4JY2A

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, native and unliganded form
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 127
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4jy2A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4jy2A01
4Z2UA 2B9XA 1VDCA 3QVPA 3NYCA 4YKFA 3BHFA 2C66A 4RG3A 2WDQA 3GRSA 4OCGA 3RHAA 4OPCA 4B68A 4H2NA 1BKWA 1IUUA 4C3XA 2QCUA 4EMWA 4RSLA 3CGCA 1D5TA 1DJQA 5KVIA 3CPHG 2YLSA 1E6EA 3V76A 1X31B 4ICYA 2YM2A 3KA7A 2C3DA 4IA5A 4J56A 1L0VA 1TDFA 3SGLA 1DOBA 1TDNA 2JB1A 3G5QA 2WPCA 4M52A 3CPJG 2Z5YA 4YXDA 2X99A 1HYUA 2FBWA 1ZOVA 1CHUA 4H4QA 1B8SA 2V61A 3T37A 4J31A 2PYXA 2WQYA 3KKJA 3SFEA 2CVJA 1JNZA 1MXTA 2JB2A 3KD9A 1CJ3A 3AYJA 2EQ6A 1EL7A 4Z24A 3GMCA 3KLJA 1H7WA 2YM1A 3GYIA 4Z44A 2A8XA 2ZZ0A 3KU9A 2XVJA 2CULA 3OZ2A 4GDPA 1TDEA 2C73A 3AE5A 5KOXA 1E39A 3LADA 3QVRA 1IJHA 1DXLA 4C77A 3AEEA 4NTCA 5GSNA 1JRYA 4Y4NA 1O5WA 2BABA 2H88A 2YVFA 4H4VA 4IVOB 2YLXA 1E1MA 1K0JA 2C7GA 1L9DA 3CTYA 2A89A 1DOCA 1GNDA 1OJCA 2GAHB 4U2LA 3S61A 3UTFA 2XLPA 3UKPA 2R0CA 3IWAA 1GXFA 1S2QA 1PJ5A 3P4QA 3COXA 3UTEA 1GRFA 2GV8A 4EQXA 5KXJA 1DNCA 5JCMA 4Z2TA 2IVEA 2FJBA 3NK0X 2WOWA 4HB9A 3UOZA 2YG4A 4J2WA 4FDCB 3AD7B 4J34A 2BCPA 4USQA 1GERA 2OA1A 3L8KA 2A87A 3NN0X 4H50A 2GB0A 3H8LA 4YSZA 1TYTA 2YQUA 1KNRA 2V3AA 2OLNA 1NHSA 3AEFA 3EAOA 3VRBA 4AP3A 2C67A 3UP4A 1IUWA 2NPXA 2ZZBA 1ZKQA 1Z6LA 3ISHA 2Q0LA 3CNJA 3M13A 1H83A 3AE6A 4U2TA 2RGOA 3V3NA 3UKQA 2WETA 4TM1A 1OJ9A 4U8KA 1B4VA 4WCTA 4JY2A 4O5QA 3BHKA 3UKLA 2CFYA 2VRMA 1E1NA 4D03A 4CRTA 4BK3A 2GMHA 1B37A 4EQWA 4ZN0A 1TRBA 2WPFA 4TM4A 3NHOX 3QSSA 2VOUA 2GAGB 3WE0A 5M10A 3GWFA 2WOIA 3ATRA 2YG6A 3Q9TA 3L1RA 2VZ2A 1PXBA 1GPEA 2EQ8A 3AXBA 5GRTA 1N4WA 4Z25A 3CGBA 5FS7A 1JRXA 1LPFA 2VQBA 4OPIA 1VG9A 2VVLA 1NG4A 4REKA 3P4RA 2X3NA 4B64A 4WX1A 4A7AA 3I6DA 4J36A 4YTPA 1GTEA 2RABA 1ZMCA 4XWZA 3BNUA 3EF6A 4LU6A 3UKAA 3O0HA 3AE9A 1B5QA 2WHDA 2VQ7A 3AE7A 2Q0KA 2W0HA 3UOYA 4N9XA 4DNAA 2JBVA 5BULA 1LTXR 2YWLA 3AYIA 1GOSA 2GR1A 2WESA 4GDEA 3DK9A 1PN0A 1K4QA 1KDGA 4U8MA 1VQWA 3B6DA 5KRQA 3Q6JA 1KF6A 2YLWA 3AYLA 1CJCA 5TR3A 3VR9A 1AOGA 2WBAA 4OPTA 4BK2A 3LZWA 4H2QA 4EQSA 1LQTA 1OJDA 2Q7VA 3H8IA 4U8IA 2E4GA 2B9WA 4TLXA 3SM8A 4YT0A 3NTAA 2BXSA 3II4A 4FK1C 5HYMA 3VR8A 3UTGA 4B69A 2RGJA 3AE3A 2R4EA 3ATQA 4U8OA 3FG2P 3AWIA 4B66A 4H4RA 3KVEA 1NDAA 2XFUA 4CCRA 1KNPA 4H4XA 5JCNA 1D4CA 3B3RA 5JCIA 1YQ4A 1P2HA 1F8SA 3LOVA 2X8HA 4TM3A 1EL8A 3AD9B 2AQJA 3C4NA 4YWOA 1M6IA 3D8XA 2C75A 4AT2A 1GTHA 1N4VA 1E1LA 2E1MA 2OAMA 2GQFA 2GR2A 3LB8A 5IPYA 1TDKA 1XANA 2E5VA 4OPDA 5FS9A 3RP7A 2V60A 3NG7X 2B9YA 4Z2RA 1NHQA 3AE8A 4EM4A 1KFYA 3C4AA 1F8RA 1ZX9A 3VRAA 2APGA 2BK3A 3NLCA 1O95A 3GWDA 5HY5A 1ELIA 1ZOYA 1GRHA 1RYIA 1REOA 2C64A 3NH3X 1PS9A 2WDVA 3AEGA 3F8DA 1L9EA 4CNKA 1EL9A 3CPIG 3KPFA 2GRTA 1OJTA 2BK4A 4J33A 3SQPA 5HXIA 2QAEA 1EL5A 1F8WA 2YR6A 1GALA 2XFOA 3LZXA 1PBEA 3QFBA 5KOWA 4A99A 3AECA 4IV9A 3ALLA 3AEAA 2GMJA 4H7UA 2BYBA 4I59A 4OVIA 5JCKA 3UKFA 2OLOA 4AOSA 2V3BA 5FS8A 3FMWA 3P4SA 1YY5A 1COYA 3D1CA 5C3JA 3GMBA 1BZLA 4A6NB 1E1KA 4KX6A 4K5SA 3UKHA 2BA9A 2XFQA 2IIDA 4BV6A 2FJEA 1KSSA 1ONFA 3ITJA 2C76A 3URHA 2QA2A 3ICSA 2CDUA 2EQ7A 2C70A 2ZBWA 4A6NA 1CC2A 2Y6RA 1GESA 4OPUA 3AB1A 5DBJA 3VRDB 4AOXA 2BCGG 5FMHA 2GH5A 2R9ZA 2DKHA 1PDHA 3BI4A 3NKSA 2WDRA 1YQZA 1LJ1A 1O94A 4X9MA 1S2YA 2EQ9A 2XDOA 3BNMA 4HA6A 2XVHA 1FL2A 1IUSA 1BGNA 4AP1A 4X4JA 2RGHA 1LQUA 3PO7A 2GR0A 2XFNA 4H4PA 1L9CA 1FECA 2B76A 2WP5A 2JB3A 5ER0A 1ZY8A 2R4JA 2WPEA 3PVCA 4CY6A 3G5RA 4DSHA 2O9ZA 3F8PA 1S3EA 1OJAA 2AAQA 3AE2A 3GD3A 3RNMA 1PHHA 3UP5A 3ADAB 2YR4A 4BK1A 1JNRA 4C74A 4A9WA 2ARDA 3OC4A 2C3CA 1KSUA 1H82A 4B63A 4ECHA 4JY3A 1NPXA 2XVFA 3CIRA 2JAEA 2BS3A 4K5RA 5CQFA 5LV9A 3C96A 3GYJA 2FJAA 1ZK7A 3DH9A 3NYFA 1LV0A 1PBFA 1NEKA 3IHGA 2GR3A 2BC1A 4JDRA 4BURA 3NK2X 1CJ4A 3EANA 4UDRA 3QFAA 1E7PA 2TMDA 3AE4A 3NN6X 3GD4A 2Z5XA 4NEVA 3NNEA 4H4SA 3K7TA 4PABA 3ALMA 3P1WA 4BJYA 4MJWA 1NAAA 1PXCA 3K30A 3CNDA 3REDA 2VRLA 2XLUA 3FBSA 3NT6A 2XLRA 3DMEA 3RP6A 5U1OA 4LIIA 1PBCA 4UP3A 3K7QX 1PXAA 2GEWA 4CY8A 1D7YA 3LJPA 4H2RA 4A65A 2C72A 3NK1X 5EB4A 4A79A 3FIMB 4UDPA 2BS2A 1N4UA 5BRTA 1BGJA 4GR1A 1D7LA 1UKVG 1F6MA 2ACZA 3CNSA 3CN8A 1M64A 2AR8A 5IQ4A 5BVAA 4E0VA 2YG7A 4A5LA 4O5UA 3UOVA 2XCGA 4EIQA 4OPLA 3UOXA 4NEWA 4JQ9A 4Y4LA 1GRAA 5U25A 2R0GA 1NG3A 4XXGA 4JNQA 5EBKA 4YKGA 3DA1A 1H6VA 2XLTA 3GSIA 4NZHA 4P9SA 3SFDA 2WU2A 1XHCA 3AE1A 4AT0A 4U8PA 2C65A 1TDOA 4U8NA 3UKKA 1FEBA 3M12A 5KWFA 2XVIA 4GRTA 1BWCA 1ZP0A 1XPQA 2X8GA 1PJ7A 1JU2A 4H4WA 3M0OA 5J7XA 1H7XA 3ICTA 1S3BA 2QA1A 2ZZCA 4YSHA 1ZMDA 5CKUA 4EM3A 4Z26A 3LXDA 4YTNA 4XWRA 4H2PA 1NENA 4EQRA 1GSNA 4NTEA 2V6OA 4BJZA 1K0LA 3DGHA 3JSKA 3PS9A 2YR5A 3NRNA 4EMIA 3CNTA 2WS3A 3DGZA 4X9NA 4EIPA 1Q1WA 4OPGA 1ZDLA 4K7ZA 4ADWA 2YG5A 2WP9A 1Y56B 4CNJA 4EMJA 1F3PA 2WU5A 3IF9A 4C5OA 1H86A 2JKCA 2WEUA 2GF3A 4YSYA 1EBDA 4H4ZA 3P9UA 3E1TA 3DJEA 2XFPA 4K8DA 1H84A 3V3OA 1Y56A 2YG3A 1GRGA 3S5WA 3ZDNA 2HQMA 4YTMA 1DJNA 1SEZA 2Y6QA 3UTHA 4B1BA 3NGCX 1GREA 3QSEA 3R9UA 4TLZA 4FX9A 3DJDA 3GDPA 3NYEA 2V5ZA 1CJ2A 1FOHA 4ZCCA 2BC0A 5M0ZA 5J60A 2WP6A 1GRBA 1GT8A 5U63A 2I0ZA 2R45A 2DKIA 2PHHA 2NVKX 4LA1A 3QJ4A 2BK5A 3H4KA 3UCLA 3DK4A 2BXRA 1PBBA 4GCMA 1QLBA 1QO8A 4IA6A 2B7RA 1D4EA 1JEHA 1FEAA 4JN9A 4U8LA 4B67A 4KPRA 4USRA 4CCQA 3P4PA 4ZCDA 4U2SA 2YLRA 3CGDA 3FPZA 4NTDA 3DJJA 1JOAA 1NHRA 2WOVA 4DSGA 1V59A 4FK1A 1IUVA 2YLTA 2VVMA 1DODA 4J57A 1XDIA 3CNPA 1Q1RA 4H4TA 2YLZA 4Y4MA 4APNA 1TYPA 4C3YA 1GRTA 1BF3A 1RSGA 2GQWA 2JK6A 2X50A 1YQ3A 1GV4A 1QJDA 4CBQA 4RG4A 4GUVA 1CL0A 1VRQB 3IHMA 1D4DA 1K0IA 2Q6UA 4Z43A 2GVCA 3GRTA 2BS4A 3BI5A 4K2XA 3IC9A 5HHFA 1NHPA 2F5ZA 1YKJA 4TM0A 5BUKA 3K7MX 4H4UA 1RP0A 3GDNA 5FS6A 3VQRA 3QSMA 5JCLA 2XYOA 1LVLA 2B7SA 2YVJA 3G5SA 2J3NA 3NTDA 1DOEA 2TPRA 2YAUA 1FCDA 1P2EA 4PAAA 3RP8A 1GETA 3ZYXA 2BACA 3CGEA 1PBDA 3EPTA 1IUTA 2FJDA 4YSXA 3HZLA 3NIXA 3ABVA 4H4YA 4I58A 1CBOA 3F8RA 4IVMB 1MO9A 3AEBA 3ICRA 3DK8A 5EB5A 4GF7A 5L46A 1N1PA 2YVGA 1VG0A 1MOKA 1IUXA 1CF3A 1H81A 2OALA 2UZZA 3BI2A 5EOWA 5IQ1A 1W4XA 1Y0PA 2XVEA 3AEDA 1JRZA 3I3LA 2IVDA 4B65A 4DGKA 1CC4A 2VVLG 2R46A 1GEUA 3AD8B 3ALJA 5C2TA 4UDQA 4JNAA 4U8JA 2H89A 2X8CA 2R0PA 1PJ6A 4D04A 5KVHA 3DJGX 2XLSA 1Q9IA 4K22A 1CC6A
