4JXIA

Directed evolution and rational design of a de novo designed esterase toward improved catalysis. northeast structural genomics consortium (nesg) target or184
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
410
structure length
410
Chain Sequence
SHMEVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTAMIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLCAGQTLVLIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASIVKSSYYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFLPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHPMTTSPYFLDWQIWSLFLDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMRGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution and rational design of a de novo designed esterase toward improved catalysis. Northeast Structural Genomics Consortium (NESG) Target OR184
rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
molecule keywords design cystein esterase
total genus 135
structure length 410
sequence length 410
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jxiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jxiA02
1ANFA 3M3FA 2P1SA 2YLNA 3N6UA 1OLCA 3OEMA 1MQHA 3B6QA 3QIMA 1ATGA 4YKJA 5K2XA 3K6WA 1Y4CA 3UN6A 4ELRA 1II5A 2XXIA 1B3EA 3HHGA 4IO2A 4Q30B 4ZE8A 3UORA 2H4IA 3ILUB 2NUVA 3RY3A 2HZLA 3SDFA 1LCFA 1NL5A 3G3JA 4TQUQ 3B7DA 4JBZA 2KLFA 1BTJA 4I8CA 2QS4A 4FE8A 3TQLA 4NE4A 2CMOA 2O69A 3T22A 5DYHA 3O97A 2F7AA 2AYSA 3CRBA 4JB7A 1Z7NE 3UGWA 1BLFA 3ILTB 4XXUA 2RC7A 1Y9UA 2ZXTA 4F2OA 5I57B 3VVFA 3Q25A 3OELA 1MS7A 3FZVA 1S9TA 4G77A 3O6HA 4H67A 4OMBA 1YPNA 2ZYOA 1MXUA 2Q2AA 1N76A 2VD3A 3K00A 1D9VA 4HTGA 4NF8A 3K6UA 4O3AA 3LR1A 4YMBA 1LAGE 4PQJA 4MBPA 2F7CA 1MM6A 2ZNUA 1O63A 1P99A 3S2VA 4NF8B 5I2KB 4GWOA 3MP1A 4U22A 3D4GA 3K02A 4F3BA 3IX1A 1RYXA 5H8NA 4F1YA 3GBBA 1N04A 4EQ9A 2ZYNA 1VE4A 1H3DA 1VR5A 1JEUA 4JWXA 2UYEA 1OVBA 3CVGA 3S9LC 1Z7ME 1LCTA 1POY1 2DS9A 2I6EA 2XXWA 2ESNA 1H44A 2PT1A 3N26A 4XKNA 3RPWA 3TTNA 4NMYA 3KN7A 3RN8A 3UIFA 2I58A 2Q2CA 2PBWA 1FQFA 2F97A 3TTLA 1MXYA 1PB8A 1XOCA 1FTJA 2DWJA 4KQPA 5F7VA 4ZEIA 1YTVA 1TXFA 1B5HA 1DTGA 2ZYKA 5TU0A 5I2KA 3CFLA 5I84A 4LATA 3TEPA 4FEDA 3IOVA 4FEBA 2X7QA 1FQCA 1MQGA 4DCYA 1N3XA 2Y7PA 5H8FB 3SESA 1LB9A 5HM4B 5ITPA 2FNCA 3P7IA 2XXUA 3OD7A 4Q0CA 2FYIA 2RC9A 4QSDA 4G2ZA 3SEXA 2XHDA 4JDFA 4EXKA 3N5LA 2QS3A 2ABHA 5I57A 1IUDA 2FA7A 3L6GA 1NNPA 1N0TA 1LAFE 3MZ9A 4LZ5A 3S9MC 1B9JA 3R26A 3K1NA 4ZECA 1PBPA 1UIUA 3K01A 5FTHA 3BFUA 3MZ1A 1RYOA 1M5DA 3FV2A 3V89B 2DE3A 3IL1B 4FATA 3CI8A 4YMAA 2DWIA 1R9LA 2R71A 4YB6A 1JQFA 2VD2A 1Y1MA 3BBRA 3EPEA 3FIRA 3PUXE 4OEUA 1O7TA 4Z0IA 2DWHA 3K2DA 5DVIA 3TMGA 1JW5A 4QHQA 1B51A 1LFIA 2F6GA 5ELVA 1JW1A 5EHSA 1NH7A 2DVZA 1WODA 1ZLQA 1MY0A 4DLDA 3RT6B 1N84A 1OQHA 1S7YA 2ANJA 5M2VA 1DMBA 4QFPA 3HV1A 5I59B 4LZ8A 1SW2A 1BKAA 3IAZA 1L5TA 4I9DA 4IGRA 2XXQA 4Q5TA 2V25A 4LONB 5H8HA 4GRKA 1IZ1A 4DZ1A 1BIYA 1UTHB 3RLFE 4OQOA 5ITOA 4RK9A 2NXOA 1LSTA 2HCAA 2I3VA 2Z8FA 2ZNTA 1URGA 3BFTA 3IB1A 1QUKA 2O84X 3LUYA 3Q27A 3C4MA 3O2AA 4PFWA 3T9HB 5B70A 1SW4A 2DXRA 5H8SA 4F29A 5LOMA 2VOZA 4O3CA 2QMWA 4H5FA 3T96B 3JV9A 1US4A 3CIJA 3MQ9A 5B7DA 1DPPA 3FVGA 3TCHA 1SVXB 2VP1A 5CI5A 4DIGA 1JVXA 4GXSB 5TP9B 3FGSA 2W7YA 5I56B 1AH5A 3A3CA 4IO3A 4R6YA 1B4HA 1TT1A 5AA4B 3S4UA 4P0IA 3MC2A 4O3BA 4QSCA 1LLSA 2O7UA 2B65A 1SI1A 3GLBA 2HEUA 1Y4TA 3BKIB 3T9VA 1P1QA 2F78A 2F8DA 3E13X 3LSFB 4OTEA 5I58B 2D5WA 3VXBA 2I4CA 2ZMBA 3H6WA 1ZMGA 3U8QA 2Z23A 3QK6A 1M5FA 4QRZA 3C35A 1NNFA 1XS5A 4PE5B 4GLIA 4TLMB 4EUOA 4F1UA 4F1VA 4DXBA 4LA9A 1H45A 2UXAA 3EHUA 1VFEA 4JSOA 5BWJA 3KOTA 2XXYA 1KWHA 2OLBA 4RJZA 3HHFA 3H6VA 3PPRA 4P0GA 1J1NA 1USYE 2VHAA 3R6UA 2DOJA 4OENA 4YKIA 5ICTA 5AA2A 4DDDA 3RNNA 4LQ5A 5EYFA 2R6GE 2Z22A 4KPTA 1GV8A 1URSA 2F6PA 1P1WA 3IO6A 3LBSA 4R2BA 5CMCA 4F31B 4KCCA 5I58A 3FVKA 3PMXA 1M5EA 2HFBA 2HAVA 4N07A 2F7BA 4OFOA 4NWCA 4RXLA 5HBCA 3KG2A 3H06B 3IK6B 1DOTA 1LBBA 4IO5A 3T9UA 5CMBA 4AQ4A 4POWA 2PT2A 3TODA 1B58A 4GOTA 4XIGQ 3D4CA 3USDA 2UYFA 1PC3A 4QF9A 4HW8A 3IJXB 4GL8A 4YAHX 3FJMA 2HZKA 3IOWA 3M3KA 4C1TA 3Q26A 5KCJB 5TPAA 2OJTA 4OVJA 1MY2A 5JTYB 2YPNA 3W15C 2HQ0A 3S9NC 5I2NA 2A5TA 3O6GA 2I4BA 5AA2D 4LUBA 2Q88A 1RKMA 3FATA 5BUUA 2DE2A 4FJPA 4G68C 5DVFA 2DVCA 3MVZA 1Y3QA 4BDMA 3EHSA 3HCQA 3PD9A 4U2RA 4X48A 1Y3PA 3CSGA 3QYTA 1PB9A 4FAJA 3FV1A 1IXGA 3ODBA 4GIZA 3M3LA 4H0WA 1EZ9A 5DT6A 1GTKA 2LAOA 3C33A 3HN0A 2V93A 1MH3A 3SERA 1UQWA 3U72A 1NKXA 2OWSA 2AL5A 3K0VA 1GVCA 2DWAA 2Q8JA 3KJ7A 3OENA 1MXWA 1MY3A 4GD5A 4H8JA 2DQVA 4F2QA 1MG1A 1MY1A 4YB7A 2I49A 3RT8A 3T9XB 2I3WA 3OMBA 2H5YA 2O1LA 1SYIA 3C36A 2XD2A 3VVDA 1UTHA 3W9WA 1TFAA 1B5IA 5FHOA 3WAFA 3TTMA 1LAHE 1FTLA 1UIVA 2I0BA 1SD3A 3IOTA 1MDQA 2H25A 4OERA 1A54A 1FW0A 4G68A 3B6WA 5H8QB 1N3WA 3TDJA 4ESXA 2DE4A 5HPQA 4F39A 4Q8RA 3OO7A 3OEKA 3WAEA 1XC1A 1A99A 3KSJA 4NF4B 2H9BA 2R9JA 4MF3A 1NMUA 3H3GA 3MP8A 5DTBA 4I62A 2A5SA 2QS1A 3QAXA 4WEPA 4R6HA 4YICA 4ZEKA 4HCYA 5JEIA 2PMSA 1B3LA 4KR5A 3MVWA 3SEWA 3PMWA 4F3SA 4U4SA 4ECFA 3S9EA 1AL3A 2XX7A 1JEVA 3LC8A 3KOSA 4IB2A 2O51A 4NEDA 2QJEA 4C1UA 3KZGA 3PUWE 1B32A 3CG1A 4KFQA 2WKYA 4GFRA 4ZDMA 1B46A 1SDXA 4POXA 3U92A 2GRVA 4RPNA 1SI0A 4DE8A 1GGGA 2DSFA 2QRYA 2RCBA 4KHZE 4X9TA 3RQTA 3RTWB 4EXLA 1IXCA 1CE2A 2REGA 3ECRA 3HSTA 5FTIA 1B0LA 3FASA 3Q28A 5L8DA 1AMFA 3JZJA 1PEBA 1B3FA 3K6XA 3KGCA 3RGYA 2Q9TA 4R73A 2V3UA 4EF1A 3MVYA 1MPDA 3SEYA 1A8FA 2IEEA 1XVYA 1B40A 2RCAA 4KYDA 4DCXA 2V3QA 3FD3A 1DSNA 1XT8A 1B2HA 3VLVA 1AOVA 3IR1A 1QUIA 5L9MA 4FORA 4JSDA 1USYH 5FHMA 4GF8A 3W9VA 4M1VA 1T0KA 1A40A 3O29A 3FJGA 4JXIA 1OQGA 2UVIA 1TFDA 1N7WA 1AIVA 1JVYA 2XD3A 1IQ7A 3HPIA 2REJA 3CFXA 1CB6A 2RKMA 3MVXA 1OIBA 3IOUA 2O68A 3PPPA 3SEUA 3T66A 1UTBB 3KBRA 1MPBA 2G29A 3RTFB 3H6UA 3ZKKA 2ZYMA 1MM7A 3TZAA 5FHNA 4XKRA 4L17A 4WXJA 2NOOA 3H6TA 3VVEA 5L9SA 4H6DA 4F18A 2Y7KA 3PMVA 5CBRA 1LGBC 2GHAA 4ZE9A 2D3IA 3FVNA 4G4PA 2PX1A 2ONSA 4MFIA 1B7ZA 1FTMA 1Y3NA 3KN8A 4H1XA 1TWYA 3G3GA 2QSXA 2Y7WA 4KCDA 3I3VA 3OSRA 4YU0A 1VFDA 2B3FA 4ND9A 4QFKA 3E3KA 1N7XA 3OOAA 3VE1B 3VLWA 3DP4A 4GXAA 3MP6A 2NVUB 2E1SA 4BDRA 1QUJA 2V84A 5I56A 3GXAA 1Y20A 2VGQA 3MPKA 1B6HA 4QFOA 4RK2A 4MLVA 3TTKA 2XXVA 3A09A 4KD5A 1IXHA 1ZTYA 1SQYA 3PPQA 1MH4A 2M8CA 4NF5A 1EU8A 4DXCA 3PD8A 1IITA 2V3TA 3MWBA 4GL0A 4R2FA 3SEVA 1YAEA 3C34A 5ISUA 4EQBA 4GQOA 4MH5A 3DLNA 4NTLA 4ZEBA 3FUZA 4IO6A 2UVJA 3EF7A 3MPLA 4G8NA 4JWOA 1MQJA 1VSOA 2F35A 3OO6A 4NF5B 4E0XA 3CG3A 3PUYE 2OZZA 4FIMA 2XXTA 3K6VA 1DPEA 4ZS9A 1QKBA 3U94A 5KCJA 1EZOA 3H03A 4KI0E 2BJJX 2QPQA 1PBQA 4LVQA 5K2YA 4QSEA 3OXNA 4RYAA 3L6HA 2H99A 4U23A 4G68B 4F3PA 5AA3A 2F5XA 3IORA 2XXRA 2ZNSA 5AA2B 2Y7RA 4IY5A 5F1QA 5J1DA 1ZBMA 1FQAA 3V5AA 1LBCA 4U1OA 1HSEA 3IB2A 3TFLA 3O66A 1O64A 2Z8EA 4M4GA 4AB6A 4BDOA 5H8NB 1P1OA 3DP8A 1B0HA 1Y1ZA 3G7WA 4ESWA 3UK4A 4QFLA 1IEJA 1ZIUA 3OSQA 1MQDA 1FTKA 2OBGA 3EHTA 3KSXA 3EQ1A 1JW4A 4R6KA 2YJPA 4R9GA 2O1MA 3K1PA 1FTOA 3N94A 1I69A 1SBPA 2ONRA 1FQDA 1SYHA 1ZJLA 2QS2A 3FXQA 2H98A 3LSXA 4H8IA 3I6VA 3O9PA 1I6QA 4N13A 4N6PA 4JWYA 2I0CA 4UACA 3T93B 3KEIA 2P2AA 1MY4A 1XHYA 3DP6A 1MRPA 3PUVE 1UTBA 3RUMA 3TYHA 5IAIA 4KYSA 3GBAA 4K3FA 4OFJA 4U4XA 4BDLA 4YB5A 4EF2A 3C32A 4ZEDA 1LB8A 2IA4A 1D9YA 1OMPA 3FXRA 3H7MA 1EH3A 3OO9A 1JNFA 3MAMA 4YKKA 2XXHA 3R7XA 3CSBA 1GR2A 2DYXA 2Y84A 3MZBA 3PUZE 5TP9A 4IGTA 3C31A 3TKDA 1D3KA 4F3GA 1ZKBA 5JTYA 2RF1A 3AXFA 5TPAB 1A55A 3QUFA 4NWDA 4PFYA 1P1UA 5DVJA 4ZZEA 5KZTA 2GFEA 4NF6B 4TLLB 3O6IA 4H5GA 2O7IA 3VXCA 4DXUA 1QW0A 4OFLA 4R75A 1R9QA 2E0SA 5CMMA 4U21A 5CMKA 3PV0E 1B7HA 4E0WA 3FXUA 2F34A 1MQIA 4LZ7A 4XKQA 2PVUA 1NNTA 4HS7A 5KDTB 2X7PA 2OCUA 1H76A 2GH9A 3QSLA 2DXYA 3HO7A 1FCKA 2Y7IA 3KJTA 4ONYA 1LFGA 4MLQA 1LFHA 4FECA 1WVJA 1PB7A 2THIA 2AIXA 1OVTA 3TUSA 3OO8A 3MJNA 1I6AA 3G3HA 4G8HA 4PETA 5L9OA 4EDPA 1URDA 2XXXA 3ZSFA 1FQEA 2X26A 4R72A 4YKPA 3E4RA 4AB5A 2CZLA 3IJOB 2Z8DA 5H8QA 1B1HA 3QXMA 2Q89A 3IB0A 3K1MA 4OWDA 1B3GA 3DM0A 4PP0A 1DTZA 5ICQA 2OK2A 4KYEA 5A5XB 4NF6A 2A5TB 1MXZA 4OYVA 4ELPA 1M5BA 1MXXA 3F11A 3IO4A 2RC8A 3VDFA 3U93A 3QUJA 1R6ZA 3TTRA 5AA4A 2RINA 4RNSA 2F36A 3TELA 3UP9A 3CR9A 5AE4A 1QJMA 5CBSA 5IKBA 4X1BA 1XVXA 4UA8A 1HSLA 1POTA 4BDNA 3LSWA 1MPCA 4I1DA 4QFNA 5DEXA 4RY1A 5CC2A 1LAXA 3K4UA 1P1NA 4F19A 1Q35A 2UVGA 2DP8A 3V83A 2UVHA 3FVOA 1QKAA 3UA8A 1NH8A 4WKMA 4LQ2A 1F9BA 4ZZAA 4EQ7A 1FQBA 1HSJA 4G8MA 3SETA 1QVSA 3PU5A 1ELJA 4WEDA 4ELQA 3PPOA 4ELOA 3I5OA 1OLAA 4X1DA 1EZPA 4F22A 3DELB 1B3HA 3SKPA 3THIA 3VLUA 3VV5A 3U1OA 5JK4A 4OHNA 2XX9A 4YZZA 5H8HB 5I2NB 4Z7EA 1ZU0A 2O6AA 1I6BA 1MDP1 3O28A 4NF4A 4XKPA 2B3BA 3TAJA 3VFJA 3TCGA 1H43A 5A5XA 1WDNA 3GZGA 4OEVA 1BP5A 1B05A 1B52A 2G93A 2P0SA 3JYRA 1B5JA 1SW5A 4IO4A 3N6TA 3V8XB 4U1ZA 4BDQA 3ZKLA 1QULA 2NWJA 3MUQA 1IIWA 3H4ZA 3FJ7A 4IO7A 1S50A 5CM6A 1R1NA 4TOZA 4RPOA 4LP2B 4XTCQ 2AL4A 3PPNA 3MBPA 1IXIA 3B6TA 4BLAA 2QL3A 1JETA 4OZ9A 2XXPA 1MXVA 2I48A 4GVOA 1A7LA 1B4ZA 2D21A 4ZEFA 2ALUA 3CFZA 3TQWA 2OWTA 1NFTA 5KDTA 1PDAA 5EHMA 5H8FA 3PGFA 1D4NA 1Q1KA 3EN3A 3KFMA 3ZS6A 2HXWA 3M8UA 1US5A 5CRYA 3Q29A 4C0RA 1B7UA 1NNKA 3TPAA 4OESA 4R9FA 5AA1A 1M5CA 3A3UA 4HCWA 4R74A 3KN3A 2GHBA 4PFTA 4THIA 2QMXA 1A8EA 3G3IA 4RA1A 3G3FA 1YCJA 4IY6A 4OETA 4OXVA 4PFUA 3C9HA 4H65A 1B1XA 3G3KA 2HAUA 2ONKE 3ONMA 3MW0A 2PYYA 4ISUA 5DEXB 2XX8A 3TCFA 3E9XA 3LSLA 4P11A 5I59A 1SW1A
