4JXIA

Directed evolution and rational design of a de novo designed esterase toward improved catalysis. northeast structural genomics consortium (nesg) target or184
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
410
structure length
410
Chain Sequence
b'SHMEVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTAMIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLCAGQTLVLIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASIVKSSYYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFLPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHPMTTSPYFLDWQIWSLFLDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMRGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution and rational design of a de novo designed esterase toward improved catalysis. Northeast Structural Genomics Consortium (NESG) Target OR184
rcsb
molecule keywords design cystein esterase
source organism Synthetic construct
molecule tags Structural genomics, unknown function
total genus 135
structure length 410
sequence length 410
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jxiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jxiA02
1RKMA 1POTA 4NF8B 2GHAA 2XX8A 4G8MA 4POWA 3KOTA 4LZ8A 3TODA 3T9XB 4ZEFA 1FQCA 2V3QA 3V89B 2Q2AA 2OCUA 3RNNA 1SW1A 4ELQA 1L5TA 1FCKA 2XXRA 4F1VA 4DCYA 4ZE9A 1R9QA 5JEIA 1LCFA 1B3HA 1FQFA 3B6TA 1H3DA 3GZGA 1MXYA 3VVEA 4ZS9A 1UTBB 2O68A 3OO9A 5EHSA 2XXUA 3TUSA 4MLQA 2A5TB 3MAMA 3QSLA 3K1NA 3PPQA 3TTRA 1MPCA 3TQWA 2FNCA 4IY5A 5ITPA 1UTBA 3K6VA 4F1UA 3PPNA 4POXA 4KYSA 3HSTA 1MXWA 2O51A 4LONB 4P0GA 3O97A 2PYYA 4KI0E 5KDTB 3FVGA 1B32A 3PPPA 3FGSA 3L6GA 5I2NB 4H1XA 4X1BA 1QULA 1EZ9A 3Q29A 5CBRA 1J1NA 5AE4A 4EQ7A 3ODBA 2DXYA 3IL1B 4OFLA 1P1UA 3RTFB 2GHBA 4U1OA 2O7IA 1H76A 3WAEA 3L6HA 3UORA 3RLFE 2F8DA 4U21A 4ZECA 3OSRA 2YLNA 1VSOA 3JV9A 4RXLA 3K02A 3PGFA 5DEXA 1RYXA 5DTBA 4U22A 3PU5A 2IA4A 3VE1B 2Z23A 4NF5A 3B7DA 3CG1A 3MP1A 2Q9TA 5I57A 3OENA 1ZLQA 3TQLA 1SI0A 1FTOA 3Q28A 1XT8A 4IY6A 2V93A 1Y4TA 4Q30B 4BDOA 1D9VA 3KN8A 4Q5TA 3OEKA 3T9HB 1FTMA 4RPNA 3S9NC 4KYEA 1TXFA 4U1ZA 2YJPA 4IGRA 4WXJA 4TLMB 1QKAA 2CZLA 4GOTA 3G3GA 2QSXA 2QS3A 1ELJA 2QMXA 1PC3A 2H99A 2QRYA 3IOVA 4QSDA 3M8UA 3SEYA 1XC1A 3KG2A 3N6TA 1VFEA 1MY4A 4OYVA 3TCFA 1A7LA 3T9VA 4MF3A 5JTYB 1NMUA 3MP8A 5H8HB 2ESNA 3CFXA 4G68B 4KCCA 3UK4A 5HPQA 2F36A 1TFAA 3C34A 4H0WA 3SDFA 1MQDA 3IK6B 3IOUA 3G3HA 3S9MC 1BIYA 3OEMA 1M5DA 2HAVA 4THIA 5TU0A 2I6EA 2OK2A 4X1DA 1MY0A 1GV8A 5ICQA 4PFUA 3W9WA 2QS1A 1I69A 2O84X 2Q2CA 4N6PA 2ABHA 3V83A 3G3FA 1NFTA 4EDPA 5AA4A 5TPAA 1CE2A 4Q0CA 3OOAA 3KJ7A 4G68C 2I48A 3EHTA 1AMFA 4IO5A 4ELOA 1JEVA 1A99A 2WKYA 1M5EA 3UN6A 1NH8A 4LP2B 2R71A 3HPIA 3PUZE 1QUKA 4RK2A 4F3GA 3RGYA 3MPLA 4TOZA 5ELVA 1XOCA 3H6UA 4DXUA 3RY3A 4JDFA 2IEEA 4GVOA 3JZJA 3P7IA 2DWIA 3K2DA 5ISUA 4PFTA 5H8SA 4QHQA 2ZNUA 4LZ7A 2Y7KA 2PT1A 3PMWA 5IAIA 3ILUB 4XKPA 2PVUA 3V5AA 4F3BA 2DYXA 4IO6A 3RT6B 2ZYOA 2I0BA 4OFJA 3K6XA 3O6GA 3I6VA 1US4A 4YKJA 2B3FA 4K3FA 2O6AA 1Y3PA 5KZTA 3K0VA 3ZSFA 2THIA 3F11A 1YCJA 3THIA 2E1SA 4PE5B 3WAFA 2ANJA 2ALUA 4PETA 2PBWA 3H4ZA 4I8CA 4F31B 1NL5A 3MVZA 1HSJA 2Q88A 3RQTA 4P0IA 2H4IA 3SETA 4O3CA 4GQOA 4IGTA 4QFLA 4EQ9A 3KEIA 4PQJA 4N07A 3CFLA 5H8FB 3FD3A 3CR9A 3C33A 5F7VA 1UTHB 2VP1A 2M8CA 4Z0IA 2I58A 2UVJA 3VDFA 4R6YA 3IO6A 5DVIA 1I6BA 3KGCA 4GRKA 3TPAA 3K00A 2DWJA 5I58A 5I59B 1YAEA 1A55A 5H8NA 1P99A 3G3IA 3VLUA 1TFDA 3SEXA 1B0HA 3VFJA 4M4GA 1AOVA 3FXQA 1IEJA 3TTNA 4TQUQ 3T96B 3AXFA 2PX1A 4YICA 2Y7WA 4KPTA 1O7TA 2XX7A 4I9DA 2QS4A 3CSBA 4WEPA 1IXHA 4FORA 1ZIUA 4BLAA 2P0SA 4R2BA 2G93A 3PUXE 1MY3A 4ESXA 4DLDA 1JEUA 2Z8EA 2V25A 3IX1A 4XIGQ 4FATA 1JNFA 4OTEA 3TAJA 2ZYMA 1H45A 3O9PA 1SYHA 3IJXB 2V3UA 4F18A 2XX9A 3MW0A 2UVIA 2RCAA 4EXLA 1A8EA 1ZJLA 4XKRA 1IQ7A 4R73A 1OMPA 3O6HA 3N94A 3A09A 1URSA 3H03A 3MZ1A 3OO7A 3C32A 1JW1A 2V3TA 3IB0A 4C1TA 4NE4A 2DE4A 4R6HA 3PD9A 5TP9A 2XXIA 1LAFE 3UIFA 5L8DA 4ONYA 4PP0A 3ONMA 4ZZAA 1MH3A 1B2HA 3MQ9A 4R9GA 4R6KA 1MRPA 2X7QA 3G3JA 1I6QA 1JETA 2I4BA 3KN7A 2O7UA 4X48A 4DXBA 4KD5A 4OESA 1MQGA 1NNFA 1LSTA 1Q35A 2DSFA 3EN3A 2HZLA 2ZXTA 2OBGA 4RA1A 3ILTB 1VE4A 1FQBA 4KR5A 4R9FA 3VLWA 4NF6A 3HHGA 2O1MA 1R6ZA 3MVXA 2VD2A 3LBSA 2AL4A 3B6WA 4RNSA 4FECA 1UQWA 4G2ZA 4O3AA 3S9LC 2F34A 4OHNA 3H6WA 3EQ1A 1AIVA 1EH3A 3MJNA 4I62A 5AA2A 1M5CA 2E0SA 4F2OA 2ZNTA 1N3XA 3LUYA 1AH5A 1DOTA 3U94A 4Q8RA 4YB7A 2AIXA 3A3CA 3FV2A 4ECFA 4BDRA 5L9OA 1URGA 4AB5A 3BFUA 1OVBA 3Q26A 3FIRA 2I0CA 1IXCA 2NXOA 4R75A 1FW0A 4E0XA 3DP8A 2RKMA 5CI5A 5DEXB 3BBRA 2ONRA 4G8HA 1FQEA 4OMBA 1LB9A 4NF5B 1OLCA 4LZ5A 5I57B 1QUIA 2QJEA 4KYDA 2NWJA 3U8QA 3GLBA 1Z7ME 4ND9A 4YKKA 5K2YA 1LLSA 1USYE 3IORA 2Y7RA 5DT6A 2P2AA 1WODA 1UIUA 4EF1A 1AL3A 1NNTA 4FEDA 5BWJA 3O6IA 1ZBMA 1LGBC 3PMVA 3SKPA 2O69A 1JVYA 2DS9A 1B4ZA 4KFQA 5DVFA 4OXVA 3IO4A 4DDDA 5B7DA 3O28A 4WEDA 3KSJA 3FXUA 4H6DA 1D3KA 1QUJA 2FA7A 1JVXA 3PPOA 1BTJA 1B46A 3TCHA 1XVXA 2OLBA 3D4GA 2HAUA 4QSEA 1SW4A 4QRZA 4R74A 3TTLA 4NWDA 1D9YA 4ZEBA 3MWBA 5DVJA 1IIWA 3OMBA 4IB2A 2QMWA 1Z7NE 4NMYA 3O29A 4YZZA 2HCAA 2REJA 4GXAA 3A3UA 3RPWA 1I6AA 2DP8A 4JSOA 5I56A 4JBZA 3PUWE 4E0WA 3D4CA 1DTZA 5AA4B 2DVZA 4ELPA 4JB7A 4NEDA 1PEBA 5TPAB 3CSGA 1TT1A 1LB8A 3CVGA 2F6GA 5CC2A 4P11A 3B6QA 2XXVA 4NWCA 3R7XA 4H5FA 2HEUA 3S9EA 3C31A 3FVNA 2PMSA 5KCJA 3IR1A 1O63A 1Y20A 4R72A 4WKMA 4FAJA 1M5BA 3FVOA 1MXXA 3KJTA 3H7MA 3M3LA 1B6HA 5AA1A 5CMKA 5FHMA 4QFOA 1B7HA 2KLFA 4KCDA 2DOJA 2DE3A 4OEUA 3S4UA 5FTHA 3O2AA 4JWOA 4NTLA 4EF2A 2OJTA 5I2KA 3HN0A 1LAXA 2YPNA 1JW4A 1B52A 4ZEKA 3CI8A 1B9JA 2RC7A 4OFOA 5EYFA 5HM4B 4XXUA 4YB5A 2XXHA 3PD8A 3TEPA 1B5JA 4BDLA 3FXRA 5LOMA 2F97A 3T9UA 3K6UA 2W7YA 2XD2A 4ESWA 2HXWA 1H43A 1NNKA 2D5WA 5ICTA 4F2QA 1ZKBA 3T93B 4KHZE 3N5LA 1LFHA 2D3IA 2OWTA 4JSDA 1OLAA 3TYHA 1MY1A 3N26A 1MM6A 4G77A 1T0KA 4F3SA 3LR1A 3KSXA 3EHUA 2ZMBA 1PB7A 1DMBA 4F3PA 3PV0E 4IO4A 1PDAA 4U23A 2XXQA 3U93A 5I58B 3IOTA 1NKXA 5CMCA 1SDXA 5H8NB 3IB2A 1USYH 4H5GA 4XTCQ 5K2XA 2I3VA 4I1DA 3VXBA 3DLNA 3QXMA 5H8QB 4GL0A 4F1YA 4HCYA 1WDNA 4H67A 3TFLA 4ZEIA 3PMXA 1JW5A 3LC8A 1KWHA 3K6WA 1MQIA 3DP6A 4RYAA 5H8QA 3K01A 1OIBA 4F39A 3FZVA 2RC8A 1MY2A 1ATGA 3HV1A 2OZZA 4NF4A 1FTJA 2DWAA 3DP4A 4JXIA 1HSLA 4UACA 3HCQA 1B0LA 1ZTYA 3OSQA 2RINA 1S7YA 4QFPA 1B1HA 1RYOA 2H9BA 3FJ7A 4ZZEA 4F22A 2O1LA 1MH4A 1SW2A 4G4PA 1PBQA 3K1PA 1A40A 4RK9A 4U4XA 2X26A 3I3VA 4H8JA 5TP9B 1SD3A 4BDMA 1QKBA 1QW0A 2AL5A 4OETA 4X9TA 1FQAA 1VR5A 2XXWA 1B3FA 2LAOA 3RTWB 2QPQA 5BUUA 1QJMA 1XVYA 5J1DA 2ZNSA 2XHDA 1NNPA 3TELA 2B3BA 2H25A 3T66A 4ISUA 3OD7A 4U2RA 5I84A 4GLIA 4OZ9A 1FTKA 2DVCA 3K4UA 4NF8A 3QAXA 3VXCA 1US5A 4RY1A 2VD3A 4FJPA 1M5FA 3IB1A 1Y9UA 3FJGA 1IXIA 3LSXA 5ITOA 1B3EA 3I5OA 4G8NA 3FASA 5DYHA 5IKBA 2P1SA 1EU8A 4NF6B 3JYRA 2UYFA 1MS7A 1DSNA 3CG3A 2GH9A 2RC9A 3UGWA 4FEBA 4GF8A 2B65A 4ZEDA 2VHAA 4LQ2A 4QSCA 5CRYA 5AA2B 3ZKKA 3HHFA 1Y4CA 1EZOA 3ZS6A 1SI1A 2PT2A 1SBPA 3E3KA 3QYTA 2BJJX 2DE2A 2Q89A 2A5TA 1MG1A 1DTGA 4GFRA 3H6TA 4F19A 3G7WA 4YKIA 4YMAA 4JWYA 2REGA 1B51A 1POY1 2DQVA 3U72A 1B05A 1LAGE 3SESA 3TMGA 1B40A 4YB6A 4C0RA 4DXCA 2VGQA 5KDTA 1OVTA 1R9LA 1BLFA 5JK4A 3QUJA 4LUBA 5FHOA 3TZAA 4BDQA 5I2NA 2F7BA 3TCGA 3MC2A 2CMOA 1A8FA 3KN3A 2XXPA 3VVDA 4MH5A 3FJMA 1LFIA 1P1OA 3OO6A 1Y1MA 2X7PA 3QIMA 2FYIA 2I3WA 1GR2A 5AA2D 3TKDA 1MXZA 1FTLA 4XKQA 1B7UA 3M3KA 4LATA 3CFZA 1N3WA 3H3GA 4RPOA 3VV5A 3R6UA 3EF7A 1B58A 4HS7A 3PUVE 2F35A 2F6PA 3MZ9A 2NOOA 1P1QA 1II5A 4H65A 3TDJA 4LVQA 3FV1A 1MXVA 4GD5A 1GVCA 1LCTA 1XHYA 1ZMGA 1GGGA 3H06B 3PUYE 1N04A 4OWDA 2DWHA 1ZU0A 1SYIA 4KQPA 3MUQA 3ECRA 4OQOA 1MQJA 1MQHA 5F1QA 2Z22A 3IOWA 3MP6A 2VOZA 3HO7A 3UA8A 4MFIA 2Z8DA 1VFDA 1WVJA 3R26A 5I56B 1Y3NA 2H5YA 2Q8JA 3N6UA 3C9HA 4JWXA 5CMBA 3V8XB 3H6VA 2V84A 4GL8A 2QL3A 3M3FA 4C1UA 1MDP1 2UVGA 4IO3A 3S2VA 2F7AA 5FHNA 5JTYA 1MDQA 2R6GE 3LSLA 2G29A 5H8HA 5KCJB 1B4HA 4FIMA 3IAZA 2Y84A 1A54A 4IO7A 4G68A 1B7ZA 1LBCA 1PB9A 4RJZA 5B70A 3BKIB 1IXGA 3E13X 3OELA 3GBAA 1GTKA 1YPNA 4DE8A 3FATA 4Z7EA 4LA9A 4HW8A 4QFNA 2ZYKA 3OXNA 1FQDA 4DCXA 1LAHE 2Y7PA 1MPDA 4TLLB 3C4MA 4M1VA 4N13A 4YAHX 5HBCA 4YKPA 1R1NA 4O3BA 5EHMA 2ONSA 4OENA 1BP5A 3Q27A 4H8IA 3GBBA 1URDA 4R2FA 1YTVA 3W15C 4L17A 2RCBA 2Y7IA 1B5IA 5I2KB 2UVHA 5AA3A 3TTKA 2HQ0A 3KBRA 4U4SA 1Y1ZA 3TTMA 1N0TA 3DM0A 1S9TA 4GWOA 1P1WA 3T22A 3MVWA 4QFKA 1LBBA 2H98A 3E9XA 2NVUB 3VVFA 2OWSA 3RT8A 3KZGA 2Z8FA 3U92A 4ZDMA 4ZE8A 3QUFA 2UXAA 2NUVA 3KOSA 3CRBA 1PB8A 2GRVA 4MLVA 3O66A 1N7XA 1P1NA 1Y3QA 3CIJA 3USDA 4EXKA 1IUDA 3K1MA 2A5SA 1N84A 3E4RA 4OVJA 4AB6A 4PFWA 4OEVA 3Q25A 2AYSA 1N76A 2XXXA 3IJOB 5CBSA 4QF9A 1LFGA 3SEUA 3ZKLA 2GFEA 4AQ4A 1BKAA 1B1XA 3KFMA 1NH7A 1MXUA 1HSEA 3RUMA 1TWYA 2F7CA 1UIVA 3GXAA 1D4NA 2XXTA 4GXSB 4YMBA 2I49A 4BDNA 5CMMA 3MVYA 2XD3A 2XXYA 2HFBA 2D21A 3G3KA 4LQ5A 3UP9A 3EPEA 5H8FA 2ZYNA 5L9SA 5L9MA 4GIZA 4NF4B 1EZPA 3EHSA 4IO2A 1UTHA 1JQFA 1MPBA 3C36A 1H44A 1MM7A 4UA8A 4YU0A 1F9BA 1ANFA 4OERA 1B3LA 3LSFB 2HZKA 2QS2A 3QK6A 1OQHA 3MBPA 5I59A 4FE8A 3C35A 3SEWA 4ELRA 1N7WA 2F5XA 4EQBA 3MPKA 5FTIA 4DZ1A 2ONKE 3DELB 3W9VA 3PPRA 1OQGA 2R9JA 4F29A 1IZ1A 2RF1A 4DIGA 3VLVA 2DXRA 5M2VA 4HTGA 1O64A 4XKNA 1PBPA 3SEVA 3U1OA 3LSWA 5CM6A 1Q1KA 1XS5A 3FVKA 1SW5A 3MZBA 4HCWA 1QVSA 5A5XB 1B3GA 1S50A 3BFTA 1B5HA 3OO8A 4EUOA 2F78A 1DPPA 4MBPA 3SERA 3FUZA 4PFYA 1DPEA 1IITA 3RN8A 1CB6A 1SQYA 1SVXB 2UYEA 5A5XA 2I4CA