chains in the Genus database with same CATH superfamily
4Z2UA 2B9XA 1VDCA 3QVPA 1C0PA 3NYCA 4YKFA 3BHFA 2C66A 4RG3A 2WDQA 3GRSA 4OCGA 3RHAA 4OPCA 4B68A 1EVIA 1BKWA 1IUUA 4H2NA 4C3XA 2E49A 2QCUA 4EMWA 4RSLA 3CGCA 1D5TA 1DJQA 5KVIA 3CPHG 2YLSA 1E6EA 3V76A 1X31B 4ICYA 4IA5A 2YM2A 2C3DA 3KA7A 4II3A 4J56A 3SGLA 1TDFA 1L0VA 1DOBA 1TDNA 3HYWA 2JB1A 3G5QA 2WPCA 4M52A 3CPJG 2Z5YA 4YXDA 3G3EA 1HYUA 2FBWA 1ZOVA 1CHUA 2X99A 1B8SA 2V61A 4H4QA 4J31A 3T37A 2PYXA 2WQYA 3KKJA 3SFEA 2CVJA 1JNZA 1MXTA 2JB2A 3KD9A 1CJ3A 3AYJA 2EQ6A 1EL7A 4Z24A 3GMCA 3KLJA 1H7WA 2YM1A 3GYIA 4Z44A 2A8XA 2ZZ0A 3KU9A 3OZ2A 2CULA 2XVJA 4GDPA 1TDEA 2C73A 4II2A 3AE5A 5KOXA 1E39A 3LADA 3QVRA 1IJHA 1DXLA 4C77A 3AEEA 4NTCA 5GSNA 1JRYA 4Y4NA 1O5WA 2BABA 2H88A 2YVFA 4H4VA 4IVOB 2YLXA 1E1MA 1K0JA 2C7GA 1L9DA 3CTYA 2A89A 1DOCA 1GNDA 1OJCA 2GAHB 4U2LA 3S61A 3UTFA 2XLPA 3UKPA 2R0CA 3IWAA 3SYIA 1GXFA 1S2QA 1PJ5A 3HYXA 3P4QA 3COXA 3UTEA 1GRFA 4NWZA 2GV8A 4EQXA 5KXJA 1DNCA 5JCMA 4Z2TA 2IVEA 2FJBA 3NK0X 2WOWA 4HB9A 1C0LA 3UOZA 2YG4A 4J2WA 4FDCB 3AD7B 4G6HA 4J34A 2BCPA 4USQA 1GERA 2OA1A 3L8KA 2A87A 3NN0X 4H50A 2GB0A 3H8LA 4YSZA 1TYTA 2YQUA 1KNRA 2V3AA 2OLNA 1NHSA 3AEFA 3EAOA 3VRBA 4AP3A 2C67A 3UP4A 1IUWA 2NPXA 2ZZBA 1ZKQA 3SX6A 1Z6LA 3ISHA 2Q0LA 3CNJA 3M13A 1H83A 3AE6A 4U2TA 2RGOA 3V3NA 3UKQA 2WETA 4TM1A 1OJ9A 4U8KA 4WCTA 1B4VA 3SXIA 4JY2A 4O5QA 4G6GA 3BHKA 3UKLA 2CFYA 2VRMA 1E1NA 4D03A 4CRTA 4BK3A 2GMHA 1B37A 4EQWA 4ZN0A 1TRBA 2WPFA 4TM4A 3NHOX 3QSSA 2VOUA 4YJFB 2GAGB 3WE0A 5M10A 3GWFA 2WOIA 3ATRA 2YG6A 3Q9TA 3L1RA 2VZ2A 1PXBA 1GPEA 2EQ8A 3AXBA 5GRTA 1N4WA 4Z25A 3CGBA 5FS7A 1JRXA 4YJFA 1LPFA 2VQBA 4OPIA 1VG9A 2VVLA 1NG4A 4REKA 3P4RA 2X3NA 4B64A 4WX1A 4A7AA 3I6DA 4J36A 4YTPA 1GTEA 2RABA 1ZMCA 4XWZA 3BNUA 3EF6A 4LU6A 3UKAA 3O0HA 3AE9A 1B5QA 2E4AA 2WHDA 2VQ7A 3AE7A 2Q0KA 2W0HA 3UOYA 4N9XA 4DNAA 2JBVA 5BULA 1LTXR 1C0KA 2YWLA 3AYIA 1GOSA 2GR1A 2WESA 3T31A 4GDEA 3DK9A 1PN0A 1K4QA 1VE9A 1KDGA 4U8MA 1VQWA 3B6DA 5KRQA 3Q6JA 1KF6A 2YLWA 3AYLA 1CJCA 5TR3A 3VR9A 1AOGA 2WBAA 4BK2A 4OPTA 3ZNQA 3LZWA 4H2QA 3SY4A 4EQSA 1LQTA 1OJDA 2Q7VA 3H8IA 4U8IA 2E4GA 3SM8A 5HYMA 2B9WA 4TLXA 3NTAA 2BXSA 3II4A 4FK1C 4YT0A 3VR8A 3HYVA 3UTGA 4B69A 2RGJA 3AE3A 2R4EA 3ATQA 4U8OA 3FG2P 3AWIA 4B66A 4H4RA 3KVEA 1NDAA 2XFUA 4CCRA 1KNPA 4H4XA 5JCNA 1D4CA 3B3RA 5JCIA 1YQ4A 1P2HA 1F8SA 3LOVA 2X8HA 4TM3A 1EL8A 3AD9B 2AQJA 3C4NA 4YWOA 1M6IA 3D8XA 2C75A 4AT2A 1GTHA 1N4VA 1E1LA 2E1MA 2OAMA 2GQFA 2GR2A 3LB8A 5IPYA 1TDKA 1XANA 2E5VA 4OPDA 5FS9A 3RP7A 2V60A 3NG7X 2B9YA 4Z2RA 1NHQA 3AE8A 4EM4A 1KFYA 3C4AA 1F8RA 1ZX9A 3VRAA 2APGA 3W4KA 2BK3A 3NLCA 1O95A 3GWDA 5HY5A 5KMSA 3KPKA 1ELIA 1ZOYA 1GRHA 1RYIA 1REOA 2C64A 3NH3X 1PS9A 2WDVA 3AEGA 3F8DA 1L9EA 4CNKA 1EL9A 3CPIG 3KPFA 2GRTA 1OJTA 2BK4A 4J33A 3SQPA 5HXIA 2QAEA 1EL5A 1F8WA 2YR6A 1GALA 2XFOA 3LZXA 1PBEA 3QFBA 3CUKA 5KOWA 4A99A 3AECA 4IV9A 3ALLA 3AEAA 2GMJA 4H7UA 2BYBA 4I59A 4OVIA 5JCKA 3UKFA 2OLOA 4AOSA 2V3BA 5FS8A 3FMWA 3P4SA 3W4IA 1YY5A 1COYA 3D1CA 5C3JA 2BRAA 3GMBA 1BZLA 4A6NB 1E1KA 4KX6A 4K5SA 3UKHA 2BA9A 2XFQA 2IIDA 4BV6A 2FJEA 1KSSA 2E48A 1ONFA 3ITJA 2C76A 3URHA 2QA2A 3ICSA 2CDUA 2EQ7A 2C70A 2ZBWA 4A6NA 1CC2A 2Y6RA 1GESA 4OPUA 3AB1A 5DBJA 3VRDB 4AOXA 2BCGG 5FMHA 2GH5A 4YJGB 2DKHA 2R9ZA 1PDHA 3BI4A 3NKSA 2WDRA 1YQZA 3SZFA 1LJ1A 4YJHB 4X9MA 1O94A 1S2YA 2EQ9A 2XDOA 3BNMA 4HA6A 2XVHA 1FL2A 1IUSA 1BGNA 4AP1A 4X4JA 2RGHA 3CMMA 1LQUA 3PO7A 4QFCA 2GR0A 2XFNA 1L9CA 1FECA 4YJHA 2B76A 4H4PA 2WP5A 2JB3A 4GAPA 5ER0A 2R4JA 3PVCA 1ZY8A 2WPEA 1C0IA 3G5RA 4G74A 2O9ZA 4CY6A 3F8PA 4DSHA 1S3EA 1OJAA 2AAQA 3AE2A 3GD3A 3RNMA 1PHHA 3UP5A 3ADAB 2YR4A 4BK1A 1JNRA 4C74A 4A9WA 2ARDA 3OC4A 2C3CA 1KSUA 1H82A 4B63A 4ECHA 4JY3A 1NPXA 2XVFA 3CIRA 2JAEA 2BS3A 4K5RA 5KMRA 5CQFA 5LV9A 3C96A 1DDOA 3GYJA 2FJAA 1ZK7A 3DH9A 3NYFA 1PBFA 1LV0A 1NEKA 3IHGA 2GR3A 2BC1A 4JDRA 4BURA 3NK2X 1CJ4A 3W4JA 3EANA 4UDRA 3QFAA 1E7PA 2TMDA 3AE4A 3NN6X 3GD4A 2Z5XA 4NEVA 3NNEA 4H4SA 3K7TA 4PABA 3ALMA 3P1WA 4BJYA 4MJWA 1NAAA 1PXCA 3K30A 3CNDA 3RP6A 2VRLA 2XLUA 3FBSA 3NT6A 2XLRA 3DMEA 3GYXA 5U1OA 4G9KA 4LIIA 1PBCA 4UP3A 3K7QX 1PXAA 2GEWA 4CY8A 1D7YA 3LJPA 4H2RA 4A65A 2C72A 3NK1X 5EB4A 3REDA 4A79A 3FIMB 4UDPA 4GAVA 2BS2A 1N4UA 5BRTA 1BGJA 4GR1A 1D7LA 1UKVG 1F6MA 2ACZA 3CNSA 3CN8A 1M64A 2AR8A 5IQ4A 5BVAA 1KIFA 3T0KA 4E0VA 2YG7A 3T2YA 4A5LA 4O5UA 3UOVA 2XCGA 4EIQA 4OPLA 3UOXA 4NEWA 4JQ9A 4YJDA 4Y4LA 1GRAA 5U25A 2R0GA 1NG3A 4XXGA 4JNQA 5EBKA 4YKGA 3DA1A 1H6VA 3ZNPA 3GSIA 2XLTA 4NZHA 4P9SA 3SFDA 2WU2A 1XHCA 3AE1A 4AT0A 2DU8A 4U8PA 2C65A 1TDOA 4U8NA 3UKKA 3M12A 1FEBA 5KWFA 2XVIA 4GRTA 1BWCA 3SZCA 1ZP0A 1XPQA 2X8GA 1PJ7A 1JU2A 4H4WA 3M0OA 5J7XA 1H7XA 3ICTA 1S3BA 2QA1A 4YSHA 2ZZCA 1ZMDA 5CKUA 4EM3A 4Z26A 3LXDA 4YTNA 4XWRA 4H2PA 1NENA 4EQRA 5KMQA 1GSNA 4NTEA 2V6OA 4BJZA 1K0LA 3DGHA 3PS9A 3JSKA 4QFDA 2YR5A 3NRNA 4EMIA 3CNTA 2WS3A 4X9NA 3DGZA 4EIPA 1Q1WA 4OPGA 1ZDLA 4K7ZA 4ADWA 2YG5A 2WP9A 1Y56B 4CNJA 4EMJA 1F3PA 2WU5A 3IF9A 4C5OA 1H86A 2JKCA 2WEUA 2GF3A 4YSYA 1EBDA 4H4ZA 3P9UA 3E1TA 3DJEA 2XFPA 4K8DA 1H84A 3V3OA 1Y56A 2YG3A 1GRGA 3S5WA 3ZDNA 2HQMA 4YTMA 1DJNA 1SEZA 2BRYA 2Y6QA 3UTHA 4B1BA 3NGCX 3QSEA 1GREA 3R9UA 4TLZA 3SZWA 4FX9A 2C4CA 3DJDA 3GDPA 3NYEA 1DAOA 2V5ZA 1FOHA 1CJ2A 4ZCCA 2BC0A 5M0ZA 5J60A 2WP6A 1GRBA 1GT8A 5U63A 2I0ZA 2R45A 2DKIA 2PHHA 2NVKX 4LA1A 3QJ4A 2BK5A 3H4KA 3UCLA 5KNLA 3DK4A 2BXRA 4YJGA 1PBBA 4GCMA 1QLBA 1QO8A 4IA6A 2B7RA 1D4EA 1JEHA 1FEAA 4JN9A 4U8LA 4B67A 4KPRA 4USRA 4CCQA 3P4PA 4ZCDA 4U2SA 2YLRA 3CGDA 3FPZA 4NTDA 3DJJA 1JOAA 