chains in the Genus database with same CATH superfamily
3N6UA 4ELRA 4YKJA 3K6WA 1II5A 4ZE8A 4IO2A 4Q30B 3ROJA 3RY3A 2XWIA 1NL5A 3B7DA 4JBZA 4I8CA 2F7AA 1NUWA 3UGWA 4XEQA 1BLFA 5EYGA 2RC7A 5ET8A 5ET5A 3O6HA 4OMBA 1MXUA 2VD3A 4HTGA 4NF8A 5IZ3B 4PGNA 4MBPA 5EQ9A 4O7IA 3S2VA 4XFEA 5I2KB 4GWOA 4U22A 3D4GA 4F3BA 3IX1A 4F1YA 1N04A 5DW8A 1FPBA 3KBZA 2UYEA 3CVGA 3S9LC 1Z7ME 2I6EA 1FBHA 3UIFA 1YXIA 4KXPA 1PB8A 1TXFA 5TU0A 5I2KA 3IOVA 2X7QA 2FNCA 3P7IA 4MAGA 2XXUA 4QSDA 4G2ZA 4JDFA 2QS3A 4AS5A 1IUDA 1NNPA 1LAFE 4ZECA 3K01A 3FV2A 4FATA 3CI8A 2DWIA 2R71A 4NF0A 3EPEA 3PUXE 4BDMA 4Z0IA 3K2DA 5DVIA 1JW5A 1B51A 1JW1A 1WODA 1MY0A 1OQHA 1N84A 3HV1A 4GRKA 1IZ1A 3RLFE 1URGA 4DCYA 3T9HB 2FBPA 1DPPA 2VP1A 5TP9B 4I3YA 3T1BA 4R6YA 1B4HA 3S4UA 4P0IA 2O7UA 1Y4TA 3T9VA 5I58B 2ZMBA 3H6WA 3QK6A 4JVDA 5BWJA 2OLBA 2P3VA 4HE2A 4MCOA 3H6VA 3PPRA 2VHAA 4OENA 5ICTA 3KC0A 1GV8A 2HPGA 2F6PA 5I58A 4N6DA 2HFBA 2HAVA 5HBCA 4NWCA 4PAIA 3KG2A 3IK6B 4POWA 2UYFA 4GL8A 5KCJB 5TPAA 1MY2A 2A5TA 3HCQA 4X48A 4JVIA 4FAJA 1EZ9A 3RPLB 3C33A 1LBVA 3KJ7A 4H8JA 2FVZA 5A5LA 4NN3A 2CZKA 2H5YA 2O1LA 1FTLA 1UIVA 1MDQA 1A54A 1FW0A 4G68A 3B8BA 2DE4A 4F39A 3IFAA 1FBCA 4NF4B 5DTBA 1NMUA 3H3GA 5LTCA 1FBFA 5JEIA 2PMSA 4KR5A 1NV1A 3S9EA 4C1UA 4IB2A 2O51A 3KZGA 4KFQA 4X9TA 1IXCA 1CE2A 3HSTA 1B0LA 4R73A 1MPDA 2IEEA 3VLVA 4FORA 4MEVA 3FJGA 1JVYA 1OIBA 2O68A 3PTYA 2G29A 3H6UA 2ZYMA 2NOOA 4GWUA 3H6TA 3VVEA 5L9SA 1G0IA 1Y3NA 3KN8A 4H1XA 1TWYA 4KCDA 4YU0A 3E3KA 1N7XA 3VE1B 3DP4A 4GXAA 2PFYA 1QUJA 1Y20A 2VGQA 4RK2A 3A29A 4MLVA 1NV7A 3TTKA 4KD5A 1IXHA 1ZTYA 2XWOA 3PPQA 3PD8A 2V3TA 4G8NA 3EF7A 4FIMA 4FBPA 3U94A 4LVQA 2BJJX 2QPQA 3L6HA 4G68B 4IY5A 5J1DA 1ZBMA 2Y5LA 1LBCA 4U1OA 1HSEA 3O66A 2Z8EA 4AB6A 3IFCA 1P1OA 3DP8A 3G7WA 3OSQA 4R9GA 3EHTA 3EQ1A 1JW4A 2O1MA 3N94A 1SBPA 2ONRA 4C1TA 4QFNA 5IGAA 2H98A 1I6QA 1LBXA 2I0CA 3HFUA 4UACA 3KEIA 2P2AA 3RYDA 3RUMA 1UTBA 5IAIA 2OX3A 4EF2A 4YB5A 3NOHA 3R7XA 2XXHA 1CNQA 4IGTA 3QUFA 5KZTA 4MHFA 2ZZVA 1QW0A 4OFLA 4R75A 1R9QA 2E0SA 5CMMA 3PV0E 4E0WA 4HS7A 2OCUA 4GWYA 3HO7A 4MNIA 1WVJA 4P8BA 3TUSA 3OO8A 4G8HA 1URDA 5ESYA 2CZLA 1IMFA 5A5XB 4NF6A 1MXZA 1MXXA 2RC8A 3U93A 3UP9A 4UA8A 1MPCA 4I1DA 3K4UA 1NUZA 4F19A 2UVHA 2WYKA 4WKMA 4LQ2A 1QVSA 1ELJA 4WEDA 4ELOA 1OLAA 3SKPA 3VLUA 4N8GA 3VV5A 4DI4B 4YZZA 1LEVA 4Z7EA 4P9KA 4XKPA 2B3BA 3TAJA 3TCGA 2G93A 3V8XB 3SZPA 4BDQA 3ZKLA 1R1NA 4RPOA 4XTCQ 2QL3A 5FBPA 1MXVA 2I48A 2D21A 4ZEFA 3ISPA 1NFTA 5KDTA 3PGFA 1D4NA 1Q1KA 3EN3A 1FBPA 3KFMA 1US5A 4C0RA 1NNKA 3TPAA 4OVRA 1M5CA 4PCDA 3KN3A 2GHBA 2F3BA 4THIA 3C9HA 3TCFA 3MW0A 4ISUA 3E9XA 5I59A 2CZHA 2Q8JA 1OLCA 3B6QA 1ATGA 2H4IA 3ILUB 2CEYA 2HZLA 3SDFA 4TQUQ 3G3JA 3TQLA 5DYHA 3O97A 4JB7A 4N6KA 3VVFA 3OELA 3FZVA 1S9TA 2ZYOA 2Q2AA 4O3AA 1N76A 4YMBA 2F7CA 1O63A 1JP4A 4NF8B 3K02A 3GBBA 4EQ9A 2ZYNA 1OVBA 3RPWA 1FBGA 2ESNA 1H44A 2PT1A 3TTNA 4NMYA 2I58A 2PBWA 1FQFA 3TTLA 1MXYA 1FPEA 1K9ZA 1FTJA 5F7VA 1B5HA 1DTGA 2ZYKA 3CFLA 5I84A 3E79A 4FEBA 1FQCA 3SESA 5H8FB 1LB9A 4Q0CA 5EQ8A 2ABHA 5I57A 1N0TA 4LZ5A 3K1NA 3QMFA 2DE3A 1R9LA 4YB6A 1JQFA 2VD2A 3FIRA 1FPJA 1O7TA 3TMGA 1ZLQA 4DLDA 1DMBA 4QFPA 5I59B 1SW2A 1BKAA 4I9DA 2V25A 4PGPA 4HE1A 2NXOA 2ZNTA 3IB1A 1SW4A 4P1LA 5H8SA 4F29A 2FIEA 3MQ9A 5B7DA 3FVGA 2JJKA 4DIGA 2W7YA 5I56B 3A3CA 4IO3A 5AA4B 2QVVA 3MC2A 4O3BA 2B65A 3GLBA 3BIGA 3LSFB 3VXBA 3U8QA 2PFZA 4PE5B 4GLIA 2UXAA 4JSOA 3EHUA 1VFEA 3MYUA 4RJZA 4X8RA 1NI9A 4YKIA 3R6UA 4DDDA 4NX1A 2Z22A 4R2BA 5CMCA 3LBSA 3PMXA 1M5EA 4RXLA 1DOTA 5CMBA 2V4CA 3TODA 1B58A 4GOTA 4XIGQ 4QF9A 3FJMA 4OVSA 2HZKA 3Q26A 2YPNA 5I2NA 4HXVA 5BUUA 4G68C 5DVFA 4U2RA 3FV1A 1IXGA 3ODBA 4H0WA 5DT6A 4N17A 3U72A 1NKXA 3K0VA 1SPIA 1GVCA 1MXWA 4IR8A 1LBYA 4YB7A 3RT8A 4GBWA 3OMBA 3C36A 2XD2A 3VVDA 1UTHA 5AA2A 4N8YA 3IOTA 2I0BA 4OERA 1FTAA 3TDJA 3B6WA 1N3WA 4ESXA 3CHGA 1INPA 3OEKA 3WAEA 1XC1A 3KSJA 4MF3A 4ESWA 4ZEKA 4PTKA 1B3LA 3MVWA 3SEWA 3PMWA 4U4SA 2XX7A 5LDZA 3KOSA 1B46A 1SDXA 4POXA 4DE8A 2DSFA 3RQTA 4PF6A 3FASA 1PEBA 1B3FA 3SEYA 1XVYA 2RCAA 4DCXA 1B2HA 3IR1A 5IM2A 2PCRA 1IMBA 1AIVA 3SEUA 3T66A 1MPBA 4L17A 4H6DA 4F18A 1LGBC 4ZE9A 2Q8MA 2PX1A 4MFIA 2Y7WA 3I3VA 3OSRA 1NUXA 4ND9A 3MP6A 1EYJA 3FXBA 3GXAA 4QFOA 2XXVA 1IITA 4R2FA 5ISUA 3C34A 4EQBA 4NTLA 2UVJA 1VSOA 3PUYE 4MX6A 5KCJA 4KI0E 5K2YA 4NAPA 4QSEA 4RYAA 2H99A 2FHYA 1FBDA 4M4GA 5H8NB 1B0HA 1Y1ZA 1FSAA 2WYPA 3KSXA 3K1PA 3LSXA 1SYHA 2QS2A 4N6PA 4H45A 1MRPA 4KYSA 4OVTA 4BDLA 4U4XA 3FXRA 1LBWA 1EH3A 2WX9A 3MAMA 2DYXA 5TP9A 1ZKBA 2RF1A 3AXFA 5DVJA 4ZZEA 2GFEA 4G61A 4U21A 5CMKA 2F34A 1NNTA 2X7PA 2DXYA 2Y7IA 3KJTA 4MLQA 1LFHA 1VDWA 2THIA 2AIXA 3BIHA 1OVTA 5EQAA 1I6AA 4PETA 2XXXA 4R72A 4PFIA 4YKPA 4AB5A 3IJOB 1B1HA 2QFLA 2KR0A 3DM0A 4PP0A 5ICQA 4KYEA 3IO4A 1LBZA 4OA4A 4OVQA 1R6ZA 2HHMA 3TTRA 2RINA 5AA4A 2F36A 3TELA 3CR9A 1POTA 5DEXA 4RY1A 1LAXA 4O8MA 2DP8A 1NH8A 4ZZAA 3SETA 4G8MA 4ELQA 3I5OA 1EZPA 1NV6A 1WDNA 1RDXA 3GZGA 1B05A 1SW5A 4U1ZA 1RDZA 3MUQA 2AL4A 3B6TA 4PFRA 1A7LA 3CFZA 1PDAA 4HCWA 4RA1A 4H65A 3UORA 3LSLA 1SW1A 1ANFA 2P1SA 2YLNA 3OEMA 4MNCA 5K2XA 1Y4CA 1RDYA 4P3LA 2XXIA 1B3EA 4QXDA 4XF5A 1LCFA 2KLFA 1BTJA 2QS4A 4NE4A 2CMOA 3CRBA 1Z7NE 5ET7A 1YYZA 3ILTB 2ZXTA 3GYYA 4H67A 1YPNA 2VPOA 3K6UA 3LR1A 1LAGE 4PQJA 2ZNUA 1MM6A 1P99A 3MP1A 5H8NA 1H3DA 1VR5A 1JEUA 4JWXA 3KN7A 3RN8A 4OANA 4P56A 2F97A 2DWJA 4ZEIA 4LATA 3TEPA 1MQGA 2Y7PA 5HM4B 3FBPA 3T0JA 2FYIA 2RC9A 3SEXA 3N5LA 2FA7A 3L6GA 3R26A 3KC1A 1PBPA 1UIUA 3BFUA 1RYOA 3V89B 3IL1B 4YMAA 1Y1MA 1NV5A 1LFIA 1NH7A 2DVZA 2Q74A 2VPNA 1L5TA 4IGRA 4Q5TA 4LONB 4DZ1A 1BIYA 1UTHB 5ITOA 1LSTA 2I3VA 3LUYA 3WAFA 4PFWA 5LOMA 4GX3A 4O3CA 2QMWA 2MKZA 4H5FA 3T96B 5CI5A 1JVXA 4GXSB 4JVCA 1LLSA 3BKIB 2F78A 2D5WA 2I4CA 2Z23A 3C35A 1XS5A 2XWKA 1DCUA 4F1VA 4LA9A 1H45A 1J1NA 1USYE 1FPGA 2QVUA 4GX6A 3RNNA 2R6GE 1P1WA 3IO6A 4F31B 3FVKA 4OFOA 4IO5A 2PT2A 5I7IA 3USDA 3IOWA 4OVJA 3W15C 4P47A 4LUBA 2Q88A 2DE2A 2DVCA 1Y3QA 1FPKA 1Y3PA 2LAOA 3SERA 1MH3A 2HXRA 1UQWA 2OWSA 2DWAA 4GD5A 2DQVA 4F2QA 1MG1A 3T9XB 2I3WA 4PAFA 1QGXA 1TFAA 1B5IA 5FHOA 4O94A 2H25A 5H8QB 4Q8RA 1EYIA 2R9JA 3MP8A 4I62A 2QS1A 4R6HA 1NV3A 1AL3A 3LC8A 3CG1A 3U92A 2GRVA 1SI0A 4P1EA 2QRYA 4KHZE 4EXLA 1KA1A 1AWBA 1Q9DA 1AMFA 1XI6A 2WBDA 2V3QA 1IMDA 5L9MA 1USYH 1A40A 4JXIA 1OQGA 2UVIA 4X04A 1FJ6A 2REJA 1CB6A 3MVXA 3IOUA 3PPPA 3ZKKA 1MM7A 5FHNA 4I3EA 2L5VA 3PMVA 1NUYA 2GHAA 5CBRA 1EYKA 3E78A 3G3GA 4QFKA 3VLWA 2E1SA 2V84A 3MPKA 1FPLA 3A09A 5I3SA 1SQYA 4DXCA 2M8CA 4NF5A 4MH5A 4ZEBA 3FUZA 2P3NA 4JWOA 1MQJA 3OO6A 2F35A 3CG3A 2OZZA 4ZS9A 1DPEA 1QKBA 1PBQA 2F3DA 3OXNA 4UABA 4U23A 4F3PA 2F5XA 3IORA 2XXRA 2R8TA 5F1QA 1FQAA 3U65A 3IB2A 1O64A 3UK4A 1IEJA 1ZIUA 1MQDA 2OBGA 2YJPA 1I69A 1ZJLA 3FXQA 4H8IA 4N13A 3I6VA 1KA0A 3T93B 1MY4A 1XHYA 2XA5A 3PUVE 3TYHA 2GQ1A 2IA4A 3H7MA 3OO9A 1JNFA 4YKKA 5I5PA 3PUZE 4F3GA 5TPAB 1A55A 4NWDA 1IMAA 4NF6B 4TLLB 3O6IA 2O7IA 3VXCA 4DXUA 2VT5A 1B7HA 4XKQA 5IZ3A 4QBAA 2GH9A 4I40A 1FCKA 4FECA 2XXKA 3EKIA 2X26A 4DI3D 3E4RA 2Q89A 3IB0A 3K1MA 4OWDA 1B3GA 1DTZA 2OK2A 4PE3A 4OYVA 4MNPA 2XWVA 3QUJA 5J16A 1FRPA 5CBSA 5IKBA 5AE4A 1HSLA 4BDNA 3LSWA 5CC2A 2UVGA 3V83A 3FVOA 3UA8A 1F9BA 4EQ7A 3PU5A 3PPOA 4X1DA 3THIA 5JK4A 3U1OA 4OHNA 4PFBA 2XX9A 5I2NB 1ZU0A 2O6AA 1I6BA 1MDP1 3O28A 4NF4A 4OEVA 3JYRA 1FBEA 3N6TA 4GWXA 1IIWA 4HE0A 3FJ7A 1S50A 4TOZA 3MBPA 1G0HA 1JETA 2XXPA 4GVOA 2ALUA 2OWTA 3Q29A 1B7UA 4R74A 3A3UA 4PFTA 1A8EA 3G3IA 3MSTA 4IY6A 4OETA 4OXVA 4PFUA 2HAUA 2ONKE 2B4MA 2PYYA 5DEXB 2XX8A 4P11A 5EYHA 3M3FA 1MQHA 3UN6A 3QIMA 3HHGA 2NUVA 2WBBA 4GWWA 4FE8A 2O69A 2AYSA 