chains in the Genus database with same CATH superfamily
1FBPA 1RKMA 1POTA 4NF8B 2GHAA 2XX8A 4G8MA 4POWA 3KOTA 4LZ8A 4O94A 4XEQA 3T9XB 4ZEFA 3TODA 1FQCA 2V3QA 3V89B 2Q2AA 4MEVA 2OCUA 3RNNA 1SW1A 4ELQA 2ZZVA 5ET8A 1L5TA 1FCKA 2XXRA 5I3SA 4F1VA 4DCYA 4ZE9A 4N4UA 1R9QA 5JEIA 2KQZA 1FPLA 1LCFA 4HE1A 5T3JA 1B3HA 1FQFA 3B6TA 1H3DA 3GZGA 1MXYA 3VVEA 4ZS9A 1BK4A 1UTBB 2O68A 3OO9A 2FIXA 5EHSA 1NV7A 2XXUA 3TUSA 4MLQA 2A5TB 3MAMA 3QSLA 1NV2A 1IMDA 1NV0A 3K1NA 3PPQA 3TTRA 1MPCA 3TQWA 2FNCA 4IY5A 4GBVA 5ITPA 1UTBA 3K6VA 4F1UA 3PPNA 4POXA 4KYSA 3HSTA 1MXWA 2O51A 3E79A 4LONB 4P0GA 1EYKA 3O97A 2PYYA 4KI0E 5KDTB 3FVGA 1B32A 3PPPA 3FGSA 2FBPA 3L6GA 5I2NB 4H1XA 4X1BA 1QULA 1EZ9A 3Q29A 5ET7A 5CBRA 1J1NA 5AE4A 4EQ7A 3ODBA 2DXYA 3IL1B 4OFLA 1P1UA 3RTFB 2GHBA 3KBZA 4U1OA 2O7IA 1H76A 5EQ7A 3WAEA 3L6HA 3UORA 3RLFE 2F8DA 3RYDA 4U21A 4ZECA 3OSRA 2YLNA 5ESYA 1VSOA 3JV9A 4RXLA 3K02A 3PGFA 1NI9A 5DEXA 1RYXA 5DTBA 4U22A 3PU5A 2IA4A 3VE1B 1K9YA 2Z23A 2CEYA 4NF5A 3B7DA 3CG1A 3MP1A 2Q9TA 5I57A 3OENA 1ZLQA 3TQLA 1SI0A 4OVPA 1FTOA 3Q28A 1XT8A 4IY6A 2V93A 1Y4TA 5IZZA 4Q30B 4BDOA 1D9VA 3KN8A 1INPA 4Q5TA 3OEKA 3T9HB 1FTMA 4RPNA 4PCDA 3S9NC 4KYEA 4HE2A 1TXFA 4U1ZA 2YJPA 4IGRA 4WXJA 4TLMB 1QKAA 2CZLA 4GOTA 3G3GA 2QSXA 4KXPA 2WBDA 2QS3A 1ELJA 2QMXA 1PC3A 2H99A 2QRYA 4UABA 4NN3A 3IOVA 4QSDA 3M8UA 3SEYA 1XC1A 3KG2A 3N6TA 1VFEA 1MY4A 4OYVA 3TCFA 1A7LA 3T9VA 4N6DA 4MF3A 3EKIA 5JTYB 1NMUA 3MP8A 5H8HB 2ESNA 3CFXA 4G68B 4KCCA 3UK4A 5HPQA 2F36A 1FBGA 1TFAA 1NUXA 3C34A 4H0WA 3SDFA 4PBQA 1MQDA 3IK6B 3IOUA 3G3HA 4X04A 3S9MC 1D9QA 1BIYA 3OEMA 1M5DA 2HAVA 4THIA 1FJ9A 4DI3D 5TU0A 2I6EA 2OK2A 4X1DA 1MY0A 1GV8A 5ICQA 4PFUA 2P3VA 3FBPA 3W9WA 2QS1A 1I69A 2O84X 2Q2CA 4N6PA 2ABHA 3V83A 3G3FA 1NFTA 4EDPA 5AA4A 5TPAA 1CE2A 4Q0CA 3OOAA 3KJ7A 4G68C 4I3EA 1NUWA 2I48A 3EHTA 1AMFA 4PDHA 4IO5A 4ELOA 1JEVA 1A99A 2WKYA 1M5EA 3UN6A 5ET6A 1NH8A 4LP2B 2R71A 3HPIA 1Q9DA 3PUZE 1QUKA 4I40A 4RK2A 4F3GA 3RGYA 3MPLA 4TOZA 5ELVA 1XOCA 3H6UA 4IR8A 1IMEA 4DXUA 3RY3A 4JDFA 4I3YA 2IEEA 4GVOA 3JZJA 3P7IA 1IMBA 2DWIA 3K2DA 5ISUA 4PFTA 5H8SA 4QHQA 2ZNUA 4LZ7A 2Y7KA 3BIGA 2PT1A 3PMWA 5IAIA 3ILUB 4XKPA 2PVUA 4G61A 3V5AA 4F3BA 2DYXA 4IO6A 4P47A 3RT6B 1FBDA 2ZYOA 2I0BA 4OFJA 3K6XA 3O6GA 3I6VA 2XWKA 1US4A 4YKJA 2B3FA 4K3FA 2O6AA 1Y3PA 5KZTA 3K0VA 3SZPA 3ZSFA 2THIA 2CZIA 3F11A 1YCJA 4H46A 3THIA 4MJOA 4MNCA 2E1SA 4PE5B 3WAFA 2ANJA 2ALUA 4PF8A 4PETA 3LUZA 4PGPA 2PBWA 3H4ZA 4I8CA 1FPEA 4F31B 1NL5A 2ZZXA 3MVZA 3T1BA 1FBHA 1HSJA 2Q88A 2FHYA 3RQTA 4P0IA 2H4IA 3SETA 4O3CA 4GQOA 4IGTA 4QFLA 2QVUA 5EQ9A 5LDZA 4EQ9A 3KEIA 4PQJA 4N07A 5F24A 3CFLA 5H8FB 3FD3A 3CR9A 4OVTA 3C33A 4N17A 5F7VA 1UTHB 2VP1A 2M8CA 4Z0IA 2I58A 2UVJA 3VDFA 4R6YA 3IO6A 5DVIA 1I6BA 3KGCA 4GRKA 3TPAA 3K00A 2DWJA 5I58A 3BIHA 4JVCA 5I59B 1YAEA 1A55A 5H8NA 1P99A 3G3IA 3VLUA 1TFDA 3SEXA 1B0HA 4NQ8A 3IFCA 3VFJA 4M4GA 2Q8MA 1AOVA 3FXQA 1IEJA 3TTNA 4TQUQ 5IZ3A 3T96B 3AXFA 2PX1A 4YICA 2Y7WA 4KPTA 1O7TA 2XX7A 4I9DA 4MCOA 2QS4A 4P9KA 3CSBA 4WEPA 1IXHA 4FORA 1ZIUA 4BLAA 2P0SA 4R2BA 2G93A 3PUXE 1MY3A 4ESXA 4DLDA 1JEUA 2Z8EA 2V25A 4N15A 3IX1A 4XIGQ 2L5VA 4FATA 1JNFA 4OTEA 3TAJA 2ZYMA 1H45A 3O9PA 1SYHA 3IJXB 2V3UA 4QBAA 3A29A 4F18A 1FJ6A 2XX9A 3MW0A 2UVIA 2RCAA 4EXLA 1A8EA 1ZJLA 4XKRA 1IQ7A 4R73A 1OMPA 3O6HA 3N94A 3A09A 1URSA 3H03A 3MZ1A 3OO7A 3C32A 1JW1A 2V3TA 3IB0A 4C1TA 4NE4A 2DE4A 2Q74A 4R6HA 3PD9A 5TP9A 2XXIA 2JJKA 1LAFE 4NF0A 1K9ZA 4NGUA 3UIFA 5L8DA 4ONYA 4PP0A 3ONMA 4ZZAA 1MH3A 4LN5A 1B2HA 3MQ9A 4R9GA 4JVDA 4R6KA 1MRPA 2X7QA 3G3JA 1I6QA 4GWXA 2HPGA 4PFBA 1JETA 2I4BA 3KN7A 4P3LA 2O7UA 1G0HA 4X48A 4DXBA 4KD5A 1IMAA 4OESA 1MQGA 1NNFA 1EYJA 3PTYA 1LSTA 1Q35A 2DSFA 2VPOA 3EN3A 2HZLA 2ZXTA 2OBGA 4RA1A 3ILTB 1VE4A 1FQBA 4KR5A 4R9FA 2BJIA 4DI4B 3VLWA 4NF6A 3HHGA 2O1MA 1R6ZA 3MVXA 2VD2A 3LBSA 2AL4A 3B6WA 4RNSA 4FECA 1UQWA 4G2ZA 4O3AA 3S9LC 2F34A 4OHNA 3H6WA 3EQ1A 1AIVA 1EH3A 3MJNA 4I62A 5AA2A 1M5CA 2E0SA 4F2OA 2ZNTA 1FPGA 1N3XA 3LUYA 1AH5A 1DOTA 3U94A 4Q8RA 4YB7A 2AIXA 3A3CA 3FV2A 4ECFA 4BDRA 5L9OA 1URGA 4AB5A 3BFUA 1OVBA 1FPFA 3Q26A 1FBCA 3FIRA 2I0CA 1IXCA 2KR0A 2NXOA 4R75A 1FW0A 2Y5KA 4E0XA 3DP8A 2RKMA 5CI5A 5DEXB 3BBRA 1SPIA 2ONRA 4G8HA 1AWBA 1FQEA 4OMBA 4O7IA 1LB9A 4NF5B 1OLCA 4LZ5A 5I57B 1QUIA 2QJEA 4KYDA 4GWWA 4GWZA 4GX4A 2V4CA 2NWJA 3U8QA 4GWYA 5A5LA 3GLBA 1Z7ME 4ND9A 4YKKA 5K2YA 1LLSA 1USYE 3IORA 2Y7RA 5DT6A 2P2AA 2R8TA 1WODA 2WYPA 1UIUA 4EF1A 1AL3A 4GX6A 1NNTA 4FEDA 5BWJA 3O6IA 1ZBMA 1LGBC 3PMVA 3SKPA 2O69A 1JVYA 5IM2A 3GYYA 2DS9A 1B4ZA 4KFQA 5DVFA 4OXVA 2WYKA 3IO4A 4DDDA 5B7DA 3O28A 1LBXA 3MYUA 4WEDA 3KSJA 1FTAA 3FXUA 1D3KA 4H6DA 4PGNA 1QUJA 2FA7A 2XWVA 1JVXA 3PPOA 1BTJA 1B46A 5ET5A 3TCHA 4GBWA 1XVXA 2OLBA 3D4GA 2XWOA 2HAUA 4QSEA 1SW4A 4QRZA 4R74A 3TTLA 4NWDA 1D9YA 4ZEBA 1KA0A 3MWBA 5DVJA 1IIWA 3OMBA 2QVRA 4IB2A 2QMWA 2XXKA 1Z7NE 4NMYA 1CNQA 3O29A 4YZZA 2HCAA 2REJA 4GXAA 3A3UA 1NV1A 3RPWA 3FXBA 1I6AA 2DP8A 4JSOA 5I56A 4JBZA 3PUWE 2VT5A 4E0WA 3D4CA 1DTZA 5AA4B 2DVZA 4ELPA 4JB7A 4NEDA 1PEBA 5TPAB 3CSGA 1TT1A 1LB8A 1DK4A 3CVGA 2F6GA 5CC2A 4P11A 3B6QA 2XXVA 1VDWA 4GX3A 4N6KA 4NWCA 3R7XA 4H5FA 2HEUA 3S9EA 3C31A 3FVNA 2PMSA 5KCJA 3IR1A 1NV5A 1O63A 1Y20A 4R72A 4WKMA 4FAJA 4PAKA 5I7IA 1M5BA 3FVOA 1MXXA 3KJTA 3H7MA 4JVIA 3M3LA 1B6HA 3D1RA 5AA1A 5CMKA 2B4LA 5FHMA 4QFOA 1LBWA 1B7HA 2KLFA 4KCDA 2DOJA 2QVVA 2DE3A 1FPDA 4OEUA 4PBHA 3S4UA 5FTHA 3O2AA 4OVRA 4JWOA 4NTLA 3KC1A 4EF2A 2OJTA 5I2KA 3HN0A 1LAXA 2YPNA 1JW4A 1B52A 4ZEKA 3CI8A 1B9JA 2RC7A 4OFOA 5EYFA 5HM4B 4XXUA 4N91A 4YB5A 2XXHA 1FSAA 3PD8A 3TEPA 1B5JA 4XFEA 3CHGA 2WX9A 4BDLA 3FXRA 5LOMA 2F97A 3T9UA 3K6UA 2W7YA 2XD2A 4ESWA 2HXWA 2P3NA 1H43A 1NNKA 2D5WA 5ICTA 4F2QA 1ZKBA 3T93B 1IMFA 4KHZE 1KZ8A 3N5LA 1LFHA 2D3IA 2OWTA 4JSDA 1OLAA 3TYHA 1MY1A 3N26A 4OVSA 1MM6A 4G77A 1T0KA 4F3SA 3LR1A 3KSXA 3EHUA 1NV3A 1PB7A 2ZMBA 1DMBA 4F3PA 3PV0E 4IO4A 1PDAA 1FRPA 4U23A 2XXQA 4OVQA 1FPKA 3U93A 5I58B 3IOTA 1NKXA 5CMCA 1SDXA 5H8NB 3IB2A 1USYH 4H5GA 4XTCQ 5K2XA 2I3VA 4I1DA 3VXBA 3DLNA 5DW8A 3QXMA 5H8QB 5IZ3B 4PDDA 4GL0A 4F1YA 4HCYA 2FVZA 4O7MA 1WDNA 4H67A 3TFLA 4MAGA 3LV0A 4ZEIA 3PMXA 4AS4A 1JW5A 3LC8A 1KWHA 3K6WA 1MQIA 3DP6A 4RYAA 4H45A 5H8QA 3K01A 4MIJA 1OIBA 4F39A 3FZVA 2RC8A 1MY2A 1ATGA 3HV1A 2OZZA 4NF4A 1FTJA 4PAFA 2DWAA 3DP4A 4JXIA 1HSLA 4UACA 3HCQA 1B0LA 1ZTYA 3OSQA 4PFIA 2RINA 1S7YA 4QFPA 1B1HA 1RYOA 3FJ7A 2H9BA 1NUYA 4ZZEA 4F22A 2O1LA 1MH4A 1SW2A 4G4PA 1LEVA 2CZKA 1PBQA 3K1PA 1A40A 4RK9A 4U4XA 2X26A 3I3VA 4H8JA 5TP9B 1SD3A 4BDMA 1QKBA 4PE3A 1QW0A 2AL5A 4OETA 4X9TA 4GWSA 1FQAA 1VR5A 2XXWA 1B3FA 4P1EA 2LAOA 3RTWB 2QPQA 5BUUA 1QJMA 1XVYA 5J1DA 2ZNSA 2XHDA 1NNPA 5IZ1A 3TELA 2B3BA 2H25A 4X8RA 3T66A 4ISUA 4QXDA 3OD7A 4XF5A 4U2RA 1IMCA 3RPLA 5I84A 4GLIA 4NHBA 4OZ9A 1FTKA 2DVCA 3K4UA 4NF8A 4AS5A 3QAXA 3VXCA 1US5A 4RY1A 2VD3A 4FBPA 4FJPA 1M5FA 3IB1A 1Y9UA 5LTCA 3FJGA 1IXIA 1NV4A 3LSXA 5ITOA 1B3EA 3I5OA 4G8NA 3FASA 5DYHA 5IKBA 2P1SA 1EU8A 4NF6B 3JYRA 2UYFA 2OWZA 1MS7A 1DSNA 3CG3A 4NAPA 2GH9A 3MSTA 2RC9A 3UGWA 4FEBA 4GF8A 2B65A 4ZEDA 2VHAA 4LQ2A 4QSCA 5CRYA 5AA2B 3ZKKA 3HHFA 1Y4CA 1EZOA 4N8GA 3T0JA 1SI1A 2PT2A 3ZS6A 1SBPA 3E3KA 3QYTA 2BJJX 2DE2A 2Q89A 2A5TA 1MG1A 1DTGA 4GFRA 3H6TA 4F19A 3G7WA 2F3DA 4YKIA 4YMAA 4HXVA 4GWUA 5EQAA 4OANA 4JWYA 2REGA 1B51A 3HFUA 1POY1 2DQVA 3U72A 4MMPA 1B05A 2Y5LA 1LAGE 3SESA 3TMGA 1B40A 4YB6A 4C0RA 4DXCA 2VGQA 5KDTA 1OVTA 1R9LA 1BLFA 5JK4A 3QUJA 4LUBA 5FHOA 3TZAA 4BDQA 5I2NA 2F7BA 4OA4A 3TCGA 4MNPA 3MC2A 2CMOA 1A8FA 3KN3A 2XXPA 3VVDA 4MH5A 3E78A 3FJMA 