1NHRA 2WOVA 4DSGA 1V59A 4FK1A 1IUVA 2YLTA 2VVMA 1DODA 4J57A 3SZ0A 1XDIA 3CNPA 1Q1RA 4H4TA 2YLZA 4Y4MA 4APNA 3T2KA 1TYPA 4C3YA 1GRTA 1BF3A 1RSGA 2GQWA 2JK6A 2X50A 1YQ3A 1GV4A 1QJDA 4CBQA 4RG4A 4GUVA 1VRQB 1CL0A 3IHMA 1K0IA 2Q6UA 1D4DA 3T2ZA 4Z43A 2GVCA 3GRTA 3T14A 2BS4A 3BI5A 4K2XA 3IC9A 5HHFA 1NHPA 2F5ZA 1YKJA 4TM0A 5BUKA 1AN9A 3K7MX 4H4UA 1RP0A 2E82A 3GDNA 3VQRA 5FS6A 3QSMA 5JCLA 2XYOA 1LVLA 2B7SA 2YVJA 3G5SA 2J3NA 3NTDA 1DOEA 2TPRA 2YAUA 4PAAA 1FCDA 1P2EA 3RP8A 1GETA 3ZYXA 2BACA 3CGEA 1PBDA 1IUTA 3EPTA 2FJDA 4YSXA 3HZLA 3NIXA 3ABVA 3WGTA 4H4YA 4I58A 1CBOA 5KMPA 3F8RA 4IVMB 1MO9A 3AEBA 3ICRA 3DK8A 5EB5A 4GF7A 5L46A 1N1PA 2YVGA 1VG0A 1MOKA 1IUXA 1CF3A 2UZZA 1H81A 2OALA 3BI2A 5EOWA 5IQ1A 1W4XA 1Y0PA 2XVEA 3AEDA 1JRZA 3I3LA 2IVDA 4B65A 4DGKA 1CC4A 4G73A 2VVLG 2R46A 1GEUA 3AD8B 3ALJA 4NNJA 4UDQA 5C2TA 3ZNNA 4JNAA 4U8JA 2H89A 2X8CA 3ZNOA 2R0PA 1PJ6A 4D04A 5KVHA 3DJGX 2XLSA 1Q9IA 4K22A 1CC6A
chains in the Genus database with same CATH topology
4Z2UA 2B9XA 1VDCA 3QVPA 3NYCA 4YKFA 3BHFA 2C66A 4RG3A 2WDQA 3GRSA 4OCGA 3RHAA 4OPCA 4B68A 4H2NA 1BKWA 1IUUA 4C3XA 2QCUA 4EMWA 4RSLA 3CGCA 1D5TA 1DJQA 5KVIA 3CPHG 2YLSA 1E6EA 3V76A 1X31B 4ICYA 4IA5A 2YM2A 2C3DA 3KA7A 4II3A 4J56A 1L0VA 1TDFA 3SGLA 1DOBA 1TDNA 3HYWA 2JB1A 3G5QA 2WPCA 4M52A 3CPJG 2Z5YA 4YXDA 2X99A 1HYUA 2FBWA 1ZOVA 1CHUA 4H4QA 1B8SA 2V61A 3T37A 4J31A 2PYXA 2WQYA 3KKJA 3SFEA 2CVJA 1JNZA 1MXTA 2JB2A 3KD9A 1CJ3A 3AYJA 2EQ6A 1EL7A 4Z24A 3GMCA 3KLJA 1H7WA 2YM1A 3GYIA 4Z44A 2A8XA 2ZZ0A 3KU9A 2XVJA 2CULA 3OZ2A 4GDPA 1TDEA 2C73A 4II2A 3AE5A 5KOXA 1E39A 3LADA 3QVRA 1IJHA 1DXLA 4C77A 3AEEA 4NTCA 5GSNA 1JRYA 4Y4NA 1O5WA 2BABA 2H88A 2YVFA 4H4VA 4IVOB 2YLXA 1E1MA 1K0JA 2C7GA 1L9DA 3CTYA 2A89A 1DOCA 1GNDA 1OJCA 2GAHB 4U2LA 3S61A 3UTFA 2XLPA 3UKPA 2R0CA 3IWAA 3SYIA 1GXFA 1S2QA 1PJ5A 3HYXA 3P4QA 3COXA 3UTEA 1GRFA 4NWZA 2GV8A 4EQXA 5KXJA 1DNCA 5JCMA 4Z2TA 2IVEA 2FJBA 3NK0X 2WOWA 4HB9A 3UOZA 2YG4A 4J2WA 4FDCB 3AD7B 4G6HA 4J34A 2BCPA 4USQA 1GERA 2OA1A 3L8KA 2A87A 3NN0X 4H50A 2GB0A 3H8LA 4YSZA 1TYTA 2YQUA 1KNRA 2V3AA 2OLNA 1NHSA 3AEFA 3EAOA 3VRBA 4AP3A 2C67A 3UP4A 1IUWA 2NPXA 2ZZBA 1ZKQA 3SX6A 1Z6LA 3ISHA 2Q0LA 3CNJA 3M13A 1H83A 3AE6A 4U2TA 2RGOA 3V3NA 3UKQA 2WETA 4TM1A 1OJ9A 4U8KA 1B4VA 4WCTA 3SXIA 4JY2A 4O5QA 4G6GA 3BHKA 3UKLA 2CFYA 2VRMA 1E1NA 4D03A 4CRTA 4BK3A 2GMHA 1B37A 4EQWA 4ZN0A 1TRBA 2WPFA 4TM4A 3NHOX 3QSSA 2VOUA 2GAGB 3WE0A 5M10A 3GWFA 2WOIA 3ATRA 2YG6A 3Q9TA 3L1RA 2VZ2A 1PXBA 1GPEA 2EQ8A 3AXBA 5GRTA 1N4WA 4Z25A 3CGBA 5FS7A 1JRXA 1LPFA 2VQBA 4OPIA 1VG9A 2VVLA 1NG4A 4REKA 3P4RA 2X3NA 4B64A 4WX1A 4A7AA 3I6DA 4J36A 4YTPA 1GTEA 2RABA 1ZMCA 4XWZA 3BNUA 3EF6A 4LU6A 3UKAA 3O0HA 3AE9A 1B5QA 2WHDA 2VQ7A 3AE7A 2Q0KA 2W0HA 3UOYA 4N9XA 4DNAA 2JBVA 5BULA 1LTXR 2YWLA 3AYIA 1GOSA 2GR1A 2WESA 3T31A 4GDEA 3DK9A 1PN0A 1K4QA 1KDGA 4U8MA 1VQWA 3B6DA 5KRQA 3Q6JA 1KF6A 2YLWA 3AYLA 1CJCA 5TR3A 3VR9A 1AOGA 2WBAA 4BK2A 4OPTA 3LZWA 4H2QA 3SY4A 4EQSA 1LQTA 1OJDA 2Q7VA 3H8IA 4U8IA 2E4GA 2B9WA 5HYMA 4TLXA 3SM8A 3NTAA 2BXSA 3II4A 4FK1C 4YT0A 3VR8A 3HYVA 3UTGA 4B69A 2RGJA 3AE3A 2R4EA 3ATQA 4U8OA 3FG2P 3AWIA 4B66A 4H4RA 3KVEA 1NDAA 2XFUA 4CCRA 1KNPA 4H4XA 5JCNA 1D4CA 3B3RA 5JCIA 1YQ4A 1P2HA 1F8SA 3LOVA 2X8HA 4TM3A 1EL8A 3AD9B 2AQJA 3C4NA 4YWOA 1M6IA 3D8XA 2C75A 4AT2A 1GTHA 1N4VA 1E1LA 2E1MA 2OAMA 2GQFA 2GR2A 3LB8A 5IPYA 1TDKA 1XANA 2E5VA 4OPDA 5FS9A 3RP7A 2V60A 3NG7X 2B9YA 4Z2RA 1NHQA 3AE8A 4EM4A 1KFYA 3C4AA 1F8RA 1ZX9A 3VRAA 2APGA 2BK3A 3NLCA 1O95A 3GWDA 5HY5A 5KMSA 3KPKA 1ELIA 1ZOYA 1GRHA 1RYIA 1REOA 2C64A 3NH3X 1PS9A 2WDVA 3AEGA 3F8DA 1L9EA 4CNKA 1EL9A 3CPIG 3KPFA 2GRTA 1OJTA 2BK4A 4J33A 3SQPA 5HXIA 2QAEA 1EL5A 1F8WA 2YR6A 1GALA 2XFOA 3LZXA 1PBEA 3QFBA 5KOWA 4A99A 3AECA 4IV9A 3ALLA 3AEAA 2GMJA 4H7UA 2BYBA 4I59A 4OVIA 5JCKA 3UKFA 2OLOA 4AOSA 2V3BA 5FS8A 3FMWA 3P4SA 1YY5A 1COYA 3D1CA 5C3JA 2BRAA 3GMBA 1BZLA 4A6NB 1E1KA 4KX6A 4K5SA 3UKHA 2BA9A 2XFQA 2IIDA 4BV6A 2FJEA 1KSSA 1ONFA 3ITJA 2C76A 3URHA 2QA2A 3ICSA 2CDUA 2EQ7A 2C70A 2ZBWA 4A6NA 1CC2A 2Y6RA 1GESA 4OPUA 3AB1A 5DBJA 3VRDB 4AOXA 2BCGG 5FMHA 2GH5A 2R9ZA 2DKHA 1PDHA 3BI4A 3NKSA 2WDRA 1YQZA 3SZFA 1LJ1A 1O94A 4X9MA 1S2YA 2EQ9A 2XDOA 3BNMA 4HA6A 2XVHA 1FL2A 1IUSA 1BGNA 4AP1A 4X4JA 2RGHA 3CMMA 1LQUA 3PO7A 2GR0A 2XFNA 4H4PA 1L9CA 1FECA 2B76A 2WP5A 2JB3A 4GAPA 5ER0A 1ZY8A 2R4JA 2WPEA 3PVCA 4G74A 3G5RA 4CY6A 2O9ZA 4DSHA 3F8PA 1S3EA 1OJAA 2AAQA 3AE2A 3GD3A 3RNMA 1PHHA 3UP5A 3ADAB 2YR4A 4BK1A 1JNRA 4C74A 4A9WA 2ARDA 3OC4A 2C3CA 1KSUA 1H82A 4B63A 4ECHA 4JY3A 1NPXA 2XVFA 3CIRA 2JAEA 2BS3A 4K5RA 5KMRA 5CQFA 5LV9A 3C96A 3GYJA 2FJAA 1ZK7A 3DH9A 3NYFA 1LV0A 1PBFA 1NEKA 3IHGA 2GR3A 2BC1A 4JDRA 4BURA 3NK2X 1CJ4A 3EANA 4UDRA 3QFAA 1E7PA 2TMDA 3AE4A 3NN6X 3GD4A 2Z5XA 4NEVA 3NNEA 4H4SA 3K7TA 4PABA 3ALMA 3P1WA 4BJYA 4MJWA 1NAAA 1PXCA 3K30A 3CNDA 3RP6A 2VRLA 2XLUA 3FBSA 3NT6A 2XLRA 3DMEA 3GYXA 5U1OA 4G9KA 4LIIA 1PBCA 4UP3A 3K7QX 1PXAA 2GEWA 4CY8A 1D7YA 3LJPA 4H2RA 4A65A 2C72A 3NK1X 5EB4A 3REDA 4A79A 3FIMB 4UDPA 4GAVA 2BS2A 1N4UA 5BRTA 1BGJA 4GR1A 1D7LA 1UKVG 1F6MA 2ACZA 3CNSA 3CN8A 1M64A 2AR8A 5IQ4A 5BVAA 3T0KA 4E0VA 2YG7A 3T2YA 4A5LA 4O5UA 3UOVA 2XCGA 4EIQA 4OPLA 3UOXA 4NEWA 4JQ9A 4Y4LA 1GRAA 5U25A 2R0GA 1NG3A 4XXGA 4JNQA 5EBKA 4YKGA 3DA1A 1H6VA 2XLTA 3GSIA 4NZHA 4P9SA 3SFDA 2WU2A 1XHCA 3AE1A 4AT0A 4U8PA 2C65A 1TDOA 4U8NA 3UKKA 1FEBA 3M12A 5KWFA 2XVIA 4GRTA 1BWCA 3SZCA 1ZP0A 1XPQA 2X8GA 1PJ7A 1JU2A 4H4WA 3M0OA 5J7XA 1H7XA 3ICTA 1S3BA 2QA1A 2ZZCA 4YSHA 1ZMDA 5CKUA 4EM3A 4Z26A 3LXDA 4YTNA 4XWRA 4H2PA 1NENA 4EQRA 5KMQA 1GSNA 4NTEA 2V6OA 4BJZA 1K0LA 3DGHA 3JSKA 3PS9A 2YR5A 3NRNA 4EMIA 3CNTA 2WS3A 3DGZA 4X9NA 4EIPA 1Q1WA 4OPGA 1ZDLA 4K7ZA 4ADWA 2YG5A 2WP9A 1Y56B 4CNJA 4EMJA 1F3PA 2WU5A 3IF9A 4C5OA 1H86A 2JKCA 2WEUA 2GF3A 4YSYA 1EBDA 4H4ZA 3P9UA 3E1TA 3DJEA 2XFPA 4K8DA 1H84A 3V3OA 1Y56A 2YG3A 1GRGA 3S5WA 3ZDNA 2HQMA 4YTMA 1DJNA 