4JY4A

Crystal structure of human fab pgt121, a broadly reactive and potent hiv-1 neutralizing antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
b'DISVAPGETARISCGEKSLGSRAVQWYQHRAGQAPSLIIYNNQDRPSGIPERFSGSPDSPFGTTATLTITSVEAGDEADYYCHIWDSRVPTKWVFGGGTTLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PGT121 heavy chain
publication title Broadly neutralizing antibody PGT121 allosterically modulates CD4 binding via recognition of the HIV-1 gp120 V3 base and multiple surrounding glycans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jy4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jy4A01
1FZKA 2EKSB 1J18A 5SX5K 1NCCH 4NC0B 3LRSB 1QRNA 2PO6C 4PGBA 4PJHB 3ZDXF 5JPNA 5L2KB 4M7JL 1HHHA 3GM0A 3T0BA 1NMBL 5GRJL 1TETL 3EJZD 4UNTA 5A16A 5CWSB 1QBLL 2XI9A 5I66B 3Q2CA 5ESQA 4PTUB 3LB6C 1RJLB 3AREC 5GRXG 2IPKA 1T0NB 2VR9A 3DX7A 2CLZB 5F1IA 4QRUB 3MMEA 2VXVH 3KPTA 1L0QA 1UM6H 2YUXA 2E7LC 1U92A 5IB4B 4XHJD 4HS6A 4KTEL 5T3ZH 4XB7A 1G7LA 1TTGA 1M6OA 1FL3B 1KSRA 3A6CH 3AXLB 2W65B 4Y4HC 1PFCA 5CHNA 4IMLA 5I1DA 4GUPA 3C8KB 3WEXB 2WW8A 4YUEH 4JZOB 3O6LL 4JHWL 1EPFA 1G6RB 4XNMA 4APQA 2KH2B 4HBCL 4LLUA 4DVRL 1I3GH 3HZYB 1IC5L 1R3IH 1WFTA 3QG6A 2BK8A 4OLWL 4PJFE 1KG0A 4JPVH 4QY8A 3I02A 3W0WD 1JFQH 4PP1D 2HKFH 5E99H 1FNAA 5EO9B 4P57B 3RGVA 3BZEA 2YN5A 1QFOA 3QUZA 1CFSB 2I60H 3HNSH 4X9GA 4UV4L 1YNTB 3O3BA 4HS3B 2A6JB 4YQXH 1PLGL 4TTDD 2IFFL 3LMJL 5FEBA 5GS0H 4ERSH 2NY6B 1LE5B 4NUGH 3ULSB 2GK0B 2YPLE 3KYMB 4MNGA 2EYTA 4KVNH 3SDAA 3TP4A 1LO2L 4KTDL 4DGIL 4KZDL 4PJ7A 2P8PB 3GNML 1U8IA 4U1NB 2R2EB 1UM5H 5AZ2L 1OAYL 3UO1L 5FO9B 4JO4L 1UG9A 3DARA 1CDYA 3D0LB 1GAFH 1I8MB 4M48L 1PKOA 4NQXA 4HWBH 3QNZB 4MD5A 3W39A 3V2AR 1BQLL 4Q2ZA 5FKPB 4LU5H 43C9B 1P4BH 2DIJA 4LSQH 3QDME 1KPRB 4HSQA 3NGBB 2VLJB 5DA4A 1KNOB 3MJ9H 4PRIB 3U2SA 2G2RB 5EBLB 3BD3A 5T1LB 5J6HB 4G6KH 4HC1H 3LHPH 4OQTA 3BO8B 4OM1H 3ARFA 3QIBB 3OV6A 3KLSA 5B39A 1CTNA 1MJUL 1JGDA 4XH2B 5I8KL 2PXYD 5B3JE 1CLYL 1E28A 1FGVH 2Y5TB 3DPBA 3GK8L 4YX2L 4KKLD 4Z76B 4F7MB 5A40E 2XACC 3UC0L 3BQUD 4O5LL 3LEVL 4PG9B 5HPMA 2FX7H 4JJ5B 5IHZB 3O6ML 1DBAH 1K4DB 4YHLH 3UBXI 