1LFIA 1P1OA 3OO6A 1Y1MA 2X7PA 3QIMA 2FYIA 2I3WA 1GR2A 4PTKA 5AA2D 1NV6A 3TKDA 2XWIA 1MXZA 1FTLA 4XKQA 1B7UA 3M3KA 4LATA 1LBVA 2WBBA 3CFZA 1N3WA 4PAIA 3H3GA 1FPJA 4RPOA 3VV5A 1G0IA 3R6UA 1NUZA 3EF7A 1B58A 4HS7A 3PUVE 2F35A 2F6PA 3MZ9A 2NOOA 1YYZA 1P1QA 1II5A 4H65A 3TDJA 2HHMA 4LVQA 5J16A 3FV1A 1MXVA 4GD5A 4MHFA 1GVCA 1LCTA 1XHYA 1ZMGA 1GGGA 3H06B 3PUYE 1N04A 1YZ0A 4OWDA 2DWHA 1ZU0A 1SYIA 4KQPA 3MUQA 3ECRA 4OQOA 4MNIA 1MQJA 1MQHA 5F1QA 2Z22A 3IOWA 3MP6A 2VOZA 3HO7A 3UA8A 4MFIA 2Z8DA 1VFDA 1WVJA 3R26A 4PC9A 5I56B 1Y3NA 2H5YA 2Q8JA 3N6UA 3B50A 3C9HA 4JWXA 3B8BA 5CMBA 3V8XB 3H6VA 2V84A 2PFZA 4GL8A 2QL3A 3M3FA 4C1UA 1MDP1 2UVGA 4IO3A 3S2VA 4N8YA 4O8MA 2F7AA 5FHNA 5JTYA 1MDQA 2R6GE 3LSLA 2G29A 5H8HA 5KCJB 1B4HA 1DCUA 4FIMA 3IAZA 2Y84A 1A54A 4IO7A 5IGAA 4G68A 1B7ZA 1LBCA 1PB9A 4RJZA 5B70A 4MX6A 3BKIB 1IXGA 3E13X 3OELA 3GBAA 1GTKA 1YPNA 4DE8A 3FATA 4Z7EA 4LA9A 2XA5A 4HW8A 4QFNA 2ZYKA 3OXNA 1FQDA 4P8BA 4DCXA 1LAHE 2Y7PA 1MPDA 4TLLB 3C4MA 4M1VA 1JP4A 4N13A 1RDYA 4YAHX 5HBCA 4YKPA 2F3BA 1R1NA 4O3BA 5EHMA 2ONSA 4OENA 1BP5A 3Q27A 4H8IA 3GBBA 1XI6A 1URDA 4R2FA 4NX1A 1YTVA 4N81A 3W15C 4L17A 2RCBA 2Y7IA 1B5IA 5I2KB 2UVHA 5AA3A 1RDXA 3TTKA 2HQ0A 3ROJA 2FIEA 3KBRA 2CZHA 4U4SA 1Y1ZA 3TTMA 4PFRA 1N0TA 5EQ8A 3DM0A 1S9TA 4GWOA 5EYGA 1P1WA 3T22A 1FPIA 3MVWA 4QFKA 1LBBA 2H98A 3E9XA 2NVUB 3VVFA 2OWSA 3RT8A 3KZGA 2Z8FA 3U92A 3QUFA 2UXAA 4ZDMA 4ZE8A 1LBYA 3IFAA 2NUVA 3KOSA 3CRBA 1FPBA 1PB8A 2GRVA 4MLVA 3O66A 5EYHA 1N7XA 1P1NA 1Y3QA 2QFLA 3CIJA 3USDA 4P56A 4EXKA 1IUDA 3K1MA 2A5SA 5FBPA 1N84A 2HXRA 3E4RA 4OVJA 4AB6A 4P1LA 4PFWA 4OEVA 4PF6A 3Q25A 2GQ1A 2AYSA 1N76A 2XXXA 1DBZA 3IJOB 5CBSA 4QF9A 1LFGA 3SEUA 3ZKLA 2GFEA 3U65A 4AQ4A 1BKAA 1YXIA 1B1XA 3KFMA 1NH7A 1MXUA 1HSEA 3RUMA 4HE0A 4NG7A 1TWYA 2F7CA 1UIVA 3GXAA 1D4NA 2XXTA 1QGXA 4GXSB 4YMBA 2I49A 4BDNA 5CMMA 3MVYA 2XD3A 2OX3A 2XXYA 2HFBA 2D21A 3G3KA 4LQ5A 3UP9A 3EPEA 1KA1A 1LBZA 5H8FA 2ZYNA 5L9SA 5L9MA 4GIZA 4NF4B 1EZPA 3EHSA 4IO2A 1UTHA 1JQFA 2VPNA 2PCRA 1MPBA 3C36A 1H44A 1MM7A 3KC0A 1RDZA 4UA8A 4YU0A 2PFYA 1F9BA 1ANFA 4OERA 1FBEA 1B3LA 3LSFB 5I5PA 2HZKA 2QS2A 3QK6A 1OQHA 3MBPA 2CEXA 3ISPA 5I59A 1EYIA 2MKZA 4FE8A 3C35A 3SEWA 4ELRA 1N7WA 2F5XA 4EQBA 3MPKA 5FTIA 3QMFA 4DZ1A 2ONKE 3DELB 3W9VA 3PPRA 1OQGA 2R9JA 4F29A 1IZ1A 2RF1A 4DIGA 3VLVA 2DXRA 5M2VA 1FBFA 4HTGA 1O64A 4XKNA 1PBPA 3SEVA 3U1OA 2DDKA 3LSWA 5CM6A 1Q1KA 1XS5A 3FVKA 1SW5A 3MZBA 4HCWA 1QVSA 5A5XB 1B3GA 1S50A 3BFTA 1B5HA 3OO8A 4EUOA 2F78A 2ZZWA 1DPPA 2WEFA 4MBPA 3SERA 3FUZA 4PFYA 1DPEA 1IITA 3RN8A 3RPLB 3NOHA 1CB6A 1SQYA 1SVXB 2B4MA 2UYEA 5A5XA 2I4CA
chains in the Genus database with same CATH topology
1RKMA 1POTA 4NF8B 2GHAA 2XX8A 4G8MA 4POWA 3KOTA 4LZ8A 3TODA 3T9XB 4ZEFA 1FQCA 2V3QA 3V89B 2Q2AA 2OCUA 3RNNA 1SW1A 4ELQA 1L5TA 1FCKA 2XXRA 4F1VA 4DCYA 4ZE9A 1R9QA 5JEIA 1LCFA 1B3HA 1FQFA 3B6TA 1H3DA 3GZGA 1MXYA 3VVEA 4ZS9A 1UTBB 2O68A 3OO9A 5EHSA 2XXUA 3TUSA 4MLQA 2A5TB 3MAMA 3QSLA 3K1NA 3PPQA 3TTRA 1MPCA 3TQWA 2FNCA 4IY5A 5ITPA 1UTBA 3K6VA 4F1UA 3PPNA 4POXA 4KYSA 3HSTA 1MXWA 2O51A 4LONB 4P0GA 3O97A 2PYYA 4KI0E 5KDTB 3FVGA 1B32A 3PPPA 3FGSA 3L6GA 5I2NB 4H1XA 4X1BA 1QULA 1EZ9A 3Q29A 5CBRA 1J1NA 5AE4A 4EQ7A 3ODBA 2DXYA 3IL1B 4OFLA 1P1UA 3RTFB 2GHBA 4U1OA 2O7IA 1H76A 3WAEA 3L6HA 3UORA 3RLFE 2F8DA 4U21A 4ZECA 3OSRA 2YLNA 1VSOA 3JV9A 4RXLA 3K02A 3PGFA 5DEXA 1RYXA 5DTBA 4U22A 3PU5A 2IA4A 3VE1B 2Z23A 4NF5A 3B7DA 3CG1A 3MP1A 2Q9TA 5I57A 3OENA 1ZLQA 3TQLA 1SI0A 1FTOA 3Q28A 1XT8A 4IY6A 2V93A 1Y4TA 4Q30B 4BDOA 1D9VA 3KN8A 4Q5TA 3OEKA 3T9HB 1FTMA 4RPNA 3S9NC 4KYEA 1TXFA 4U1ZA 2YJPA 4IGRA 4WXJA 4TLMB 1QKAA 2CZLA 4GOTA 3G3GA 2QSXA 2QS3A 1ELJA 2QMXA 1PC3A 2H99A 2QRYA 3IOVA 4QSDA 3M8UA 3SEYA 1XC1A 3KG2A 3N6TA 1VFEA 1MY4A 4OYVA 3TCFA 1A7LA 3T9VA 4MF3A 5JTYB 1NMUA 3MP8A 5H8HB 2ESNA 3CFXA 4G68B 4KCCA 3UK4A 5HPQA 2F36A 1TFAA 3C34A 4H0WA 3SDFA 1MQDA 3IK6B 3IOUA 3G3HA 3S9MC 1BIYA 3OEMA 1M5DA 2HAVA 4THIA 5TU0A 2I6EA 2OK2A 4X1DA 1MY0A 1GV8A 5ICQA 4PFUA 3W9WA 2QS1A 1I69A 2O84X 2Q2CA 4N6PA 2ABHA 3V83A 3G3FA 1NFTA 4EDPA 5AA4A 5TPAA 1CE2A 4Q0CA 3OOAA 3KJ7A 4G68C 2I48A 3EHTA 1AMFA 4IO5A 4ELOA 1JEVA 1A99A 2WKYA 1M5EA 3UN6A 1NH8A 4LP2B 2R71A 3HPIA 3PUZE 1QUKA 4RK2A 4F3GA 3RGYA 3MPLA 4TOZA 5ELVA 1XOCA 3H6UA 4DXUA 3RY3A 4JDFA 2IEEA 4GVOA 3JZJA 3P7IA 2DWIA 3K2DA 5ISUA 4PFTA 5H8SA 4QHQA 2ZNUA 4LZ7A 2Y7KA 2PT1A 3PMWA 5IAIA 3ILUB 4XKPA 2PVUA 3V5AA 4F3BA 2DYXA 4IO6A 3RT6B 2ZYOA 2I0BA 4OFJA 3K6XA 3O6GA 3I6VA 1US4A 4YKJA 2B3FA 4K3FA 2O6AA 1Y3PA 5KZTA 3K0VA 3ZSFA 2THIA 3F11A 1YCJA 3THIA 2E1SA 4PE5B 3WAFA 2ANJA 2ALUA 4PETA 2PBWA 3H4ZA 4I8CA 4F31B 1NL5A 3MVZA 1HSJA 2Q88A 3RQTA 4P0IA 2H4IA 3SETA 4O3CA 4GQOA 4IGTA 4QFLA 4EQ9A 3KEIA 4PQJA 4N07A 3CFLA 5H8FB 3FD3A 3CR9A 3C33A 5F7VA 1UTHB 2VP1A 2M8CA 4Z0IA 2I58A 2UVJA 3VDFA 4R6YA 3IO6A 5DVIA 1I6BA 3KGCA 4GRKA 3TPAA 3K00A 2DWJA 5I58A 5I59B 1YAEA 1A55A 5H8NA 1P99A 3G3IA 3VLUA 1TFDA 3SEXA 1B0HA 3VFJA 4M4GA 1AOVA 3FXQA 1IEJA 3TTNA 4TQUQ 3T96B 3AXFA 2PX1A 4YICA 2Y7WA 4KPTA 1O7TA 2XX7A 4I9DA 2QS4A 3CSBA 4WEPA 1IXHA 4FORA 1ZIUA 4BLAA 2P0SA 4R2BA 2G93A 3PUXE 1MY3A 4ESXA 4DLDA 1JEUA 2Z8EA 2V25A 3IX1A 4XIGQ 4FATA 1JNFA 4OTEA 3TAJA 2ZYMA 1H45A 3O9PA 1SYHA 3IJXB 2V3UA 4F18A 2XX9A 3MW0A 2UVIA 2RCAA 4EXLA 1A8EA 1ZJLA 4XKRA 1IQ7A 4R73A 1OMPA 3O6HA 3N94A 3A09A 1URSA 3H03A 3MZ1A 3OO7A 3C32A 1JW1A 2V3TA 3IB0A 4C1TA 4NE4A 2DE4A 4R6HA 3PD9A 5TP9A 2XXIA 1LAFE 3UIFA 5L8DA 4ONYA 4PP0A 3ONMA 4ZZAA 1MH3A 1B2HA 3MQ9A 4R9GA 4R6KA 1MRPA 2X7QA 3G3JA 1I6QA 1JETA 2I4BA 3KN7A 2O7UA 4X48A 4DXBA 4KD5A 4OESA 1MQGA 1NNFA 1LSTA 1Q35A 2DSFA 3EN3A 2HZLA 2ZXTA 2OBGA 4RA1A 3ILTB 1VE4A 1FQBA 4KR5A 4R9FA 3VLWA 4NF6A 3HHGA 2O1MA 1R6ZA 3MVXA 2VD2A 3LBSA 2AL4A 3B6WA 4RNSA 4FECA 1UQWA 4G2ZA 4O3AA 3S9LC 2F34A 4OHNA 3H6WA 3EQ1A 1AIVA 1EH3A 3MJNA 4I62A 5AA2A 1M5CA 2E0SA 4F2OA 2ZNTA 1N3XA 3LUYA 1AH5A 1DOTA 3U94A 4Q8RA 4YB7A 2AIXA 3A3CA 3FV2A 4ECFA 4BDRA 5L9OA 1URGA 4AB5A 3BFUA 1OVBA 3Q26A 3FIRA 2I0CA 1IXCA 2NXOA 4R75A 1FW0A 4E0XA 3DP8A 2RKMA 5CI5A 5DEXB 3BBRA 2ONRA 4G8HA 1FQEA 4OMBA 1LB9A 4NF5B 1OLCA 4LZ5A 5I57B 1QUIA 2QJEA 4KYDA 2NWJA 3U8QA 3GLBA 1Z7ME 4ND9A 4YKKA 5K2YA 1LLSA 1USYE 3IORA 2Y7RA 5DT6A 2P2AA 1WODA 1UIUA 4EF1A 1AL3A 1NNTA 4FEDA 5BWJA 3O6IA 1ZBMA 1LGBC 3PMVA 3SKPA 2O69A 1JVYA 2DS9A 1B4ZA 4KFQA 5DVFA 4OXVA 3IO4A 4DDDA 5B7DA 3O28A 4WEDA 3KSJA 3FXUA 4H6DA 1D3KA 1QUJA 2FA7A 1JVXA 3PPOA 1BTJA 1B46A 3TCHA 1XVXA 2OLBA 3D4GA 2HAUA 4QSEA 1SW4A 4QRZA 4R74A 3TTLA 4NWDA 1D9YA 4ZEBA 3MWBA 5DVJA 1IIWA 3OMBA 4IB2A 2QMWA 1Z7NE 4NMYA 3O29A 4YZZA 2HCAA 2REJA 4GXAA 3A3UA 3RPWA 1I6AA 2DP8A 4JSOA 5I56A 4JBZA 3PUWE 4E0WA 3D4CA 1DTZA 5AA4B 2DVZA 4ELPA 4JB7A 4NEDA 1PEBA 5TPAB 3CSGA 1TT1A 1LB8A 3CVGA 2F6GA 5CC2A 4P11A 3B6QA 2XXVA 4NWCA 3R7XA 4H5FA 2HEUA 3S9EA 3C31A 3FVNA 2PMSA 5KCJA 3IR1A 1O63A 1Y20A 4R72A 4WKMA 4FAJA 1M5BA 3FVOA 1MXXA 3KJTA 3H7MA 3M3LA 1B6HA 5AA1A 5CMKA 5FHMA 4QFOA 1B7HA 2KLFA 4KCDA 2DOJA 2DE3A 4OEUA 3S4UA 5FTHA 3O2AA 4JWOA 4NTLA 4EF2A 2OJTA 5I2KA 3HN0A 1LAXA 2YPNA 1JW4A 1B52A 4ZEKA 3CI8A 1B9JA 2RC7A 4OFOA 5EYFA 5HM4B 4XXUA 4YB5A 2XXHA 3PD8A 3TEPA 1B5JA 4BDLA 3FXRA 5LOMA 2F97A 3T9UA 3K6UA 2W7YA 2XD2A 4ESWA 2HXWA 1H43A 1NNKA 2D5WA 5ICTA 4F2QA 1ZKBA 3T93B 4KHZE 3N5LA 1LFHA 2D3IA 2OWTA 4JSDA 1OLAA 3TYHA 1MY1A 3N26A 1MM6A 4G77A 1T0KA 4F3SA 3LR1A 3KSXA 3EHUA 2ZMBA 1PB7A 1DMBA 4F3PA 3PV0E 4IO4A 1PDAA 4U23A 2XXQA 3U93A 5I58B 3IOTA 1NKXA 5CMCA 1SDXA 5H8NB 3IB2A 1USYH 4H5GA 4XTCQ 5K2XA 2I3VA 4I1DA 3VXBA 3DLNA 3QXMA 5H8QB 4GL0A 4F1YA 4HCYA 1WDNA 4H67A 3TFLA 4ZEIA 3PMXA 1JW5A 3LC8A 1KWHA 3K6WA 1MQIA 3DP6A 4RYAA 5H8QA 3K01A 1OIBA 4F39A 3FZVA 2RC8A 1MY2A 1ATGA 3HV1A 2OZZA 4NF4A 1FTJA 2DWAA 3DP4A 4JXIA 1HSLA 4UACA 3HCQA 1B0LA 1ZTYA 3OSQA 2RINA 1S7YA 4QFPA 1B1HA 1RYOA 2H9BA 3FJ7A 4ZZEA 4F22A 2O1LA 1MH4A 1SW2A 4G4PA 1PBQA 3K1PA 1A40A 4RK9A 4U4XA 2X26A 3I3VA 4H8JA 5TP9B 1SD3A 4BDMA 1QKBA 1QW0A 2AL5A 4OETA 4X9TA 1FQAA 1VR5A 2XXWA 1B3FA 2LAOA 3RTWB 2QPQA 5BUUA 1QJMA 1XVYA 5J1DA 2ZNSA 2XHDA 1NNPA 3TELA 2B3BA 2H25A 3T66A 4ISUA 3OD7A 4U2RA 5I84A 4GLIA 4OZ9A 1FTKA 2DVCA 3K4UA 4NF8A 3QAXA 3VXCA 1US5A 4RY1A 2VD3A 4FJPA 1M5FA 3IB1A 1Y9UA 3FJGA 1IXIA 3LSXA 5ITOA 1B3EA 3I5OA 4G8NA 3FASA 5DYHA 5IKBA 2P1SA 1EU8A 4NF6B 3JYRA 2UYFA 1MS7A 1DSNA 3CG3A 2GH9A 2RC9A 3UGWA 4FEBA 4GF8A 2B65A 4ZEDA 2VHAA 4LQ2A 4QSCA 5CRYA 5AA2B 3ZKKA 3HHFA 1Y4CA 1EZOA 3ZS6A 1SI1A 2PT2A 1SBPA 3E3KA 3QYTA 2BJJX 2DE2A 2Q89A 2A5TA 1MG1A 