1SEZA 2BRYA 2Y6QA 3UTHA 4B1BA 3NGCX 1GREA 3QSEA 3R9UA 4TLZA 3SZWA 4FX9A 2C4CA 3DJDA 3GDPA 3NYEA 2V5ZA 1CJ2A 1FOHA 4ZCCA 2BC0A 5M0ZA 5J60A 2WP6A 1GRBA 1GT8A 5U63A 2I0ZA 2R45A 2DKIA 2PHHA 2NVKX 4LA1A 3QJ4A 2BK5A 3H4KA 3UCLA 5KNLA 3DK4A 2BXRA 1PBBA 4GCMA 1QLBA 1QO8A 4IA6A 2B7RA 1D4EA 1JEHA 1FEAA 4JN9A 4U8LA 4B67A 4KPRA 4USRA 4CCQA 3P4PA 4ZCDA 4U2SA 2YLRA 3CGDA 3FPZA 4NTDA 3DJJA 1JOAA 1NHRA 2WOVA 4DSGA 1V59A 4FK1A 1IUVA 2YLTA 2VVMA 1DODA 4J57A 3SZ0A 1XDIA 3CNPA 1Q1RA 4H4TA 2YLZA 4Y4MA 4APNA 3T2KA 1TYPA 4C3YA 1GRTA 1BF3A 1RSGA 2GQWA 2JK6A 2X50A 1YQ3A 1GV4A 1QJDA 4CBQA 4RG4A 4GUVA 1CL0A 1VRQB 3IHMA 1D4DA 1K0IA 2Q6UA 3T2ZA 4Z43A 2GVCA 3GRTA 3T14A 2BS4A 3BI5A 4K2XA 3IC9A 5HHFA 1NHPA 2F5ZA 1YKJA 4TM0A 5BUKA 3K7MX 4H4UA 1RP0A 3GDNA 5FS6A 3VQRA 3QSMA 5JCLA 2XYOA 1LVLA 2B7SA 2YVJA 3G5SA 2J3NA 3NTDA 1DOEA 2TPRA 2YAUA 1FCDA 1P2EA 4PAAA 3RP8A 1GETA 3ZYXA 2BACA 3CGEA 1PBDA 3EPTA 1IUTA 2FJDA 4YSXA 3HZLA 3NIXA 3ABVA 4H4YA 4I58A 1CBOA 5KMPA 3F8RA 4IVMB 1MO9A 3AEBA 3ICRA 3DK8A 5EB5A 4GF7A 5L46A 1N1PA 2YVGA 1VG0A 1MOKA 1IUXA 1CF3A 1H81A 2OALA 2UZZA 3BI2A 5EOWA 5IQ1A 1W4XA 1Y0PA 2XVEA 3AEDA 1JRZA 3I3LA 2IVDA 4B65A 4DGKA 1CC4A 4G73A 2VVLG 2R46A 1GEUA 3AD8B 3ALJA 4NNJA 4UDQA 5C2TA 4JNAA 4U8JA 2H89A 2X8CA 2R0PA 1PJ6A 4D04A 5KVHA 3DJGX 2XLSA 1Q9IA 4K22A 1CC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2U A;  2B9X A;  1VDC A;  3QVP A;  3NYC A;  4YKF A;  3BHF A;  2C66 A;  4RG3 A;  2WDQ A;  3GRS A;  4OCG A;  3RHA A;  4OPC A;  4B68 A;  4H2N A;  1BKW A;  1IUU A;  4C3X A;  2QCU A;  4EMW A;  4RSL A;  3CGC A;  1D5T A;  1DJQ A;  5KVI A;  3CPH G;  2YLS A;  1E6E A;  3V76 A;  1X31 B;  4ICY A;  2YM2 A;  3KA7 A;  2C3D A;  4IA5 A;  4J56 A;  1L0V A;  1TDF A;  3SGL A;  1DOB A;  1TDN A;  2JB1 A;  3G5Q A;  2WPC A;  4M52 A;  3CPJ G;  2Z5Y A;  4YXD A;  2X99 A;  1HYU A;  2FBW A;  1ZOV A;  1CHU A;  4H4Q A;  1B8S A;  2V61 A;  3T37 A;  4J31 A;  2PYX A;  2WQY A;  3KKJ A;  3SFE A;  2CVJ A;  1JNZ A;  1MXT A;  2JB2 A;  3KD9 A;  1CJ3 A;  3AYJ A;  2EQ6 A;  1EL7 A;  4Z24 A;  3GMC A;  3KLJ A;  1H7W A;  2YM1 A;  3GYI A;  4Z44 A;  2A8X A;  2ZZ0 A;  3KU9 A;  2XVJ A;  2CUL A;  3OZ2 A;  4GDP A;  1TDE A;  2C73 A;  3AE5 A;  5KOX A;  1E39 A;  3LAD A;  3QVR A;  1IJH A;  1DXL A;  4C77 A;  3AEE A;  4NTC A;  5GSN A;  1JRY A;  4Y4N A;  1O5W A;  2BAB A;  2H88 A;  2YVF A;  4H4V A;  4IVO B;  2YLX A;  1E1M A;  1K0J A;  2C7G A;  1L9D A;  3CTY A;  2A89 A;  1DOC A;  1GND A;  1OJC A;  2GAH B;  4U2L A;  3S61 A;  3UTF A;  2XLP A;  3UKP A;  2R0C A;  3IWA A;  1GXF A;  1S2Q A;  1PJ5 A;  3P4Q A;  3COX A;  3UTE A;  1GRF A;  2GV8 A;  4EQX A;  5KXJ A;  1DNC A;  5JCM A;  4Z2T A;  2IVE A;  2FJB A;  3NK0 X;  2WOW A;  4HB9 A;  3UOZ A;  2YG4 A;  4J2W A;  4FDC B;  3AD7 B;  4J34 A;  2BCP A;  4USQ A;  1GER A;  2OA1 A;  3L8K A;  2A87 A;  3NN0 X;  4H50 A;  2GB0 A;  3H8L A;  4YSZ A;  1TYT A;  2YQU A;  1KNR A;  2V3A A;  2OLN A;  1NHS A;  3AEF A;  3EAO A;  3VRB A;  4AP3 A;  2C67 A;  3UP4 A;  1IUW A;  2NPX A;  2ZZB A;  1ZKQ A;  1Z6L A;  3ISH A;  2Q0L A;  3CNJ A;  3M13 A;  1H83 A;  3AE6 A;  4U2T A;  2RGO A;  3V3N A;  3UKQ A;  2WET A;  4TM1 A;  1OJ9 A;  4U8K A;  1B4V A;  4WCT A;  4JY2 A;  4O5Q A;  3BHK A;  3UKL A;  2CFY A;  2VRM A;  1E1N A;  4D03 A;  4CRT A;  4BK3 A;  2GMH A;  1B37 A;  4EQW A;  4ZN0 A;  1TRB A;  2WPF A;  4TM4 A;  3NHO X;  3QSS A;  2VOU A;  2GAG B;  3WE0 A;  5M10 A;  3GWF A;  2WOI A;  3ATR A;  2YG6 A;  3Q9T A;  3L1R A;  2VZ2 A;  1PXB A;  1GPE A;  2EQ8 A;  3AXB A;  5GRT A;  1N4W A;  4Z25 A;  3CGB A;  5FS7 A;  1JRX A;  1LPF A;  2VQB A;  4OPI A;  1VG9 A;  2VVL A;  1NG4 A;  4REK A;  3P4R A;  2X3N A;  4B64 A;  4WX1 A;  4A7A A;  3I6D A;  4J36 A;  4YTP A;  1GTE A;  2RAB A;  1ZMC A;  4XWZ A;  3BNU A;  3EF6 A;  4LU6 A;  3UKA A;  3O0H A;  3AE9 A;  1B5Q A;  2WHD A;  2VQ7 A;  3AE7 A;  2Q0K A;  2W0H A;  3UOY A;  4N9X A;  4DNA A;  2JBV A;  5BUL A;  1LTX R;  2YWL A;  3AYI A;  1GOS A;  2GR1 A;  2WES A;  4GDE A;  3DK9 A;  1PN0 A;  1K4Q A;  1KDG A;  4U8M A;  1VQW A;  3B6D A;  5KRQ A;  3Q6J A;  1KF6 A;  2YLW A;  3AYL A;  1CJC A;  5TR3 A;  3VR9 A;  1AOG A;  2WBA A;  4OPT A;  4BK2 A;  3LZW A;  4H2Q A;  4EQS A;  1LQT A;  1OJD A;  2Q7V A;  3H8I A;  4U8I A;  2E4G A;  2B9W A;  4TLX A;  3SM8 A;  4YT0 A;  3NTA A;  2BXS A;  3II4 A;  4FK1 C;  5HYM A;  3VR8 A;  3UTG A;  4B69 A;  2RGJ A;  3AE3 A;  2R4E A;  3ATQ A;  4U8O A;  3FG2 P;  3AWI A;  4B66 A;  4H4R A;  3KVE A;  1NDA A;  2XFU A;  4CCR A;  1KNP A;  4H4X A;  5JCN A;  1D4C A;  3B3R A;  5JCI A;  1YQ4 A;  1P2H A;  1F8S A;  3LOV A;  2X8H A;  4TM3 A;  1EL8 A;  3AD9 B;  2AQJ A;  3C4N A;  4YWO A;  1M6I A;  3D8X A;  2C75 A;  4AT2 A;  1GTH A;  1N4V A;  1E1L A;  2E1M A;  2OAM A;  2GQF A;  2GR2 A;  3LB8 A;  5IPY A;  1TDK A;  1XAN A;  2E5V A;  4OPD A;  5FS9 A;  3RP7 A;  2V60 A;  3NG7 X;  2B9Y A;  4Z2R A;  1NHQ A;  3AE8 A;  4EM4 A;  1KFY A;  3C4A A;  1F8R A;  1ZX9 A;  3VRA A;  2APG A;  2BK3 A;  3NLC A;  1O95 A;  3GWD A;  5HY5 A;  1ELI A;  1ZOY A;  1GRH A;  1RYI A;  1REO A;  2C64 A;  3NH3 X;  1PS9 A;  2WDV A;  3AEG A;  3F8D A;  1L9E A;  4CNK A;  1EL9 A;  3CPI G;  3KPF A;  2GRT A;  1OJT A;  2BK4 A;  4J33 A;  3SQP A;  5HXI A;  2QAE A;  1EL5 A;  1F8W A;  2YR6 A;  1GAL A;  2XFO A;  3LZX A;  1PBE A;  3QFB A;  5KOW A;  4A99 A;  3AEC A;  4IV9 A;  3ALL A;  3AEA A;  2GMJ A;  4H7U A;  2BYB A;  4I59 A;  4OVI A;  5JCK A;  3UKF A;  2OLO A;  4AOS A;  2V3B A;  5FS8 A;  3FMW A;  3P4S A;  1YY5 A;  1COY A;  3D1C A;  5C3J A;  3GMB A;  1BZL A;  4A6N B;  1E1K A;  4KX6 A;  4K5S A;  3UKH A;  2BA9 A;  2XFQ A;  2IID A;  4BV6 A;  2FJE A;  1KSS A;  1ONF A;  3ITJ A;  2C76 A;  3URH A;  2QA2 A;  3ICS A;  2CDU A;  2EQ7 A;  2C70 A;  2ZBW A;  4A6N A;  1CC2 A;  2Y6R A;  1GES A;  4OPU A;  3AB1 A;  5DBJ A;  3VRD B;  4AOX A;  2BCG G;  5FMH A;  2GH5 A;  2R9Z A;  2DKH