1I1AC 1XR8B 5ANMA 5CEZL 3CFKA 1IAMA 4MXQC 2CXGA 4Y16A 5GJTH 1U3JA 3NZ8A 4ZD3L 2VE6B 4KHXL 5C09D 1L4IA 3FRUB 2CGRH 3MNZA 5HTSA 1GGTA 1GIGH 2VLRE 4K23L 4XXDB 5GGSY 3ZYOA 5K9KA 4PPTA 4JLRA 1OP3K 1BFOA 1YEIL 5D2NA 5AZEH 1B3JA 5E6IB 5TE7H 2AK4B 2ZUXA 3HLAA 4X5WA 1H3UA 1JZ6A 3BJ91 2FJGB 1BBJA 3HPLA 5E2UL 3KS0J 3GUTB 1XGTB 4LLDB 2VAAB 3ZMRA 4YBLC 5GGSB 3D69B 4PJCF 4KROB 5A3ID 3TYFA 4G43B 2OL3L 5KOMC 5DHVH 4KK5C 2NYYD 3EOAB 4TUOB 1T03H 2VNCA 2H1PL 2WBJD 1OL0A 1VFOA 3QZWA 3PP4H 4KJWD 4GG8A 3KPQB 2FH8A 4K94C 4NQED 1KJVB 4GSDH 4C56A 1S5HA 4WCYL 3WFDH 3EYVA 1J86A 3QNYA 3O2DL 1NDGB 3VW3H 2NTFB 2HJKA 3CMGA 3V6OA 1MCEA 2WK2A 2W0FA 4RDQG 2FH6A 1BQHA 1FZMB 1ZA3A 2GSGA 3BPNC 3G6JA 2OLDA 3O3DB 1T66C 2AI0L 1BD2E 5B39G 4P46B 1Q94B 4MQTB 4DGYH 5HGGS 3TCXA 2XICA 4CVUA 5F7NC 3HC3H 1ZS8A 4BYHA 1T83C 1EMTL 3QFJE 1A9EB 1IEAA 3BGFB 2IH1A 1OF2B 1FZJA 4JDTL 1DQJB 2UUDH 1N3NA 2XFXA 4YDJB 1PX3A 4ODSH 1D5BA 1MAML 3GJFB 2WLZA 5E8NA 5DD1H 5DHYA 3PDOB 4NIKB 2CK2A 5CBEB 1XF5B 4F2MB 2V17L 3RWHA 2ITCB 3MFGB 1B0GB 1L9MA 3ZKMC 3P77A 1GGIL 5GGUB 3UJJH 1ZLSH 1X5KA 3GB7A 1MQKH 1IKNC 3Q5YA 4GRMB 5HDBF 1CS6A 3MUGB 3S5LA 4L3EE 2B4CH 1J10A 2FIKB 3QHFL 3MA9H 3NFSH 2GJ6E 4MDJA 1JF1B 3TJHC 3QXVA 4JFZL 3MV9E 3HG1E 3WNKA 1DQDL 2BXYA 3ULUE 1CK0L 1K2DB 1P6FA 5IWLC 3HRZB 5J12B 4QKXB 3QZWG 4WWKA 5D7LB 1PJ9A 5L6YL 5CILH 1EV2E 3HNTH 5ISZD 2YPKB 1HXMA 3U0TA 3IDYB 1CN4A 4K8RD 2AJYH 1NGQL 3PQYE 4S1QL 3DETC 3ZTNL 1U8KA 3CPLB 3C8DA 4PJAE 4BH7B 1JPSH 3T1FA 3G6AA 1BQHG 3RNQA 1C5DA 1F3DH 2Z35B 4M43H 3TCLA 1QR1A 2DKUA 4G5ZL 5DRWB 2C1PA 5GS2D 3WE6A 3T1WA 4HUVA 5F7EH 3SY0B 1MJ8H 1LO4L 1NGPH 3VDCA 5CEYB 4N8VB 5CZXD 3WHE0 1KFAH 2OZ4A 2R8SL 3PWPD 2JELH 1R24A 3VFOB 5ADOH 3WO3B 2BJML 5SWSA 1OSPL 5D7IE 1XR9A 1DBJL 1P7KA 4FQ1L 1G9MH 3MBEA 1FFOB 2VR4A 1AGBA 4QXGH 3MNVB 3R0MA 4S1SL 1G7PB 5FGBC 2AEWA 1NMCB 5FOBA 3LIZH 3DV4A 5I16A 2EDDA 1DUYA 3KYNB 4X80H 3H9SD 1DQTA 3WUWB 4P3CH 5DMIH 2UZXB 1P2CB 2VZUA 3S5LG 4BQ9A 4LPXA 4J8RB 2OR9L 4L4TD 1CG9B 2R0KH 5DMGC 4J1UA 4N0FB 3ZDZE 1NUNB 5C6TL 1QBMH 2WM0A 1KC5L 2X09A 2BY1A 1YNLH 5HGBA 5SWZA 1DUZB 1ZVSA 3QUKA 3TN0A 4I0PA 3I75A 3KXFD 5DJCA 3M45A 