1DTGA 4GFRA 3H6TA 4F19A 3G7WA 4YKIA 4YMAA 4JWYA 2REGA 1B51A 1POY1 2DQVA 3U72A 1B05A 1LAGE 3SESA 3TMGA 1B40A 4YB6A 4C0RA 4DXCA 2VGQA 5KDTA 1OVTA 1R9LA 1BLFA 5JK4A 3QUJA 4LUBA 5FHOA 3TZAA 4BDQA 5I2NA 2F7BA 3TCGA 3MC2A 2CMOA 1A8FA 3KN3A 2XXPA 3VVDA 4MH5A 3FJMA 1LFIA 1P1OA 3OO6A 1Y1MA 2X7PA 3QIMA 2FYIA 2I3WA 1GR2A 5AA2D 3TKDA 1MXZA 1FTLA 4XKQA 1B7UA 3M3KA 4LATA 3CFZA 1N3WA 3H3GA 4RPOA 3VV5A 3R6UA 3EF7A 1B58A 4HS7A 3PUVE 2F35A 2F6PA 3MZ9A 2NOOA 1P1QA 1II5A 4H65A 3TDJA 4LVQA 3FV1A 1MXVA 4GD5A 1GVCA 1LCTA 1XHYA 1ZMGA 1GGGA 3H06B 3PUYE 1N04A 4OWDA 2DWHA 1ZU0A 1SYIA 4KQPA 3MUQA 3ECRA 4OQOA 1MQJA 1MQHA 5F1QA 2Z22A 3IOWA 3MP6A 2VOZA 3HO7A 3UA8A 4MFIA 2Z8DA 1VFDA 1WVJA 3R26A 5I56B 1Y3NA 2H5YA 2Q8JA 3N6UA 3C9HA 4JWXA 5CMBA 3V8XB 3H6VA 2V84A 4GL8A 2QL3A 3M3FA 4C1UA 1MDP1 2UVGA 4IO3A 3S2VA 2F7AA 5FHNA 5JTYA 1MDQA 2R6GE 3LSLA 2G29A 5H8HA 5KCJB 1B4HA 4FIMA 3IAZA 2Y84A 1A54A 4IO7A 4G68A 1B7ZA 1LBCA 1PB9A 4RJZA 5B70A 3BKIB 1IXGA 3E13X 3OELA 3GBAA 1GTKA 1YPNA 4DE8A 3FATA 4Z7EA 4LA9A 4HW8A 4QFNA 2ZYKA 3OXNA 1FQDA 4DCXA 1LAHE 2Y7PA 1MPDA 4TLLB 3C4MA 4M1VA 4N13A 4YAHX 5HBCA 4YKPA 1R1NA 4O3BA 5EHMA 2ONSA 4OENA 1BP5A 3Q27A 4H8IA 3GBBA 1URDA 4R2FA 1YTVA 3W15C 4L17A 2RCBA 2Y7IA 1B5IA 5I2KB 2UVHA 5AA3A 3TTKA 2HQ0A 3KBRA 4U4SA 1Y1ZA 3TTMA 1N0TA 3DM0A 1S9TA 4GWOA 1P1WA 3T22A 3MVWA 4QFKA 1LBBA 2H98A 3E9XA 2NVUB 3VVFA 2OWSA 3RT8A 3KZGA 2Z8FA 3U92A 4ZDMA 4ZE8A 3QUFA 2UXAA 2NUVA 3KOSA 3CRBA 1PB8A 2GRVA 4MLVA 3O66A 1N7XA 1P1NA 1Y3QA 3CIJA 3USDA 4EXKA 1IUDA 3K1MA 2A5SA 1N84A 3E4RA 4OVJA 4AB6A 4PFWA 4OEVA 3Q25A 2AYSA 1N76A 2XXXA 3IJOB 5CBSA 4QF9A 1LFGA 3SEUA 3ZKLA 2GFEA 4AQ4A 1BKAA 1B1XA 3KFMA 1NH7A 1MXUA 1HSEA 3RUMA 1TWYA 2F7CA 1UIVA 3GXAA 1D4NA 2XXTA 4GXSB 4YMBA 2I49A 4BDNA 5CMMA 3MVYA 2XD3A 2XXYA 2HFBA 2D21A 3G3KA 4LQ5A 3UP9A 3EPEA 5H8FA 2ZYNA 5L9SA 5L9MA 4GIZA 4NF4B 1EZPA 3EHSA 4IO2A 1UTHA 1JQFA 1MPBA 3C36A 1H44A 1MM7A 4UA8A 4YU0A 1F9BA 1ANFA 4OERA 1B3LA 3LSFB 2HZKA 2QS2A 3QK6A 1OQHA 3MBPA 5I59A 4FE8A 3C35A 3SEWA 4ELRA 1N7WA 2F5XA 4EQBA 3MPKA 5FTIA 4DZ1A 2ONKE 3DELB 3W9VA 3PPRA 1OQGA 2R9JA 4F29A 1IZ1A 2RF1A 4DIGA 3VLVA 2DXRA 5M2VA 4HTGA 1O64A 4XKNA 1PBPA 3SEVA 3U1OA 3LSWA 5CM6A 1Q1KA 1XS5A 3FVKA 1SW5A 3MZBA 4HCWA 1QVSA 5A5XB 1B3GA 1S50A 3BFTA 1B5HA 3OO8A 4EUOA 2F78A 1DPPA 4MBPA 3SERA 3FUZA 4PFYA 1DPEA 1IITA 3RN8A 1CB6A 1SQYA 1SVXB 2UYEA 5A5XA 2I4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKM A;  1POT A;  4NF8 B;  2GHA A;  2XX8 A;  4G8M A;  4POW A;  3KOT A;  4LZ8 A;  3TOD A;  3T9X B;  4ZEF A;  1FQC A;  2V3Q A;  3V89 B;  2Q2A A;  2OCU A;  3RNN A;  1SW1 A;  4ELQ A;  1L5T A;  1FCK A;  2XXR A;  4F1V A;  4DCY A;  4ZE9 A;  1R9Q A;  5JEI A;  1LCF A;  1B3H A;  1FQF A;  3B6T A;  1H3D A;  3GZG A;  1MXY A;  3VVE A;  4ZS9 A;  1UTB B;  2O68 A;  3OO9 A;  5EHS A;  2XXU A;  3TUS A;  4MLQ A;  2A5T B;  3MAM A;  3QSL A;  3K1N A;  3PPQ A;  3TTR A;  1MPC A;  3TQW A;  2FNC A;  4IY5 A;  5ITP A;  1UTB A;  3K6V A;  4F1U A;  3PPN A;  4POX A;  4KYS A;  3HST A;  1MXW A;  2O51 A;  4LON B;  4P0G A;  3O97 A;  2PYY A;  4KI0 E;  5KDT B;  3FVG A;  1B32 A;  3PPP A;  3FGS A;  3L6G A;  5I2N B;  4H1X A;  4X1B A;  1QUL A;  1EZ9 A;  3Q29 A;  5CBR A;  1J1N A;  5AE4 A;  4EQ7 A;  3ODB A;  2DXY A;  3IL1 B;  4OFL A;  1P1U A;  3RTF B;  2GHB A;  4U1O A;  2O7I A;  1H76 A;  3WAE A;  3L6H A;  3UOR A;  3RLF E;  2F8D A;  4U21 A;  4ZEC A;  3OSR A;  2YLN A;  1VSO A;  3JV9 A;  4RXL A;  3K02 A;  3PGF A;  5DEX A;  1RYX A;  5DTB A;  4U22 A;  3PU5 A;  2IA4 A;  3VE1 B;  2Z23 A;  4NF5 A;  3B7D A;  3CG1 A;  3MP1 A;  2Q9T A;  5I57 A;  3OEN A;  1ZLQ A;  3TQL A;  1SI0 A;  1FTO A;  3Q28 A;  1XT8 A;  4IY6 A;  2V93 A;  1Y4T A;  4Q30 B;  4BDO A;  1D9V A;  3KN8 A;  4Q5T A;  3OEK A;  3T9H B;  1FTM A;  4RPN A;  3S9N C;  4KYE A;  1TXF A;  4U1Z A;  2YJP A;  4IGR A;  4WXJ A;  4TLM B;  1QKA A;  2CZL A;  4GOT A;  3G3G A;  2QSX A;  2QS3 A;  1ELJ A;  2QMX A;  1PC3 A;  2H99 A;  2QRY A;  3IOV A;  4QSD A;  3M8U A;  3SEY A;  1XC1 A;  3KG2 A;  3N6T A;  1VFE A;  1MY4 A;  4OYV A;  3TCF A;  1A7L A;  3T9V A;  4MF3 A;  5JTY B;  1NMU A;  3MP8 A;  5H8H B;  2ESN A;  3CFX A;  4G68 B;  4KCC A;  3UK4 A;  5HPQ A;  2F36 A;  1TFA A;  3C34 A;  4H0W A;  3SDF A;  1MQD A;  3IK6 B;  3IOU A;  3G3H A;  3S9M C;  1BIY A;  3OEM A;  1M5D A;  2HAV A;  4THI A;  5TU0 A;  2I6E A;  2OK2 A;  4X1D A;  1MY0 A;  1GV8 A;  5ICQ A;  4PFU A;  3W9W A;  2QS1 A;  1I69 A;  2O84 X;  2Q2C A;  4N6P A;  2ABH A;  3V83 A;  3G3F A;  1NFT A;  4EDP A;  5AA4 A;  5TPA A;  1CE2 A;  4Q0C A;  3OOA A;  3KJ7 A;  4G68 C;  2I48 A;  3EHT A;  1AMF A;  4IO5 A;  4ELO A;  1JEV A;  1A99 A;  2WKY A;  1M5E A;  3UN6 A;  1NH8 A;  4LP2 B;  2R71 A;  3HPI A;  3PUZ E;  1QUK A;  4RK2 A;  4F3G A;  3RGY A;  3MPL A;  4TOZ A;  5ELV A;  1XOC A;  3H6U A;  4DXU A;  3RY3 A;  4JDF A;  2IEE A;  4GVO A;  3JZJ A;  3P7I A;  2DWI A;  3K2D A;  5ISU A;  4PFT A;  5H8S A;  4QHQ A;  2ZNU A;  4LZ7 A;  2Y7K A;  2PT1 A;  3PMW A;  5IAI A;  3ILU B;  4XKP A;  2PVU A;  3V5A A;  4F3B A;  2DYX A;  4IO6 A;  3RT6 B;  2ZYO A;  2I0B A;  4OFJ A;  3K6X A;  3O6G A;  3I6V A;  1US4 A;  4YKJ A;  2B3F A;  4K3F A;  2O6A A;  1Y3P A;  5KZT A;  3K0V A;  3ZSF A;  2THI A;  3F11 A;  1YCJ A;  3THI A;  2E1S A;  4PE5 B;  3WAF A;  2ANJ A;  2ALU A;  4PET A;  2PBW A;  3H4Z A;  4I8C A;  4F31 B;  1NL5 A;  3MVZ A;  1HSJ A;  2Q88 A;  3RQT A;  4P0I A;  2H4I A;  3SET A;  4O3C A;  4GQO A;  4IGT A;  4QFL A;  4EQ9 A;  3KEI A;  4PQJ A;  4N07 A;  3CFL A;  5H8F B;  3FD3 A;  3CR9 A;  3C33 A;  5F7V A;  1UTH B;  2VP1 A;  2M8C A;  4Z0I A;  2I58 A;  2UVJ A;  3VDF A;  4R6Y A;  3IO6 A;  5DVI A;  1I6B A;  3KGC A;  4GRK A;  3TPA A;  3K00 A;  2DWJ A;  5I58 A;  5I59 B;  1YAE A;  1A55 A;  5H8N A;  1P99 A;  3G3I A;  3VLU A;  1TFD A;  3SEX A;  1B0H A;  3VFJ A;  4M4G A;  1AOV A;  3FXQ A;  1IEJ A;  3TTN A;  4TQU Q;  3T96 B;  3AXF A;  2PX1 A;  4YIC A;  2Y7W A;  4KPT A;  1O7T A;  2XX7 A;  4I9D A;  2QS4 A;  3CSB A;  4WEP A;  1IXH A;  4FOR A;  1ZIU A;  4BLA A;  2P0S A;  4R2B A;  2G93 A;  3PUX E;  1MY3 A;  4ESX A;  4DLD A;  1JEU A;  2Z8E A;  2V25 A;  3IX1 A;  4XIG Q;  4FAT A;  1JNF A;  4OTE A;  3TAJ A;  2ZYM A;  1H45 A;  3O9P A;  1SYH A;  3IJX B;  2V3U A;  4F18 A;  2XX9 A;  3MW0 A;  2UVI A;  2RCA A;  4EXL A;  1A8E A;  1ZJL A;  4XKR A;  1IQ7 A;  4R73 A;  1OMP A;  3O6H A;  3N94 A;  3A09 A;  1URS A;  3H03 A;  3MZ1 A;  3OO7 A;  3C32 A;  1JW1 A;  2V3T A;  3IB0 A;  4C1T A;  4NE4 A;  2DE4 A;  4R6H A;  3PD9 A;  5TP9 A;  2XXI A;  1LAF E;  3UIF A;  5L8D A;  4ONY A;  4PP0 A;  3ONM A;  4ZZA A;  1MH3 A;  1B2H A;  3MQ9 A;  4R9G A;  4R6K A;  1MRP A;  2X7Q A;  3G3J A;  1I6Q A;  1JET A;  2I4B A;  3KN7 A;  2O7U A;  4X48 A;  4DXB A;  4KD5 A;  4OES A;  1MQG A;  1NNF A;  1LST A;  1Q35 A;  2DSF A;  3EN3 A;  2HZL A;  2ZXT A;  2OBG A;  4RA1 A;  3ILT B;  1VE4 A;  1FQB A;  4KR5 A;  4R9F A;  3VLW A;  4NF6 A;  3HHG A;  2O1M A;  1R6Z A;  3MVX A;  2VD2 A;  3LBS A;  2AL4 A;  3B6W A;  4RNS A;  4FEC A;  1UQW A;  4G2Z A;  4O3A A;  3S9L C;  2F34 A;  4OHN A;  3H6W A;  3EQ1 A;  1AIV A;  1EH3 A;  3MJN A;  4I62 A;  5AA2 A;  1M5C A;  2E0S A;  4F2O A;  2ZNT A;  1N3X A;  3LUY A;  1AH5 A;  1DOT A;  3U94 A;  4Q8R A;  4YB7 A;  2AIX A;  3A3C A;  3FV2 A;  4ECF A;  4BDR A;  5L9O A;  1URG A;  4AB5 A;  3BFU A;  1OVB A;  3Q26 A;  3FIR A;  2I0C A;  1IXC A;  2NXO A;  4R75 A;  1FW0 A;  4E0X A;  3DP8 A;  2RKM A;  5CI5 A;  5DEX B;  3BBR A;  2ONR A;  4G8H A;  1FQE A;  4OMB A;  1LB9 A;  4NF5 B;  1OLC A;  4LZ5 A;  5I57 B;  1QUI A;  2QJE A;  4KYD A;  2NWJ A;  3U8Q A;  3GLB A;  1Z7M E;  4ND9 A;  4YKK A;  5K2Y A;  1LLS A;  1USY E;  3IOR A;  2Y7R A;  5DT6 A;  2P2A A;  1WOD A;  1UIU A;  4EF1 A;  1AL3 A;  1NNT A;  4FED A;  5BWJ A;  3O6I A;  1ZBM A;  1LGB C;  3PMV A;  3SKP A;  2O69 A;  1JVY A;  2DS9 A;  1B4Z A;  4KFQ A;  5DVF A;  4OXV A;  3IO4 A;  4DDD A;  5B7D A;  3O28 A;  4WED A;  3KSJ A;  3FXU A;  4H6D A;  1D3K A;  1QUJ A;  2FA7 A;  1JVX A;  3PPO A;  1BTJ A;  1B46 A;  3TCH A;  1XVX A;  2OLB A;  3D4G A;  2HAU A;  4QSE A;  1SW4 A;  4QRZ A;  4R74 A;  3TTL A;  4NWD A;  1D9Y A;  4ZEB A;  3MWB A;  5DVJ A;  1IIW A;  3OMB A;  4IB2 A;  2QMW A;  1Z7N E;  4NMY A;  3O29 A;  4YZZ A;  2HCA A;  2REJ A;  4GXA A;  3A3U A;  3RPW A;  1I6A A;  2DP8 A;  4JSO A;  5I56 A;  4JBZ A;  3PUW E;  4E0W A;  3D4C A;  1DTZ A;  5AA4 B;  2DVZ A;  4ELP A;  4JB7 A;  4NED