A;  1PDH A;  3BI4 A;  3NKS A;  2WDR A;  1YQZ A;  1LJ1 A;  1O94 A;  4X9M A;  1S2Y A;  2EQ9 A;  2XDO A;  3BNM A;  4HA6 A;  2XVH A;  1FL2 A;  1IUS A;  1BGN A;  4AP1 A;  4X4J A;  2RGH A;  1LQU A;  3PO7 A;  2GR0 A;  2XFN A;  4H4P A;  1L9C A;  1FEC A;  2B76 A;  2WP5 A;  2JB3 A;  5ER0 A;  1ZY8 A;  2R4J A;  2WPE A;  3PVC A;  4CY6 A;  3G5R A;  4DSH A;  2O9Z A;  3F8P A;  1S3E A;  1OJA A;  2AAQ A;  3AE2 A;  3GD3 A;  3RNM A;  1PHH A;  3UP5 A;  3ADA B;  2YR4 A;  4BK1 A;  1JNR A;  4C74 A;  4A9W A;  2ARD A;  3OC4 A;  2C3C A;  1KSU A;  1H82 A;  4B63 A;  4ECH A;  4JY3 A;  1NPX A;  2XVF A;  3CIR A;  2JAE A;  2BS3 A;  4K5R A;  5CQF A;  5LV9 A;  3C96 A;  3GYJ A;  2FJA A;  1ZK7 A;  3DH9 A;  3NYF A;  1LV0 A;  1PBF A;  1NEK A;  3IHG A;  2GR3 A;  2BC1 A;  4JDR A;  4BUR A;  3NK2 X;  1CJ4 A;  3EAN A;  4UDR A;  3QFA A;  1E7P A;  2TMD A;  3AE4 A;  3NN6 X;  3GD4 A;  2Z5X A;  4NEV A;  3NNE A;  4H4S A;  3K7T A;  4PAB A;  3ALM A;  3P1W A;  4BJY A;  4MJW A;  1NAA A;  1PXC A;  3K30 A;  3CND A;  3RED A;  2VRL A;  2XLU A;  3FBS A;  3NT6 A;  2XLR A;  3DME A;  3RP6 A;  5U1O A;  4LII A;  1PBC A;  4UP3 A;  3K7Q X;  1PXA A;  2GEW A;  4CY8 A;  1D7Y A;  3LJP A;  4H2R A;  4A65 A;  2C72 A;  3NK1 X;  5EB4 A;  4A79 A;  3FIM B;  4UDP A;  2BS2 A;  1N4U A;  5BRT A;  1BGJ A;  4GR1 A;  1D7L A;  1UKV G;  1F6M A;  2ACZ A;  3CNS A;  3CN8 A;  1M64 A;  2AR8 A;  5IQ4 A;  5BVA A;  4E0V A;  2YG7 A;  4A5L A;  4O5U A;  3UOV A;  2XCG A;  4EIQ A;  4OPL A;  3UOX A;  4NEW A;  4JQ9 A;  4Y4L A;  1GRA A;  5U25 A;  2R0G A;  1NG3 A;  4XXG A;  4JNQ A;  5EBK A;  4YKG A;  3DA1 A;  1H6V A;  2XLT A;  3GSI A;  4NZH A;  4P9S A;  3SFD A;  2WU2 A;  1XHC A;  3AE1 A;  4AT0 A;  4U8P A;  2C65 A;  1TDO A;  4U8N A;  3UKK A;  1FEB A;  3M12 A;  5KWF A;  2XVI A;  4GRT A;  1BWC A;  1ZP0 A;  1XPQ A;  2X8G A;  1PJ7 A;  1JU2 A;  4H4W A;  3M0O A;  5J7X A;  1H7X A;  3ICT A;  1S3B A;  2QA1 A;  2ZZC A;  4YSH A;  1ZMD A;  5CKU A;  4EM3 A;  4Z26 A;  3LXD A;  4YTN A;  4XWR A;  4H2P A;  1NEN A;  4EQR A;  1GSN A;  4NTE A;  2V6O A;  4BJZ A;  1K0L A;  3DGH A;  3JSK A;  3PS9 A;  2YR5 A;  3NRN A;  4EMI A;  3CNT A;  2WS3 A;  3DGZ A;  4X9N A;  4EIP A;  1Q1W A;  4OPG A;  1ZDL A;  4K7Z A;  4ADW A;  2YG5 A;  2WP9 A;  1Y56 B;  4CNJ A;  4EMJ A;  1F3P A;  2WU5 A;  3IF9 A;  4C5O A;  1H86 A;  2JKC A;  2WEU A;  2GF3 A;  4YSY A;  1EBD A;  4H4Z A;  3P9U A;  3E1T A;  3DJE A;  2XFP A;  4K8D A;  1H84 A;  3V3O A;  1Y56 A;  2YG3 A;  1GRG A;  3S5W A;  3ZDN A;  2HQM A;  4YTM A;  1DJN A;  1SEZ A;  2Y6Q A;  3UTH A;  4B1B A;  3NGC X;  1GRE A;  3QSE A;  3R9U A;  4TLZ A;  4FX9 A;  3DJD A;  3GDP A;  3NYE A;  2V5Z A;  1CJ2 A;  1FOH A;  4ZCC A;  2BC0 A;  5M0Z A;  5J60 A;  2WP6 A;  1GRB A;  1GT8 A;  5U63 A;  2I0Z A;  2R45 A;  2DKI A;  2PHH A;  2NVK X;  4LA1 A;  3QJ4 A;  2BK5 A;  3H4K A;  3UCL A;  3DK4 A;  2BXR A;  1PBB A;  4GCM A;  1QLB A;  1QO8 A;  4IA6 A;  2B7R A;  1D4E A;  1JEH A;  1FEA A;  4JN9 A;  4U8L A;  4B67 A;  4KPR A;  4USR A;  4CCQ A;  3P4P A;  4ZCD A;  4U2S A;  2YLR A;  3CGD A;  3FPZ A;  4NTD A;  3DJJ A;  1JOA A;  1NHR A;  2WOV A;  4DSG A;  1V59 A;  4FK1 A;  1IUV A;  2YLT A;  2VVM A;  1DOD A;  4J57 A;  1XDI A;  3CNP A;  1Q1R A;  4H4T A;  2YLZ A;  4Y4M A;  4APN A;  1TYP A;  4C3Y A;  1GRT A;  1BF3 A;  1RSG A;  2GQW A;  2JK6 A;  2X50 A;  1YQ3 A;  1GV4 A;  1QJD A;  4CBQ A;  4RG4 A;  4GUV A;  1CL0 A;  1VRQ B;  3IHM A;  1D4D A;  1K0I A;  2Q6U A;  4Z43 A;  2GVC A;  3GRT A;  2BS4 A;  3BI5 A;  4K2X A;  3IC9 A;  5HHF A;  1NHP A;  2F5Z A;  1YKJ A;  4TM0 A;  5BUK A;  3K7M X;  4H4U A;  1RP0 A;  3GDN A;  5FS6 A;  3VQR A;  3QSM A;  5JCL A;  2XYO A;  1LVL A;  2B7S A;  2YVJ A;  3G5S A;  2J3N A;  3NTD A;  1DOE A;  2TPR A;  2YAU A;  1FCD A;  1P2E A;  4PAA A;  3RP8 A;  1GET A;  3ZYX A;  2BAC A;  3CGE A;  1PBD A;  3EPT A;  1IUT A;  2FJD A;  4YSX A;  3HZL A;  3NIX A;  3ABV A;  4H4Y A;  4I58 A;  1CBO A;  3F8R A;  4IVM B;  1MO9 A;  3AEB A;  3ICR A;  3DK8 A;  5EB5 A;  4GF7 A;  5L46 A;  1N1P A;  2YVG A;  1VG0 A;  1MOK A;  1IUX A;  1CF3 A;  1H81 A;  2OAL A;  2UZZ A;  3BI2 A;  5EOW A;  5IQ1 A;  1W4X A;  1Y0P A;  2XVE A;  3AED A;  1JRZ A;  3I3L A;  2IVD A;  4B65 A;  4DGK A;  1CC4 A;  2VVL G;  2R46 A;  1GEU A;  3AD8 B;  3ALJ A;  5C2T A;  4UDQ A;  4JNA A;  4U8J A;  2H89 A;  2X8C A;  2R0P A;  1PJ6 A;  4D04 A;  5KVH A;  3DJG X;  2XLS A;  1Q9I A;  4K22 A;  1CC6 A; 
#chains in the Genus database with same CATH topology
 4Z2U A;  2B9X A;  1VDC A;  3QVP A;  1C0P A;  3NYC A;  4YKF A;  3BHF A;  2C66 A;  4RG3 A;  2WDQ A;  3GRS A;  4OCG A;  3RHA A;  4OPC A;  4B68 A;  1EVI A;  1BKW A;  1IUU A;  4H2N A;  4C3X A;  2E49 A;  2QCU A;  4EMW A;  4RSL A;  3CGC A;  1D5T A;  1DJQ A;  5KVI A;  3CPH G;  2YLS A;  1E6E A;  3V76 A;  1X31 B;  4ICY A;  4IA5 A;  2YM2 A;  2C3D A;  3KA7 A;  4II3 A;  4J56 A;  3SGL A;  1TDF A;  1L0V A;  1DOB A;  1TDN A;  3HYW A;  2JB1 A;  3G5Q A;  2WPC A;  4M52 A;  3CPJ G;  2Z5Y A;  4YXD A;  3G3E A;  1HYU A;  2FBW A;  1ZOV A;  1CHU A;  2X99 A;  1B8S A;  2V61 A;  4H4Q A;  4J31 A;  3T37 A;  2PYX A;  2WQY A;  3KKJ A;  3SFE A;  2CVJ A;  1JNZ A;  1MXT A;  2JB2 A;  3KD9 A;  1CJ3 A;  3AYJ A;  2EQ6 A;  1EL7 A;  4Z24 A;  3GMC A;  3KLJ A;  1H7W A;  2YM1 A;  3GYI A;  4Z44 A;  2A8X A;  2ZZ0 A;  3KU9 A;  3OZ2 A;  2CUL A;  2XVJ A;  4GDP A;  1TDE A;  2C73 A;  4II2 A;  3AE5 A;  5KOX A;  1E39 A;  3LAD A;  3QVR A;  1IJH A;  1DXL A;  4C77 A;  3AEE A;  4NTC A;  5GSN A;  1JRY A;  4Y4N A;  1O5W A;  2BAB A;  2H88 A;  2YVF A;  4H4V A;  4IVO B;  2YLX A;  1E1M A;  1K0J A;  2C7G A;  1L9D A;  3CTY A;  2A89 A;  1DOC A;  1GND A;  1OJC A;  2GAH B;  4U2L A;  3S61 A;  3UTF A;  2XLP A;  3UKP A;  2R0C A;  3IWA A;  3SYI A;  1GXF A;  1S2Q A;  1PJ5 A;  3HYX A;  3P4Q A;  3COX A;  3UTE A;  1GRF A;  4NWZ A;  2GV8 A;  4EQX A;  5KXJ A;  1DNC A;  5JCM