4LIQE 2UV3A 2FATH 3U0WH 4XC3H 1KCKA 4Z8FL 3M17B 4TUKH 4IRJB 2EYSB 1O5DT 2QSVA 4OUUA 4EZMA 3VXUA 1KEML 5DMJB 4N9GA 3QEHA 2F58H 5LJYH 1HQRB 5KN5A 4LARL 4LSDA 2YD4A 3FFCA 5I6XC 3BGMB 1V05A 1CD9B 1QPXA 3MCG1 3IXTB 3QQ4B 2J8HA 1G7IA 4QHMA 3LEYL 2NY6C 1CFBA 3AU1B 3BYYA 4HKZB 4H20L 5KS9B 3CAFA 1YEHH 4A6YA 4GAGH 3NFPB 4OZ4B 2MNUA 3GGWB 3FQNA 5BVJB 1LK2B 3L1OL 2DYPB 2FD6H 3K0WA 2PW1B 1N8ZB 1RJYA 4FA8A 1LEGB 2AQ2A 3CFJB 4LHUB 4ZO7A 4QT5B 4JDZA 3ETBF 4H0IA 4X4MA 1OLLA 2QSQA 3NGBC 2HFGL 3WKNA 4HMEA 5AEAA 1MCOH 1FH5H 4ODUB 1HXYA 3QBTB 5BV7H 4RQQA 3BAEH 3QXDB 2FGWL 4MA3B 5GHWL 2WWKT 3QIBC 1NCWL 2R0LH 4P2QD 3CC5B 1S7XB 3FCTA 1IAOA 3K8KA 4YK4B 1CL7L 1AHWA 4NWUH 4M62H 4ZPVB 3AS0A 1IGIL 2DQJH 3WNPA 1REIA 4EN3B 3STZB 5LQBL 5HYJA 2Y5EA 1OGAD 4N1EA 5C6WH 3AS3A 2IAMB 1MEXH 4L29A 5AAMA 2HT2C 4DFIA 1JRHH 1KPUB 3GIVA 1CTOA 4P3DB 5FUZL 5HDOA 3TA3B 3AS2A 3RDTA 3WN5A 4CVZB 1P69B 5C0BD 2XXMB 5E6IC 5C8JA 2B5IB 5EBWB 4MD4A 5CLTA 3NIGE 4U3XA 2VKXA 4NZRH 4Q9QH 3W2DH 4GRWH 2EDTA 4MZ2A 2VUOA 4ENED 4KRNA 1JHLL 3AGVA 4KROC 2OTWB 2GAZB 1EEYA 3VFPB 2IBGA 3TVMA 2HT3C 1IAIM 3QA3A 4U1LA 5CSBA 2KZ1B 4EI5B 4D0CB 3KJ6H 3D3VD 5EZIL 3ARTA 4Z7WE 4G42A 2GTZA 5BRZA 2DRUA 5IFAH 1AY1L 2R29L 1UGNA 5F9WB 1HIML 2H26A 3VG0L 5HYSB 1KTDB 5EC2A 4LP4A 4N0UE 1TPXB 5DJ2A 3QPQD 4Z7UE 1DBML 1FZOB 1X4XA 1IQDB 1BAFL 1KB9J 1TZIA 5ALBH 2Y06L 2FL5B 3C6LD 3B9KA 5FA4B 3LN5B 5ID1A 1WWBX 3KPSB 2GTWB 3DI2B 1A5FH 1BVLB 2VZTA 4P46C 5KTEH 1UJ3B 2BNRE 3ULVF 2HFTA 5DJZB 5ENWB 3QUYD 1QSEB 3RY5A 4DGVH 4TQEL 5C07E 3WFCL 1AGFA 1M4KA 2EDQA 4JGJA 4QRPE 1EBPA 3BGFC 4PGCA 4DN3H 2MJWA 3MRIB 1PY9A 3QWOA 3IAPA 1ZXQA 4J2XA 5DJYA 2EXYC 4XCCL 1AD0A 1S7TB 5D1XB 1AGEB 2Q8AH 5IHBA 1BF2A 2ATKB 2VLLA 2M2DA 3WDHA 4U1HA 1A4KA 2BC4B 4PJXE 2H2PD 5C0AE 1N2RA 5JHLL 1GVIA 5DTFB 4LCUA 5JO5B 3D87B 2BOCA 1XGYL 4WHTB 5E2TL 1C1EH 3JWDH 2AJ3A 2BY2A 4PY7B 3H3PH 3B5HA 4YGAB 2R2HA 5MEQA 2ZUTA 2KL6A 5IBUG 4JE4B 5EIVA 4OZIB 5E70A 5L0QB 4U4BA 1G9NH 2P48B 1A3LH 4HZLA 4Q74A 5D7JA 5DDHB 4H0HB 5BVPL 1FL6A 1TJIL 3VJ6A 5KVEH 3TBSB 4XPBL 5J12C 4X4YA 4KKAC 3QDGB 1FLRH 1F13A 5IR1B 2P24B 3BX7C 1MWAH 4NM8L 1D6VH 3TO4B 3IDYC 