A;  1PEB A;  5TPA B;  3CSG A;  1TT1 A;  1LB8 A;  3CVG A;  2F6G A;  5CC2 A;  4P11 A;  3B6Q A;  2XXV A;  4NWC A;  3R7X A;  4H5F A;  2HEU A;  3S9E A;  3C31 A;  3FVN A;  2PMS A;  5KCJ A;  3IR1 A;  1O63 A;  1Y20 A;  4R72 A;  4WKM A;  4FAJ A;  1M5B A;  3FVO A;  1MXX A;  3KJT A;  3H7M A;  3M3L A;  1B6H A;  5AA1 A;  5CMK A;  5FHM A;  4QFO A;  1B7H A;  2KLF A;  4KCD A;  2DOJ A;  2DE3 A;  4OEU A;  3S4U A;  5FTH A;  3O2A A;  4JWO A;  4NTL A;  4EF2 A;  2OJT A;  5I2K A;  3HN0 A;  1LAX A;  2YPN A;  1JW4 A;  1B52 A;  4ZEK A;  3CI8 A;  1B9J A;  2RC7 A;  4OFO A;  5EYF A;  5HM4 B;  4XXU A;  4YB5 A;  2XXH A;  3PD8 A;  3TEP A;  1B5J A;  4BDL A;  3FXR A;  5LOM A;  2F97 A;  3T9U A;  3K6U A;  2W7Y A;  2XD2 A;  4ESW A;  2HXW A;  1H43 A;  1NNK A;  2D5W A;  5ICT A;  4F2Q A;  1ZKB A;  3T93 B;  4KHZ E;  3N5L A;  1LFH A;  2D3I A;  2OWT A;  4JSD A;  1OLA A;  3TYH A;  1MY1 A;  3N26 A;  1MM6 A;  4G77 A;  1T0K A;  4F3S A;  3LR1 A;  3KSX A;  3EHU A;  2ZMB A;  1PB7 A;  1DMB A;  4F3P A;  3PV0 E;  4IO4 A;  1PDA A;  4U23 A;  2XXQ A;  3U93 A;  5I58 B;  3IOT A;  1NKX A;  5CMC A;  1SDX A;  5H8N B;  3IB2 A;  1USY H;  4H5G A;  4XTC Q;  5K2X A;  2I3V A;  4I1D A;  3VXB A;  3DLN A;  3QXM A;  5H8Q B;  4GL0 A;  4F1Y A;  4HCY A;  1WDN A;  4H67 A;  3TFL A;  4ZEI A;  3PMX A;  1JW5 A;  3LC8 A;  1KWH A;  3K6W A;  1MQI A;  3DP6 A;  4RYA A;  5H8Q A;  3K01 A;  1OIB A;  4F39 A;  3FZV A;  2RC8 A;  1MY2 A;  1ATG A;  3HV1 A;  2OZZ A;  4NF4 A;  1FTJ A;  2DWA A;  3DP4 A;  4JXI A;  1HSL A;  4UAC A;  3HCQ A;  1B0L A;  1ZTY A;  3OSQ A;  2RIN A;  1S7Y A;  4QFP A;  1B1H A;  1RYO A;  2H9B A;  3FJ7 A;  4ZZE A;  4F22 A;  2O1L A;  1MH4 A;  1SW2 A;  4G4P A;  1PBQ A;  3K1P A;  1A40 A;  4RK9 A;  4U4X A;  2X26 A;  3I3V A;  4H8J A;  5TP9 B;  1SD3 A;  4BDM A;  1QKB A;  1QW0 A;  2AL5 A;  4OET A;  4X9T A;  1FQA A;  1VR5 A;  2XXW A;  1B3F A;  2LAO A;  3RTW B;  2QPQ A;  5BUU A;  1QJM A;  1XVY A;  5J1D A;  2ZNS A;  2XHD A;  1NNP A;  3TEL A;  2B3B A;  2H25 A;  3T66 A;  4ISU A;  3OD7 A;  4U2R A;  5I84 A;  4GLI A;  4OZ9 A;  1FTK A;  2DVC A;  3K4U A;  4NF8 A;  3QAX A;  3VXC A;  1US5 A;  4RY1 A;  2VD3 A;  4FJP A;  1M5F A;  3IB1 A;  1Y9U A;  3FJG A;  1IXI A;  3LSX A;  5ITO A;  1B3E A;  3I5O A;  4G8N A;  3FAS A;  5DYH A;  5IKB A;  2P1S A;  1EU8 A;  4NF6 B;  3JYR A;  2UYF A;  1MS7 A;  1DSN A;  3CG3 A;  2GH9 A;  2RC9 A;  3UGW A;  4FEB A;  4GF8 A;  2B65 A;  4ZED A;  2VHA A;  4LQ2 A;  4QSC A;  5CRY A;  5AA2 B;  3ZKK A;  3HHF A;  1Y4C A;  1EZO A;  3ZS6 A;  1SI1 A;  2PT2 A;  1SBP A;  3E3K A;  3QYT A;  2BJJ X;  2DE2 A;  2Q89 A;  2A5T A;  1MG1 A;  1DTG A;  4GFR A;  3H6T A;  4F19 A;  3G7W A;  4YKI A;  4YMA A;  4JWY A;  2REG A;  1B51 A;  1POY 1;  2DQV A;  3U72 A;  1B05 A;  1LAG E;  3SES A;  3TMG A;  1B40 A;  4YB6 A;  4C0R A;  4DXC A;  2VGQ A;  5KDT A;  1OVT A;  1R9L A;  1BLF A;  5JK4 A;  3QUJ A;  4LUB A;  5FHO A;  3TZA A;  4BDQ A;  5I2N A;  2F7B A;  3TCG A;  3MC2 A;  2CMO A;  1A8F A;  3KN3 A;  2XXP A;  3VVD A;  4MH5 A;  3FJM A;  1LFI A;  1P1O A;  3OO6 A;  1Y1M A;  2X7P A;  3QIM A;  2FYI A;  2I3W A;  1GR2 A;  5AA2 D;  3TKD A;  1MXZ A;  1FTL A;  4XKQ A;  1B7U A;  3M3K A;  4LAT A;  3CFZ A;  1N3W A;  3H3G A;  4RPO A;  3VV5 A;  3R6U A;  3EF7 A;  1B58 A;  4HS7 A;  3PUV E;  2F35 A;  2F6P A;  3MZ9 A;  2NOO A;  1P1Q A;  1II5 A;  4H65 A;  3TDJ A;  4LVQ A;  3FV1 A;  1MXV A;  4GD5 A;  1GVC A;  1LCT A;  1XHY A;  1ZMG A;  1GGG A;  3H06 B;  3PUY E;  1N04 A;  4OWD A;  2DWH A;  1ZU0 A;  1SYI A;  4KQP A;  3MUQ A;  3ECR A;  4OQO A;  1MQJ A;  1MQH A;  5F1Q A;  2Z22 A;  3IOW A;  3MP6 A;  2VOZ A;  3HO7 A;  3UA8 A;  4MFI A;  2Z8D A;  1VFD A;  1WVJ A;  3R26 A;  5I56 B;  1Y3N A;  2H5Y A;  2Q8J A;  3N6U A;  3C9H A;  4JWX A;  5CMB A;  3V8X B;  3H6V A;  2V84 A;  4GL8 A;  2QL3 A;  3M3F A;  4C1U A;  1MDP 1;  2UVG A;  4IO3 A;  3S2V A;  2F7A A;  5FHN A;  5JTY A;  1MDQ A;  2R6G E;  3LSL A;  2G29 A;  5H8H A;  5KCJ B;  1B4H A;  4FIM A;  3IAZ A;  2Y84 A;  1A54 A;  4IO7 A;  4G68 A;  1B7Z A;  1LBC A;  1PB9 A;  4RJZ A;  5B70 A;  3BKI B;  1IXG A;  3E13 X;  3OEL A;  3GBA A;  1GTK A;  1YPN A;  4DE8 A;  3FAT A;  4Z7E A;  4LA9 A;  4HW8 A;  4QFN A;  2ZYK A;  3OXN A;  1FQD A;  4DCX A;  1LAH E;  2Y7P A;  1MPD A;  4TLL B;  3C4M A;  4M1V A;  4N13 A;  4YAH X;  5HBC A;  4YKP A;  1R1N A;  4O3B A;  5EHM A;  2ONS A;  4OEN A;  1BP5 A;  3Q27 A;  4H8I A;  3GBB A;  1URD A;  4R2F A;  1YTV A;  3W15 C;  4L17 A;  2RCB A;  2Y7I A;  1B5I A;  5I2K B;  2UVH A;  5AA3 A;  3TTK A;  2HQ0 A;  3KBR A;  4U4S A;  1Y1Z A;  3TTM A;  1N0T A;  3DM0 A;  1S9T A;  4GWO A;  1P1W A;  3T22 A;  3MVW A;  4QFK A;  1LBB A;  2H98 A;  3E9X A;  2NVU B;  3VVF A;  2OWS A;  3RT8 A;  3KZG A;  2Z8F A;  3U92 A;  4ZDM A;  4ZE8 A;  3QUF A;  2UXA A;  2NUV A;  3KOS A;  3CRB A;  1PB8 A;  2GRV A;  4MLV A;  3O66 A;  1N7X A;  1P1N A;  1Y3Q A;  3CIJ A;  3USD A;  4EXK A;  1IUD A;  3K1M A;  2A5S A;  1N84 A;  3E4R A;  4OVJ A;  4AB6 A;  4PFW A;  4OEV A;  3Q25 A;  2AYS A;  1N76 A;  2XXX A;  3IJO B;  5CBS A;  4QF9 A;  1LFG A;  3SEU A;  3ZKL A;  2GFE A;  4AQ4 A;  1BKA A;  1B1X A;  3KFM A;  1NH7 A;  1MXU A;  1HSE A;  3RUM A;  1TWY A;  2F7C A;  1UIV A;  3GXA A;  1D4N A;  2XXT A;  4GXS B;  4YMB A;  2I49 A;  4BDN A;  5CMM A;  3MVY A;  2XD3 A;  2XXY A;  2HFB A;  2D21 A;  3G3K A;  4LQ5 A;  3UP9 A;  3EPE A;  5H8F A;  2ZYN A;  5L9S A;  5L9M A;  4GIZ A;  4NF4 B;  1EZP A;  3EHS A;  4IO2 A;  1UTH A;  1JQF A;  1MPB A;  3C36 A;  1H44 A;  1MM7 A;  4UA8 A;  4YU0 A;  1F9B A;  1ANF A;  4OER A;  1B3L A;  3LSF B;  2HZK A;  2QS2 A;  3QK6 A;  1OQH A;  3MBP A;  5I59 A;  4FE8 A;  3C35 A;  3SEW A;  4ELR A;  1N7W A;  2F5X A;  4EQB A;  3MPK A;  5FTI A;  4DZ1 A;  2ONK E;  3DEL B;  3W9V A;  3PPR A;  1OQG A;  2R9J A;  4F29 A;  1IZ1 A;  2RF1 A;  4DIG A;  3VLV A;  2DXR A;  5M2V A;  4HTG A;  1O64 A;  4XKN A;  1PBP A;  3SEV A;  3U1O A;  3LSW A;  5CM6 A;  1Q1K A;  1XS5 A;  3FVK A;  1SW5 A;  3MZB A;  4HCW A;  1QVS A;  5A5X B;  1B3G A;  1S50 A;  3BFT A;  1B5H A;  3OO8 A;  4EUO A;  2F78 A;  1DPP A;  4MBP A;  3SER A;  3FUZ A;  4PFY A;  1DPE A;  1IIT A;  3RN8 A;  1CB6 A;  1SQY A;  1SVX B;  2UYE A;  5A5X A;  2I4C A; 
#chains in the Genus database with same CATH topology
 1FBP A;  1RKM A;  1POT A;  4NF8 B;  2GHA A;  2XX8 A;  4G8M A;  4POW A;  3KOT A;  4LZ8 A;  4O94 A;  4XEQ A;  3T9X B;  4ZEF A;  3TOD A;  1FQC A;  2V3Q A;  3V89 B;  2Q2A A;  4MEV A;  2OCU A;  3RNN A;  1SW1 A;  4ELQ A;  2ZZV A;  5ET8 A;  1L5T A;  1FCK A;  2XXR A;  5I3S A;  4F1V A;  4DCY A;  4ZE9 A;  4N4U A;  1R9Q A;  5JEI A;  2KQZ A;  1FPL A;  1LCF A;  4HE1 A;  5T3J A;  1B3H A;  1FQF A;  3B6T A;  1H3D A;  3GZG A;  1MXY A;  3VVE A;  4ZS9 A;  1BK4 A;  1UTB B;  2O68 A;  3OO9 A;  2FIX A;  5EHS A;  1NV7 A;  2XXU A;  3TUS A;  4MLQ A;  2A5T B;  3MAM A;  3QSL A;  1NV2 A;  1IMD A;  1NV0 A;  3K1N A;  3PPQ A;  3TTR A;  1MPC A;  3TQW A;  2FNC A;  4IY5 A;  4GBV A;  5ITP A;  1UTB A;  3K6V A;  4F1U A;  3PPN A;  4POX A;  4KYS A;  3HST A;  1MXW A;  2O51 A;  3E79 A;  4LON B;  4P0G A;  1EYK A;  3O97 A;  2PYY A;  4KI0 E;  5KDT B;  3FVG A;  1B32 A;  3PPP A;  3FGS A;  2FBP A;  3L6G A;  5I2N B;  4H1X A;  4X1B A;  1QUL A;  1EZ9 A;  3Q29 A;  5ET7 A;  5CBR A;  1J1N A;  5AE4 A;  4EQ7 A;  3ODB A;  2DXY A;  3IL1 B;  4OFL A;  1P1U A;  3RTF B;  2GHB A;  3KBZ A;  4U1O A;  2O7I A;  1H76 A;  5EQ7 A;  3WAE A;  3L6H A;  3UOR A;  3RLF E;  2F8D A;  3RYD A;  4U21 A;  4ZEC A;  3OSR A;  2YLN A;  5ESY A;  1VSO A;  3JV9 A;  4RXL A;  3K02 A;  3PGF A;  1NI9 A;  5DEX A;  1RYX A;  5DTB A;  4U22 A;  3PU5 A;  2IA4 A;  3VE1 B;  1K9Y A;  2Z23 A;  2CEY A;  4NF5 A;  3B7D A;  3CG1 A;  3MP1 A;  2Q9T A;  5I57 A;  3OEN A;  1ZLQ A;  3TQL A;  1SI0 A;  4OVP A;  1FTO A;  3Q28 A;  1XT8 A;  4IY6 A;  2V93 A;  1Y4T A;  5IZZ A;  4Q30 B;  4BDO A;  1D9V A;  3KN8 A;  1INP A;  4Q5T A;  3OEK A;  3T9H B;  1FTM A;  4RPN A;  4PCD A;  3S9N C;  4KYE A;  4HE2 A;  1TXF A;  4U1Z A;  2YJP A;  4IGR A;  4WXJ A;  4TLM B;  1QKA A;  2CZL A;  4GOT A;  3G3G A;  2QSX A;  4KXP A;  2WBD A;  2QS3 A;  1ELJ A;  2QMX A;  1PC3 A;  2H99 A;  2QRY A;  4UAB A;  4NN3 A;  3IOV A;  4QSD A;  3M8U A;  3SEY A;  1XC1 A;  3KG2 A;  3N6T A;  1VFE A;  1MY4 A;  4OYV A;  3TCF A;  1A7L A;  3T9V A;  4N6D A;  4MF3 A;  3EKI A;  5JTY B;  1NMU A;  3MP8 A;  5H8H B;  2ESN A;  3CFX A;  4G68 B;  4KCC A;  3UK4 A;  