A;  4Z2T A;  2IVE A;  2FJB A;  3NK0 X;  2WOW A;  4HB9 A;  1C0L A;  3UOZ A;  2YG4 A;  4J2W A;  4FDC B;  3AD7 B;  4G6H A;  4J34 A;  2BCP A;  4USQ A;  1GER A;  2OA1 A;  3L8K A;  2A87 A;  3NN0 X;  4H50 A;  2GB0 A;  3H8L A;  4YSZ A;  1TYT A;  2YQU A;  1KNR A;  2V3A A;  2OLN A;  1NHS A;  3AEF A;  3EAO A;  3VRB A;  4AP3 A;  2C67 A;  3UP4 A;  1IUW A;  2NPX A;  2ZZB A;  1ZKQ A;  3SX6 A;  1Z6L A;  3ISH A;  2Q0L A;  3CNJ A;  3M13 A;  1H83 A;  3AE6 A;  4U2T A;  2RGO A;  3V3N A;  3UKQ A;  2WET A;  4TM1 A;  1OJ9 A;  4U8K A;  4WCT A;  1B4V A;  3SXI A;  4JY2 A;  4O5Q A;  4G6G A;  3BHK A;  3UKL A;  2CFY A;  2VRM A;  1E1N A;  4D03 A;  4CRT A;  4BK3 A;  2GMH A;  1B37 A;  4EQW A;  4ZN0 A;  1TRB A;  2WPF A;  4TM4 A;  3NHO X;  3QSS A;  2VOU A;  4YJF B;  2GAG B;  3WE0 A;  5M10 A;  3GWF A;  2WOI A;  3ATR A;  2YG6 A;  3Q9T A;  3L1R A;  2VZ2 A;  1PXB A;  1GPE A;  2EQ8 A;  3AXB A;  5GRT A;  1N4W A;  4Z25 A;  3CGB A;  5FS7 A;  1JRX A;  4YJF A;  1LPF A;  2VQB A;  4OPI A;  1VG9 A;  2VVL A;  1NG4 A;  4REK A;  3P4R A;  2X3N A;  4B64 A;  4WX1 A;  4A7A A;  3I6D A;  4J36 A;  4YTP A;  1GTE A;  2RAB A;  1ZMC A;  4XWZ A;  3BNU A;  3EF6 A;  4LU6 A;  3UKA A;  3O0H A;  3AE9 A;  1B5Q A;  2E4A A;  2WHD A;  2VQ7 A;  3AE7 A;  2Q0K A;  2W0H A;  3UOY A;  4N9X A;  4DNA A;  2JBV A;  5BUL A;  1LTX R;  1C0K A;  2YWL A;  3AYI A;  1GOS A;  2GR1 A;  2WES A;  3T31 A;  4GDE A;  3DK9 A;  1PN0 A;  1K4Q A;  1VE9 A;  1KDG A;  4U8M A;  1VQW A;  3B6D A;  5KRQ A;  3Q6J A;  1KF6 A;  2YLW A;  3AYL A;  1CJC A;  5TR3 A;  3VR9 A;  1AOG A;  2WBA A;  4BK2 A;  4OPT A;  3ZNQ A;  3LZW A;  4H2Q A;  3SY4 A;  4EQS A;  1LQT A;  1OJD A;  2Q7V A;  3H8I A;  4U8I A;  2E4G A;  3SM8 A;  5HYM A;  2B9W A;  4TLX A;  3NTA A;  2BXS A;  3II4 A;  4FK1 C;  4YT0 A;  3VR8 A;  3HYV A;  3UTG A;  4B69 A;  2RGJ A;  3AE3 A;  2R4E A;  3ATQ A;  4U8O A;  3FG2 P;  3AWI A;  4B66 A;  4H4R A;  3KVE A;  1NDA A;  2XFU A;  4CCR A;  1KNP A;  4H4X A;  5JCN A;  1D4C A;  3B3R A;  5JCI A;  1YQ4 A;  1P2H A;  1F8S A;  3LOV A;  2X8H A;  4TM3 A;  1EL8 A;  3AD9 B;  2AQJ A;  3C4N A;  4YWO A;  1M6I A;  3D8X A;  2C75 A;  4AT2 A;  1GTH A;  1N4V A;  1E1L A;  2E1M A;  2OAM A;  2GQF A;  2GR2 A;  3LB8 A;  5IPY A;  1TDK A;  1XAN A;  2E5V A;  4OPD A;  5FS9 A;  3RP7 A;  2V60 A;  3NG7 X;  2B9Y A;  4Z2R A;  1NHQ A;  3AE8 A;  4EM4 A;  1KFY A;  3C4A A;  1F8R A;  1ZX9 A;  3VRA A;  2APG A;  3W4K A;  2BK3 A;  3NLC A;  1O95 A;  3GWD A;  5HY5 A;  5KMS A;  3KPK A;  1ELI A;  1ZOY A;  1GRH A;  1RYI A;  1REO A;  2C64 A;  3NH3 X;  1PS9 A;  2WDV A;  3AEG A;  3F8D A;  1L9E A;  4CNK A;  1EL9 A;  3CPI G;  3KPF A;  2GRT A;  1OJT A;  2BK4 A;  4J33 A;  3SQP A;  5HXI A;  2QAE A;  1EL5 A;  1F8W A;  2YR6 A;  1GAL A;  2XFO A;  3LZX A;  1PBE A;  3QFB A;  3CUK A;  5KOW A;  4A99 A;  3AEC A;  4IV9 A;  3ALL A;  3AEA A;  2GMJ A;  4H7U A;  2BYB A;  4I59 A;  4OVI A;  5JCK A;  3UKF A;  2OLO A;  4AOS A;  2V3B A;  5FS8 A;  3FMW A;  3P4S A;  3W4I A;  1YY5 A;  1COY A;  3D1C A;  5C3J A;  2BRA A;  3GMB A;  1BZL A;  4A6N B;  1E1K A;  4KX6 A;  4K5S A;  3UKH A;  2BA9 A;  2XFQ A;  2IID A;  4BV6 A;  2FJE A;  1KSS A;  2E48 A;  1ONF A;  3ITJ A;  2C76 A;  3URH A;  2QA2 A;  3ICS A;  2CDU A;  2EQ7 A;  2C70 A;  2ZBW A;  4A6N A;  1CC2 A;  2Y6R A;  1GES A;  4OPU A;  3AB1 A;  5DBJ A;  3VRD B;  4AOX A;  2BCG G;  5FMH A;  2GH5 A;  4YJG B;  2DKH A;  2R9Z A;  1PDH A;  3BI4 A;  3NKS A;  2WDR A;  1YQZ A;  3SZF A;  1LJ1 A;  4YJH B;  4X9M A;  1O94 A;  1S2Y A;  2EQ9 A;  2XDO A;  3BNM A;  4HA6 A;  2XVH A;  1FL2 A;  1IUS A;  1BGN A;  4AP1 A;  4X4J A;  2RGH A;  3CMM A;  1LQU A;  3PO7 A;  4QFC A;  2GR0 A;  2XFN A;  1L9C A;  1FEC A;  4YJH A;  2B76 A;  4H4P A;  2WP5 A;  2JB3 A;  4GAP A;  5ER0 A;  2R4J A;  3PVC A;  1ZY8 A;  2WPE A;  1C0I A;  3G5R A;  4G74 A;  2O9Z A;  4CY6 A;  3F8P A;  4DSH A;  1S3E A;  1OJA A;  2AAQ A;  3AE2 A;  3GD3 A;  3RNM A;  1PHH A;  3UP5 A;  3ADA B;  2YR4 A;  4BK1 A;  1JNR A;  4C74 A;  4A9W A;  2ARD A;  3OC4 A;  2C3C A;  1KSU A;  1H82 A;  4B63 A;  4ECH A;  4JY3 A;  1NPX A;  2XVF A;  3CIR A;  2JAE A;  2BS3 A;  4K5R A;  5KMR A;  5CQF A;  5LV9 A;  3C96 A;  1DDO A;  3GYJ A;  2FJA A;  1ZK7 A;  3DH9 A;  3NYF A;  1PBF A;  1LV0 A;  1NEK A;  3IHG A;  2GR3 A;  2BC1 A;  4JDR A;  4BUR A;  3NK2 X;  1CJ4 A;  3W4J A;  3EAN A;  4UDR A;  3QFA A;  1E7P A;  2TMD A;  3AE4 A;  3NN6 X;  3GD4 A;  2Z5X A;  4NEV A;  3NNE A;  4H4S A;  3K7T A;  4PAB A;  3ALM A;  3P1W A;  4BJY A;  4MJW A;  1NAA A;  1PXC A;  3K30 A;  3CND A;  3RP6 A;  2VRL A;  2XLU A;  3FBS A;  3NT6 A;  2XLR A;  3DME A;  3GYX A;  5U1O A;  4G9K A;  4LII A;  1PBC A;  4UP3 A;  3K7Q X;  1PXA A;  2GEW A;  4CY8 A;  1D7Y A;  3LJP A;  4H2R A;  4A65 A;  2C72 A;  3NK1 X;  5EB4 A;  3RED A;  4A79 A;  3FIM B;  4UDP A;  4GAV A;  2BS2 A;  1N4U A;  5BRT A;  1BGJ A;  4GR1 A;  1D7L A;  1UKV G;  1F6M A;  2ACZ A;  3CNS A;  3CN8 A;  1M64 A;  2AR8 A;  5IQ4 A;  5BVA A;  1KIF A;  3T0K A;  4E0V A;  2YG7 A;  3T2Y A;  4A5L A;  4O5U A;  3UOV A;  2XCG A;  4EIQ A;  4OPL A;  3UOX A;  4NEW A;  4JQ9 A;  4YJD A;  4Y4L A;  1GRA A;  5U25 A;  2R0G A;  1NG3 A;  4XXG A;  4JNQ A;  5EBK A;  4YKG A;  3DA1 A;  1H6V A;  3ZNP A;  3GSI A;  2XLT A;  4NZH A;  4P9S A;  3SFD A;  2WU2 A;  1XHC A;  3AE1 A;  4AT0 A;  2DU8 A;  4U8P A;  2C65 A;  1TDO A;  4U8N A;  3UKK A;  3M12 A;  1FEB A;  5KWF A;  2XVI A;  4GRT A;  1BWC A;  3SZC A;  1ZP0 A;  1XPQ A;  2X8G A;  1PJ7 A;  1JU2 A;  4H4W A;  3M0O A;  5J7X A;  1H7X A;  3ICT A;  1S3B A;  2QA1 A;  4YSH A;  2ZZC A;  1ZMD A;  5CKU A;  4EM3 A;  4Z26 A;  3LXD A;  4YTN A;  4XWR A;  4H2P A;  1NEN A;  4EQR A;  5KMQ A;  1GSN A;  4NTE A;  2V6O A;  4BJZ A;  1K0L A;  3DGH A;  3PS9 A;  3JSK A;  4QFD A;  2YR5 A;  3NRN A;  4EMI A;  3CNT A;  2WS3 A;  4X9N A;  3DGZ A;  4EIP A;  1Q1W A;  4OPG A;  1ZDL A;  4K7Z A;  4ADW A;  