1H8SA 5DJ6B 2KUTA 3SGEH 3OGOE 5DC9B 3T2QA 1CGXA 5TQ2L 2HJFA 1CXIA 2BFVH 4HXAH 5T3XH 5TQ0H 1MVUB 3X14A 4L8CA 4U3CA 4FXKB 3W11C 4PJFA 4UILH 1QQDA 5MERA 3IVKA 4I5BB 3HE6B 4J4PA 1B2WL 1UJTA 3G5VB 3RY4A 3HPJA 3VG9B 4XP9L 4U1JB 5GRWA 1KLUB 4WFFD 4P5KB 1OGTA 5DD3H 4CN4A 2LU7A 5HHOA 3TJEH 3MBXL 1FO0B 3OJDB 3UROR 3GBML 5E9DE 1G9EA 2VXUL 1DANU 5JW4M 4XXCC 1P7QD 4FP8H 4YAQA 3E6HB 3FO1B 1F4AA 4N8CL 3BWUC 1YPZE 1YA5A 3BE1H 1J87A 1S5IH 5DGQA 1AXIB 2J12B 4EUPB 2YPLA 1L7IH 1TFHA 2FBJL 3EKCA 4WU7B 3TPUB 3D39D 2H6PA 1W72L 2CLRA 4NDMA 3L5WA 1VACB 4XAWL 3QYCA 5FGCB 1F45A 2CMRL 2VDOH 4KDVA 3CSYA 4P23B 5JHDB 5E8PA 1X3DA 3SE3C 4J3VA 3QDJB 5IQ7H 3V4PH 2VUYA 2NW2A 3CFBA 3VXME 3HUJF 4PB9L 3IJHA 3B6SB 1AE6L 2HTLC 1JV5A 1CFQB 2P8MB 4MLSA 4LK4A 3DXAA 3QDMA 4PB0H 4MAUL 2VQTA 1WC7B 4GRLB 4KRLB 5F88A 1NGYB 4EBQL 2YD2A 3RVUD 3MLZH 3IFOB 4IRJC 4N8PA 4AEEA 3MLWL 1ADQL 3LCYA 1TCRA 3BPOB 3TIEA 1K8DA 4GFTB 4NUJA 2WMPA 5E8EA 4X6DF 1NFKA 1HKLL 3EHBD 3UBXB 1GHFL 4HJ0C 4L4VD 2ZOLA 3VXSA 3SO5A 1PX4A 4Q6IB 4HUXB 4QXWA 4PJHE 5L2KE 3RWGB 5EIIA 5ITBH 1AXTL 5LGJB 4LLWB 2IPUG 3V8CA 2HVKB 4PP2A 1LGVA 1HWHB 1CT8A 1T2JA 5D4QA 5CEXA 1U91A 2P42B 1I7RA 4OSUL 2VLRA 1YDPB 3LQAH 1CGSL 2QQQA 3KNBA 4NO2A 3IKCB 4D8PA 4IRZH 5HD8C 3V0WH 2O26U 3WIHA 3S3SA 4PRHA 4Z0XB 1SJEB 4JDVA 3UTSA 1A02N 2CLVB 1RZGA 2JLLA 4RIRB 4OZFA 2X4UA 3IDMB 4YZFF 1A7BA 2QKIB 5HVGB 5GRUH 4Y88A 1YMME 4O2CA 3VFWA 1IZJA 3HKFA 2W9EL 1RZ8A 2XKNB 3HE7D 2OP4L 3QIWA 5L9DL 4LLQA 4HPYL 4YK4C 4P2OA 1GGBH 1Y6KR 2W9DH 2BOBB 4Y4FA 4DN4L 3VU2A 1MIEL 1P9MC 4LVHB 4EN3C 5J89A 1RZJH 1FDLH 1BQSA 1KJ2L 3WO4B 3FQXB 1Z9MA 3MRPA 5FUCC 4JHAH 4PGJA 1T80A 5EOTA 5IVZB 2Y36H 3C60A 2IAMC 4MJ5B 1DE4A 4OJFH 5E2WH 3S96B 4Y5YB 2DLHA 1TTFA 2L7UA 2QQKH 1ZGLA 1HCFX 3TA3C 3MLSH 3S34H 2XQYG 3WXWH 1EH9A 4XVSL 2BSTB 4WO4D 2X7LB 1QFWM 4RCAA 3QFJA 2XZQH 1NBVL 2J1KA 4HXBL 3MJ8B 2DWEA 1WBXA 3GI9H 2V9TA 3MRBB 2B5IC 3QPXH 1KBGL 4L9LA 4TRPL 4MD0B 1OT1A 3JV6B 5IT2L 5FUOL 1KIQB 4RFOH 3IXAA 3FQUA 4IDJH 3RWFA 5IROA 5LWYH 5K33A 4OAWA 4QRRB 5CMAB 2VLJE 4EI5C 5B38B 2VDKL 4PRIE 3B9EA 3DBXB 2SEBA 4ONFH 5JOEA 4XNZB 1QLEL 3V6BR 4TVPH 12E8L 3BSZH 