5HPQ A;  2F36 A;  1FBG A;  1TFA A;  1NUX A;  3C34 A;  4H0W A;  3SDF A;  4PBQ A;  1MQD A;  3IK6 B;  3IOU A;  3G3H A;  4X04 A;  3S9M C;  1D9Q A;  1BIY A;  3OEM A;  1M5D A;  2HAV A;  4THI A;  1FJ9 A;  4DI3 D;  5TU0 A;  2I6E A;  2OK2 A;  4X1D A;  1MY0 A;  1GV8 A;  5ICQ A;  4PFU A;  2P3V A;  3FBP A;  3W9W A;  2QS1 A;  1I69 A;  2O84 X;  2Q2C A;  4N6P A;  2ABH A;  3V83 A;  3G3F A;  1NFT A;  4EDP A;  5AA4 A;  5TPA A;  1CE2 A;  4Q0C A;  3OOA A;  3KJ7 A;  4G68 C;  4I3E A;  1NUW A;  2I48 A;  3EHT A;  1AMF A;  4PDH A;  4IO5 A;  4ELO A;  1JEV A;  1A99 A;  2WKY A;  1M5E A;  3UN6 A;  5ET6 A;  1NH8 A;  4LP2 B;  2R71 A;  3HPI A;  1Q9D A;  3PUZ E;  1QUK A;  4I40 A;  4RK2 A;  4F3G A;  3RGY A;  3MPL A;  4TOZ A;  5ELV A;  1XOC A;  3H6U A;  4IR8 A;  1IME A;  4DXU A;  3RY3 A;  4JDF A;  4I3Y A;  2IEE A;  4GVO A;  3JZJ A;  3P7I A;  1IMB A;  2DWI A;  3K2D A;  5ISU A;  4PFT A;  5H8S A;  4QHQ A;  2ZNU A;  4LZ7 A;  2Y7K A;  3BIG A;  2PT1 A;  3PMW A;  5IAI A;  3ILU B;  4XKP A;  2PVU A;  4G61 A;  3V5A A;  4F3B A;  2DYX A;  4IO6 A;  4P47 A;  3RT6 B;  1FBD A;  2ZYO A;  2I0B A;  4OFJ A;  3K6X A;  3O6G A;  3I6V A;  2XWK A;  1US4 A;  4YKJ A;  2B3F A;  4K3F A;  2O6A A;  1Y3P A;  5KZT A;  3K0V A;  3SZP A;  3ZSF A;  2THI A;  2CZI A;  3F11 A;  1YCJ A;  4H46 A;  3THI A;  4MJO A;  4MNC A;  2E1S A;  4PE5 B;  3WAF A;  2ANJ A;  2ALU A;  4PF8 A;  4PET A;  3LUZ A;  4PGP A;  2PBW A;  3H4Z A;  4I8C A;  1FPE A;  4F31 B;  1NL5 A;  2ZZX A;  3MVZ A;  3T1B A;  1FBH A;  1HSJ A;  2Q88 A;  2FHY A;  3RQT A;  4P0I A;  2H4I A;  3SET A;  4O3C A;  4GQO A;  4IGT A;  4QFL A;  2QVU A;  5EQ9 A;  5LDZ A;  4EQ9 A;  3KEI A;  4PQJ A;  4N07 A;  5F24 A;  3CFL A;  5H8F B;  3FD3 A;  3CR9 A;  4OVT A;  3C33 A;  4N17 A;  5F7V A;  1UTH B;  2VP1 A;  2M8C A;  4Z0I A;  2I58 A;  2UVJ A;  3VDF A;  4R6Y A;  3IO6 A;  5DVI A;  1I6B A;  3KGC A;  4GRK A;  3TPA A;  3K00 A;  2DWJ A;  5I58 A;  3BIH A;  4JVC A;  5I59 B;  1YAE A;  1A55 A;  5H8N A;  1P99 A;  3G3I A;  3VLU A;  1TFD A;  3SEX A;  1B0H A;  4NQ8 A;  3IFC A;  3VFJ A;  4M4G A;  2Q8M A;  1AOV A;  3FXQ A;  1IEJ A;  3TTN A;  4TQU Q;  5IZ3 A;  3T96 B;  3AXF A;  2PX1 A;  4YIC A;  2Y7W A;  4KPT A;  1O7T A;  2XX7 A;  4I9D A;  4MCO A;  2QS4 A;  4P9K A;  3CSB A;  4WEP A;  1IXH A;  4FOR A;  1ZIU A;  4BLA A;  2P0S A;  4R2B A;  2G93 A;  3PUX E;  1MY3 A;  4ESX A;  4DLD A;  1JEU A;  2Z8E A;  2V25 A;  4N15 A;  3IX1 A;  4XIG Q;  2L5V A;  4FAT A;  1JNF A;  4OTE A;  3TAJ A;  2ZYM A;  1H45 A;  3O9P A;  1SYH A;  3IJX B;  2V3U A;  4QBA A;  3A29 A;  4F18 A;  1FJ6 A;  2XX9 A;  3MW0 A;  2UVI A;  2RCA A;  4EXL A;  1A8E A;  1ZJL A;  4XKR A;  1IQ7 A;  4R73 A;  1OMP A;  3O6H A;  3N94 A;  3A09 A;  1URS A;  3H03 A;  3MZ1 A;  3OO7 A;  3C32 A;  1JW1 A;  2V3T A;  3IB0 A;  4C1T A;  4NE4 A;  2DE4 A;  2Q74 A;  4R6H A;  3PD9 A;  5TP9 A;  2XXI A;  2JJK A;  1LAF E;  4NF0 A;  1K9Z A;  4NGU A;  3UIF A;  5L8D A;  4ONY A;  4PP0 A;  3ONM A;  4ZZA A;  1MH3 A;  4LN5 A;  1B2H A;  3MQ9 A;  4R9G A;  4JVD A;  4R6K A;  1MRP A;  2X7Q A;  3G3J A;  1I6Q A;  4GWX A;  2HPG A;  4PFB A;  1JET A;  2I4B A;  3KN7 A;  4P3L A;  2O7U A;  1G0H A;  4X48 A;  4DXB A;  4KD5 A;  1IMA A;  4OES A;  1MQG A;  1NNF A;  1EYJ A;  3PTY A;  1LST A;  1Q35 A;  2DSF A;  2VPO A;  3EN3 A;  2HZL A;  2ZXT A;  2OBG A;  4RA1 A;  3ILT B;  1VE4 A;  1FQB A;  4KR5 A;  4R9F A;  2BJI A;  4DI4 B;  3VLW A;  4NF6 A;  3HHG A;  2O1M A;  1R6Z A;  3MVX A;  2VD2 A;  3LBS A;  2AL4 A;  3B6W A;  4RNS A;  4FEC A;  1UQW A;  4G2Z A;  4O3A A;  3S9L C;  2F34 A;  4OHN A;  3H6W A;  3EQ1 A;  1AIV A;  1EH3 A;  3MJN A;  4I62 A;  5AA2 A;  1M5C A;  2E0S A;  4F2O A;  2ZNT A;  1FPG A;  1N3X A;  3LUY A;  1AH5 A;  1DOT A;  3U94 A;  4Q8R A;  4YB7 A;  2AIX A;  3A3C A;  3FV2 A;  4ECF A;  4BDR A;  5L9O A;  1URG A;  4AB5 A;  3BFU A;  1OVB A;  1FPF A;  3Q26 A;  1FBC A;  3FIR A;  2I0C A;  1IXC A;  2KR0 A;  2NXO A;  4R75 A;  1FW0 A;  2Y5K A;  4E0X A;  3DP8 A;  2RKM A;  5CI5 A;  5DEX B;  3BBR A;  1SPI A;  2ONR A;  4G8H A;  1AWB A;  1FQE A;  4OMB A;  4O7I A;  1LB9 A;  4NF5 B;  1OLC A;  4LZ5 A;  5I57 B;  1QUI A;  2QJE A;  4KYD A;  4GWW A;  4GWZ A;  4GX4 A;  2V4C A;  2NWJ A;  3U8Q A;  4GWY A;  5A5L A;  3GLB A;  1Z7M E;  4ND9 A;  4YKK A;  5K2Y A;  1LLS A;  1USY E;  3IOR A;  2Y7R A;  5DT6 A;  2P2A A;  2R8T A;  1WOD A;  2WYP A;  1UIU A;  4EF1 A;  1AL3 A;  4GX6 A;  1NNT A;  4FED A;  5BWJ A;  3O6I A;  1ZBM A;  1LGB C;  3PMV A;  3SKP A;  2O69 A;  1JVY A;  5IM2 A;  3GYY A;  2DS9 A;  1B4Z A;  4KFQ A;  5DVF A;  4OXV A;  2WYK A;  3IO4 A;  4DDD A;  5B7D A;  3O28 A;  1LBX A;  3MYU A;  4WED A;  3KSJ A;  1FTA A;  3FXU A;  1D3K A;  4H6D A;  4PGN A;  1QUJ A;  2FA7 A;  2XWV A;  1JVX A;  3PPO A;  1BTJ A;  1B46 A;  5ET5 A;  3TCH A;  4GBW A;  1XVX A;  2OLB A;  3D4G A;  2XWO A;  2HAU A;  4QSE A;  1SW4 A;  4QRZ A;  4R74 A;  3TTL A;  4NWD A;  1D9Y A;  4ZEB A;  1KA0 A;  3MWB A;  5DVJ A;  1IIW A;  3OMB A;  2QVR A;  4IB2 A;  2QMW A;  2XXK A;  1Z7N E;  4NMY A;  1CNQ A;  3O29 A;  4YZZ A;  2HCA A;  2REJ A;  4GXA A;  3A3U A;  1NV1 A;  3RPW A;  3FXB A;  1I6A A;  2DP8 A;  4JSO A;  5I56 A;  4JBZ A;  3PUW E;  2VT5 A;  4E0W A;  3D4C A;  1DTZ A;  5AA4 B;  2DVZ A;  4ELP A;  4JB7 A;  4NED A;  1PEB A;  5TPA B;  3CSG A;  1TT1 A;  1LB8 A;  1DK4 A;  3CVG A;  2F6G A;  5CC2 A;  4P11 A;  3B6Q A;  2XXV A;  1VDW A;  4GX3 A;  4N6K A;  4NWC A;  3R7X A;  4H5F A;  2HEU A;  3S9E A;  3C31 A;  3FVN A;  2PMS A;  5KCJ A;  3IR1 A;  1NV5 A;  1O63 A;  1Y20 A;  4R72 A;  4WKM A;  4FAJ A;  4PAK A;  5I7I A;  1M5B A;  3FVO A;  1MXX A;  3KJT A;  3H7M A;  4JVI A;  3M3L A;  1B6H A;  3D1R A;  5AA1 A;  5CMK A;  2B4L A;  5FHM A;  4QFO A;  1LBW A;  1B7H A;  2KLF A;  4KCD A;  2DOJ A;  2QVV A;  2DE3 A;  1FPD A;  4OEU A;  4PBH A;  3S4U A;  5FTH A;  3O2A A;  4OVR A;  4JWO A;  4NTL A;  3KC1 A;  4EF2 A;  2OJT A;  5I2K A;  3HN0 A;  1LAX A;  2YPN A;  1JW4 A;  1B52 A;  4ZEK A;  3CI8 A;  1B9J A;  2RC7 A;  4OFO A;  5EYF A;  5HM4 B;  4XXU A;  4N91 A;  4YB5 A;  2XXH A;  1FSA A;  3PD8 A;  3TEP A;  1B5J A;  4XFE A;  3CHG A;  2WX9 A;  4BDL A;  3FXR A;  5LOM A;  2F97 A;  3T9U A;  3K6U A;  2W7Y A;  2XD2 A;  4ESW A;  2HXW A;  2P3N A;  1H43 A;  1NNK A;  2D5W A;  5ICT A;  4F2Q A;  1ZKB A;  3T93 B;  1IMF A;  4KHZ E;  1KZ8 A;  3N5L A;  1LFH A;  2D3I A;  2OWT A;  4JSD A;  1OLA A;  3TYH A;  1MY1 A;  3N26 A;  4OVS A;  1MM6 A;  4G77 A;  1T0K A;  4F3S A;  3LR1 A;  3KSX A;  3EHU A;  1NV3 A;  1PB7 A;  2ZMB A;  1DMB A;  4F3P A;  3PV0 E;  4IO4 A;  1PDA A;  1FRP A;  4U23 A;  2XXQ A;  4OVQ A;  1FPK A;  3U93 A;  5I58 B;  3IOT A;  1NKX A;  5CMC A;  1SDX A;  5H8N B;  3IB2 A;  1USY H;  4H5G A;  4XTC Q;  5K2X A;  2I3V A;  4I1D A;  3VXB A;  3DLN A;  5DW8 A;  3QXM A;  5H8Q B;  5IZ3 B;  4PDD A;  4GL0 A;  4F1Y A;  4HCY A;  2FVZ A;  4O7M A;  1WDN A;  4H67 A;  3TFL A;  4MAG A;  3LV0 A;  4ZEI A;  3PMX A;  4AS4 A;  1JW5 A;  3LC8 A;  1KWH A;  3K6W A;  1MQI A;  3DP6 A;  4RYA A;  4H45 A;  5H8Q A;  3K01 A;  4MIJ A;  1OIB A;  4F39 A;  3FZV A;  2RC8 A;  1MY2 A;  1ATG A;  3HV1 A;  2OZZ A;  4NF4 A;  1FTJ A;  4PAF A;  2DWA A;  3DP4 A;  4JXI A;  1HSL A;  4UAC A;  3HCQ A;  1B0L A;  1ZTY A;  3OSQ A;  4PFI A;  2RIN A;  1S7Y A;  4QFP A;  1B1H A;  1RYO A;  3FJ7 A;  2H9B A;  1NUY A;  4ZZE A;  4F22 A;  2O1L A;  1MH4 A;  1SW2 A;  4G4P A;  1LEV A;  2CZK A;  1PBQ A;  3K1P A;  1A40 A;  4RK9 A;  4U4X A;  2X26 A;  3I3V A;  4H8J A;  5TP9 B;  1SD3 A;  4BDM A;  1QKB A;  4PE3 A;  1QW0 A;  2AL5 A;  4OET A;  4X9T A;  4GWS A;  1FQA A;  1VR5 A;  2XXW A;  1B3F A;  4P1E A;  2LAO A;  3RTW B;  2QPQ A;  5BUU A;  1QJM A;  1XVY A;  5J1D A;  2ZNS A;  2XHD A;  1NNP A;  5IZ1 A;  3TEL A;  2B3B A;  2H25 A;  4X8R A;  3T66 A;  4ISU A;  4QXD A;  3OD7 A;  4XF5 A;  4U2R A;  1IMC A;  3RPL A;  5I84 A;  4GLI A;  4NHB A;  4OZ9 A;  1FTK A;  2DVC A;  3K4U A;  4NF8 A;  4AS5 A;  3QAX A;  3VXC A;  1US5 A;  4RY1 A;  2VD3 A;  4FBP A;  4FJP A;  1M5F A;  3IB1 A;  1Y9U A;  5LTC A;  3FJG A;  1IXI A;  1NV4 A;  3LSX A;  5ITO A;  1B3E A;  3I5O A;  4G8N A;  3FAS A;  5DYH A;  5IKB A;  2P1S A;  1EU8 A;  4NF6 B;  3JYR A;  2UYF A;  2OWZ A;  1MS7 A;  1DSN A;  3CG3 A;  4NAP A;  2GH9 A;  3MST A;  2RC9 A;  3UGW A;  4FEB A;  4GF8 A;  2B65 A;  4ZED A;  2VHA A;  4LQ2 A;  4QSC A;  5CRY A;  5AA2 B;  3ZKK A;  3HHF A;  1Y4C A;  1EZO A;  4N8G A;  3T0J A;  1SI1 A;  2PT2 