2YG5 A;  2WP9 A;  1Y56 B;  4CNJ A;  4EMJ A;  1F3P A;  2WU5 A;  3IF9 A;  4C5O A;  1H86 A;  2JKC A;  2WEU A;  2GF3 A;  4YSY A;  1EBD A;  4H4Z A;  3P9U A;  3E1T A;  3DJE A;  2XFP A;  4K8D A;  1H84 A;  3V3O A;  1Y56 A;  2YG3 A;  1GRG A;  3S5W A;  3ZDN A;  2HQM A;  4YTM A;  1DJN A;  1SEZ A;  2BRY A;  2Y6Q A;  3UTH A;  4B1B A;  3NGC X;  3QSE A;  1GRE A;  3R9U A;  4TLZ A;  3SZW A;  4FX9 A;  2C4C A;  3DJD A;  3GDP A;  3NYE A;  1DAO A;  2V5Z A;  1FOH A;  1CJ2 A;  4ZCC A;  2BC0 A;  5M0Z A;  5J60 A;  2WP6 A;  1GRB A;  1GT8 A;  5U63 A;  2I0Z A;  2R45 A;  2DKI A;  2PHH A;  2NVK X;  4LA1 A;  3QJ4 A;  2BK5 A;  3H4K A;  3UCL A;  5KNL A;  3DK4 A;  2BXR A;  4YJG A;  1PBB A;  4GCM A;  1QLB A;  1QO8 A;  4IA6 A;  2B7R A;  1D4E A;  1JEH A;  1FEA A;  4JN9 A;  4U8L A;  4B67 A;  4KPR A;  4USR A;  4CCQ A;  3P4P A;  4ZCD A;  4U2S A;  2YLR A;  3CGD A;  3FPZ A;  4NTD A;  3DJJ A;  1JOA A;  1NHR A;  2WOV A;  4DSG A;  1V59 A;  4FK1 A;  1IUV A;  2YLT A;  2VVM A;  1DOD A;  4J57 A;  3SZ0 A;  1XDI A;  3CNP A;  1Q1R A;  4H4T A;  2YLZ A;  4Y4M A;  4APN A;  3T2K A;  1TYP A;  4C3Y A;  1GRT A;  1BF3 A;  1RSG A;  2GQW A;  2JK6 A;  2X50 A;  1YQ3 A;  1GV4 A;  1QJD A;  4CBQ A;  4RG4 A;  4GUV A;  1VRQ B;  1CL0 A;  3IHM A;  1K0I A;  2Q6U A;  1D4D A;  3T2Z A;  4Z43 A;  2GVC A;  3GRT A;  3T14 A;  2BS4 A;  3BI5 A;  4K2X A;  3IC9 A;  5HHF A;  1NHP A;  2F5Z A;  1YKJ A;  4TM0 A;  5BUK A;  1AN9 A;  3K7M X;  4H4U A;  1RP0 A;  2E82 A;  3GDN A;  3VQR A;  5FS6 A;  3QSM A;  5JCL A;  2XYO A;  1LVL A;  2B7S A;  2YVJ A;  3G5S A;  2J3N A;  3NTD A;  1DOE A;  2TPR A;  2YAU A;  4PAA A;  1FCD A;  1P2E A;  3RP8 A;  1GET A;  3ZYX A;  2BAC A;  3CGE A;  1PBD A;  1IUT A;  3EPT A;  2FJD A;  4YSX A;  3HZL A;  3NIX A;  3ABV A;  3WGT A;  4H4Y A;  4I58 A;  1CBO A;  5KMP A;  3F8R A;  4IVM B;  1MO9 A;  3AEB A;  3ICR A;  3DK8 A;  5EB5 A;  4GF7 A;  5L46 A;  1N1P A;  2YVG A;  1VG0 A;  1MOK A;  1IUX A;  1CF3 A;  2UZZ A;  1H81 A;  2OAL A;  3BI2 A;  5EOW A;  5IQ1 A;  1W4X A;  1Y0P A;  2XVE A;  3AED A;  1JRZ A;  3I3L A;  2IVD A;  4B65 A;  4DGK A;  1CC4 A;  4G73 A;  2VVL G;  2R46 A;  1GEU A;  3AD8 B;  3ALJ A;  4NNJ A;  4UDQ A;  5C2T A;  3ZNN A;  4JNA A;  4U8J A;  2H89 A;  2X8C A;  3ZNO A;  2R0P A;  1PJ6 A;  4D04 A;  5KVH A;  3DJG X;  2XLS A;  1Q9I A;  4K22 A;  1CC6 A; 
#chains in the Genus database with same CATH homology
 4Z2U A;  2B9X A;  1VDC A;  3QVP A;  3NYC A;  4YKF A;  3BHF A;  2C66 A;  4RG3 A;  2WDQ A;  3GRS A;  4OCG A;  3RHA A;  4OPC A;  4B68 A;  4H2N A;  1BKW A;  1IUU A;  4C3X A;  2QCU A;  4EMW A;  4RSL A;  3CGC A;  1D5T A;  1DJQ A;  5KVI A;  3CPH G;  2YLS A;  1E6E A;  3V76 A;  1X31 B;  4ICY A;  4IA5 A;  2YM2 A;  2C3D A;  3KA7 A;  4II3 A;  4J56 A;  1L0V A;  1TDF A;  3SGL A;  1DOB A;  1TDN A;  3HYW A;  2JB1 A;  3G5Q A;  2WPC A;  4M52 A;  3CPJ G;  2Z5Y A;  4YXD A;  2X99 A;  1HYU A;  2FBW A;  1ZOV A;  1CHU A;  4H4Q A;  1B8S A;  2V61 A;  3T37 A;  4J31 A;  2PYX A;  2WQY A;  3KKJ A;  3SFE A;  2CVJ A;  1JNZ A;  1MXT A;  2JB2 A;  3KD9 A;  1CJ3 A;  3AYJ A;  2EQ6 A;  1EL7 A;  4Z24 A;  3GMC A;  3KLJ A;  1H7W A;  2YM1 A;  3GYI A;  4Z44 A;  2A8X A;  2ZZ0 A;  3KU9 A;  2XVJ A;  2CUL A;  3OZ2 A;  4GDP A;  1TDE A;  2C73 A;  4II2 A;  3AE5 A;  5KOX A;  1E39 A;  3LAD A;  3QVR A;  1IJH A;  1DXL A;  4C77 A;  3AEE A;  4NTC A;  5GSN A;  1JRY A;  4Y4N A;  1O5W A;  2BAB A;  2H88 A;  2YVF A;  4H4V A;  4IVO B;  2YLX A;  1E1M A;  1K0J A;  2C7G A;  1L9D A;  3CTY A;  2A89 A;  1DOC A;  1GND A;  1OJC A;  2GAH B;  4U2L A;  3S61 A;  3UTF A;  2XLP A;  3UKP A;  2R0C A;  3IWA A;  3SYI A;  1GXF A;  1S2Q A;  1PJ5 A;  3HYX A;  3P4Q A;  3COX A;  3UTE A;  1GRF A;  4NWZ A;  2GV8 A;  4EQX A;  5KXJ A;  1DNC A;  5JCM A;  4Z2T A;  2IVE A;  2FJB A;  3NK0 X;  2WOW A;  4HB9 A;  3UOZ A;  2YG4 A;  4J2W A;  4FDC B;  3AD7 B;  4G6H A;  4J34 A;  2BCP A;  4USQ A;  1GER A;  2OA1 A;  3L8K A;  2A87 A;  3NN0 X;  4H50 A;  2GB0 A;  3H8L A;  4YSZ A;  1TYT A;  2YQU A;  1KNR A;  2V3A A;  2OLN A;  1NHS A;  3AEF A;  3EAO A;  3VRB A;  4AP3 A;  2C67 A;  3UP4 A;  1IUW A;  2NPX A;  2ZZB A;  1ZKQ A;  3SX6 A;  1Z6L A;  3ISH A;  2Q0L A;  3CNJ A;  3M13 A;  1H83 A;  3AE6 A;  4U2T A;  2RGO A;  3V3N A;  3UKQ A;  2WET A;  4TM1 A;  1OJ9 A;  4U8K A;  1B4V A;  4WCT A;  3SXI A;  4JY2 A;  4O5Q A;  4G6G A;  3BHK A;  3UKL A;  2CFY A;  2VRM A;  1E1N A;  4D03 A;  4CRT A;  4BK3 A;  2GMH A;  1B37 A;  4EQW A;  4ZN0 A;  1TRB A;  2WPF A;  4TM4 A;  3NHO X;  3QSS A;  2VOU A;  2GAG B;  3WE0 A;  5M10 A;  3GWF A;  2WOI A;  3ATR A;  2YG6 A;  3Q9T A;  3L1R A;  2VZ2 A;  1PXB A;  1GPE A;  2EQ8 A;  3AXB A;  5GRT A;  1N4W A;  4Z25 A;  3CGB A;  5FS7 A;  1JRX A;  1LPF A;  2VQB A;  4OPI A;  1VG9 A;  2VVL A;  1NG4 A;  4REK A;  3P4R A;  2X3N A;  4B64 A;  4WX1 A;  4A7A A;  3I6D A;  4J36 A;  4YTP A;  1GTE A;  2RAB A;  1ZMC A;  4XWZ A;  3BNU A;  3EF6 A;  4LU6 A;  3UKA A;  3O0H A;  3AE9 A;  1B5Q A;  2WHD A;  2VQ7 A;  3AE7 A;  2Q0K A;  2W0H A;  3UOY A;  4N9X A;  4DNA A;  2JBV A;  5BUL A;  1LTX R;  2YWL A;  3AYI A;  1GOS A;  2GR1 A;  2WES A;  3T31 A;  4GDE A;  3DK9 A;  1PN0 A;  1K4Q A;  1KDG A;  4U8M A;  1VQW A;  3B6D A;  5KRQ A;  3Q6J A;  1KF6 A;  2YLW A;  3AYL A;  1CJC A;  5TR3 A;  3VR9 A;  1AOG A;  2WBA A;  4BK2 A;  4OPT A;  3LZW A;  4H2Q A;  3SY4 A;  4EQS A;  1LQT A;  1OJD A;  2Q7V A;  3H8I A;  4U8I A;  2E4G A;  2B9W A;  5HYM A;  4TLX A;  3SM8 A;  3NTA A;  2BXS A;  3II4 A;  4FK1 C;  4YT0 A;  3VR8 A;  3HYV A;  3UTG A;  4B69 A;  2RGJ A;  3AE3 A;  2R4E A;  3ATQ A;  4U8O A;  3FG2 P;  3AWI A;  4B66 A;  4H4R A;  3KVE A;  1NDA A;  2XFU A;  4CCR A;  1KNP A;  4H4X A;  5JCN A;  1D4C A;  3B3R A;  5JCI A;  1YQ4 A;  1P2H A;  1F8S A;  3LOV A;  2X8H A;  4TM3 A;  1EL8 A;  3AD9 B;  2AQJ A;  3C4N A;  4YWO A;  1M6I A;  3D8X A;  2C75 A;  4AT2 A;  1GTH A;  1N4V A;  