4XXUA 5IZ1A 1Y9UA 5I57B 4F2OA 3Q25A 1MS7A 4G77A 3K00A 3T22A 1D9VA 2OWZA 2DDKA 4MIJA 1RYXA 1VE4A 1LCTA 1POY1 2DS9A 2XXWA 4XKNA 3N26A 2Q2CA 1FPFA 1XOCA 4KQPA 2WEFA 1YTVA 2B4LA 4NQ8A 4FEDA 1N3XA 5ITPA 3OD7A 2XHDA 4EXKA 4N4UA 3MZ9A 3S9MC 1B9JA 5FTHA 3MZ1A 1M5DA 4PF8A 3BBRA 4NHBA 4OEUA 1K9YA 2DWHA 4QHQA 2F6GA 5ELVA 5EHSA 4PDDA 3LV0A 3RT6B 1S7YA 2ANJA 4MJOA 5M2VA 4LZ8A 3IAZA 2XXQA 4LN5A 5H8HA 4OQOA 4RK9A 2HCAA 2Z8FA 3Q27A 3ZS6A 3BFTA 1QUKA 2O84X 3C4MA 3O2AA 5B70A 2DXRA 2VOZA 1FPIA 3JV9A 1US4A 3CIJA 3TCHA 1SVXB 3FGSA 1AH5A 1TT1A 4QSCA 1FJ9A 1SI1A 2HEUA 1P1QA 3E13X 2F8DA 4OTEA 1ZMGA 1M5FA 4QRZA 1NNFA 4TLMB 4EUOA 4F1UA 4DXBA 3KOTA 4GBVA 2XXYA 1KWHA 3HHFA 4P0GA 2DOJA 4LQ5A 5EYFA 2Y5KA 4KPTA 1URSA 4KCCA 4N07A 2F7BA 5EQ7A 3H06B 1LBBA 3T9UA 4AQ4A 4HW8A 3D4CA 1PC3A 3IJXB 4YAHX 3M3KA 2OJTA 5IZZA 5JTYB 2HQ0A 3S9NC 3O6GA 2I4BA 5AA2D 1RKMA 3FATA 4FJPA 2BJIA 3MVZA 3EHSA 3PD9A 3CSGA 3QYTA 1PB9A 4GIZA 3M3LA 1DK4A 1GTKA 3HN0A 2V93A 2AL5A 3OENA 2ZZWA 1MY3A 1MY1A 2I49A 1SYIA 3W9WA 3TTMA 1LAHE 1SD3A 5F24A 5HPQA 3OO7A 4N81A 1A99A 4N15A 2H9BA 1IMCA 5T3JA 2A5SA 3QAXA 4WEPA 4YICA 4HCYA 4F3SA 4ECFA 1JEVA 4NEDA 2QJEA 3PUWE 1B32A 4GX4A 2WKYA 4GFRA 4ZDMA 4RPNA 1GGGA 2RCBA 3RTWB 2REGA 3ECRA 4GWZA 5FTIA 4PBHA 3Q28A 5L8DA 3JZJA 3K6XA 3KGCA 3RGYA 1D9QA 2Q9TA 2V3UA 4EF1A 3MVYA 1NV2A 1A8FA 1B40A 4KYDA 3FD3A 1DSNA 1XT8A 1AOVA 1QUIA 5FHMA 4JSDA 3W9VA 1T0KA 4GF8A 4M1VA 3O29A 1TFDA 1N7WA 2XD3A 1IQ7A 3HPIA 3CFXA 2RKMA 3ZSFA 1UTBB 3KBRA 3RTFB 1FPDA 3TZAA 4XKRA 4WXJA 2Y7KA 2D3IA 3FVNA 4G4PA 2ONSA 1B7ZA 1FTMA 4N91A 2QSXA 1VFDA 3B50A 2B3FA 3OOAA 4BDRA 2NVUB 5I56A 1B6HA 1DBZA 1MH4A 1EU8A 3MWBA 4GL0A 3SEVA 1YAEA 4GWSA 4GQOA 3DLNA 4IO6A 4NF5B 3MPLA 3LUZA 4E0XA 2XXTA 1BK4A 3K6VA 4H46A 1EZOA 3H03A 1IMEA 4NG7A 5AA3A 2ZNSA 2KQZA 5AA2B 2Y7RA 3V5AA 3TFLA 4BDOA 4PBQA 4R6KA 1FTKA 4QFLA 1FTOA 1FQDA 2QVRA 1NV4A 1KZ8A 3O9PA 4JWYA 3DP6A 4NGUA 3GBAA 4K3FA 4OFJA 4ZEDA 3C32A 1LB8A 1D9YA 1OMPA 3CSBA 1GR2A 2Y84A 3MZBA 3TKDA 3C31A 5JTYA 1D3KA 1NV0A 2CEXA 4PDHA 4PFYA 1P1UA 4H5GA 3FXUA 1MQIA 4LZ7A 2PVUA 5KDTB 1H76A 3QSLA 4ONYA 1LFGA 5ET6A 1PB7A 3MJNA 3G3HA 5L9OA 4EDPA 1FQEA 2Z8DA 5H8QA 3QXMA 2A5TB 4ELPA 1M5BA 3F11A 3D1RA 3VDFA 4AS4A 3RPLA 4RNSA 1QJMA 4O7MA 4X1BA 1XVXA 1P1NA 1Q35A 1QKAA 1FQBA 1HSJA 4F22A 3DELB 1B3HA 5H8HB 2CZIA 3VFJA 1H43A 5A5XA 4PC9A 1BP5A 1B52A 2P0SA 4IO4A 1B5JA 1QULA 4OVPA 2NWJA 3H4ZA 4IO7A 5CM6A 4LP2B 3PPNA 1IXIA 4BLAA 1YZ0A 4OZ9A 1B4ZA 3TQWA 5H8FA 5EHMA 2FIXA 2HXWA 2ZZXA 3M8UA 5CRYA 4OESA 4R9FA 5AA1A 4MMPA 2QMXA 3G3FA 1YCJA 1B1XA 3G3KA 3ONMA 4PAKA
chains in the Genus database with same CATH topology
1ANFA 3M3FA 2P1SA 2YLNA 3N6UA 1OLCA 3OEMA 1MQHA 3B6QA 3QIMA 1ATGA 4YKJA 5K2XA 3K6WA 1Y4CA 3UN6A 4ELRA 1II5A 2XXIA 1B3EA 3HHGA 4IO2A 4Q30B 4ZE8A 3UORA 2H4IA 3ILUB 2NUVA 3RY3A 2HZLA 3SDFA 1LCFA 1NL5A 3G3JA 4TQUQ 3B7DA 4JBZA 2KLFA 1BTJA 4I8CA 2QS4A 4FE8A 3TQLA 4NE4A 2CMOA 2O69A 3T22A 5DYHA 3O97A 2F7AA 2AYSA 3CRBA 4JB7A 1Z7NE 3UGWA 1BLFA 3ILTB 4XXUA 2RC7A 1Y9UA 2ZXTA 4F2OA 5I57B 3VVFA 3Q25A 3OELA 1MS7A 3FZVA 1S9TA 4G77A 3O6HA 4H67A 4OMBA 1YPNA 2ZYOA 1MXUA 2Q2AA 1N76A 2VD3A 3K00A 1D9VA 4HTGA 4NF8A 3K6UA 4O3AA 3LR1A 4YMBA 1LAGE 4PQJA 4MBPA 2F7CA 1MM6A 2ZNUA 1O63A 1P99A 3S2VA 4NF8B 5I2KB 4GWOA 3MP1A 4U22A 3D4GA 3K02A 4F3BA 3IX1A 1RYXA 5H8NA 4F1YA 3GBBA 1N04A 4EQ9A 2ZYNA 1VE4A 1H3DA 1VR5A 1JEUA 4JWXA 2UYEA 1OVBA 3CVGA 3S9LC 1Z7ME 1LCTA 1POY1 2DS9A 2I6EA 2XXWA 2ESNA 1H44A 2PT1A 3N26A 4XKNA 3RPWA 3TTNA 4NMYA 3KN7A 3RN8A 3UIFA 2I58A 2Q2CA 2PBWA 1FQFA 2F97A 3TTLA 1MXYA 1PB8A 1XOCA 1FTJA 2DWJA 4KQPA 5F7VA 4ZEIA 1YTVA 1TXFA 1B5HA 1DTGA 2ZYKA 5TU0A 5I2KA 3CFLA 5I84A 4LATA 3TEPA 4FEDA 3IOVA 4FEBA 2X7QA 1FQCA 1MQGA 4DCYA 1N3XA 2Y7PA 5H8FB 3SESA 1LB9A 5HM4B 5ITPA 2FNCA 3P7IA 2XXUA 3OD7A 4Q0CA 2FYIA 2RC9A 4QSDA 4G2ZA 3SEXA 2XHDA 4JDFA 4EXKA 3N5LA 2QS3A 2ABHA 5I57A 1IUDA 2FA7A 3L6GA 1NNPA 1N0TA 1LAFE 3MZ9A 4LZ5A 3S9MC 1B9JA 3R26A 3K1NA 4ZECA 1PBPA 1UIUA 3K01A 5FTHA 3BFUA 3MZ1A 1RYOA 1M5DA 3FV2A 3V89B 2DE3A 3IL1B 4FATA 3CI8A 4YMAA 2DWIA 1R9LA 2R71A 4YB6A 1JQFA 2VD2A 1Y1MA 3BBRA 3EPEA 3FIRA 3PUXE 4OEUA 1O7TA 4Z0IA 2DWHA 3K2DA 5DVIA 3TMGA 1JW5A 4QHQA 1B51A 1LFIA 2F6GA 5ELVA 1JW1A 5EHSA 1NH7A 2DVZA 1WODA 1ZLQA 1MY0A 4DLDA 3RT6B 1N84A 1OQHA 1S7YA 2ANJA 5M2VA 1DMBA 4QFPA 3HV1A 5I59B 4LZ8A 1SW2A 1BKAA 3IAZA 1L5TA 4I9DA 4IGRA 2XXQA 4Q5TA 2V25A 4LONB 5H8HA 4GRKA 1IZ1A 4DZ1A 1BIYA 1UTHB 3RLFE 4OQOA 5ITOA 4RK9A 2NXOA 1LSTA 2HCAA 2I3VA 2Z8FA 2ZNTA 1URGA 3BFTA 3IB1A 1QUKA 2O84X 3LUYA 3Q27A 3C4MA 3O2AA 4PFWA 3T9HB 5B70A 1SW4A 2DXRA 5H8SA 4F29A 5LOMA 2VOZA 4O3CA 2QMWA 4H5FA 3T96B 3JV9A 1US4A 3CIJA 3MQ9A 5B7DA 1DPPA 3FVGA 3TCHA 1SVXB 2VP1A 5CI5A 4DIGA 1JVXA 4GXSB 5TP9B 3FGSA 2W7YA 5I56B 1AH5A 3A3CA 4IO3A 4R6YA 1B4HA 1TT1A 5AA4B 3S4UA 4P0IA 3MC2A 4O3BA 4QSCA 1LLSA 2O7UA 2B65A 1SI1A 3GLBA 2HEUA 1Y4TA 3BKIB 3T9VA 1P1QA 2F78A 2F8DA 3E13X 3LSFB 4OTEA 5I58B 2D5WA 3VXBA 2I4CA 2ZMBA 3H6WA 1ZMGA 3U8QA 2Z23A 3QK6A 1M5FA 4QRZA 3C35A 1NNFA 1XS5A 4PE5B 4GLIA 4TLMB 4EUOA 4F1UA 4F1VA 4DXBA 4LA9A 1H45A 2UXAA 3EHUA 1VFEA 4JSOA 5BWJA 3KOTA 2XXYA 1KWHA 2OLBA 4RJZA 3HHFA 3H6VA 3PPRA 4P0GA 1J1NA 1USYE 2VHAA 3R6UA 2DOJA 4OENA 4YKIA 5ICTA 5AA2A 4DDDA 3RNNA 4LQ5A 5EYFA 2R6GE 2Z22A 4KPTA 1GV8A 1URSA 2F6PA 1P1WA 3IO6A 3LBSA 4R2BA 5CMCA 4F31B 4KCCA 5I58A 3FVKA 3PMXA 1M5EA 2HFBA 2HAVA 4N07A 2F7BA 4OFOA 4NWCA 4RXLA 5HBCA 3KG2A 3H06B 3IK6B 1DOTA 1LBBA 4IO5A 3T9UA 5CMBA 4AQ4A 4POWA 2PT2A 3TODA 1B58A 4GOTA 4XIGQ 3D4CA 3USDA 2UYFA 1PC3A 4QF9A 4HW8A 3IJXB 4GL8A 4YAHX 3FJMA 2HZKA 3IOWA 3M3KA 4C1TA 3Q26A 5KCJB 5TPAA 2OJTA 4OVJA 1MY2A 5JTYB 2YPNA 3W15C 2HQ0A 3S9NC 5I2NA 2A5TA 3O6GA 2I4BA 5AA2D 4LUBA 2Q88A 1RKMA 3FATA 5BUUA 2DE2A 4FJPA 4G68C 5DVFA 2DVCA 3MVZA 1Y3QA 4BDMA 3EHSA 3HCQA 3PD9A 4U2RA 4X48A 1Y3PA 3CSGA 3QYTA 1PB9A 4FAJA 3FV1A 1IXGA 3ODBA 4GIZA 3M3LA 4H0WA 1EZ9A 5DT6A 1GTKA 2LAOA 3C33A 3HN0A 2V93A 1MH3A 3SERA 1UQWA 3U72A 1NKXA 2OWSA 2AL5A 3K0VA 1GVCA 2DWAA 2Q8JA 3KJ7A 3OENA 1MXWA 1MY3A 4GD5A 4H8JA 2DQVA 4F2QA 1MG1A 1MY1A 4YB7A 2I49A 3RT8A 3T9XB 2I3WA 3OMBA 2H5YA 2O1LA 1SYIA 3C36A 2XD2A 3VVDA 1UTHA 3W9WA 1TFAA 1B5IA 5FHOA 3WAFA 3TTMA 1LAHE 1FTLA 1UIVA 2I0BA 1SD3A 3IOTA 1MDQA 2H25A 4OERA 1A54A 1FW0A 4G68A 3B6WA 5H8QB 1N3WA 3TDJA 4ESXA 2DE4A 5HPQA 4F39A 4Q8RA 3OO7A 3OEKA 3WAEA 1XC1A 1A99A 3KSJA 4NF4B 2H9BA 2R9JA 4MF3A 1NMUA 3H3GA 3MP8A 5DTBA 4I62A 2A5SA 2QS1A 3QAXA 4WEPA 4R6HA 4YICA 4ZEKA 4HCYA 5JEIA 2PMSA 1B3LA 4KR5A 3MVWA 3SEWA 3PMWA 4F3SA 4U4SA 4ECFA 3S9EA 1AL3A 2XX7A 1JEVA 3LC8A 3KOSA 4IB2A 2O51A 4NEDA 2QJEA 4C1UA 3KZGA 3PUWE 1B32A 3CG1A 4KFQA 2WKYA 4GFRA 4ZDMA 1B46A 1SDXA 4POXA 3U92A 2GRVA 4RPNA 1SI0A 4DE8A 1GGGA 2DSFA 2QRYA 2RCBA 4KHZE 4X9TA 3RQTA 3RTWB 4EXLA 1IXCA 1CE2A 2REGA 3ECRA 3HSTA 5FTIA 1B0LA 3FASA 3Q28A 5L8DA 1AMFA 3JZJA 1PEBA 1B3FA 3K6XA 3KGCA 3RGYA 2Q9TA 4R73A 2V3UA 4EF1A 3MVYA 1MPDA 3SEYA 1A8FA 2IEEA 1XVYA 1B40A 2RCAA 4KYDA 4DCXA 2V3QA 3FD3A 1DSNA 1XT8A 1B2HA 3VLVA 1AOVA 3IR1A 1QUIA 5L9MA 4FORA 4JSDA 1USYH 5FHMA 4GF8A 3W9VA 4M1VA 1T0KA 1A40A 3O29A 3FJGA 4JXIA 1OQGA 2UVIA 1TFDA 1N7WA 1AIVA 1JVYA 2XD3A 1IQ7A 3HPIA 2REJA 3CFXA 1CB6A 2RKMA 3MVXA 1OIBA 3IOUA 2O68A 3PPPA 3SEUA 3T66A 1UTBB 3KBRA 1MPBA 2G29A 3RTFB 3H6UA 3ZKKA 2ZYMA 1MM7A 3TZAA 5FHNA 4XKRA 4L17A 4WXJA 2NOOA 3H6TA 3VVEA 5L9SA 4H6DA 4F18A 2Y7KA 3PMVA 5CBRA 1LGBC 2GHAA 4ZE9A 2D3IA 3FVNA 4G4PA 2PX1A 2ONSA 4MFIA 1B7ZA 1FTMA 1Y3NA 3KN8A 4H1XA 1TWYA 3G3GA 2QSXA 2Y7WA 4KCDA 3I3VA 3OSRA 4YU0A 1VFDA 2B3FA 4ND9A 4QFKA 3E3KA 1N7XA 3OOAA 3VE1B 3VLWA 3DP4A 4GXAA 3MP6A 2NVUB 2E1SA 4BDRA 1QUJA 2V84A 5I56A 3GXAA 1Y20A 2VGQA 3MPKA 1B6HA 4QFOA 4RK2A 4MLVA 3TTKA 2XXVA 3A09A 4KD5A 1IXHA 1ZTYA 1SQYA 3PPQA 1MH4A 2M8CA 4NF5A 1EU8A 4DXCA 3PD8A 1IITA 2V3TA 3MWBA 4GL0A 4R2FA 3SEVA 1YAEA 3C34A 5ISUA 4EQBA 4GQOA 4MH5A 3DLNA 4NTLA 4ZEBA 3FUZA 4IO6A 2UVJA 3EF7A 3MPLA 4G8NA 4JWOA 1MQJA 1VSOA 2F35A 3OO6A 4NF5B 4E0XA 3CG3A 3PUYE 2OZZA 4FIMA 2XXTA 3K6VA 1DPEA 4ZS9A 1QKBA 3U94A 5KCJA 1EZOA 3H03A 4KI0E 2BJJX 2QPQA 1PBQA 4LVQA 5K2YA 4QSEA 3OXNA 4RYAA 3L6HA 2H99A 4U23A 4G68B 4F3PA 5AA3A 2F5XA 3IORA 2XXRA 2ZNSA 5AA2B 2Y7RA 4IY5A 5F1QA 5J1DA 1ZBMA 1FQAA 3V5AA 1LBCA 4U1OA 1HSEA 3IB2A 3TFLA 3O66A 1O64A 2Z8EA 4M4GA 4AB6A 4BDOA 5H8NB 1P1OA 3DP8A 1B0HA 1Y1ZA 3G7WA 4ESWA 3UK4A 4QFLA 1IEJA 1ZIUA 3OSQA 1MQDA 1FTKA 2OBGA 3EHTA 3KSXA 3EQ1A 1JW4A 4R6KA 2YJPA 4R9GA 2O1MA 3K1PA 1FTOA 3N94A 1I69A 1SBPA 