3G5YB 3T4AA 4MB5A 5F9WC 1R3HA 4L3EA 4MQXD 3V5HA 1TNMA 3ZKQD 4OZFG 3AAZB 1TPXC 4U05A 5FHBL 3RRQA 1N6QL 5FO8A 4WEBL 2GJ6A 3PJSB 2CJUL 3MV9A 3A6BL 4JFFD 2NY2D 2I9TB 1UJ3C 2R4SL 2HLAA 5T5FH 2R39A 1NCBL 3FB8B 4LPYA 5HHPA 3MRJA 4LASL 2V5YA 1RUAL 1UA6L 3DRTB 1UYWH 2VSDA 3BKML 4OCNC 4FZEH 2DI7A 5DD6A 4EDXA 4HFUL 3KVQA 3SDCB 4HH9A 4RBPK 1HSBB 1WBZB 3PQYA 4H1LH 1CFVH 1HHGA 5I1IH 4PJAA 4BM7A 4WHYG 1MCPH 4CW1A 3KJ4B 2FHCA 2H8PB 4ETQA 5D1XC 3MRFB 3NMEA 3IGAA 1FVCA 2X70A 1U8PB 4XPGH 3FL7A 3TV3L 4XZUB 3X11A 3P4MA 5I9QC 2VXSL 5ADPH 1QSVA 5D1QB 4G3YL 1FG2B 4YDKH 1XGQB 4NSKB 3AM8C 5AWNL 4QEGA 4F37K 2WUBL 1AFVL 1A0QH 4PJGB 5HVWA 5D7IA 3VGEA 1MCLA 4WI5A 1MIMH 4HD9A 4H25A 1NL0H 1VB9A 1NAMA 1IM3B 3W9DA 4YHKH 5EUOF 5L0QC 2HH0L 4F7PB 2DTSA 3C2AH 2I26N 1KCSH 4ZAKA 5F9JB 4YBHA 5KVMC 3SJVD 1HHIB 3MUY1 3BDXA 4HUUA 1ZGLM 1YEFL 4KMTH 3JV0A 2A9NH 3TO4C 4HT1H 3NFNA 4FTVB 1JI2A 1FJ1B 2JE8A 5DUPH 1BJ1H 5KSUB 1OY3B 1ZT4A 3KR3L 3TBWA 3DROA 1A6AB 1PG7L 3MV01 1NMAL 1NKOA 1T20B 3BP6B 3HMWL 1BHGA 1FLTX 1RJZA 1WTLA 2F19H 2O5XH 5FO7B 4Z7OE 5IKCB 5DI8A 4JFXA 3CMOH 3HE6C 1AR2A 4KI5F 3VG9C 4XMPL 4P2RD 1IC4H 1D5ZA 4R4FL 1F4HA 1PDKA 4MHHG 5D72L 4XCFL 4MXWH 2ICEA 5GSVA 1WFNA 5J8OA 5C0IB 1R5VB 1ZTXL 4XP6H 3ULVL 3O4LB 1YJDH 3QEGH 1T1YB 3NCJL 1TJGH 2VWEE 3DUUB 1CD8A 3DO7B 4M9OA 1X5YA 1OW0C 3REVB 1MFBL 2W59A 1KYOJ 1U93B 1MY5A 5ICYA 5I73B 3VFTA 1SVCP 3DYPA 5J3HC 1J1XH 1JPFA 4P23C 1I9RL 3BD4A 8FABB 4P4KA 5LXGH 2RHEA 2EH7H 3CDFA 2A73B 5EA0L 2P4AB 4U6VL 2UZIL 4PS4H 2E7LA 3U4EA 4LNVA 1OPGH 5E6YA 2Z8RA 3MOBH 1IM9A 5C86A 1NEZB 1R5IA 1TIUA 3Q6FA 4ZUSB 2FHFA 2FDBP 4GRLC 4TOYH 3SDDD 1XCQA 3SKJL 1FV1B 4S0TD 3IFLL 5JOPD 1E6JH 2XTLA 3ZT6A 3GO1H 2X4NA 3BPOC 4LL9A 3RL2B 1QRND 5JNYB 3VI3F 2GSIB 1KXQE 2P46B 3RAJH 3RX8A 3SKNA 4UAOB 4NZUH 5DYOA 4Q6IC 1U8OB 2Z91A 3ALXA 3BJLA 1D9KB 4WGVB 5I15L 1SEBA 1TQBB 3BIBX 5FKAA 4ZFOL 3D9AH 3WJJA 3BN9C 4JZNA 1UXSB 5EU3B 3LKSB 1NCCL 4KDWA 4F8QA 1LO0L 4LF3A 3IU4L 4XTRC 4OI8A 4RGMB 2I9LA 4WTZA 35C8H 3H3KA 3T3ME 1PZ5B 5BXFB 4QHLB 2YBRB 2HMIC 1QRKA 1HINH 2GQHA 3MRDB 1K3ZA 2F8VA 2VXVL 2H9GB 3ZYJA 2OMNA 4GXVH 3DV6A 4G6JH 3SO3B 3QO1B 4AEHL 