1E1L A;  2E1M A;  2OAM A;  2GQF A;  2GR2 A;  3LB8 A;  5IPY A;  1TDK A;  1XAN A;  2E5V A;  4OPD A;  5FS9 A;  3RP7 A;  2V60 A;  3NG7 X;  2B9Y A;  4Z2R A;  1NHQ A;  3AE8 A;  4EM4 A;  1KFY A;  3C4A A;  1F8R A;  1ZX9 A;  3VRA A;  2APG A;  2BK3 A;  3NLC A;  1O95 A;  3GWD A;  5HY5 A;  5KMS A;  3KPK A;  1ELI A;  1ZOY A;  1GRH A;  1RYI A;  1REO A;  2C64 A;  3NH3 X;  1PS9 A;  2WDV A;  3AEG A;  3F8D A;  1L9E A;  4CNK A;  1EL9 A;  3CPI G;  3KPF A;  2GRT A;  1OJT A;  2BK4 A;  4J33 A;  3SQP A;  5HXI A;  2QAE A;  1EL5 A;  1F8W A;  2YR6 A;  1GAL A;  2XFO A;  3LZX A;  1PBE A;  3QFB A;  5KOW A;  4A99 A;  3AEC A;  4IV9 A;  3ALL A;  3AEA A;  2GMJ A;  4H7U A;  2BYB A;  4I59 A;  4OVI A;  5JCK A;  3UKF A;  2OLO A;  4AOS A;  2V3B A;  5FS8 A;  3FMW A;  3P4S A;  1YY5 A;  1COY A;  3D1C A;  5C3J A;  2BRA A;  3GMB A;  1BZL A;  4A6N B;  1E1K A;  4KX6 A;  4K5S A;  3UKH A;  2BA9 A;  2XFQ A;  2IID A;  4BV6 A;  2FJE A;  1KSS A;  1ONF A;  3ITJ A;  2C76 A;  3URH A;  2QA2 A;  3ICS A;  2CDU A;  2EQ7 A;  2C70 A;  2ZBW A;  4A6N A;  1CC2 A;  2Y6R A;  1GES A;  4OPU A;  3AB1 A;  5DBJ A;  3VRD B;  4AOX A;  2BCG G;  5FMH A;  2GH5 A;  2R9Z A;  2DKH A;  1PDH A;  3BI4 A;  3NKS A;  2WDR A;  1YQZ A;  3SZF A;  1LJ1 A;  1O94 A;  4X9M A;  1S2Y A;  2EQ9 A;  2XDO A;  3BNM A;  4HA6 A;  2XVH A;  1FL2 A;  1IUS A;  1BGN A;  4AP1 A;  4X4J A;  2RGH A;  3CMM A;  1LQU A;  3PO7 A;  2GR0 A;  2XFN A;  4H4P A;  1L9C A;  1FEC A;  2B76 A;  2WP5 A;  2JB3 A;  4GAP A;  5ER0 A;  1ZY8 A;  2R4J A;  2WPE A;  3PVC A;  4G74 A;  3G5R A;  4CY6 A;  2O9Z A;  4DSH A;  3F8P A;  1S3E A;  1OJA A;  2AAQ A;  3AE2 A;  3GD3 A;  3RNM A;  1PHH A;  3UP5 A;  3ADA B;  2YR4 A;  4BK1 A;  1JNR A;  4C74 A;  4A9W A;  2ARD A;  3OC4 A;  2C3C A;  1KSU A;  1H82 A;  4B63 A;  4ECH A;  4JY3 A;  1NPX A;  2XVF A;  3CIR A;  2JAE A;  2BS3 A;  4K5R A;  5KMR A;  5CQF A;  5LV9 A;  3C96 A;  3GYJ A;  2FJA A;  1ZK7 A;  3DH9 A;  3NYF A;  1LV0 A;  1PBF A;  1NEK A;  3IHG A;  2GR3 A;  2BC1 A;  4JDR A;  4BUR A;  3NK2 X;  1CJ4 A;  3EAN A;  4UDR A;  3QFA A;  1E7P A;  2TMD A;  3AE4 A;  3NN6 X;  3GD4 A;  2Z5X A;  4NEV A;  3NNE A;  4H4S A;  3K7T A;  4PAB A;  3ALM A;  3P1W A;  4BJY A;  4MJW A;  1NAA A;  1PXC A;  3K30 A;  3CND A;  3RP6 A;  2VRL A;  2XLU A;  3FBS A;  3NT6 A;  2XLR A;  3DME A;  3GYX A;  5U1O A;  4G9K A;  4LII A;  1PBC A;  4UP3 A;  3K7Q X;  1PXA A;  2GEW A;  4CY8 A;  1D7Y A;  3LJP A;  4H2R A;  4A65 A;  2C72 A;  3NK1 X;  5EB4 A;  3RED A;  4A79 A;  3FIM B;  4UDP A;  4GAV A;  2BS2 A;  1N4U A;  5BRT A;  1BGJ A;  4GR1 A;  1D7L A;  1UKV G;  1F6M A;  2ACZ A;  3CNS A;  3CN8 A;  1M64 A;  2AR8 A;  5IQ4 A;  5BVA A;  3T0K A;  4E0V A;  2YG7 A;  3T2Y A;  4A5L A;  4O5U A;  3UOV A;  2XCG A;  4EIQ A;  4OPL A;  3UOX A;  4NEW A;  4JQ9 A;  4Y4L A;  1GRA A;  5U25 A;  2R0G A;  1NG3 A;  4XXG A;  4JNQ A;  5EBK A;  4YKG A;  3DA1 A;  1H6V A;  2XLT A;  3GSI A;  4NZH A;  4P9S A;  3SFD A;  2WU2 A;  1XHC A;  3AE1 A;  4AT0 A;  4U8P A;  2C65 A;  1TDO A;  4U8N A;  3UKK A;  1FEB A;  3M12 A;  5KWF A;  2XVI A;  4GRT A;  1BWC A;  3SZC A;  1ZP0 A;  1XPQ A;  2X8G A;  1PJ7 A;  1JU2 A;  4H4W A;  3M0O A;  5J7X A;  1H7X A;  3ICT A;  1S3B A;  2QA1 A;  2ZZC A;  4YSH A;  1ZMD A;  5CKU A;  4EM3 A;  4Z26 A;  3LXD A;  4YTN A;  4XWR A;  4H2P A;  1NEN A;  4EQR A;  5KMQ A;  1GSN A;  4NTE A;  2V6O A;  4BJZ A;  1K0L A;  3DGH A;  3JSK A;  3PS9 A;  2YR5 A;  3NRN A;  4EMI A;  3CNT A;  2WS3 A;  3DGZ A;  4X9N A;  4EIP A;  1Q1W A;  4OPG A;  1ZDL A;  4K7Z A;  4ADW A;  2YG5 A;  2WP9 A;  1Y56 B;  4CNJ A;  4EMJ A;  1F3P A;  2WU5 A;  3IF9 A;  4C5O A;  1H86 A;  2JKC A;  2WEU A;  2GF3 A;  4YSY A;  1EBD A;  4H4Z A;  3P9U A;  3E1T A;  3DJE A;  2XFP A;  4K8D A;  1H84 A;  3V3O A;  1Y56 A;  2YG3 A;  1GRG A;  3S5W A;  3ZDN A;  2HQM A;  4YTM A;  1DJN A;  1SEZ A;  2BRY A;  2Y6Q A;  3UTH A;  4B1B A;  3NGC X;  1GRE A;  3QSE A;  3R9U A;  4TLZ A;  3SZW A;  4FX9 A;  2C4C A;  3DJD A;  3GDP A;  3NYE A;  2V5Z A;  1CJ2 A;  1FOH A;  4ZCC A;  2BC0 A;  5M0Z A;  5J60 A;  2WP6 A;  1GRB A;  1GT8 A;  5U63 A;  2I0Z A;  2R45 A;  2DKI A;  2PHH A;  2NVK X;  4LA1 A;  3QJ4 A;  2BK5 A;  3H4K A;  3UCL A;  5KNL A;  3DK4 A;  2BXR A;  1PBB A;  4GCM A;  1QLB A;  1QO8 A;  4IA6 A;  2B7R A;  1D4E A;  1JEH A;  1FEA A;  4JN9 A;  4U8L A;  4B67 A;  4KPR A;  4USR A;  4CCQ A;  3P4P A;  4ZCD A;  4U2S A;  2YLR A;  3CGD A;  3FPZ A;  4NTD A;  3DJJ A;  1JOA A;  1NHR A;  2WOV A;  4DSG A;  1V59 A;  4FK1 A;  1IUV A;  2YLT A;  2VVM A;  1DOD A;  4J57 A;  3SZ0 A;  1XDI A;  3CNP A;  1Q1R A;  4H4T A;  2YLZ A;  4Y4M A;  4APN A;  3T2K A;  1TYP A;  4C3Y A;  1GRT A;  1BF3 A;  1RSG A;  2GQW A;  2JK6 A;  2X50 A;  1YQ3 A;  1GV4 A;  1QJD A;  4CBQ A;  4RG4 A;  4GUV A;  1CL0 A;  1VRQ B;  3IHM A;  1D4D A;  1K0I A;  2Q6U A;  3T2Z A;  4Z43 A;  2GVC A;  3GRT A;  3T14 A;  2BS4 A;  3BI5 A;  4K2X A;  3IC9 A;  5HHF A;  1NHP A;  2F5Z A;  1YKJ A;  4TM0 A;  5BUK A;  3K7M X;  4H4U A;  1RP0 A;  3GDN A;  5FS6 A;  3VQR A;  3QSM A;  5JCL A;  2XYO A;  1LVL A;  2B7S A;  2YVJ A;  3G5S A;  2J3N A;  3NTD A;  1DOE A;  2TPR A;  2YAU A;  1FCD A;  1P2E A;  4PAA A;  3RP8 A;  1GET A;  3ZYX A;  2BAC A;  3CGE A;  1PBD A;  3EPT A;  1IUT A;  2FJD A;  4YSX A;  3HZL A;  3NIX A;  3ABV A;  4H4Y A;  4I58 A;  1CBO A;  5KMP A;  3F8R A;  4IVM B;  1MO9 A;  3AEB A;  3ICR A;  3DK8 A;  5EB5 A;  4GF7 A;  5L46 A;  1N1P A;  2YVG A;  1VG0 A;  1MOK A;  1IUX A;  1CF3 A;  1H81 A;  2OAL A;  2UZZ A;  3BI2 A;  5EOW A;  5IQ1 A;  1W4X A;  1Y0P A;  2XVE A;  3AED A;  1JRZ A;  3I3L A;  2IVD A;  4B65 A;  4DGK A;  1CC4 A;  4G73 A;  2VVL G;  2R46 A;  1GEU A;  3AD8 B;  3ALJ A;  4NNJ A;  4UDQ A;  5C2T A;  4JNA A;  4U8J A;  2H89 A;  2X8C A;  2R0P A;  1PJ6 A;  4D04 A;  5KVH A;  3DJG X;  2XLS A;  1Q9I A;  4K22 A;  1CC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...