2ONRA 1FQDA 1SYHA 1ZJLA 2QS2A 3FXQA 2H98A 3LSXA 4H8IA 3I6VA 3O9PA 1I6QA 4N13A 4N6PA 4JWYA 2I0CA 4UACA 3T93B 3KEIA 2P2AA 1MY4A 1XHYA 3DP6A 1MRPA 3PUVE 1UTBA 3RUMA 3TYHA 5IAIA 4KYSA 3GBAA 4K3FA 4OFJA 4U4XA 4BDLA 4YB5A 4EF2A 3C32A 4ZEDA 1LB8A 2IA4A 1D9YA 1OMPA 3FXRA 3H7MA 1EH3A 3OO9A 1JNFA 3MAMA 4YKKA 2XXHA 3R7XA 3CSBA 1GR2A 2DYXA 2Y84A 3MZBA 3PUZE 5TP9A 4IGTA 3C31A 3TKDA 1D3KA 4F3GA 1ZKBA 5JTYA 2RF1A 3AXFA 5TPAB 1A55A 3QUFA 4NWDA 4PFYA 1P1UA 5DVJA 4ZZEA 5KZTA 2GFEA 4NF6B 4TLLB 3O6IA 4H5GA 2O7IA 3VXCA 4DXUA 1QW0A 4OFLA 4R75A 1R9QA 2E0SA 5CMMA 4U21A 5CMKA 3PV0E 1B7HA 4E0WA 3FXUA 2F34A 1MQIA 4LZ7A 4XKQA 2PVUA 1NNTA 4HS7A 5KDTB 2X7PA 2OCUA 1H76A 2GH9A 3QSLA 2DXYA 3HO7A 1FCKA 2Y7IA 3KJTA 4ONYA 1LFGA 4MLQA 1LFHA 4FECA 1WVJA 1PB7A 2THIA 2AIXA 1OVTA 3TUSA 3OO8A 3MJNA 1I6AA 3G3HA 4G8HA 4PETA 5L9OA 4EDPA 1URDA 2XXXA 3ZSFA 1FQEA 2X26A 4R72A 4YKPA 3E4RA 4AB5A 2CZLA 3IJOB 2Z8DA 5H8QA 1B1HA 3QXMA 2Q89A 3IB0A 3K1MA 4OWDA 1B3GA 3DM0A 4PP0A 1DTZA 5ICQA 2OK2A 4KYEA 5A5XB 4NF6A 2A5TB 1MXZA 4OYVA 4ELPA 1M5BA 1MXXA 3F11A 3IO4A 2RC8A 3VDFA 3U93A 3QUJA 1R6ZA 3TTRA 5AA4A 2RINA 4RNSA 2F36A 3TELA 3UP9A 3CR9A 5AE4A 1QJMA 5CBSA 5IKBA 4X1BA 1XVXA 4UA8A 1HSLA 1POTA 4BDNA 3LSWA 1MPCA 4I1DA 4QFNA 5DEXA 4RY1A 5CC2A 1LAXA 3K4UA 1P1NA 4F19A 1Q35A 2UVGA 2DP8A 3V83A 2UVHA 3FVOA 1QKAA 3UA8A 1NH8A 4WKMA 4LQ2A 1F9BA 4ZZAA 4EQ7A 1FQBA 1HSJA 4G8MA 3SETA 1QVSA 3PU5A 1ELJA 4WEDA 4ELQA 3PPOA 4ELOA 3I5OA 1OLAA 4X1DA 1EZPA 4F22A 3DELB 1B3HA 3SKPA 3THIA 3VLUA 3VV5A 3U1OA 5JK4A 4OHNA 2XX9A 4YZZA 5H8HB 5I2NB 4Z7EA 1ZU0A 2O6AA 1I6BA 1MDP1 3O28A 4NF4A 4XKPA 2B3BA 3TAJA 3VFJA 3TCGA 1H43A 5A5XA 1WDNA 3GZGA 4OEVA 1BP5A 1B05A 1B52A 2G93A 2P0SA 3JYRA 1B5JA 1SW5A 4IO4A 3N6TA 3V8XB 4U1ZA 4BDQA 3ZKLA 1QULA 2NWJA 3MUQA 1IIWA 3H4ZA 3FJ7A 4IO7A 1S50A 5CM6A 1R1NA 4TOZA 4RPOA 4LP2B 4XTCQ 2AL4A 3PPNA 3MBPA 1IXIA 3B6TA 4BLAA 2QL3A 1JETA 4OZ9A 2XXPA 1MXVA 2I48A 4GVOA 1A7LA 1B4ZA 2D21A 4ZEFA 2ALUA 3CFZA 3TQWA 2OWTA 1NFTA 5KDTA 1PDAA 5EHMA 5H8FA 3PGFA 1D4NA 1Q1KA 3EN3A 3KFMA 3ZS6A 2HXWA 3M8UA 1US5A 5CRYA 3Q29A 4C0RA 1B7UA 1NNKA 3TPAA 4OESA 4R9FA 5AA1A 1M5CA 3A3UA 4HCWA 4R74A 3KN3A 2GHBA 4PFTA 4THIA 2QMXA 1A8EA 3G3IA 4RA1A 3G3FA 1YCJA 4IY6A 4OETA 4OXVA 4PFUA 3C9HA 4H65A 1B1XA 3G3KA 2HAUA 2ONKE 3ONMA 3MW0A 2PYYA 4ISUA 5DEXB 2XX8A 3TCFA 3E9XA 3LSLA 4P11A 5I59A 1SW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ANF A;  3M3F A;  2P1S A;  2YLN A;  3N6U A;  1OLC A;  3OEM A;  1MQH A;  3B6Q A;  3QIM A;  1ATG A;  4YKJ A;  5K2X A;  3K6W A;  1Y4C A;  3UN6 A;  4ELR A;  1II5 A;  2XXI A;  1B3E A;  3HHG A;  4IO2 A;  4Q30 B;  4ZE8 A;  3UOR A;  2H4I A;  3ILU B;  2NUV A;  3RY3 A;  2HZL A;  3SDF A;  1LCF A;  1NL5 A;  3G3J A;  4TQU Q;  3B7D A;  4JBZ A;  2KLF A;  1BTJ A;  4I8C A;  2QS4 A;  4FE8 A;  3TQL A;  4NE4 A;  2CMO A;  2O69 A;  3T22 A;  5DYH A;  3O97 A;  2F7A A;  2AYS A;  3CRB A;  4JB7 A;  1Z7N E;  3UGW A;  1BLF A;  3ILT B;  4XXU A;  2RC7 A;  1Y9U A;  2ZXT A;  4F2O A;  5I57 B;  3VVF A;  3Q25 A;  3OEL A;  1MS7 A;  3FZV A;  1S9T A;  4G77 A;  3O6H A;  4H67 A;  4OMB A;  1YPN A;  2ZYO A;  1MXU A;  2Q2A A;  1N76 A;  2VD3 A;  3K00 A;  1D9V A;  4HTG A;  4NF8 A;  3K6U A;  4O3A A;  3LR1 A;  4YMB A;  1LAG E;  4PQJ A;  4MBP A;  2F7C A;  1MM6 A;  2ZNU A;  1O63 A;  1P99 A;  3S2V A;  4NF8 B;  5I2K B;  4GWO A;  3MP1 A;  4U22 A;  3D4G A;  3K02 A;  4F3B A;  3IX1 A;  1RYX A;  5H8N A;  4F1Y A;  3GBB A;  1N04 A;  4EQ9 A;  2ZYN A;  1VE4 A;  1H3D A;  1VR5 A;  1JEU A;  4JWX A;  2UYE A;  1OVB A;  3CVG A;  3S9L C;  1Z7M E;  1LCT A;  1POY 1;  2DS9 A;  2I6E A;  2XXW A;  2ESN A;  1H44 A;  2PT1 A;  3N26 A;  4XKN A;  3RPW A;  3TTN A;  4NMY A;  3KN7 A;  3RN8 A;  3UIF A;  2I58 A;  2Q2C A;  2PBW A;  1FQF A;  2F97 A;  3TTL A;  1MXY A;  1PB8 A;  1XOC A;  1FTJ A;  2DWJ A;  4KQP A;  5F7V A;  4ZEI A;  1YTV A;  1TXF A;  1B5H A;  1DTG A;  2ZYK A;  5TU0 A;  5I2K A;  3CFL A;  5I84 A;  4LAT A;  3TEP A;  4FED A;  3IOV A;  4FEB A;  2X7Q A;  1FQC A;  1MQG A;  4DCY A;  1N3X A;  2Y7P A;  5H8F B;  3SES A;  1LB9 A;  5HM4 B;  5ITP A;  2FNC A;  3P7I A;  2XXU A;  3OD7 A;  4Q0C A;  2FYI A;  2RC9 A;  4QSD A;  4G2Z A;  3SEX A;  2XHD A;  4JDF A;  4EXK A;  3N5L A;  2QS3 A;  2ABH A;  5I57 A;  1IUD A;  2FA7 A;  3L6G A;  1NNP A;  1N0T A;  1LAF E;  3MZ9 A;  4LZ5 A;  3S9M C;  1B9J A;  3R26 A;  3K1N A;  4ZEC A;  1PBP A;  1UIU A;  3K01 A;  5FTH A;  3BFU A;  3MZ1 A;  1RYO A;  1M5D A;  3FV2 A;  3V89 B;  2DE3 A;  3IL1 B;  4FAT A;  3CI8 A;  4YMA A;  2DWI A;  1R9L A;  2R71 A;  4YB6 A;  1JQF A;  2VD2 A;  1Y1M A;  3BBR A;  3EPE A;  3FIR A;  3PUX E;  4OEU A;  1O7T A;  4Z0I A;  2DWH A;  3K2D A;  5DVI A;  3TMG A;  1JW5 A;  4QHQ A;  1B51 A;  1LFI A;  2F6G A;  5ELV A;  1JW1 A;  5EHS A;  1NH7 A;  2DVZ A;  1WOD A;  1ZLQ A;  1MY0 A;  4DLD A;  3RT6 B;  1N84 A;  1OQH A;  1S7Y A;  2ANJ A;  5M2V A;  1DMB A;  4QFP A;  3HV1 A;  5I59 B;  4LZ8 A;  1SW2 A;  1BKA A;  3IAZ A;  1L5T A;  4I9D A;  4IGR A;  2XXQ A;  4Q5T A;  2V25 A;  4LON B;  5H8H A;  4GRK A;  1IZ1 A;  4DZ1 A;  1BIY A;  1UTH B;  3RLF E;  4OQO A;  5ITO A;  4RK9 A;  2NXO A;  1LST A;  2HCA A;  2I3V A;  2Z8F A;  2ZNT A;  1URG A;  3BFT A;  3IB1 A;  1QUK A;  2O84 X;  3LUY A;  3Q27 A;  3C4M A;  3O2A A;  4PFW A;  3T9H B;  5B70 A;  1SW4 A;  2DXR A;  5H8S A;  4F29 A;  5LOM A;  2VOZ A;  4O3C A;  2QMW A;  4H5F A;  3T96 B;  3JV9 A;  1US4 A;  3CIJ A;  3MQ9 A;  5B7D A;  1DPP A;  3FVG A;  3TCH A;  1SVX B;  2VP1 A;  5CI5 A;  4DIG A;  1JVX A;  4GXS B;  5TP9 B;  3FGS A;  2W7Y A;  5I56 B;  1AH5 A;  3A3C A;  4IO3 A;  4R6Y A;  1B4H A;  1TT1 A;  5AA4 B;  3S4U A;  4P0I A;  3MC2 A;  4O3B A;  4QSC A;  1LLS A;  2O7U A;  2B65 A;  1SI1 A;  3GLB A;  2HEU A;  1Y4T A;  3BKI B;  3T9V A;  1P1Q A;  2F78 A;  2F8D A;  3E13 X;  3LSF B;  4OTE A;  5I58 B;  2D5W A;  3VXB A;  2I4C A;  2ZMB A;  3H6W A;  1ZMG A;  3U8Q A;  2Z23 A;  3QK6 A;  1M5F A;  4QRZ A;  3C35 A;  1NNF A;  1XS5 A;  4PE5 B;  4GLI A;  4TLM B;  4EUO A;  4F1U A;  4F1V A;  4DXB A;  4LA9 A;  1H45 A;  2UXA A;  3EHU A;  1VFE A;  4JSO A;  5BWJ A;  3KOT A;  2XXY A;  1KWH A;  2OLB A;  4RJZ A;  3HHF A;  3H6V A;  3PPR A;  4P0G A;  1J1N A;  1USY E;  2VHA A;  3R6U A;  2DOJ A;  4OEN A;  4YKI A;  5ICT A;  5AA2 A;  4DDD A;  3RNN A;  4LQ5 A;  5EYF A;  2R6G E;  2Z22 A;  4KPT A;  1GV8 A;  1URS A;  2F6P A;  1P1W A;  3IO6 A;  3LBS A;  4R2B A;  5CMC A;  4F31 B;  4KCC A;  5I58 A;  3FVK A;  3PMX A;  1M5E A;  2HFB A;  2HAV A;  4N07 A;  2F7B A;  4OFO A;  4NWC A;  4RXL A;  5HBC A;  3KG2 A;  3H06 B;  3IK6 B;  1DOT A;  1LBB A;  4IO5 A;  3T9U A;  5CMB A;  4AQ4 A;  4POW A;  2PT2 A;  3TOD A;  1B58 A;  4GOT A;  4XIG Q;  3D4C A;  3USD A;  2UYF A;  1PC3 A;  4QF9 A;  4HW8 A;  3IJX B;  4GL8 A;  4YAH X;  3FJM A;  2HZK A;  3IOW A;  3M3K A;  4C1T A;  3Q26 A;  5KCJ B;  5TPA A;  2OJT A;  4OVJ A;  1MY2 A;  5JTY B;  2YPN A;  3W15 C;  2HQ0 A;  3S9N C;  5I2N A;  2A5T A;  3O6G A;  2I4B A;  5AA2 D;  4LUB A;  2Q88 A;  1RKM A;  3FAT A;  5BUU A;  2DE2 A;  4FJP A;  4G68 C;  5DVF A;  2DVC A;  3MVZ A;  1Y3Q A;  4BDM A;  3EHS A;  3HCQ A;  3PD9 A;  4U2R A;  4X48 A;  1Y3P A;  3CSG A;  3QYT A;  1PB9 A;  4FAJ A;  3FV1 A;  1IXG A;  3ODB A;  4GIZ A;  3M3L A;  4H0W A;  1EZ9 A;  5DT6 A;  1GTK A;  2LAO A;  3C33 A;  3HN0 A;  2V93 A;  1MH3 A;  3SER A;  1UQW A;  3U72 A;  1NKX A;  2OWS A;  2AL5 A;  3K0V A;  1GVC A;  2DWA A;  2Q8J A;  3KJ7 A;  3OEN A;  1MXW A;  1MY3 A;  4GD5 A;  4H8J A;  2DQV A;  4F2Q A;  1MG1 A;  1MY1 A;  4YB7 A;  2I49 A;  3RT8 A;  3T9X B;  2I3W A;  3OMB A;  2H5Y A;  2O1L A;  1SYI A;  3C36 A;  2XD2 A;  3VVD A;  1UTH A;  3W9W A;  1TFA A;  1B5I A;  5FHO A;  3WAF A;  3TTM A;  1LAH E;  1FTL A;  1UIV A;  2I0B A;  1SD3 A;  3IOT A;  1MDQ A;  2H25 A;  4OER A;  1A54 A;  1FW0 A;  4G68 A;  3B6W A;  5H8Q B;  1N3W A;  3TDJ A;  4ESX A;  2DE4 A;  5HPQ A;  4F39 A;  4Q8R A;  3OO7 A;  3OEK A;  3WAE A;  1XC1 A;  1A99 A;  3KSJ A;  4NF4 B;  2H9B A;  2R9J A;  4MF3 A;  1NMU A;  3H3G A;  3MP8 A;  5DTB A;  4I62 A;  2A5S A;  2QS1 A;  3QAX A;  4WEP A;  4R6H A;  4YIC A;  4ZEK A;  4HCY A;  5JEI A;  2PMS A;  1B3L A;  4KR5 A;  3MVW A;  3SEW A;  3PMW A;  4F3S A;  4U4S A;  4ECF A;  3S9E A;  1AL3 A;  2XX7 A;  1JEV A;  3LC8 A;  3KOS A;  4IB2 A;  2O51 A;  4NED A;  2QJE A;  4C1U A;  3KZG A;  3PUW E;  1B32 A;  3CG1 A;  4KFQ A;  2WKY A;  4GFR A;  4ZDM A;  1B46 A;  1SDX A;  4POX