EZO A;  4BDQ A;  1A99 A;  1NNT A;  1M5D A;  1DOT A;  2QL3 A;  4QFP A;  4F1Y A;  2NOO A;  5J1D A;  1AMF A;  4I9D A;  2AL5 A;  3EHT A;  5IKB A;  4LZ5 A;  1SYI A;  3BKI B;  3VE1 B;  3TQL A;  2DE2 A;  3K0V A;  3FJG A;  1WDN A;  5EYF A;  1IUD A;  1VFE A;  1R9L A;  1O7T A;  3ECR A;  3EQ1 A;  2RCB A;  1N76 A;  5JTY B;  4NF4 B;  3OMB A;  1N0T A;  1EU8 A;  4O3B A;  2V84 A;  5ITP A;  1LFI A;  3OO6 A;  1H45 A;  1EH3 A;  4WXJ A;  1FTL A;  1N7W A;  2DQV A;  1QJM A;  4XTC Q;  5HM4 B;  1VSO A;  2R6G E;  4BDO A;  3OSQ A;  2P2A A;  1SW1 A;  2V3Q A;  2ESN A;  2ZNS A;  3MVW A;  1DSN A;  3T9V A;  4F2O A;  5M2V A;  1MG1 A;  3RT8 A;  4JWO A;  4MLV A;  3PUX E;  1NMU A;  3MZ9 A;  2P1S A;  1JVY A;  3K1N A;  4HTG A;  1POY 1;  3PU5 A;  1IIW A;  2O1M A;  3IOU A;  4LA9 A;  1B3G A;  4LQ5 A;  3T9H B;  4G4P A;  5L9O A;  2QS1 A;  4N6P A;  4PFY A;  1RYO A;  1OVB A;  2B3F A;  2YLN A;  1IZ1 A;  1LAF E;  1OQH A;  3QAX A;  3RNN A;  3PD9 A;  1Y3P A;  3QK6 A;  3PPR A;  4N07 A;  1UTB B;  3H6U A;  1A8E A;  3IB2 A;  1LBC A;  5ICQ A;  3Q28 A;  2B65 A;  1JQF A;  3JZJ A;  4GXA A;  4HCW A;  1MDP 1;  5CMB A;  3TCG A;  5I2N B;  1LB9 A;  1B46 A;  4HS7 A;  5CI5 A;  1MY1 A;  1MPC A;  4RK9 A;  3LSX A;  3S9N C;  1B58 A;  5DT6 A;  2GHB A;  2G93 A;  1QUL A;  4RNS A;  3V8X B;  3H06 B;  2Q89 A;  3EHU A;  3K01 A;  3E13 X;  3SEV A;  3RT6 B;  4GQO A;  3TPA A;  4NWD A;  2PMS A;  3FV1 A;  5DVJ A;  4IGR A;  3TCH A;  1SD3 A;  2V93 A;  1MQI A;  3I3V A;  5AA2 B;  1M5F A;  4WEP A;  4KI0 E;  4LP2 B;  2I48 A;  3PPQ A;  4QRZ A;  4EXL A;  5ITO A;  2VD3 A;  1B2H A;  4JB7 A;  4OFO A;  3IOR A;  2H25 A;  2F6G A;  2P0S A;  1MS7 A;  2XXU A;  4KHZ E;  3C34 A;  1B3L A;  3FAT A;  2OCU A;  4R2F A;  1MH3 A;  1DPE A;  1N3W A;  1ZIU A;  4ZDM A;  3HHG A;  2XD2 A;  4U4X A;  2E1S A;  4Q8R A;  3A09 A;  4LQ2 A;  4ELO A;  5JTY A;  1US4 A;  4NF4 A;  3VDF A;  5KCJ B;  3O6I A;  3O6G A;  3ZKL A;  3SEU A;  4FAJ A;  1SW5 A;  4IO3 A;  2QMW A;  3IJO B;  2FYI A;  2QPQ A;  5I84 A;  2XX9 A;  3U8Q A;  4QHQ A;  1QUJ A;  4IY5 A;  4H5G A;  1PBP A;  2R71 A;  1QUI A;  2CMO A;  2PYY A;  1IEJ A;  3E4R A;  5CBS A;  2V3U A;  3MPL A;  3BBR A;  2NWJ A;  2UVH A;  4YZZ A;  1B5J A;  3JYR A;  2XXH A;  3GLB A;  1MPD A;  3GZG A;  1JW5 A;  3FGS A;  3V5A A;  3HCQ A;  2RC7 A;  3RGY A;  4U4S A;  3ZKK A;  5FTH A;  4OHN A;  2NUV A;  1AIV A;  3FD3 A;  2Z8D A;  4R73 A;  1TFD A;  3RLF E;  4ECF A;  3N26 A;  1LST A;  2A5T B;  2PX1 A;  3TFL A;  3K6U A;  