3VGFA 5A43C 1CXKA 4X6BA 3K4AA 1PSKH 3RGVD 3RWCA 3QUZD 1RURH 1ZSDB 2NX5A 4NT6B 2BY0A 4LRIC 4Z7WA 1RVFL 3D85A 1EHLL 3OKNA 2EYRA 3O2WL 3LDBB 2ICWJ 4YUEL 4XCNA 4Z0BL 3IFNL 4N0UA 1KCUH 4LVHC 1I9EA 4Z7UA 2AQ3A 5KSBF 1R3IL 1P6AB 5EZLA 3QIUB 4YHIA 1MFEH 3SE4A 3WO4C 4HUKB 3SDAD 1WSST 5TFSL 5HJ3B 2DJ4A 2EDWA 3QRGH 2HKFL 5E99L 4HW6A 1G84A 2AJZA 3RNKA 1HHJB 2BNRA 2VXQH 4G7YH 4Y5YC 4M5YL 1CE6A 1UWXK 4I18B 1XCTA 4GRWF 3T04D 3OL2A 5C07A 5KSAA 3GHBH 2OTUB 3GHEL 5KS9E 1HILA 2HN7B 5IEKA 4QRPA 1E4KC 3ARVA 1J0JA 5HHVL 4XPAH 4PV9B 4UUJA 5KANG 4NRYB 5F9OH 2NW3B 3JTSA 1INQB 1S9KC 4ERSL 5FYLD 2AKRB 5DMKA 1FFNA 3QXTA 3WSQL 3WLBB 3BH9A 4FHBD 4KVNL 3ZO0A 1JN6A 5TE4L 5LG1A 1T22A 3VRLE 2OJZH 4HGKC 1EXUB 1OT2A 5C0AA 1UM5L 4X5XA 4OM0H 3ARFD 1T6WA 2CDFB 4YBQD 1Y6MR 5ERWA 4XBGB 4F7TA 5CZVH 4NQSB 5SWQB 2O61B 4FZ8L 2AJUH 1BJMA 4XNZC 2Q7YA 1S8DA 1AD9B 4HIJB 4LU5L 1P4BL 1NSNH 1VFBA 4HF5L 2NNAA 4EVNB 4OI9A 1I3RA 3D18B 1ORQA 3MJ9L 2NMSA 4NO0B 1E4JA 1RK1A 2GITB 4JRXB 2DLTA 2Q86A 3LHPL 4JFYA 2XN9B 4Y16D 3MGTB 2VQUA 1CF8H 1BFVH 1GZQB 2CO6B 4S1DD 3BP7A 5MI0B 4G8FA 5EU7C 4E9LA 1Q38A 4M1DH 1CLCA 4DUWA 4K8RL 3HRPA 3I2CL 5FUCE 4XMKH 3EDFA 5D1ZD 3PGCB 3SDCC 4LDLB 4HGWA 1JWMA 4PLKD 3QUMA 3T0EA 4LCWB 1T04B 4UTAL 2EO9A 3HAEA 1T83A 4YHLL 3QCUL 1OP5K 3KJ4C 4YIQA 4E5XB 3VXTB 1KCVH 2R23B 4PRBB 1TVBB 1GIGL 3GEWB 5D93B 5HDQH 2CDGA 4V2CB 1CWVA 5D1QC 5MENA 2G75B 4ZSOA 5B22A 5JA8B 4FQCH 5C0GB 3VFSA 5IGXL 1MJJA 5EU5A 4R26L 3NN8B 4C56D 2EC8A 3HI5H 3LSOB 1HCVA 3GKWH 5HSFA 2HT4D 5E1AA 1IKNA 1K5NB 1N0XH 1YPZA 2C5DC 2JJSC 1GSMA 4W4OA 3E6FB 1II4E 4OFYA 4PJCB 3ME0A 1T03L 1EGJH 1FCGA 3I85A 3ZLQC 4WUKL 5DO2D 4C54A 2XYCA 1T89C 4QRQB 1OM3H 1ZLWK 2FB4L 3EBAA 1RZIB 3VGAB 3WFDL 1P4IL 2VL5A 1N4XH 4LAQH 1F8TH 4QRTB 4ZNCD 3OX8B 1QSEE 2QHRH 2VLKB 2DM4A 3HI1B 3QEQB 2A38A 5IW6B 1DSFL 1ODAA 4OKDA 5FF6A 5HYIA 2DQTH 1GOHA 3DVIA 1K3IA 1DL7L 1KB5B 1LNUA 1IZKA 2F53B 4YDVB 1FORH 3X13B 1EO5A 3HNVL 2P5EB 4O9HL 2ADFH 3HAEG 1J0KA 4DW2H 4MQ7B 3BXNA 1I8KA 1OD9A 4ODSL 1M1SA 2EKSA 5I1GH 1XAUA 2MCPL 4OLYL 3LRSA 5L2KA 5JIHA 1QNZH 3T2NH 1ZLVK 1P7HL 4EOWH 5F3BB 5EWIL 5I73C 5FGBA 3S4SB 5I66A 2FX8H 