A;  3U92 A;  2GRV A;  4RPN A;  1SI0 A;  4DE8 A;  1GGG A;  2DSF A;  2QRY A;  2RCB A;  4KHZ E;  4X9T A;  3RQT A;  3RTW B;  4EXL A;  1IXC A;  1CE2 A;  2REG A;  3ECR A;  3HST A;  5FTI A;  1B0L A;  3FAS A;  3Q28 A;  5L8D A;  1AMF A;  3JZJ A;  1PEB A;  1B3F A;  3K6X A;  3KGC A;  3RGY A;  2Q9T A;  4R73 A;  2V3U A;  4EF1 A;  3MVY A;  1MPD A;  3SEY A;  1A8F A;  2IEE A;  1XVY A;  1B40 A;  2RCA A;  4KYD A;  4DCX A;  2V3Q A;  3FD3 A;  1DSN A;  1XT8 A;  1B2H A;  3VLV A;  1AOV A;  3IR1 A;  1QUI A;  5L9M A;  4FOR A;  4JSD A;  1USY H;  5FHM A;  4GF8 A;  3W9V A;  4M1V A;  1T0K A;  1A40 A;  3O29 A;  3FJG A;  4JXI A;  1OQG A;  2UVI A;  1TFD A;  1N7W A;  1AIV A;  1JVY A;  2XD3 A;  1IQ7 A;  3HPI A;  2REJ A;  3CFX A;  1CB6 A;  2RKM A;  3MVX A;  1OIB A;  3IOU A;  2O68 A;  3PPP A;  3SEU A;  3T66 A;  1UTB B;  3KBR A;  1MPB A;  2G29 A;  3RTF B;  3H6U A;  3ZKK A;  2ZYM A;  1MM7 A;  3TZA A;  5FHN A;  4XKR A;  4L17 A;  4WXJ A;  2NOO A;  3H6T A;  3VVE A;  5L9S A;  4H6D A;  4F18 A;  2Y7K A;  3PMV A;  5CBR A;  1LGB C;  2GHA A;  4ZE9 A;  2D3I A;  3FVN A;  4G4P A;  2PX1 A;  2ONS A;  4MFI A;  1B7Z A;  1FTM A;  1Y3N A;  3KN8 A;  4H1X A;  1TWY A;  3G3G A;  2QSX A;  2Y7W A;  4KCD A;  3I3V A;  3OSR A;  4YU0 A;  1VFD A;  2B3F A;  4ND9 A;  4QFK A;  3E3K A;  1N7X A;  3OOA A;  3VE1 B;  3VLW A;  3DP4 A;  4GXA A;  3MP6 A;  2NVU B;  2E1S A;  4BDR A;  1QUJ A;  2V84 A;  5I56 A;  3GXA A;  1Y20 A;  2VGQ A;  3MPK A;  1B6H A;  4QFO A;  4RK2 A;  4MLV A;  3TTK A;  2XXV A;  3A09 A;  4KD5 A;  1IXH A;  1ZTY A;  1SQY A;  3PPQ A;  1MH4 A;  2M8C A;  4NF5 A;  1EU8 A;  4DXC A;  3PD8 A;  1IIT A;  2V3T A;  3MWB A;  4GL0 A;  4R2F A;  3SEV A;  1YAE A;  3C34 A;  5ISU A;  4EQB A;  4GQO A;  4MH5 A;  3DLN A;  4NTL A;  4ZEB A;  3FUZ A;  4IO6 A;  2UVJ A;  3EF7 A;  3MPL A;  4G8N A;  4JWO A;  1MQJ A;  1VSO A;  2F35 A;  3OO6 A;  4NF5 B;  4E0X A;  3CG3 A;  3PUY E;  2OZZ A;  4FIM A;  2XXT A;  3K6V A;  1DPE A;  4ZS9 A;  1QKB A;  3U94 A;  5KCJ A;  1EZO A;  3H03 A;  4KI0 E;  2BJJ X;  2QPQ A;  1PBQ A;  4LVQ A;  5K2Y A;  4QSE A;  3OXN A;  4RYA A;  3L6H A;  2H99 A;  4U23 A;  4G68 B;  4F3P A;  5AA3 A;  2F5X A;  3IOR A;  2XXR A;  2ZNS A;  5AA2 B;  2Y7R A;  4IY5 A;  5F1Q A;  5J1D A;  1ZBM A;  1FQA A;  3V5A A;  1LBC A;  4U1O A;  1HSE A;  3IB2 A;  3TFL A;  3O66 A;  1O64 A;  2Z8E A;  4M4G A;  4AB6 A;  4BDO A;  5H8N B;  1P1O A;  3DP8 A;  1B0H A;  1Y1Z A;  3G7W A;  4ESW A;  3UK4 A;  4QFL A;  1IEJ A;  1ZIU A;  3OSQ A;  1MQD A;  1FTK A;  2OBG A;  3EHT A;  3KSX A;  3EQ1 A;  1JW4 A;  4R6K A;  2YJP A;  4R9G A;  2O1M A;  3K1P A;  1FTO A;  3N94 A;  1I69 A;  1SBP A;  2ONR A;  1FQD A;  1SYH A;  1ZJL A;  2QS2 A;  3FXQ A;  2H98 A;  3LSX A;  4H8I A;  3I6V A;  3O9P A;  1I6Q A;  4N13 A;  4N6P A;  4JWY A;  2I0C A;  4UAC A;  3T93 B;  3KEI A;  2P2A A;  1MY4 A;  1XHY A;  3DP6 A;  1MRP A;  3PUV E;  1UTB A;  3RUM A;  3TYH A;  5IAI A;  4KYS A;  3GBA A;  4K3F A;  4OFJ A;  4U4X A;  4BDL A;  4YB5 A;  4EF2 A;  3C32 A;  4ZED A;  1LB8 A;  2IA4 A;  1D9Y A;  1OMP A;  3FXR A;  3H7M A;  1EH3 A;  3OO9 A;  1JNF A;  3MAM A;  4YKK A;  2XXH A;  3R7X A;  3CSB A;  1GR2 A;  2DYX A;  2Y84 A;  3MZB A;  3PUZ E;  5TP9 A;  4IGT A;  3C31 A;  3TKD A;  1D3K A;  4F3G A;  1ZKB A;  5JTY A;  2RF1 A;  3AXF A;  5TPA B;  1A55 A;  3QUF A;  4NWD A;  4PFY A;  1P1U A;  5DVJ A;  4ZZE A;  5KZT A;  2GFE A;  4NF6 B;  4TLL B;  3O6I A;  4H5G A;  2O7I A;  3VXC A;  4DXU A;  1QW0 A;  4OFL A;  4R75 A;  1R9Q A;  2E0S A;  5CMM A;  4U21 A;  5CMK A;  3PV0 E;  1B7H A;  4E0W A;  3FXU A;  2F34 A;  1MQI A;  4LZ7 A;  4XKQ A;  2PVU A;  1NNT A;  4HS7 A;  5KDT B;  2X7P A;  2OCU A;  1H76 A;  2GH9 A;  3QSL A;  2DXY A;  3HO7 A;  1FCK A;  2Y7I A;  3KJT A;  4ONY A;  1LFG A;  4MLQ A;  1LFH A;  4FEC A;  1WVJ A;  1PB7 A;  2THI A;  2AIX A;  1OVT A;  3TUS A;  3OO8 A;  3MJN A;  1I6A A;  3G3H A;  4G8H A;  4PET A;  5L9O A;  4EDP A;  1URD A;  2XXX A;  3ZSF A;  1FQE A;  2X26 A;  4R72 A;  4YKP A;  3E4R A;  4AB5 A;  2CZL A;  3IJO B;  2Z8D A;  5H8Q A;  1B1H A;  3QXM A;  2Q89 A;  3IB0 A;  3K1M A;  4OWD A;  1B3G A;  3DM0 A;  4PP0 A;  1DTZ A;  5ICQ A;  2OK2 A;  4KYE A;  5A5X B;  4NF6 A;  2A5T B;  1MXZ A;  4OYV A;  4ELP A;  1M5B A;  1MXX A;  3F11 A;  3IO4 A;  2RC8 A;  3VDF A;  3U93 A;  3QUJ A;  1R6Z A;  3TTR A;  5AA4 A;  2RIN A;  4RNS A;  2F36 A;  3TEL A;  3UP9 A;  3CR9 A;  5AE4 A;  1QJM A;  5CBS A;  5IKB A;  4X1B A;  1XVX A;  4UA8 A;  1HSL A;  1POT A;  4BDN A;  3LSW A;  1MPC A;  4I1D A;  4QFN A;  5DEX A;  4RY1 A;  5CC2 A;  1LAX A;  3K4U A;  1P1N A;  4F19 A;  1Q35 A;  2UVG A;  2DP8 A;  3V83 A;  2UVH A;  3FVO A;  1QKA A;  3UA8 A;  1NH8 A;  4WKM A;  4LQ2 A;  1F9B A;  4ZZA A;  4EQ7 A;  1FQB A;  1HSJ A;  4G8M A;  3SET A;  1QVS A;  3PU5 A;  1ELJ A;  4WED A;  4ELQ A;  3PPO A;  4ELO A;  3I5O A;  1OLA A;  4X1D A;  1EZP A;  4F22 A;  3DEL B;  1B3H A;  3SKP A;  3THI A;  3VLU A;  3VV5 A;  3U1O A;  5JK4 A;  4OHN A;  2XX9 A;  4YZZ A;  5H8H B;  5I2N B;  4Z7E A;  1ZU0 A;  2O6A A;  1I6B A;  1MDP 1;  3O28 A;  4NF4 A;  4XKP A;  2B3B A;  3TAJ A;  3VFJ A;  3TCG A;  1H43 A;  5A5X A;  1WDN A;  3GZG A;  4OEV A;  1BP5 A;  1B05 A;  1B52 A;  2G93 A;  2P0S A;  3JYR A;  1B5J A;  1SW5 A;  4IO4 A;  3N6T A;  3V8X B;  4U1Z A;  4BDQ A;  3ZKL A;  1QUL A;  2NWJ A;  3MUQ A;  1IIW A;  3H4Z A;  3FJ7 A;  4IO7 A;  1S50 A;  5CM6 A;  1R1N A;  4TOZ A;  4RPO A;  4LP2 B;  4XTC Q;  2AL4 A;  3PPN A;  3MBP A;  1IXI A;  3B6T A;  4BLA A;  2QL3 A;  1JET A;  4OZ9 A;  2XXP A;  1MXV A;  2I48 A;  4GVO A;  1A7L A;  1B4Z A;  2D21 A;  4ZEF A;  2ALU A;  3CFZ A;  3TQW A;  2OWT A;  1NFT A;  5KDT A;  1PDA A;  5EHM A;  5H8F A;  3PGF A;  1D4N A;  1Q1K A;  3EN3 A;  3KFM A;  3ZS6 A;  2HXW A;  3M8U A;  1US5 A;  5CRY A;  3Q29 A;  4C0R A;  1B7U A;  1NNK A;  3TPA A;  4OES A;  4R9F A;  5AA1 A;  1M5C A;  3A3U A;  4HCW A;  4R74 A;  3KN3 A;  2GHB A;  4PFT A;  4THI A;  2QMX A;  1A8E A;  3G3I A;  4RA1 A;  3G3F A;  1YCJ A;  4IY6 A;  4OET A;  4OXV A;  4PFU A;  3C9H A;  4H65 A;  1B1X A;  3G3K A;  2HAU A;  2ONK E;  3ONM A;  3MW0 A;  2PYY A;  4ISU A;  5DEX B;  2XX8 A;  3TCF A;  3E9X A;  3LSL A;  4P11 A;  5I59 A;  1SW1 A; 
#chains in the Genus database with same CATH topology
 3N6U A;  4ELR A;  4YKJ A;  3K6W A;  1II5 A;  4ZE8 A;  4IO2 A;  4Q30 B;  3ROJ A;  3RY3 A;  2XWI A;  1NL5 A;  3B7D A;  4JBZ A;  4I8C A;  2F7A A;  1NUW A;  3UGW A;  4XEQ A;  1BLF A;  5EYG A;  2RC7 A;  5ET8 A;  5ET5 A;  3O6H A;  4OMB A;  1MXU A;  2VD3 A;  4HTG A;  4NF8 A;  5IZ3 B;  4PGN A;  4MBP A;  5EQ9 A;  4O7I A;  3S2V A;  4XFE A;  5I2K B;  4GWO A;  4U22 A;  3D4G A;  4F3B A;  3IX1 A;  4F1Y A;  1N04 A;  5DW8 A;  1FPB A;  3KBZ A;  2UYE A;  3CVG A;  3S9L C;  1Z7M E;  2I6E A;  1FBH A;  3UIF A;  1YXI A;  4KXP A;  1PB8 A;  1TXF A;  5TU0 A;  5I2K A;  3IOV A;  2X7Q A;  2FNC A;  3P7I A;  4MAG A;  2XXU A;  4QSD A;  4G2Z A;  4JDF A;  2QS3 A;  4AS5 A;  1IUD A;  1NNP A;  1LAF E;  4ZEC A;  3K01 A;  3FV2 A;  4FAT A;  3CI8 A;  2DWI A;  2R71 A;  4NF0 A;  3EPE A;  3PUX E;  4BDM A;  4Z0I A;  3K2D A;  5DVI A;  1JW5 A;  1B51 A;  1JW1 A;  1WOD A;  1MY0 A;  1OQH A;  1N84 A;  3HV1 A;  4GRK A;  1IZ1 A;  3RLF E;  1URG A;  4DCY A;  3T9H B;  2FBP A;  1DPP A;  2VP1 A;  5TP9 B;  4I3Y A;  3T1B A;  4R6Y A;  1B4H A;  3S4U A;  4P0I A;  2O7U A;  1Y4T A;  3T9V A;  5I58 B;  2ZMB A;  3H6W A;  3QK6 A;  4JVD A;  5BWJ A;  2OLB A;  2P3V A;  4HE2 A;  4MCO A;  3H6V A;  3PPR A;  2VHA A;  4OEN A;  5ICT A;  3KC0 A;  1GV8 A;  2HPG A;  2F6P A;  5I58 A;  4N6D A;  2HFB A;  2HAV A;  5HBC A;  4NWC A;  4PAI A;  3KG2 A;  3IK6 B;  4POW A;  2UYF A;  4GL8 A;  5KCJ B;  5TPA A;  1MY2 A;  2A5T A;  3HCQ A;  4X48 A;  4JVI A;  4FAJ A;  1EZ9 A;  3RPL B;  3C33 A;  1LBV A;  3KJ7 A;  4H8J A;  2FVZ A;  5A5L A;  4NN3 A;  2CZK A;  2H5Y A;  2O1L A;  1FTL A;  1UIV A;  1MDQ A;  1A54 A;  1FW0 A;  4G68 A;  3B8B A;  2DE4 A;  4F39 A;  3IFA A;  1FBC A;  4NF4 B;  5DTB A;  1NMU A;  3H3G A;  5LTC A;  1FBF A;  5JEI A;  2PMS A;  4KR5 A;  1NV1 A;  3S9E A;  4C1U A;  4IB2 A;  2O51 A;  3KZG A;  4KFQ A;  4X9T A;  1IXC A;  1CE2 A;  3HST A;  1B0L A;  4R73 A;  1MPD A;  2IEE A;  3VLV A;  4FOR A;  4MEV A;  3FJG A;  1JVY A;  1OIB A;  2O68 A;  3PTY A;  2G29 A;  3H6U A;  2ZYM A;  2NOO A;  4GWU A;  3H6T A;  3VVE A;  5L9S A;  1G0I A;  1Y3N A;  3KN8 A;  4H1X A;  1TWY A;  4KCD A;  4YU0 A;  3E3K A;  1N7X