4JDF A;  2DP8 A;  4U21 A;  2X26 A;  4ZE8 A;  3L6G A;  3I6V A;  3FAS A;  4QF9 A;  1QVS A;  1B40 A;  3M8U A;  5BWJ A;  3KZG A;  4GF8 A;  4NMY A;  2I49 A;  1UTB A;  3D4G A;  1F9B A;  4FEC A;  3AXF A;  1I6B A;  4PFW A;  2QJE A;  1S9T A;  2GH9 A;  2F6P A;  2THI A;  1II5 A;  3MVZ A;  5I2N A;  1UIV A;  4OFJ A;  2Y7W A;  1D9V A;  2Y7I A;  4E0W A;  1FTJ A;  3E9X A;  2I4B A;  5AA3 A;  1BP5 A;  5L9S A;  3KN3 A;  1D4N A;  3CIJ A;  3C36 A;  5DVF A;  5K2X A;  2OWS A;  5HBC A;  1MQH A;  4OTE A;  1P1O A;  3Q29 A;  4F3P A;  5I57 B;  4OEV A;  4THI A;  4GL0 A;  1PB7 A;  3S2V A;  2Q8J A;  1MH4 A;  1Y9U A;  3N5L A;  3ODB A;  2VHA A;  1ATG A;  2XXR A;  4ZEB A;  1FQB A;  4YU0 A;  3W9V A;  5AA2 A;  4GIZ A;  4YKJ A;  3K02 A;  1B5I A;  2DXY A;  1YAE A;  4FEB A;  1MDQ A;  1MQJ A;  3MZ1 A;  4FAT A;  1IQ7 A;  1TWY A;  1MY0 A;  5B70 A;  3T93 B;  3MP1 A;  3K6W A;  5DVI A;  1H43 A;  4C1T A;  3THI A;  1AL3 A;  3WAF A;  1B7Z A;  4BDM A;  4KD5 A;  5I59 B;  2UYE A;  4X1B A;  4YMA A;  1FQC A;  4H1X A;  4YIC A;  1B4Z A;  4UAC A;  5KCJ A;  1A7L A;  3OEK A;  4ESW A;  4ZED A;  5A5X B;  2QS3 A;  1N84 A;  5BUU A;  4P11 A;  4OET A;  3OOA A;  1FTO A;  1Y1M A;  4QSD A;  4X1D A;  3LSW A;  3G3G A;  1S50 A;  3FIR A;  3RTW B;  1B7H A;  1PC3 A;  1B5H A;  3OO9 A;  2VP1 A;  4H65 A;  5CRY A;  1B4H A;  3FV2 A;  3PUV E;  3VVE A;  3DM0 A;  3P7I A;  3UA8 A;  3T96 B;  3R7X A;  3TCF A;  3S4U A;  1S7Y A;  3B7D A;  1MXV A;  5ELV A;  4RY1 A;  3KBR A;  4NED A;  2DYX A;  2G29 A;  1QKA A;  1URD A;  2F5X A;  2A5T A;  3PGF A;  3O9P A;  4QFK A;  4P0G A;  3H7M A;  2AL4 A;  3K1P A;  1XC1 A;  4L17 A;  3OO7 A;  5FHN A;  1BLF A;  2DE4 A;  1JW4 A;  4G2Z A;  3C35 A;  3QXM A;  3PMW A;  2DVC A;  2HEU A;  1H76 A;  5H8Q B;  3N6T A;  3K00 A;  3UN6 A;  3JV9 A;  2NXO A;  5LOM A;  3FVG A;  3G3H A;  4I8C A;  3KN8 A;  3TEP A;  3T22 A;  2F34 A;  2RC8 A;  3M3L A;  4H67 A;  1Y3N A;  3U92 A;  1D3K A;  1LAX A;  3FZV A;  2ONK E;  5CBR A;  1MM6 A;  4ELR A;  4YAH X;  1JEU A;  2XXY A;  4ZEK A;  3IB1 A;  4R2B A;  4F3G A;  2H4I A;  3W9W A;  3VLV A;  5I57 A;  2HCA A;  3IB0 A;  2Y7R A;  1ANF A;  2D21 A;  3H6W A;  2Y7P A;  2XXW A;  5K2Y A;  3DP6 A;  1MXY A;  3C9H A;  1IXC A;  4UA8 A;  4XKQ A;  1B3H A;  2ALU A;  1ZKB A;  2GRV A;  4ISU A;  4F1V A;  3TTM A;  2OZZ A;  1XHY A;  2Q2A A;  5EHS A;  3IO4 A;  5DEX B;  3VVD A;  2F97 A;  4F18 A;  3CSB A;  3RQT A;  4ZZE A;  1H44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...