5IVNA 5L88H 2DD8H 1T3FB 3CFCH 3S97C 4HUWB 4AJ0A 4I1NB 2CLZA 4QRUA 1A14H 2CDEA 4GQPH 3QCTH 4MA7L 3OWEA 3QDGE 2WUCH 1NGZB 5IB4A 4JHZA 4U6HB 3O3EB 3NH7H 4J23A 3BP5B 5IESH 3C8KA 2D31B 4WDIB 3PGDB 3B2UC 2IH3B 4JZOA 3GMNB 1NPUA 2AEPL 1G6RA 5CILL 4QTIH 1YMMA 4G6AC 2XZAL 2CXKA 2AJYL 2QADD 2WQRA 3HZYA 4JQXC 2ADIB 5GGTH 5I30H 5SWSD 1WEJL 4OCWH 3S35X 4NJAL 1A7RL 5DQDH 2UVEA 4FFWD 4M43L 1A6VH 4P49A 1NDMB 4UAOC 1NBYB 1NCDL 4P57A 2DB8A 5F7EL 3AMLA 1BMGA 1MJ8L 4FQLL 4PGDA 1JF6A 4YHZH 3T4YB 1D9KC 1N64H 4S2SB 4HS3A 1KFAL 1TQBC 5F7HA 4BKLB 4KQ3L 3TEUA 1S9XB 3PWJB 1G6VK 4XRCB 3EYUL 3ULSA 4OD1H 2A9ML 1S7RB 3KYMA 4PRDB 1G9ML 4I2XA 4LPWA 1IAKB 4RGMC 5IV2B 5FGCE 1FN4B 2F74A 4OGYH 2P8PA 3P4LA 4LPCA 5JHDE 3GMOA 4U1NA 4Y4KB 1FNSL 5SWZD 3MACH 3HZKB 3QDJE 4OV5A 3TN0D 4I0PD 1BZ7B 1QA9B 5AAWA 1I8MA 2YK1L 1CD1B 2X4PA 4GKNA 3MXWL 4RWYH 5ILTL 3SO3C 2H2SC 1F4XH 1S9VA 3RTQB 4YHYB 3VXUD 5FDWB 2XA8H 4LLYA 4OZHF 5T1LA 1N6UA 5J6HA 1Z0NA 1QBML 3ESVF 3FFCD 4POZC 3T77B 1XIWB 4BZ2H 3MR9A 3LDBC 3QIBA 1KJ2B 1A3RH 4PRPB 2PTTB 2CKBL 4XWOC 1CZ8H 4XH2A 4Z77B 3CIQA 2FATL 5EU6A 2Y5TA 1X5ZA 1J0YA 3U0WL 2A6KB 1HOCB 1MRDH 3QIUC 5JW3H 2EIDA 5D6CA 1T1ZB 4ZMAT 4DUXA 5EC1B 4JJ5A 3VGBA 5IHZA 2R1WB 3K7UA 2AK1H 1K4DA 4I18C 1XR8A 1EZVX 2IBZY 1YEDA 4G7VH 4KKCD 3T8XA 1U8JB 2PYED 2VE6A 3ZTJG 3FRUA 2EE6A 3FTGB 2J6EA 4I4WB 3VCLB 1JUFA 1OB1A 5D2LF 2F5AL 4UZGA 4GAGL 3C2SA 5CD3B 3O9WB 5MP6L 1ZT1B 3IB4A 8CGTA 2FJGA 2FD6L 4RGND 4MX7B 5FYKH 4KUCD 3ZSSA 1C7TA 3GUTA 4LLDA 4MS8C 2C9AA 4ZFFA 3D69A 3PDDA 2XIDA 4YLQT 4UOW1 4UINL 3LN4A 2OXHA 3D25B 2DQFB 3BIKB 3EOAA 3QULA 4TUOA 2VZOA 1BIHA 3CFDA 2B7DT 4FMKA 4M7LH 4M8QA 5DFVD 5F93C 2H45A 3HTLX 4MWFA 3I9GH 2MKWA 3O8XB 3WS6C 1A4JA 3KPQA 3GSVB 5BV7L 5HYJD 5DJAB 1ZWIA 4GQ9H 1NDGA 4GOSA 5MI0C 2Y7QB 4M6NH 3VXRD 4F7EB 5JXAH 1FZMA 3O3DA 4RZCB 4M62L 1IL1B 3RDTD 1YEEH 1ULVA 5LCVH 3GSUA 2JJVA 4NNPH 1MREL 1Q94A 1CXFA 1KIRB 4JG0H 4AEIL 1WZMA 2IPTH 2YSSB 3IDIA 5EZJB 5TE6L 1F11B 5IVXE 3DSFH 4HIHB 3VFGH 5JORB 3U79A 4JPWL 4PJ8B 4PJEF 3X3GH 1ES0A 2AABH 4JKPH 5I1JH 5K9QI 3WXVL 4G6FD 3VGHA 1OF2A 5DVMA 1DQJA 5LBSL 3TVMD 2MTPA 5D93C 4YDJA 5AUMA 4MA8H 