A;  3ZS6 A;  1SBP A;  3E3K A;  3QYT A;  2BJJ X;  2DE2 A;  2Q89 A;  2A5T A;  1MG1 A;  1DTG A;  4GFR A;  3H6T A;  4F19 A;  3G7W A;  2F3D A;  4YKI A;  4YMA A;  4HXV A;  4GWU A;  5EQA A;  4OAN A;  4JWY A;  2REG A;  1B51 A;  3HFU A;  1POY 1;  2DQV A;  3U72 A;  4MMP A;  1B05 A;  2Y5L A;  1LAG E;  3SES A;  3TMG A;  1B40 A;  4YB6 A;  4C0R A;  4DXC A;  2VGQ A;  5KDT A;  1OVT A;  1R9L A;  1BLF A;  5JK4 A;  3QUJ A;  4LUB A;  5FHO A;  3TZA A;  4BDQ A;  5I2N A;  2F7B A;  4OA4 A;  3TCG A;  4MNP A;  3MC2 A;  2CMO A;  1A8F A;  3KN3 A;  2XXP A;  3VVD A;  4MH5 A;  3E78 A;  3FJM A;  1LFI A;  1P1O A;  3OO6 A;  1Y1M A;  2X7P A;  3QIM A;  2FYI A;  2I3W A;  1GR2 A;  4PTK A;  5AA2 D;  1NV6 A;  3TKD A;  2XWI A;  1MXZ A;  1FTL A;  4XKQ A;  1B7U A;  3M3K A;  4LAT A;  1LBV A;  2WBB A;  3CFZ A;  1N3W A;  4PAI A;  3H3G A;  1FPJ A;  4RPO A;  3VV5 A;  1G0I A;  3R6U A;  1NUZ A;  3EF7 A;  1B58 A;  4HS7 A;  3PUV E;  2F35 A;  2F6P A;  3MZ9 A;  2NOO A;  1YYZ A;  1P1Q A;  1II5 A;  4H65 A;  3TDJ A;  2HHM A;  4LVQ A;  5J16 A;  3FV1 A;  1MXV A;  4GD5 A;  4MHF A;  1GVC A;  1LCT A;  1XHY A;  1ZMG A;  1GGG A;  3H06 B;  3PUY E;  1N04 A;  1YZ0 A;  4OWD A;  2DWH A;  1ZU0 A;  1SYI A;  4KQP A;  3MUQ A;  3ECR A;  4OQO A;  4MNI A;  1MQJ A;  1MQH A;  5F1Q A;  2Z22 A;  3IOW A;  3MP6 A;  2VOZ A;  3HO7 A;  3UA8 A;  4MFI A;  2Z8D A;  1VFD A;  1WVJ A;  3R26 A;  4PC9 A;  5I56 B;  1Y3N A;  2H5Y A;  2Q8J A;  3N6U A;  3B50 A;  3C9H A;  4JWX A;  3B8B A;  5CMB A;  3V8X B;  3H6V A;  2V84 A;  2PFZ A;  4GL8 A;  2QL3 A;  3M3F A;  4C1U A;  1MDP 1;  2UVG A;  4IO3 A;  3S2V A;  4N8Y A;  4O8M A;  2F7A A;  5FHN A;  5JTY A;  1MDQ A;  2R6G E;  3LSL A;  2G29 A;  5H8H A;  5KCJ B;  1B4H A;  1DCU A;  4FIM A;  3IAZ A;  2Y84 A;  1A54 A;  4IO7 A;  5IGA A;  4G68 A;  1B7Z A;  1LBC A;  1PB9 A;  4RJZ A;  5B70 A;  4MX6 A;  3BKI B;  1IXG A;  3E13 X;  3OEL A;  3GBA A;  1GTK A;  1YPN A;  4DE8 A;  3FAT A;  4Z7E A;  4LA9 A;  2XA5 A;  4HW8 A;  4QFN A;  2ZYK A;  3OXN A;  1FQD A;  4P8B A;  4DCX A;  1LAH E;  2Y7P A;  1MPD A;  4TLL B;  3C4M A;  4M1V A;  1JP4 A;  4N13 A;  1RDY A;  4YAH X;  5HBC A;  4YKP A;  2F3B A;  1R1N A;  4O3B A;  5EHM A;  2ONS A;  4OEN A;  1BP5 A;  3Q27 A;  4H8I A;  3GBB A;  1XI6 A;  1URD A;  4R2F A;  4NX1 A;  1YTV A;  4N81 A;  3W15 C;  4L17 A;  2RCB A;  2Y7I A;  1B5I A;  5I2K B;  2UVH A;  5AA3 A;  1RDX A;  3TTK A;  2HQ0 A;  3ROJ A;  2FIE A;  3KBR A;  2CZH A;  4U4S A;  1Y1Z A;  3TTM A;  4PFR A;  1N0T A;  5EQ8 A;  3DM0 A;  1S9T A;  4GWO A;  5EYG A;  1P1W A;  3T22 A;  1FPI A;  3MVW A;  4QFK A;  1LBB A;  2H98 A;  3E9X A;  2NVU B;  3VVF A;  2OWS A;  3RT8 A;  3KZG A;  2Z8F A;  3U92 A;  3QUF A;  2UXA A;  4ZDM A;  4ZE8 A;  1LBY A;  3IFA A;  2NUV A;  3KOS A;  3CRB A;  1FPB A;  1PB8 A;  2GRV A;  4MLV A;  3O66 A;  5EYH A;  1N7X A;  1P1N A;  1Y3Q A;  2QFL A;  3CIJ A;  3USD A;  4P56 A;  4EXK A;  1IUD A;  3K1M A;  2A5S A;  5FBP A;  1N84 A;  2HXR A;  3E4R A;  4OVJ A;  4AB6 A;  4P1L A;  4PFW A;  4OEV A;  4PF6 A;  3Q25 A;  2GQ1 A;  2AYS A;  1N76 A;  2XXX A;  1DBZ A;  3IJO B;  5CBS A;  4QF9 A;  1LFG A;  3SEU A;  3ZKL A;  2GFE A;  3U65 A;  4AQ4 A;  1BKA A;  1YXI A;  1B1X A;  3KFM A;  1NH7 A;  1MXU A;  1HSE A;  3RUM A;  4HE0 A;  4NG7 A;  1TWY A;  2F7C A;  1UIV A;  3GXA A;  1D4N A;  2XXT A;  1QGX A;  4GXS B;  4YMB A;  2I49 A;  4BDN A;  5CMM A;  3MVY A;  2XD3 A;  2OX3 A;  2XXY A;  2HFB A;  2D21 A;  3G3K A;  4LQ5 A;  3UP9 A;  3EPE A;  1KA1 A;  1LBZ A;  5H8F A;  2ZYN A;  5L9S A;  5L9M A;  4GIZ A;  4NF4 B;  1EZP A;  3EHS A;  4IO2 A;  1UTH A;  1JQF A;  2VPN A;  2PCR A;  1MPB A;  3C36 A;  1H44 A;  1MM7 A;  3KC0 A;  1RDZ A;  4UA8 A;  4YU0 A;  2PFY A;  1F9B A;  1ANF A;  4OER A;  1FBE A;  1B3L A;  3LSF B;  5I5P A;  2HZK A;  2QS2 A;  3QK6 A;  1OQH A;  3MBP A;  2CEX A;  3ISP A;  5I59 A;  1EYI A;  2MKZ A;  4FE8 A;  3C35 A;  3SEW A;  4ELR A;  1N7W A;  2F5X A;  4EQB A;  3MPK A;  5FTI A;  3QMF A;  4DZ1 A;  2ONK E;  3DEL B;  3W9V A;  3PPR A;  1OQG A;  2R9J A;  4F29 A;  1IZ1 A;  2RF1 A;  4DIG A;  3VLV A;  2DXR A;  5M2V A;  1FBF A;  4HTG A;  1O64 A;  4XKN A;  1PBP A;  3SEV A;  3U1O A;  2DDK A;  3LSW A;  5CM6 A;  1Q1K A;  1XS5 A;  3FVK A;  1SW5 A;  3MZB A;  4HCW A;  1QVS A;  5A5X B;  1B3G A;  1S50 A;  3BFT A;  1B5H A;  3OO8 A;  4EUO A;  2F78 A;  2ZZW A;  1DPP A;  2WEF A;  4MBP A;  3SER A;  3FUZ A;  4PFY A;  1DPE A;  1IIT A;  3RN8 A;  3RPL B;  3NOH A;  1CB6 A;  1SQY A;  1SVX B;  2B4M A;  2UYE A;  5A5X A;  2I4C A; 
#chains in the Genus database with same CATH homology
 1RKM A;  1POT A;  4NF8 B;  2GHA A;  2XX8 A;  4G8M A;  4POW A;  3KOT A;  4LZ8 A;  3TOD A;  3T9X B;  4ZEF A;  1FQC A;  2V3Q A;  3V89 B;  2Q2A A;  2OCU A;  3RNN A;  1SW1 A;  4ELQ A;  1L5T A;  1FCK A;  2XXR A;  4F1V A;  4DCY A;  4ZE9 A;  1R9Q A;  5JEI A;  1LCF A;  1B3H A;  1FQF A;  3B6T A;  1H3D A;  3GZG A;  1MXY A;  3VVE A;  4ZS9 A;  1UTB B;  2O68 A;  3OO9 A;  5EHS A;  2XXU A;  3TUS A;  4MLQ A;  2A5T B;  3MAM A;  3QSL A;  3K1N A;  3PPQ A;  3TTR A;  1MPC A;  3TQW A;  2FNC A;  4IY5 A;  5ITP A;  1UTB A;  3K6V A;  4F1U A;  3PPN A;  4POX A;  4KYS A;  3HST A;  1MXW A;  2O51 A;  4LON B;  4P0G A;  3O97 A;  2PYY A;  4KI0 E;  5KDT B;  3FVG A;  1B32 A;  3PPP A;  3FGS A;  3L6G A;  5I2N B;  4H1X A;  4X1B A;  1QUL A;  1EZ9 A;  3Q29 A;  5CBR A;  1J1N A;  5AE4 A;  4EQ7 A;  3ODB A;  2DXY A;  3IL1 B;  4OFL A;  1P1U A;  3RTF B;  2GHB A;  4U1O A;  2O7I A;  1H76 A;  3WAE A;  3L6H A;  3UOR A;  3RLF E;  2F8D A;  4U21 A;  4ZEC A;  3OSR A;  2YLN A;  1VSO A;  3JV9 A;  4RXL A;  3K02 A;  3PGF A;  5DEX A;  1RYX A;  5DTB A;  4U22 A;  3PU5 A;  2IA4 A;  3VE1 B;  2Z23 A;  4NF5 A;  3B7D A;  3CG1 A;  3MP1 A;  2Q9T A;  5I57 A;  3OEN A;  1ZLQ A;  3TQL A;  1SI0 A;  1FTO A;  3Q28 A;  1XT8 A;  4IY6 A;  2V93 A;  1Y4T A;  4Q30 B;  4BDO A;  1D9V A;  3KN8 A;  4Q5T A;  3OEK A;  3T9H B;  1FTM A;  4RPN A;  3S9N C;  4KYE A;  1TXF A;  4U1Z A;  2YJP A;  4IGR A;  4WXJ A;  4TLM B;  1QKA A;  2CZL A;  4GOT A;  3G3G A;  2QSX A;  2QS3 A;  1ELJ A;  2QMX A;  1PC3 A;  2H99 A;  2QRY A;  3IOV A;  4QSD A;  3M8U A;  3SEY A;  1XC1 A;  3KG2 A;  3N6T A;  1VFE A;  1MY4 A;  4OYV A;  3TCF A;  1A7L A;  3T9V A;  4MF3 A;  5JTY B;  1NMU A;  3MP8 A;  5H8H B;  2ESN A;  3CFX A;  4G68 B;  4KCC A;  3UK4 A;  5HPQ A;  2F36 A;  1TFA A;  3C34 A;  4H0W A;  3SDF A;  1MQD A;  3IK6 B;  3IOU A;  3G3H A;  3S9M C;  1BIY A;  3OEM A;  1M5D A;  2HAV A;  4THI A;  5TU0 A;  2I6E A;  2OK2 A;  4X1D A;  1MY0 A;  1GV8 A;  5ICQ A;  4PFU A;  3W9W A;  2QS1 A;  1I69 A;  2O84 X;  2Q2C A;  4N6P A;  2ABH A;  3V83 A;  3G3F A;  1NFT A;  4EDP A;  5AA4 A;  5TPA A;  1CE2 A;  4Q0C A;  3OOA A;  3KJ7 A;  4G68 C;  2I48 A;  3EHT A;  1AMF A;  4IO5 A;  4ELO A;  1JEV A;  1A99 A;  2WKY A;  1M5E A;  3UN6 A;  1NH8 A;  4LP2 B;  2R71 A;  3HPI A;  3PUZ E;  1QUK A;  4RK2 A;  4F3G A;  3RGY A;  3MPL A;  4TOZ A;  5ELV A;  1XOC A;  3H6U A;  4DXU A;  3RY3 A;  4JDF A;  2IEE A;  4GVO A;  3JZJ A;  3P7I A;  2DWI A;  3K2D A;  5ISU A;  4PFT A;  5H8S A;  4QHQ A;  2ZNU A;  4LZ7 A;  2Y7K A;  2PT1 A;  3PMW A;  5IAI A;  3ILU B;  4XKP A;  2PVU A;  3V5A A;  4F3B A;  2DYX A;  4IO6 A;  3RT6 B;  2ZYO A;  2I0B A;  4OFJ A;  3K6X A;  3O6G A;  3I6V A;  1US4 A;  4YKJ A;  2B3F A;  4K3F A;  2O6A A;  1Y3P A;  5KZT A;  3K0V A;  3ZSF A;  2THI A;  3F11 A;  1YCJ A;  3THI A;  2E1S A;  4PE5 B;  3WAF A;  2ANJ A;  2ALU A;  4PET A;  2PBW A;  3H4Z A;  4I8C A;  4F31 B;  1NL5 A;  3MVZ A;  1HSJ A;  2Q88 A;  3RQT A;  4P0I A;  2H4I A;  3SET A;  4O3C A;  4GQO A;  4IGT A;  4QFL A;  4EQ9 A;  3KEI A;  4PQJ A;  4N07 A;  3CFL A;  5H8F B;  3FD3 A;  3CR9 A;  3C33 A;  5F7V A;  1UTH B;  2VP1 A;  2M8C A;  4Z0I A;  2I58 A;  2UVJ A;  3VDF A;  4R6Y A;  3IO6 A;  5DVI A;  1I6B A;  3KGC A;  4GRK A;  3TPA A;  3K00 A;  2DWJ A;  5I58 A;  5I59 B;  1YAE A;  1A55 A;  5H8N A;  1P99 A;  3G3I A;  3VLU A;  1TFD A;  3SEX A;  1B0H A;  3VFJ A;  4M4G A;  1AOV A;  3FXQ A;  1IEJ A;  3TTN A;  4TQU Q;  3T96 B;  3AXF A;  2PX1 A;  4YIC A;  2Y7W A;  4KPT A;  1O7T A;  2XX7 A;  4I9D A;  2QS4 A;  3CSB A;  4WEP A;  1IXH A;  4FOR A;  1ZIU A;  4BLA A;  2P0S A;  4R2B A;  2G93 A;  3PUX E;  1MY3 A;  4ESX A;  4DLD A;  1JEU A;  2Z8E A;  2V25 A;  3IX1 A;  4XIG Q;  4FAT A;  1JNF A;  4OTE A;  3TAJ A;  2ZYM A;  1H45 A;  3O9P A;  1SYH A;  3IJX B;  2V3U A;  4F18 A;  2XX9 A;  3MW0 A;  