A;  3VE1 B;  3DP4 A;  4GXA A;  2PFY A;  1QUJ A;  1Y20 A;  2VGQ A;  4RK2 A;  3A29 A;  4MLV A;  1NV7 A;  3TTK A;  4KD5 A;  1IXH A;  1ZTY A;  2XWO A;  3PPQ A;  3PD8 A;  2V3T A;  4G8N A;  3EF7 A;  4FIM A;  4FBP A;  3U94 A;  4LVQ A;  2BJJ X;  2QPQ A;  3L6H A;  4G68 B;  4IY5 A;  5J1D A;  1ZBM A;  2Y5L A;  1LBC A;  4U1O A;  1HSE A;  3O66 A;  2Z8E A;  4AB6 A;  3IFC A;  1P1O A;  3DP8 A;  3G7W A;  3OSQ A;  4R9G A;  3EHT A;  3EQ1 A;  1JW4 A;  2O1M A;  3N94 A;  1SBP A;  2ONR A;  4C1T A;  4QFN A;  5IGA A;  2H98 A;  1I6Q A;  1LBX A;  2I0C A;  3HFU A;  4UAC A;  3KEI A;  2P2A A;  3RYD A;  3RUM A;  1UTB A;  5IAI A;  2OX3 A;  4EF2 A;  4YB5 A;  3NOH A;  3R7X A;  2XXH A;  1CNQ A;  4IGT A;  3QUF A;  5KZT A;  4MHF A;  2ZZV A;  1QW0 A;  4OFL A;  4R75 A;  1R9Q A;  2E0S A;  5CMM A;  3PV0 E;  4E0W A;  4HS7 A;  2OCU A;  4GWY A;  3HO7 A;  4MNI A;  1WVJ A;  4P8B A;  3TUS A;  3OO8 A;  4G8H A;  1URD A;  5ESY A;  2CZL A;  1IMF A;  5A5X B;  4NF6 A;  1MXZ A;  1MXX A;  2RC8 A;  3U93 A;  3UP9 A;  4UA8 A;  1MPC A;  4I1D A;  3K4U A;  1NUZ A;  4F19 A;  2UVH A;  2WYK A;  4WKM A;  4LQ2 A;  1QVS A;  1ELJ A;  4WED A;  4ELO A;  1OLA A;  3SKP A;  3VLU A;  4N8G A;  3VV5 A;  4DI4 B;  4YZZ A;  1LEV A;  4Z7E A;  4P9K A;  4XKP A;  2B3B A;  3TAJ A;  3TCG A;  2G93 A;  3V8X B;  3SZP A;  4BDQ A;  3ZKL A;  1R1N A;  4RPO A;  4XTC Q;  2QL3 A;  5FBP A;  1MXV A;  2I48 A;  2D21 A;  4ZEF A;  3ISP A;  1NFT A;  5KDT A;  3PGF A;  1D4N A;  1Q1K A;  3EN3 A;  1FBP A;  3KFM A;  1US5 A;  4C0R A;  1NNK A;  3TPA A;  4OVR A;  1M5C A;  4PCD A;  3KN3 A;  2GHB A;  2F3B A;  4THI A;  3C9H A;  3TCF A;  3MW0 A;  4ISU A;  3E9X A;  5I59 A;  2CZH A;  2Q8J A;  1OLC A;  3B6Q A;  1ATG A;  2H4I A;  3ILU B;  2CEY A;  2HZL A;  3SDF A;  4TQU Q;  3G3J A;  3TQL A;  5DYH A;  3O97 A;  4JB7 A;  4N6K A;  3VVF A;  3OEL A;  3FZV A;  1S9T A;  2ZYO A;  2Q2A A;  4O3A A;  1N76 A;  4YMB A;  2F7C A;  1O63 A;  1JP4 A;  4NF8 B;  3K02 A;  3GBB A;  4EQ9 A;  2ZYN A;  1OVB A;  3RPW A;  1FBG A;  2ESN A;  1H44 A;  2PT1 A;  3TTN A;  4NMY A;  2I58 A;  2PBW A;  1FQF A;  3TTL A;  1MXY A;  1FPE A;  1K9Z A;  1FTJ A;  5F7V A;  1B5H A;  1DTG A;  2ZYK A;  3CFL A;  5I84 A;  3E79 A;  4FEB A;  1FQC A;  3SES A;  5H8F B;  1LB9 A;  4Q0C A;  5EQ8 A;  2ABH A;  5I57 A;  1N0T A;  4LZ5 A;  3K1N A;  3QMF A;  2DE3 A;  1R9L A;  4YB6 A;  1JQF A;  2VD2 A;  3FIR A;  1FPJ A;  1O7T A;  3TMG A;  1ZLQ A;  4DLD A;  1DMB A;  4QFP A;  5I59 B;  1SW2 A;  1BKA A;  4I9D A;  2V25 A;  4PGP A;  4HE1 A;  2NXO A;  2ZNT A;  3IB1 A;  1SW4 A;  4P1L A;  5H8S A;  4F29 A;  2FIE A;  3MQ9 A;  5B7D A;  3FVG A;  2JJK A;  4DIG A;  2W7Y A;  5I56 B;  3A3C A;  4IO3 A;  5AA4 B;  2QVV A;  3MC2 A;  4O3B A;  2B65 A;  3GLB A;  3BIG A;  3LSF B;  3VXB A;  3U8Q A;  2PFZ A;  4PE5 B;  4GLI A;  2UXA A;  4JSO A;  3EHU A;  1VFE A;  3MYU A;  4RJZ A;  4X8R A;  1NI9 A;  4YKI A;  3R6U A;  4DDD A;  4NX1 A;  2Z22 A;  4R2B A;  5CMC A;  3LBS A;  3PMX A;  1M5E A;  4RXL A;  1DOT A;  5CMB A;  2V4C A;  3TOD A;  1B58 A;  4GOT A;  4XIG Q;  4QF9 A;  3FJM A;  4OVS A;  2HZK A;  3Q26 A;  2YPN A;  5I2N A;  4HXV A;  5BUU A;  4G68 C;  5DVF A;  4U2R A;  3FV1 A;  1IXG A;  3ODB A;  4H0W A;  5DT6 A;  4N17 A;  3U72 A;  1NKX A;  3K0V A;  1SPI A;  1GVC A;  1MXW A;  4IR8 A;  1LBY A;  4YB7 A;  3RT8 A;  4GBW A;  3OMB A;  3C36 A;  2XD2 A;  3VVD A;  1UTH A;  5AA2 A;  4N8Y A;  3IOT A;  2I0B A;  4OER A;  1FTA A;  3TDJ A;  3B6W A;  1N3W A;  4ESX A;  3CHG A;  1INP A;  3OEK A;  3WAE A;  1XC1 A;  3KSJ A;  4MF3 A;  4ESW A;  4ZEK A;  4PTK A;  1B3L A;  3MVW A;  3SEW A;  3PMW A;  4U4S A;  2XX7 A;  5LDZ A;  3KOS A;  1B46 A;  1SDX A;  4POX A;  4DE8 A;  2DSF A;  3RQT A;  4PF6 A;  3FAS A;  1PEB A;  1B3F A;  3SEY A;  1XVY A;  2RCA A;  4DCX A;  1B2H A;  3IR1 A;  5IM2 A;  2PCR A;  1IMB A;  1AIV A;  3SEU A;  3T66 A;  1MPB A;  4L17 A;  4H6D A;  4F18 A;  1LGB C;  4ZE9 A;  2Q8M A;  2PX1 A;  4MFI A;  2Y7W A;  3I3V A;  3OSR A;  1NUX A;  4ND9 A;  3MP6 A;  1EYJ A;  3FXB A;  3GXA A;  4QFO A;  2XXV A;  1IIT A;  4R2F A;  5ISU A;  3C34 A;  4EQB A;  4NTL A;  2UVJ A;  1VSO A;  3PUY E;  4MX6 A;  5KCJ A;  4KI0 E;  5K2Y A;  4NAP A;  4QSE A;  4RYA A;  2H99 A;  2FHY A;  1FBD A;  4M4G A;  5H8N B;  1B0H A;  1Y1Z A;  1FSA A;  2WYP A;  3KSX A;  3K1P A;  3LSX A;  1SYH A;  2QS2 A;  4N6P A;  4H45 A;  1MRP A;  4KYS A;  4OVT A;  4BDL A;  4U4X A;  3FXR A;  1LBW A;  1EH3 A;  2WX9 A;  3MAM A;  2DYX A;  5TP9 A;  1ZKB A;  2RF1 A;  3AXF A;  5DVJ A;  4ZZE A;  2GFE A;  4G61 A;  4U21 A;  5CMK A;  2F34 A;  1NNT A;  2X7P A;  2DXY A;  2Y7I A;  3KJT A;  4MLQ A;  1LFH A;  1VDW A;  2THI A;  2AIX A;  3BIH A;  1OVT A;  5EQA A;  1I6A A;  4PET A;  2XXX A;  4R72 A;  4PFI A;  4YKP A;  4AB5 A;  3IJO B;  1B1H A;  2QFL A;  2KR0 A;  3DM0 A;  4PP0 A;  5ICQ A;  4KYE A;  3IO4 A;  1LBZ A;  4OA4 A;  4OVQ A;  1R6Z A;  2HHM A;  3TTR A;  2RIN A;  5AA4 A;  2F36 A;  3TEL A;  3CR9 A;  1POT A;  5DEX A;  4RY1 A;  1LAX A;  4O8M A;  2DP8 A;  1NH8 A;  4ZZA A;  3SET A;  4G8M A;  4ELQ A;  3I5O A;  1EZP A;  1NV6 A;  1WDN A;  1RDX A;  3GZG A;  1B05 A;  1SW5 A;  4U1Z A;  1RDZ A;  3MUQ A;  2AL4 A;  3B6T A;  4PFR A;  1A7L A;  3CFZ A;  1PDA A;  4HCW A;  4RA1 A;  4H65 A;  3UOR A;  3LSL A;  1SW1 A;  1ANF A;  2P1S A;  2YLN A;  3OEM A;  4MNC A;  5K2X A;  1Y4C A;  1RDY A;  4P3L A;  2XXI A;  1B3E A;  4QXD A;  4XF5 A;  1LCF A;  2KLF A;  1BTJ A;  2QS4 A;  4NE4 A;  2CMO A;  3CRB A;  1Z7N E;  5ET7 A;  1YYZ A;  3ILT B;  2ZXT A;  3GYY A;  4H67 A;  1YPN A;  2VPO A;  3K6U A;  3LR1 A;  1LAG E;  4PQJ A;  2ZNU A;  1MM6 A;  1P99 A;  3MP1 A;  5H8N A;  1H3D A;  1VR5 A;  1JEU A;  4JWX A;  3KN7 A;  3RN8 A;  4OAN A;  4P56 A;  2F97 A;  2DWJ A;  4ZEI A;  4LAT A;  3TEP A;  1MQG A;  2Y7P A;  5HM4 B;  3FBP A;  3T0J A;  2FYI A;  2RC9 A;  3SEX A;  3N5L A;  2FA7 A;  3L6G A;  3R26 A;  3KC1 A;  1PBP A;  1UIU A;  3BFU A;  1RYO A;  3V89 B;  3IL1 B;  4YMA A;  1Y1M A;  1NV5 A;  1LFI A;  1NH7 A;  2DVZ A;  2Q74 A;  2VPN A;  1L5T A;  4IGR A;  4Q5T A;  4LON B;  4DZ1 A;  1BIY A;  1UTH B;  5ITO A;  1LST A;  2I3V A;  3LUY A;  3WAF A;  4PFW A;  5LOM A;  4GX3 A;  4O3C A;  2QMW A;  2MKZ A;  4H5F A;  3T96 B;  5CI5 A;  1JVX A;  4GXS B;  4JVC A;  1LLS A;  3BKI B;  2F78 A;  2D5W A;  2I4C A;  2Z23 A;  3C35 A;  1XS5 A;  2XWK A;  1DCU A;  4F1V A;  4LA9 A;  1H45 A;  1J1N A;  1USY E;  1FPG A;  2QVU A;  4GX6 A;  3RNN A;  2R6G E;  1P1W A;  3IO6 A;  4F31 B;  3FVK A;  4OFO A;  4IO5 A;  2PT2 A;  5I7I A;  3USD A;  3IOW A;  4OVJ A;  3W15 C;  4P47 A;  4LUB A;  2Q88 A;  2DE2 A;  2DVC A;  1Y3Q A;  1FPK A;  1Y3P A;  2LAO A;  3SER A;  1MH3 A;  2HXR A;  1UQW A;  2OWS A;  2DWA A;  4GD5 A;  2DQV A;  4F2Q A;  1MG1 A;  3T9X B;  2I3W A;  4PAF A;  1QGX A;  1TFA A;  1B5I A;  5FHO A;  4O94 A;  2H25 A;  5H8Q B;  4Q8R A;  1EYI A;  2R9J A;  3MP8 A;  4I62 A;  2QS1 A;  4R6H A;  1NV3 A;  1AL3 A;  3LC8 A;  3CG1 A;  3U92 A;  2GRV A;  1SI0 A;  4P1E A;  2QRY A;  4KHZ E;  4EXL A;  1KA1 A;  1AWB A;  1Q9D A;  1AMF A;  1XI6 A;  2WBD A;  2V3Q A;  1IMD A;  5L9M A;  1USY H;  1A40 A;  4JXI A;  1OQG A;  2UVI A;  4X04 A;  1FJ6 A;  2REJ A;  1CB6 A;  3MVX A;  3IOU A;  3PPP A;  3ZKK A;  1MM7 A;  5FHN A;  4I3E A;  2L5V A;  3PMV A;  1NUY A;  2GHA A;  5CBR A;  1EYK A;  3E78 A;  3G3G A;  4QFK A;  3VLW A;  2E1S A;  2V84 A;  3MPK A;  1FPL A;  3A09 A;  5I3S A;  1SQY A;  4DXC A;  2M8C A;  4NF5 A;  4MH5 A;  4ZEB A;  3FUZ A;  2P3N A;  4JWO A;  1MQJ A;  3OO6 A;  2F35 A;  3CG3 A;  2OZZ A;  4ZS9 A;  1DPE A;  1QKB A;  1PBQ A;  2F3D A;  3OXN A;  4UAB A;  4U23 A;  4F3P A;  2F5X A;  3IOR A;  2XXR A;  2R8T A;  5F1Q A;  1FQA A;  3U65 A;  3IB2 A;  1O64 A;  3UK4 A;  1IEJ A;  1ZIU A;  1MQD A;  2OBG A;  2YJP A;  1I69 A;  1ZJL A;  3FXQ A;  4H8I A;  4N13 A;  3I6V A;  1KA0 A;  3T93 B;  1MY4 A;  1XHY A;  2XA5 A;  3PUV E;  3TYH A;  2GQ1 A;  2IA4 A;  3H7M A;  3OO9 A;  1JNF A;  4YKK A;  5I5P A;  3PUZ E;  4F3G A;  5TPA B;  1A55 A;  4NWD A;  1IMA A;  4NF6 B;  4TLL B;  3O6I A;  2O7I A;  3VXC A;  4DXU A;  2VT5 A;  1B7H A;  4XKQ A;  5IZ3 A;  4QBA A;  2GH9 A;  4I40 A;  1FCK A;  4FEC A;  2XXK A;  3EKI A;  2X26 A;  4DI3 D;  3E4R A;  2Q89 A;  3IB0 A;  3K1M A;  4OWD A;  1B3G A;  1DTZ A;  2OK2 A;  4PE3 A;  4OYV A;  4MNP A;  2XWV A;  3QUJ A;  5J16 A;  1FRP A;  5CBS A;  5IKB A;  5AE4 A;  1HSL A;  4BDN A;  3LSW A;  5CC2 A;  2UVG A;  3V83 A;  3FVO A;  3UA8 A;  1F9B A;  4EQ7 A;  3PU5 A;  3PPO A;  4X1D A;  3THI A;  5JK4 A;  3U1O A;  4OHN A;  4PFB A;  2XX9 A;  5I2N B;  1ZU0 A;  2O6A A;  1I6B A;  1MDP 1;  3O28 A;  4NF4 A;  4OEV A;  3JYR A;  1FBE A;  3N6T A;  4GWX A;  1IIW A;  4HE0 A;  3FJ7 A;  1S50 A;  4TOZ A;  3MBP A;  1G0H A;  1JET A;  2XXP A;  4GVO A;  2ALU A;  2OWT A;  3Q29 A;  1B7U A;  4R74 A;  3A3U A;  4PFT A;  1A8E A;  3G3I A;  3MST A;  4IY6 A;  4OET A;  4OXV A;  4PFU A;  2HAU A;  2ONK E;  2B4M A;  2PYY A;  5DEX B;  2XX8 A;  4P11 A;  5EYH A;  3M3F A;  1MQH A;  3UN6 A;  3QIM A;  3HHG A;  2NUV A;  2WBB A;  4GWW A;  4FE8 A;  2O69 A;  2AYS A;  4XXU A;  5IZ1 A;  1Y9U A;  5I57 B;  4F2O A;  3Q25 A;  1MS7 A;  4G77 A;  3K00 A;  3T22 A;  1D9V A;  2OWZ A;  2DDK A;  4MIJ A;  1RYX A;  1VE4 A;  1LCT A;  1POY 1;  2DS9 A;  2XXW A;  4XKN A;  3N26 A;  2Q2C A;  1FPF A;  1XOC A;  4KQP A;  2WEF A;  1YTV A;  2B4L A;  4NQ8 A;  4FED A;  1N3X A;  5ITP A;  3OD7 A;  2XHD A;  4EXK A;  4N4U A;  3MZ9 A;  3S9M C;  1B9J A;  5FTH A;  3MZ1 A;  1M5D A;  4PF8 A;  3BBR A;  4NHB A;  4OEU A;  1K9Y A;  2DWH A;  4QHQ A;  2F6G A;  5ELV A;  5EHS A;  4PDD A;  3LV0 A;  3RT6 B;  1S7Y A;  2ANJ A;  4MJO A;  5M2V A;  4LZ8 A;  3IAZ A;  2XXQ A;  4LN5 A;  5H8H A;  4OQO A;  4RK9 A;  2HCA A;  2Z8F A;  3Q27 A;  3ZS6 A;  3BFT A;  1QUK A;  2O84 X;  3C4M A;  3O2A A;  5B70 A;  2DXR A;  2VOZ A;  1FPI A;  3JV9 A;  1US4 A;  3CIJ A;  3TCH A;  1SVX B;  3FGS A;  1AH5 A;  1TT1 A;  4QSC A;  1FJ9 A;  1SI1 A;  2HEU A;  1P1Q A;  3E13 X;  2F8D A;  4OTE A;  1ZMG A;  1M5F A;  4QRZ A;  1NNF A;  4TLM B;  4EUO A;  4F1U A;  4DXB A;  3KOT A;  4GBV A;  2XXY A;  1KWH A;  3HHF A;  4P0G A;  2DOJ A;  4LQ5 A;  5EYF A;  2Y5K A;  4KPT A;  1URS A;  4KCC A;  4N07 A;  2F7B A;  5EQ7 A;  3H06 B;  1LBB A;  3T9U A;  4AQ4 A;  4HW8 A;  3D4C A;  1PC3 A;  3IJX B;  4YAH X;  3M3K A;  2OJT A;  5IZZ A;  5JTY B;  2HQ0 A;  3S9N C;  3O6G A;  2I4B A;  5AA2 D;  1RKM A;  3FAT A;  4FJP A;  2BJI A;  3MVZ A;  3EHS A;  3PD9 A;  3CSG A;  3QYT A;  1PB9 A;  4GIZ A;  3M3L A;  1DK4 A;  1GTK A;  3HN0 A;  2V93 A;  2AL5 A;  3OEN A;  2ZZW A;  1MY3 A;  1MY1 A;  2I49 A;  1SYI A;  3W9W A;  3TTM A;  1LAH E;  1SD3 A;  5F24 A;  5HPQ A;  3OO7 A;  4N81 A;  1A99 A;  4N15 A;  2H9B A;  1IMC A;  5T3J A;  2A5S A;  3QAX A;  4WEP A;  4YIC A;  4HCY A;  4F3S A;  4ECF A;  1JEV A;  4NED A;  2QJE A;  3PUW E;  1B32 A;  4GX4 A;  2WKY A;  4GFR A;  4ZDM A;  4RPN A;  1GGG A;  2RCB A;  3RTW B;  2REG A;  3ECR A;  4GWZ A;  5FTI A;  4PBH A;  3Q28 A;  5L8D A;  3JZJ A;  3K6X A;  3KGC A;  3RGY A;  1D9Q A;  2Q9T A;  2V3U A;  4EF1 A;  3MVY A;  1NV2 A;  1A8F A;  1B40 A;  4KYD A;  3FD3 A;  1DSN A;  1XT8 A;  1AOV A;  1QUI A;  5FHM A;  4JSD A;  3W9V A;  1T0K A;  4GF8 A;  4M1V A;  3O29 A;  1TFD A;  1N7W A;  2XD3 A;  1IQ7 A;  3HPI A;  3CFX A;  2RKM A;  3ZSF A;  1UTB B;  3KBR A;  3RTF B;  1FPD A;  3TZA A;  4XKR A;  4WXJ A;  2Y7K A;  2D3I A;  3FVN A;  4G4P A;  2ONS A;  1B7Z A;  1FTM A;  4N91 A;  2QSX A;  1VFD A;  3B50 A;  2B3F A;  3OOA A;  4BDR A;  2NVU B;  5I56 A;  1B6H A;  1DBZ A;  1MH4 A;  1EU8 A;  3MWB A;  4GL0 A;  3SEV A;  1YAE A;  4GWS A;  4GQO A;  3DLN A;  4IO6 A;  4NF5 B;  3MPL A;  3LUZ A;  4E0X A;  2XXT A;  1BK4 A;  3K6V A;  4H46 A;  1EZO A;  3H03 A;  1IME A;  4NG7 A;  5AA3 A;  2ZNS A;  2KQZ A;  5AA2 B;  2Y7R A;  3V5A A;  3TFL A;  4BDO A;  4PBQ A;  4R6K A;  1FTK A;  4QFL A;  1FTO A;  1FQD A;  2QVR A;  1NV4 A;  1KZ8 A;  3O9P A;  4JWY A;  3DP6 A;  4NGU A;  3GBA A;  4K3F A;  4OFJ A;  4ZED A;  3C32 A;  1LB8 A;  1D9Y A;  1OMP A;  3CSB A;  1GR2 A;  2Y84 A;  3MZB A;  3TKD A;  3C31 A;  5JTY A;  1D3K A;  1NV0 A;  2CEX A;  4PDH A;  4PFY A;  1P1U A;  4H5G A;  3FXU A;  1MQI A;  4LZ7 A;  2PVU A;  5KDT B;  1H76 A;  3QSL A;  4ONY A;  1LFG A;  5ET6 A;  1PB7 A;  3MJN A;  3G3H A;  5L9O A;  4EDP A;  1FQE A;  2Z8D A;  5H8Q A;  3QXM A;  2A5T B;  4ELP A;  1M5B A;  3F11 A;  3D1R A;  3VDF A;  4AS4 A;  3RPL A;  4RNS A;  1QJM A;  4O7M A;  4X1B A;  1XVX A;  1P1N A;  1Q35 A;  1QKA A;  1FQB A;  1HSJ A;  4F22 A;  3DEL B;  1B3H A;  5H8H B;  2CZI A;  3VFJ A;  1H43 A;  5A5X A;  4PC9 A;  1BP5 A;  1B52 A;  2P0S A;  4IO4 A;  1B5J A;  1QUL A;  4OVP A;  2NWJ A;  3H4Z A;  4IO7 A;  5CM6 A;  4LP2 B;  3PPN A;  1IXI A;  4BLA A;  1YZ0 A;  4OZ9 A;  1B4Z A;  3TQW A;  5H8F A;  5EHM A;  2FIX A;  2HXW A;  2ZZX A;  3M8U A;  5CRY A;  4OES A;  4R9F A;  5AA1 A;  4MMP A;  2QMX A;  3G3F A;  1YCJ A;  1B1X A;  3G3K A;  3ONM A;  4PAK A; 
#chains in the Genus database with same CATH homology
 1ANF A;  3M3F A;  2P1S A;  2YLN A;  3N6U A;  1OLC A;  3OEM A;  1MQH A;  3B6Q A;  3QIM A;  1ATG A;  4YKJ A;  5K2X A;  3K6W A;  1Y4C A;  3UN6 A;  4ELR A;  1II5 A;  2XXI A;  1B3E A;  3HHG A;  4IO2 A;  4Q30 B;  4ZE8 A;  3UOR A;  2H4I A;  3ILU B;  2NUV A;  3RY3 A;  2HZL A;  3SDF A;  1LCF A;  1NL5 A;  3G3J A;  4TQU Q;  3B7D A;  4JBZ A;  2KLF A;  1BTJ A;  4I8C A;  2QS4 A;  4FE8 A;  3TQL A;  4NE4 A;  2CMO A;  2O69 A;  3T22 A;  5DYH A;  3O97 A;  2F7A A;  2AYS A;  3CRB A;  4JB7 A;  1Z7N E;  3UGW A;  1BLF A;  3ILT B;  4XXU A;  2RC7 A;  1Y9U A;  2ZXT A;  4F2O A;  5I57 B;  3VVF A;  3Q25 A;  3OEL A;  1MS7 A;  3FZV A;  1S9T A;  4G77 A;  3O6H A;  4H67 A;  4OMB A;  1YPN A;  2ZYO A;  1MXU A;  2Q2A A;  1N76 A;  2VD3 A;  3K00 A;  1D9V A;  4HTG A;  4NF8 A;  3K6U A;  4O3A A;  3LR1 A;  4YMB A;  1LAG E;  4PQJ A;  4MBP A;  2F7C A;  1MM6 A;  2ZNU A;  1O63 A;  1P99 A;  3S2V A;  4NF8 B;  5I2K B;  4GWO A;  3MP1 A;  4U22 A;  3D4G A;  3K02 A;  4F3B A;  3IX1 A;  1RYX A;  5H8N A;  4F1Y A;  3GBB A;  1N04 A;  4EQ9 A;  2ZYN A;  1VE4 A;  1H3D A;  1VR5 A;  1JEU A;  4JWX A;  2UYE A;  1OVB A;  3CVG A;  3S9L C;  1Z7M E;  1LCT A;  1POY 1;  2DS9 A;  2I6E A;  2XXW A;  2ESN A;  1H44 A;  2PT1 A;  3N26 A;  4XKN A;  3RPW A;  3TTN A;  4NMY A;  3KN7 A;  3RN8 A;  3UIF A;  2I58 A;  2Q2C A;  2PBW A;  1FQF A;  2F97 A;  3TTL A;  1MXY A;  1PB8 A;  1XOC A;  1FTJ A;  2DWJ A;  4KQP A;  5F7V A;  4ZEI A;  1YTV A;  1TXF A;  1B5H A;  1DTG A;  2ZYK A;  5TU0 A;  5I2K A;  3CFL A;  5I84 A;  4LAT A;  3TEP A;  4FED A;  3IOV A;  4FEB A;  2X7Q A;  1FQC A;  1MQG A;  4DCY A;  1N3X A;  2Y7P A;  5H8F B;  3SES A;  1LB9 A;  5HM4 B;  5ITP A;  2FNC A;  3P7I A;  2XXU A;  3OD7 A;  4Q0C A;  2FYI A;  2RC9 A;  4QSD A;  4G2Z A;  3SEX A;  2XHD A;  4JDF A;  4EXK A;  3N5L A;  2QS3 A;  2ABH A;  5I57 A;  1IUD A;  2FA7 A;  3L6G A;  1NNP A;  1N0T A;  1LAF E;  3MZ9 A;  4LZ5 A;  3S9M C;  1B9J A;  3R26 A;  3K1N A;  4ZEC A;  1PBP A;  1UIU A;  3K01 A;  5FTH A;  3BFU A;  3MZ1 A;  1RYO A;  1M5D A;  3FV2 A;  3V89 B;  2DE3 A;  3IL1 B;  4FAT A;  3CI8 A;  4YMA A;  2DWI A;  1R9L A;  2R71 A;  4YB6 A;  1JQF A;  2VD2 A;  1Y1M A;  3BBR A;  3EPE A;  3FIR A;  3PUX E;  4OEU A;  1O7T A;  4Z0I A;  2DWH A;  3K2D A;  5DVI A;  3TMG A;  1JW5 A;  4QHQ A;  1B51 A;  1LFI A;  2F6G A;  5ELV A;  1JW1 A;  5EHS A;  1NH7 A;  2DVZ A;  1WOD A;  1ZLQ A;  1MY0 A;  4DLD A;  3RT6 B;  1N84 A;  1OQH A;  1S7Y A;  2ANJ A;  5M2V A;  1DMB A;  4QFP A;  3HV1 A;  5I59 B;  4LZ8 A;  1SW2 A;  1BKA A;  3IAZ A;  1L5T A;  4I9D A;  4IGR A;  2XXQ A;  4Q5T A;  2V25 A;  4LON B;  5H8H A;  4GRK A;  1IZ1 A;  4DZ1 A;  1BIY A;  1UTH B;  3RLF E;  4OQO A;  5ITO A;  4RK9 A;  2NXO A;  1LST A;  2HCA A;  2I3V A;  2Z8F A;  2ZNT A;  1URG A;  3BFT A;  3IB1 A;  1QUK A;  2O84 X;  3LUY A;  3Q27 A;  3C4M A;  3O2A A;  4PFW A;  3T9H B;  5B70 A;  1SW4 A;  2DXR A;  5H8S A;  4F29 A;  5LOM A;  2VOZ A;  4O3C A;  2QMW A;  4H5F A;  3T96 B;  3JV9 A;  1US4 A;  3CIJ A;  3MQ9 A;  5B7D A;  1DPP A;  3FVG A;  3TCH A;  1SVX B;  2VP1 A;  5CI5 A;  4DIG A;  1JVX A;  4GXS B;  5TP9 B;  3FGS A;  2W7Y A;  5I56 B;  1AH5 A;  3A3C A;  4IO3 A;  4R6Y A;  1B4H A;  1TT1 A;  5AA4 B;  3S4U A;  4P0I A;  3MC2 A;  4O3B A;  4QSC A;  1LLS A;  2O7U A;  2B65 A;  1SI1 A;  3GLB A;  2HEU A;  1Y4T A;  3BKI B;  3T9V A;  1P1Q A;  2F78 A;  2F8D A;  3E13 X;  3LSF B;  4OTE A;  5I58 B;  2D5W A;  3VXB A;  2I4C A;  2ZMB A;  3H6W A;  1ZMG A;  3U8Q A;  2Z23 A;  3QK6 A;  1M5F A;  4QRZ A;  3C35 A;  1NNF A;  1XS5 A;  4PE5 B;  4GLI A;  4TLM B;  4EUO A;  4F1U A;  4F1V A;  4DXB A;  4LA9 A;  1H45 A;  2UXA A;  3EHU A;  1VFE A;  4JSO A;  5BWJ A;  3KOT A;  2XXY A;  1KWH A;  2OLB A;  4RJZ A;  3HHF A;  3H6V A;  3PPR A;  4P0G A;  1J1N A;  1USY E;  2VHA A;  3R6U A;  2DOJ A;  4OEN A;  4YKI A;  5ICT