2UVI A;  2RCA A;  4EXL A;  1A8E A;  1ZJL A;  4XKR A;  1IQ7 A;  4R73 A;  1OMP A;  3O6H A;  3N94 A;  3A09 A;  1URS A;  3H03 A;  3MZ1 A;  3OO7 A;  3C32 A;  1JW1 A;  2V3T A;  3IB0 A;  4C1T A;  4NE4 A;  2DE4 A;  4R6H A;  3PD9 A;  5TP9 A;  2XXI A;  1LAF E;  3UIF A;  5L8D A;  4ONY A;  4PP0 A;  3ONM A;  4ZZA A;  1MH3 A;  1B2H A;  3MQ9 A;  4R9G A;  4R6K A;  1MRP A;  2X7Q A;  3G3J A;  1I6Q A;  1JET A;  2I4B A;  3KN7 A;  2O7U A;  4X48 A;  4DXB A;  4KD5 A;  4OES A;  1MQG A;  1NNF A;  1LST A;  1Q35 A;  2DSF A;  3EN3 A;  2HZL A;  2ZXT A;  2OBG A;  4RA1 A;  3ILT B;  1VE4 A;  1FQB A;  4KR5 A;  4R9F A;  3VLW A;  4NF6 A;  3HHG A;  2O1M A;  1R6Z A;  3MVX A;  2VD2 A;  3LBS A;  2AL4 A;  3B6W A;  4RNS A;  4FEC A;  1UQW A;  4G2Z A;  4O3A A;  3S9L C;  2F34 A;  4OHN A;  3H6W A;  3EQ1 A;  1AIV A;  1EH3 A;  3MJN A;  4I62 A;  5AA2 A;  1M5C A;  2E0S A;  4F2O A;  2ZNT A;  1N3X A;  3LUY A;  1AH5 A;  1DOT A;  3U94 A;  4Q8R A;  4YB7 A;  2AIX A;  3A3C A;  3FV2 A;  4ECF A;  4BDR A;  5L9O A;  1URG A;  4AB5 A;  3BFU A;  1OVB A;  3Q26 A;  3FIR A;  2I0C A;  1IXC A;  2NXO A;  4R75 A;  1FW0 A;  4E0X A;  3DP8 A;  2RKM A;  5CI5 A;  5DEX B;  3BBR A;  2ONR A;  4G8H A;  1FQE A;  4OMB A;  1LB9 A;  4NF5 B;  1OLC A;  4LZ5 A;  5I57 B;  1QUI A;  2QJE A;  4KYD A;  2NWJ A;  3U8Q A;  3GLB A;  1Z7M E;  4ND9 A;  4YKK A;  5K2Y A;  1LLS A;  1USY E;  3IOR A;  2Y7R A;  5DT6 A;  2P2A A;  1WOD A;  1UIU A;  4EF1 A;  1AL3 A;  1NNT A;  4FED A;  5BWJ A;  3O6I A;  1ZBM A;  1LGB C;  3PMV A;  3SKP A;  2O69 A;  1JVY A;  2DS9 A;  1B4Z A;  4KFQ A;  5DVF A;  4OXV A;  3IO4 A;  4DDD A;  5B7D A;  3O28 A;  4WED A;  3KSJ A;  3FXU A;  4H6D A;  1D3K A;  1QUJ A;  2FA7 A;  1JVX A;  3PPO A;  1BTJ A;  1B46 A;  3TCH A;  1XVX A;  2OLB A;  3D4G A;  2HAU A;  4QSE A;  1SW4 A;  4QRZ A;  4R74 A;  3TTL A;  4NWD A;  1D9Y A;  4ZEB A;  3MWB A;  5DVJ A;  1IIW A;  3OMB A;  4IB2 A;  2QMW A;  1Z7N E;  4NMY A;  3O29 A;  4YZZ A;  2HCA A;  2REJ A;  4GXA A;  3A3U A;  3RPW A;  1I6A A;  2DP8 A;  4JSO A;  5I56 A;  4JBZ A;  3PUW E;  4E0W A;  3D4C A;  1DTZ A;  5AA4 B;  2DVZ A;  4ELP A;  4JB7 A;  4NED A;  1PEB A;  5TPA B;  3CSG A;  1TT1 A;  1LB8 A;  3CVG A;  2F6G A;  5CC2 A;  4P11 A;  3B6Q A;  2XXV A;  4NWC A;  3R7X A;  4H5F A;  2HEU A;  3S9E A;  3C31 A;  3FVN A;  2PMS A;  5KCJ A;  3IR1 A;  1O63 A;  1Y20 A;  4R72 A;  4WKM A;  4FAJ A;  1M5B A;  3FVO A;  1MXX A;  3KJT A;  3H7M A;  3M3L A;  1B6H A;  5AA1 A;  5CMK A;  5FHM A;  4QFO A;  1B7H A;  2KLF A;  4KCD A;  2DOJ A;  2DE3 A;  4OEU A;  3S4U A;  5FTH A;  3O2A A;  4JWO A;  4NTL A;  4EF2 A;  2OJT A;  5I2K A;  3HN0 A;  1LAX A;  2YPN A;  1JW4 A;  1B52 A;  4ZEK A;  3CI8 A;  1B9J A;  2RC7 A;  4OFO A;  5EYF A;  5HM4 B;  4XXU A;  4YB5 A;  2XXH A;  3PD8 A;  3TEP A;  1B5J A;  4BDL A;  3FXR A;  5LOM A;  2F97 A;  3T9U A;  3K6U A;  2W7Y A;  2XD2 A;  4ESW A;  2HXW A;  1H43 A;  1NNK A;  2D5W A;  5ICT A;  4F2Q A;  1ZKB A;  3T93 B;  4KHZ E;  3N5L A;  1LFH A;  2D3I A;  2OWT A;  4JSD A;  1OLA A;  3TYH A;  1MY1 A;  3N26 A;  1MM6 A;  4G77 A;  1T0K A;  4F3S A;  3LR1 A;  3KSX A;  3EHU A;  2ZMB A;  1PB7 A;  1DMB A;  4F3P A;  3PV0 E;  4IO4 A;  1PDA A;  4U23 A;  2XXQ A;  3U93 A;  5I58 B;  3IOT A;  1NKX A;  5CMC A;  1SDX A;  5H8N B;  3IB2 A;  1USY H;  4H5G A;  4XTC Q;  5K2X A;  2I3V A;  4I1D A;  3VXB A;  3DLN A;  3QXM A;  5H8Q B;  4GL0 A;  4F1Y A;  4HCY A;  1WDN A;  4H67 A;  3TFL A;  4ZEI A;  3PMX A;  1JW5 A;  3LC8 A;  1KWH A;  3K6W A;  1MQI A;  3DP6 A;  4RYA A;  5H8Q A;  3K01 A;  1OIB A;  4F39 A;  3FZV A;  2RC8 A;  1MY2 A;  1ATG A;  3HV1 A;  2OZZ A;  4NF4 A;  1FTJ A;  2DWA A;  3DP4 A;  4JXI A;  1HSL A;  4UAC A;  3HCQ A;  1B0L A;  1ZTY A;  3OSQ A;  2RIN A;  1S7Y A;  4QFP A;  1B1H A;  1RYO A;  2H9B A;  3FJ7 A;  4ZZE A;  4F22 A;  2O1L A;  1MH4 A;  1SW2 A;  4G4P A;  1PBQ A;  3K1P A;  1A40 A;  4RK9 A;  4U4X A;  2X26 A;  3I3V A;  4H8J A;  5TP9 B;  1SD3 A;  4BDM A;  1QKB A;  1QW0 A;  2AL5 A;  4OET A;  4X9T A;  1FQA A;  1VR5 A;  2XXW A;  1B3F A;  2LAO A;  3RTW B;  2QPQ A;  5BUU A;  1QJM A;  1XVY A;  5J1D A;  2ZNS A;  2XHD A;  1NNP A;  3TEL A;  2B3B A;  2H25 A;  3T66 A;  4ISU A;  3OD7 A;  4U2R A;  5I84 A;  4GLI A;  4OZ9 A;  1FTK A;  2DVC A;  3K4U A;  4NF8 A;  3QAX A;  3VXC A;  1US5 A;  4RY1 A;  2VD3 A;  4FJP A;  1M5F A;  3IB1 A;  1Y9U A;  3FJG A;  1IXI A;  3LSX A;  5ITO A;  1B3E A;  3I5O A;  4G8N A;  3FAS A;  5DYH A;  5IKB A;  2P1S A;  1EU8 A;  4NF6 B;  3JYR A;  2UYF A;  1MS7 A;  1DSN A;  3CG3 A;  2GH9 A;  2RC9 A;  3UGW A;  4FEB A;  4GF8 A;  2B65 A;  4ZED A;  2VHA A;  4LQ2 A;  4QSC A;  5CRY A;  5AA2 B;  3ZKK A;  3HHF A;  1Y4C A;  1EZO A;  3ZS6 A;  1SI1 A;  2PT2 A;  1SBP A;  3E3K A;  3QYT A;  2BJJ X;  2DE2 A;  2Q89 A;  2A5T A;  1MG1 A;  1DTG A;  4GFR A;  3H6T A;  4F19 A;  3G7W A;  4YKI A;  4YMA A;  4JWY A;  2REG A;  1B51 A;  1POY 1;  2DQV A;  3U72 A;  1B05 A;  1LAG E;  3SES A;  3TMG A;  1B40 A;  4YB6 A;  4C0R A;  4DXC A;  2VGQ A;  5KDT A;  1OVT A;  1R9L A;  1BLF A;  5JK4 A;  3QUJ A;  4LUB A;  5FHO A;  3TZA A;  4BDQ A;  5I2N A;  2F7B A;  3TCG A;  3MC2 A;  2CMO A;  1A8F A;  3KN3 A;  2XXP A;  3VVD A;  4MH5 A;  3FJM A;  1LFI A;  1P1O A;  3OO6 A;  1Y1M A;  2X7P A;  3QIM A;  2FYI A;  2I3W A;  1GR2 A;  5AA2 D;  3TKD A;  1MXZ A;  1FTL A;  4XKQ A;  1B7U A;  3M3K A;  4LAT A;  3CFZ A;  1N3W A;  3H3G A;  4RPO A;  3VV5 A;  3R6U A;  3EF7 A;  1B58 A;  4HS7 A;  3PUV E;  2F35 A;  2F6P A;  3MZ9 A;  2NOO A;  1P1Q A;  1II5 A;  4H65 A;  3TDJ A;  4LVQ A;  3FV1 A;  1MXV A;  4GD5 A;  1GVC A;  1LCT A;  1XHY A;  1ZMG A;  1GGG A;  3H06 B;  3PUY E;  1N04 A;  4OWD A;  2DWH A;  1ZU0 A;  1SYI A;  4KQP A;  3MUQ A;  3ECR A;  4OQO A;  1MQJ A;  1MQH A;  5F1Q A;  2Z22 A;  3IOW A;  3MP6 A;  2VOZ A;  3HO7 A;  3UA8 A;  4MFI A;  2Z8D A;  1VFD A;  1WVJ A;  3R26 A;  5I56 B;  1Y3N A;  2H5Y A;  2Q8J A;  3N6U A;  3C9H A;  4JWX A;  5CMB A;  3V8X B;  3H6V A;  2V84 A;  4GL8 A;  2QL3 A;  3M3F A;  4C1U A;  1MDP 1;  2UVG A;  4IO3 A;  3S2V A;  2F7A A;  5FHN A;  5JTY A;  1MDQ A;  2R6G E;  3LSL A;  2G29 A;  5H8H A;  5KCJ B;  1B4H A;  4FIM A;  3IAZ A;  2Y84 A;  1A54 A;  4IO7 A;  4G68 A;  1B7Z A;  1LBC A;  1PB9 A;  4RJZ A;  5B70 A;  3BKI B;  1IXG A;  3E13 X;  3OEL A;  3GBA A;  1GTK A;  1YPN A;  4DE8 A;  3FAT A;  4Z7E A;  4LA9 A;  4HW8 A;  4QFN A;  2ZYK A;  3OXN A;  1FQD A;  4DCX A;  1LAH E;  2Y7P A;  1MPD A;  4TLL B;  3C4M A;  4M1V A;  4N13 A;  4YAH X;  5HBC A;  4YKP A;  1R1N A;  4O3B A;  5EHM A;  2ONS A;  4OEN A;  1BP5 A;  3Q27 A;  4H8I A;  3GBB A;  1URD A;  4R2F A;  1YTV A;  3W15 C;  4L17 A;  2RCB A;  2Y7I A;  1B5I A;  5I2K B;  2UVH A;  5AA3 A;  3TTK A;  2HQ0 A;  3KBR A;  4U4S A;  1Y1Z A;  3TTM A;  1N0T A;  3DM0 A;  1S9T A;  4GWO A;  1P1W A;  3T22 A;  3MVW A;  4QFK A;  1LBB A;  2H98 A;  3E9X A;  2NVU B;  3VVF A;  2OWS A;  3RT8 A;  3KZG A;  2Z8F A;  3U92 A;  4ZDM A;  4ZE8 A;  3QUF A;  2UXA A;  2NUV A;  3KOS A;  3CRB A;  1PB8 A;  2GRV A;  4MLV A;  3O66 A;  1N7X A;  1P1N A;  1Y3Q A;  3CIJ A;  3USD A;  4EXK A;  1IUD A;  3K1M A;  2A5S A;  1N84 A;  3E4R A;  4OVJ A;  4AB6 A;  4PFW A;  4OEV A;  3Q25 A;  2AYS A;  1N76 A;  2XXX A;  3IJO B;  5CBS A;  4QF9 A;  1LFG A;  3SEU A;  3ZKL A;  2GFE A;  4AQ4 A;  1BKA A;  1B1X A;  3KFM A;  1NH7 A;  1MXU A;  1HSE A;  3RUM A;  1TWY A;  2F7C A;  1UIV A;  3GXA A;  1D4N A;  2XXT A;  4GXS B;  4YMB A;  2I49 A;  4BDN A;  5CMM A;  3MVY A;  2XD3 A;  2XXY A;  2HFB A;  2D21 A;  3G3K A;  4LQ5 A;  3UP9 A;  3EPE A;  5H8F A;  2ZYN A;  5L9S A;  5L9M A;  4GIZ A;  4NF4 B;  1EZP A;  3EHS A;  4IO2 A;  1UTH A;  1JQF A;  1MPB A;  3C36 A;  1H44 A;  1MM7 A;  4UA8 A;  4YU0 A;  1F9B A;  1ANF A;  4OER A;  1B3L A;  3LSF B;  2HZK A;  2QS2 A;  3QK6 A;  1OQH A;  3MBP A;  5I59 A;  4FE8 A;  3C35 A;  3SEW A;  4ELR A;  1N7W A;  2F5X A;  4EQB A;  3MPK A;  5FTI A;  4DZ1 A;  2ONK E;  3DEL B;  3W9V A;  3PPR A;  1OQG A;  2R9J A;  4F29 A;  1IZ1 A;  2RF1 A;  4DIG A;  3VLV A;  2DXR A;  5M2V A;  4HTG A;  1O64 A;  4XKN A;  1PBP A;  3SEV A;  3U1O A;  3LSW A;  5CM6 A;  1Q1K A;  1XS5 A;  3FVK A;  1SW5 A;  3MZB A;  4HCW A;  1QVS A;  5A5X B;  1B3G A;  1S50 A;  3BFT A;  1B5H A;  3OO8 A;  4EUO A;  2F78 A;  1DPP A;  4MBP A;  3SER A;  3FUZ A;  4PFY A;  1DPE A;  1IIT A;  3RN8 A;  1CB6 A;  1SQY A;  1SVX B;  2UYE A;  5A5X A;  2I4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...