A;  5AA2 A;  4DDD A;  3RNN A;  4LQ5 A;  5EYF A;  2R6G E;  2Z22 A;  4KPT A;  1GV8 A;  1URS A;  2F6P A;  1P1W A;  3IO6 A;  3LBS A;  4R2B A;  5CMC A;  4F31 B;  4KCC A;  5I58 A;  3FVK A;  3PMX A;  1M5E A;  2HFB A;  2HAV A;  4N07 A;  2F7B A;  4OFO A;  4NWC A;  4RXL A;  5HBC A;  3KG2 A;  3H06 B;  3IK6 B;  1DOT A;  1LBB A;  4IO5 A;  3T9U A;  5CMB A;  4AQ4 A;  4POW A;  2PT2 A;  3TOD A;  1B58 A;  4GOT A;  4XIG Q;  3D4C A;  3USD A;  2UYF A;  1PC3 A;  4QF9 A;  4HW8 A;  3IJX B;  4GL8 A;  4YAH X;  3FJM A;  2HZK A;  3IOW A;  3M3K A;  4C1T A;  3Q26 A;  5KCJ B;  5TPA A;  2OJT A;  4OVJ A;  1MY2 A;  5JTY B;  2YPN A;  3W15 C;  2HQ0 A;  3S9N C;  5I2N A;  2A5T A;  3O6G A;  2I4B A;  5AA2 D;  4LUB A;  2Q88 A;  1RKM A;  3FAT A;  5BUU A;  2DE2 A;  4FJP A;  4G68 C;  5DVF A;  2DVC A;  3MVZ A;  1Y3Q A;  4BDM A;  3EHS A;  3HCQ A;  3PD9 A;  4U2R A;  4X48 A;  1Y3P A;  3CSG A;  3QYT A;  1PB9 A;  4FAJ A;  3FV1 A;  1IXG A;  3ODB A;  4GIZ A;  3M3L A;  4H0W A;  1EZ9 A;  5DT6 A;  1GTK A;  2LAO A;  3C33 A;  3HN0 A;  2V93 A;  1MH3 A;  3SER A;  1UQW A;  3U72 A;  1NKX A;  2OWS A;  2AL5 A;  3K0V A;  1GVC A;  2DWA A;  2Q8J A;  3KJ7 A;  3OEN A;  1MXW A;  1MY3 A;  4GD5 A;  4H8J A;  2DQV A;  4F2Q A;  1MG1 A;  1MY1 A;  4YB7 A;  2I49 A;  3RT8 A;  3T9X B;  2I3W A;  3OMB A;  2H5Y A;  2O1L A;  1SYI A;  3C36 A;  2XD2 A;  3VVD A;  1UTH A;  3W9W A;  1TFA A;  1B5I A;  5FHO A;  3WAF A;  3TTM A;  1LAH E;  1FTL A;  1UIV A;  2I0B A;  1SD3 A;  3IOT A;  1MDQ A;  2H25 A;  4OER A;  1A54 A;  1FW0 A;  4G68 A;  3B6W A;  5H8Q B;  1N3W A;  3TDJ A;  4ESX A;  2DE4 A;  5HPQ A;  4F39 A;  4Q8R A;  3OO7 A;  3OEK A;  3WAE A;  1XC1 A;  1A99 A;  3KSJ A;  4NF4 B;  2H9B A;  2R9J A;  4MF3 A;  1NMU A;  3H3G A;  3MP8 A;  5DTB A;  4I62 A;  2A5S A;  2QS1 A;  3QAX A;  4WEP A;  4R6H A;  4YIC A;  4ZEK A;  4HCY A;  5JEI A;  2PMS A;  1B3L A;  4KR5 A;  3MVW A;  3SEW A;  3PMW A;  4F3S A;  4U4S A;  4ECF A;  3S9E A;  1AL3 A;  2XX7 A;  1JEV A;  3LC8 A;  3KOS A;  4IB2 A;  2O51 A;  4NED A;  2QJE A;  4C1U A;  3KZG A;  3PUW E;  1B32 A;  3CG1 A;  4KFQ A;  2WKY A;  4GFR A;  4ZDM A;  1B46 A;  1SDX A;  4POX A;  3U92 A;  2GRV A;  4RPN A;  1SI0 A;  4DE8 A;  1GGG A;  2DSF A;  2QRY A;  2RCB A;  4KHZ E;  4X9T A;  3RQT A;  3RTW B;  4EXL A;  1IXC A;  1CE2 A;  2REG A;  3ECR A;  3HST A;  5FTI A;  1B0L A;  3FAS A;  3Q28 A;  5L8D A;  1AMF A;  3JZJ A;  1PEB A;  1B3F A;  3K6X A;  3KGC A;  3RGY A;  2Q9T A;  4R73 A;  2V3U A;  4EF1 A;  3MVY A;  1MPD A;  3SEY A;  1A8F A;  2IEE A;  1XVY A;  1B40 A;  2RCA A;  4KYD A;  4DCX A;  2V3Q A;  3FD3 A;  1DSN A;  1XT8 A;  1B2H A;  3VLV A;  1AOV A;  3IR1 A;  1QUI A;  5L9M A;  4FOR A;  4JSD A;  1USY H;  5FHM A;  4GF8 A;  3W9V A;  4M1V A;  1T0K A;  1A40 A;  3O29 A;  3FJG A;  4JXI A;  1OQG A;  2UVI A;  1TFD A;  1N7W A;  1AIV A;  1JVY A;  2XD3 A;  1IQ7 A;  3HPI A;  2REJ A;  3CFX A;  1CB6 A;  2RKM A;  3MVX A;  1OIB A;  3IOU A;  2O68 A;  3PPP A;  3SEU A;  3T66 A;  1UTB B;  3KBR A;  1MPB A;  2G29 A;  3RTF B;  3H6U A;  3ZKK A;  2ZYM A;  1MM7 A;  3TZA A;  5FHN A;  4XKR A;  4L17 A;  4WXJ A;  2NOO A;  3H6T A;  3VVE A;  5L9S A;  4H6D A;  4F18 A;  2Y7K A;  3PMV A;  5CBR A;  1LGB C;  2GHA A;  4ZE9 A;  2D3I A;  3FVN A;  4G4P A;  2PX1 A;  2ONS A;  4MFI A;  1B7Z A;  1FTM A;  1Y3N A;  3KN8 A;  4H1X A;  1TWY A;  3G3G A;  2QSX A;  2Y7W A;  4KCD A;  3I3V A;  3OSR A;  4YU0 A;  1VFD A;  2B3F A;  4ND9 A;  4QFK A;  3E3K A;  1N7X A;  3OOA A;  3VE1 B;  3VLW A;  3DP4 A;  4GXA A;  3MP6 A;  2NVU B;  2E1S A;  4BDR A;  1QUJ A;  2V84 A;  5I56 A;  3GXA A;  1Y20 A;  2VGQ A;  3MPK A;  1B6H A;  4QFO A;  4RK2 A;  4MLV A;  3TTK A;  2XXV A;  3A09 A;  4KD5 A;  1IXH A;  1ZTY A;  1SQY A;  3PPQ A;  1MH4 A;  2M8C A;  4NF5 A;  1EU8 A;  4DXC A;  3PD8 A;  1IIT A;  2V3T A;  3MWB A;  4GL0 A;  4R2F A;  3SEV A;  1YAE A;  3C34 A;  5ISU A;  4EQB A;  4GQO A;  4MH5 A;  3DLN A;  4NTL A;  4ZEB A;  3FUZ A;  4IO6 A;  2UVJ A;  3EF7 A;  3MPL A;  4G8N A;  4JWO A;  1MQJ A;  1VSO A;  2F35 A;  3OO6 A;  4NF5 B;  4E0X A;  3CG3 A;  3PUY E;  2OZZ A;  4FIM A;  2XXT A;  3K6V A;  1DPE A;  4ZS9 A;  1QKB A;  3U94 A;  5KCJ A;  1EZO A;  3H03 A;  4KI0 E;  2BJJ X;  2QPQ A;  1PBQ A;  4LVQ A;  5K2Y A;  4QSE A;  3OXN A;  4RYA A;  3L6H A;  2H99 A;  4U23 A;  4G68 B;  4F3P A;  5AA3 A;  2F5X A;  3IOR A;  2XXR A;  2ZNS A;  5AA2 B;  2Y7R A;  4IY5 A;  5F1Q A;  5J1D A;  1ZBM A;  1FQA A;  3V5A A;  1LBC A;  4U1O A;  1HSE A;  3IB2 A;  3TFL A;  3O66 A;  1O64 A;  2Z8E A;  4M4G A;  4AB6 A;  4BDO A;  5H8N B;  1P1O A;  3DP8 A;  1B0H A;  1Y1Z A;  3G7W A;  4ESW A;  3UK4 A;  4QFL A;  1IEJ A;  1ZIU A;  3OSQ A;  1MQD A;  1FTK A;  2OBG A;  3EHT A;  3KSX A;  3EQ1 A;  1JW4 A;  4R6K A;  2YJP A;  4R9G A;  2O1M A;  3K1P A;  1FTO A;  3N94 A;  1I69 A;  1SBP A;  2ONR A;  1FQD A;  1SYH A;  1ZJL A;  2QS2 A;  3FXQ A;  2H98 A;  3LSX A;  4H8I A;  3I6V A;  3O9P A;  1I6Q A;  4N13 A;  4N6P A;  4JWY A;  2I0C A;  4UAC A;  3T93 B;  3KEI A;  2P2A A;  1MY4 A;  1XHY A;  3DP6 A;  1MRP A;  3PUV E;  1UTB A;  3RUM A;  3TYH A;  5IAI A;  4KYS A;  3GBA A;  4K3F A;  4OFJ A;  4U4X A;  4BDL A;  4YB5 A;  4EF2 A;  3C32 A;  4ZED A;  1LB8 A;  2IA4 A;  1D9Y A;  1OMP A;  3FXR A;  3H7M A;  1EH3 A;  3OO9 A;  1JNF A;  3MAM A;  4YKK A;  2XXH A;  3R7X A;  3CSB A;  1GR2 A;  2DYX A;  2Y84 A;  3MZB A;  3PUZ E;  5TP9 A;  4IGT A;  3C31 A;  3TKD A;  1D3K A;  4F3G A;  1ZKB A;  5JTY A;  2RF1 A;  3AXF A;  5TPA B;  1A55 A;  3QUF A;  4NWD A;  4PFY A;  1P1U A;  5DVJ A;  4ZZE A;  5KZT A;  2GFE A;  4NF6 B;  4TLL B;  3O6I A;  4H5G A;  2O7I A;  3VXC A;  4DXU A;  1QW0 A;  4OFL A;  4R75 A;  1R9Q A;  2E0S A;  5CMM A;  4U21 A;  5CMK A;  3PV0 E;  1B7H A;  4E0W A;  3FXU A;  2F34 A;  1MQI A;  4LZ7 A;  4XKQ A;  2PVU A;  1NNT A;  4HS7 A;  5KDT B;  2X7P A;  2OCU A;  1H76 A;  2GH9 A;  3QSL A;  2DXY A;  3HO7 A;  1FCK A;  2Y7I A;  3KJT A;  4ONY A;  1LFG A;  4MLQ A;  1LFH A;  4FEC A;  1WVJ A;  1PB7 A;  2THI A;  2AIX A;  1OVT A;  3TUS A;  3OO8 A;  3MJN A;  1I6A A;  3G3H A;  4G8H A;  4PET A;  5L9O A;  4EDP A;  1URD A;  2XXX A;  3ZSF A;  1FQE A;  2X26 A;  4R72 A;  4YKP A;  3E4R A;  4AB5 A;  2CZL A;  3IJO B;  2Z8D A;  5H8Q A;  1B1H A;  3QXM A;  2Q89 A;  3IB0 A;  3K1M A;  4OWD A;  1B3G A;  3DM0 A;  4PP0 A;  1DTZ A;  5ICQ A;  2OK2 A;  4KYE A;  5A5X B;  4NF6 A;  2A5T B;  1MXZ A;  4OYV A;  4ELP A;  1M5B A;  1MXX A;  3F11 A;  3IO4 A;  2RC8 A;  3VDF A;  3U93 A;  3QUJ A;  1R6Z A;  3TTR A;  5AA4 A;  2RIN A;  4RNS A;  2F36 A;  3TEL A;  3UP9 A;  3CR9 A;  5AE4 A;  1QJM A;  5CBS A;  5IKB A;  4X1B A;  1XVX A;  4UA8 A;  1HSL A;  1POT A;  4BDN A;  3LSW A;  1MPC A;  4I1D A;  4QFN A;  5DEX A;  4RY1 A;  5CC2 A;  1LAX A;  3K4U A;  1P1N A;  4F19 A;  1Q35 A;  2UVG A;  2DP8 A;  3V83 A;  2UVH A;  3FVO A;  1QKA A;  3UA8 A;  1NH8 A;  4WKM A;  4LQ2 A;  1F9B A;  4ZZA A;  4EQ7 A;  1FQB A;  1HSJ A;  4G8M A;  3SET A;  1QVS A;  3PU5 A;  1ELJ A;  4WED A;  4ELQ A;  3PPO A;  4ELO A;  3I5O A;  1OLA A;  4X1D A;  1EZP A;  4F22 A;  3DEL B;  1B3H A;  3SKP A;  3THI A;  3VLU A;  3VV5 A;  3U1O A;  5JK4 A;  4OHN A;  2XX9 A;  4YZZ A;  5H8H B;  5I2N B;  4Z7E A;  1ZU0 A;  2O6A A;  1I6B A;  1MDP 1;  3O28 A;  4NF4 A;  4XKP A;  2B3B A;  3TAJ A;  3VFJ A;  3TCG A;  1H43 A;  5A5X A;  1WDN A;  3GZG A;  4OEV A;  1BP5 A;  1B05 A;  1B52 A;  2G93 A;  2P0S A;  3JYR A;  1B5J A;  1SW5 A;  4IO4 A;  3N6T A;  3V8X B;  4U1Z A;  4BDQ A;  3ZKL A;  1QUL A;  2NWJ A;  3MUQ A;  1IIW A;  3H4Z A;  3FJ7 A;  4IO7 A;  1S50 A;  5CM6 A;  1R1N A;  4TOZ A;  4RPO A;  4LP2 B;  4XTC Q;  2AL4 A;  3PPN A;  3MBP A;  1IXI A;  3B6T A;  4BLA A;  2QL3 A;  1JET A;  4OZ9 A;  2XXP A;  1MXV A;  2I48 A;  4GVO A;  1A7L A;  1B4Z A;  2D21 A;  4ZEF A;  2ALU A;  3CFZ A;  3TQW A;  2OWT A;  1NFT A;  5KDT A;  1PDA A;  5EHM A;  5H8F A;  3PGF A;  1D4N A;  1Q1K A;  3EN3 A;  3KFM A;  3ZS6 A;  2HXW A;  3M8U A;  1US5 A;  5CRY A;  3Q29 A;  4C0R A;  1B7U A;  1NNK A;  3TPA A;  4OES A;  4R9F A;  5AA1 A;  1M5C A;  3A3U A;  4HCW A;  4R74 A;  3KN3 A;  2GHB A;  4PFT A;  4THI A;  2QMX A;  1A8E A;  3G3I A;  4RA1 A;  3G3F A;  1YCJ A;  4IY6 A;  4OET A;  4OXV A;  4PFU A;  3C9H A;  4H65 A;  1B1X A;  3G3K A;  2HAU A;  2ONK E;  3ONM A;  3MW0 A;  2PYY A;  4ISU A;  5DEX B;  2XX8 A;  3TCF A;  3E9X A;  3LSL A;  4P11 A;  5I59 A;  1SW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...