3NZHL 3JWOH 1QFWH 3GJFA 2X4SA 1YN7B 3LPFA 1U8NB 3PDOA 3VE0A 2DIAA 5FM8A 4PJBA 1M7XA 5BRZD 1ORSB 5CBEA 4F2MA 3C5JA 4QF1B 1X7QA 2AV7B 2ITCA 1B0GA 2A83B 4QRRE 4NZRL 3W2DL 4KK6C 4FNLL 4JANA 4GRMA 3MUGA 3EFDL 2P49B 2OK0L 4MAYB 3B9KD 4XPTH 1M71A 2B2XH 5TGBB 4MJ2A 5JIIA 4NNYB 2FIKA 5MHSD 3H7BB 3KHOA 4EQ2A 3L3DB 4JB9H 3RI5F 5ACLA 4UT7L 4ZS6D 1JF1A 1MCWW 1QOKA 4NQDB 5IFAL 1DQML 2VZSA 3GMPB 1Z0MA 4KI1A 1K2DA 1QFPA 3UZQA 2D7TH 3VGAC 2C4FT 1JNNH 1JMZA 5EU7E 1T4KB 1MHCA 4F15B 2J5LB 2HFEA 3W0WB 1RPQA 4GG6F 2YPKA 1XEDA 1T2QH 4BQ8A 2VISA 3RKDD 1CICA 5GRVK 3CPLA 3MA7B 1TVHA 2QQLL 1X5AA 2JIXB 2Z35A 3KYAA 4K7FB 3VXPB 1JRHI 4KY1L 5E56A 4LOUD 4PD4K 4AIZB 2YPVL 2AEIT 5IF0B 5CEYA 5K9JH 4NPYB 4XNQB 2QSCH 4Q9RL 1GL4B 3VFOA 4HWEH 2DQDL 4U1KB 4WU5A 4Z78A 4PJGE 4WI6A 1P4LB 5D7JD 2Y6SC 3OJMB 4M6OH 4U1IB 1FFOA 4PBVC 1NBZA 5J13B 1P5VA 4XXCA 1G7PA 3JWDL 3OHXB 5HI5C 1RUPH 1B88A 1ZA6B 1U8QA 1UVQB 4ZO8A 1RD6A 1QZ1A 3U9UB 2P43B 3TWCL 4GMTH 2CKNA 1BJ1J 5T5NG 3MGOA 1BX2A 5ESAB 1HI6B 3GSNL 4LSPH 3SE3A 1P2CA 1G9NL 4M6MH 1A3LL 3IRZA 5JLZA 4J8RA 3MV8B 2PXYB 1CG9A 1DEEA 4L5FL 1GZPA 2R2CA 2VJXA 5KVEL 4GBXA 2J88H 3SPVB 2XKSA 3BQUB 1CU4H 4J4PD 1FLRL 4ORGA 1I85C 4IMKC 1MWAL 2ORBL 2R9HC 4Z95L 2E6PA 1JGUL 3WDIA 1ZVHA 3M17A 5CCKH 2EYSA 4HXAL 2BCKA 2AXGA 4R0LB 2R1YB 2CRZA 4HGMA 4GS7B 4OLVH 4ZUTA 4ZFOB 5DMYA 5CP3A 1A6ZA 1HNGA 1JTTA 1NEUA 1SM3H 2YPLD 4ZUWA 3O4LE 1F5WA 4JKLA 3MRGB 1IJ9A 1R3JA 5C7XL 4OZGA 1RIHH 4U7KA 5CJXA 4MDIA 5KVGH 3IXTA 1JHTB 3QQ4A 5DD3L 5E00B 3TJEL 3ROOA 4N8VG 3CVHL 4NFDA 5B21A 5D5MF 1BLNA 1A9BB 4OZ4A 3WLWC 3GGWA 5BVJA 2XQBL 3BE1L 4M7JH 2DYPA 4PJDA 4S11A 1S5IL 4Y4KC 4UDTB 5DEGA 1BQUA 1L7IL 5GRJH 1PZUB 3QDMD 1TETH 2WBJB 2C4XA 3CFJA 1QBLH 1S9WA 2GJZA 4YGVA 2QL1A 4TSCH 4NQEB 3OG6B 3CFEA 3KYOA 3RTQC 1X44A 3N9GL 4PREB 4YHYC 1M05B 3V4PL 4N90E 1CDHA 2ZG1A 2OM5A 4ODUA 4AH2A 4PY8J 4Q0XL 4NHUB 5BS0E 2R0WH 3F62A 1XIWC 4KTEH 1ND0B 3EYQD 4R8WH 3SGEI 5F3HB 4JRYA 4XVUD 3BZFB 1S7XA 5ETUB 4RMQA 3T2PA 3VXSD 2IQAB 1AXSB 2FYYB 4LGPB 1YEGH 2CPCA 3OKMB 4ZPVA 5JDJA 3UTTB 1QLRA 3O6LH 4R7DA 1MHHA 5DURD 3FONB 3LKOA 3WFBL 4HBCH 4DVRH 4DTGL 3GSXB 3ABZA 1NC2A 2GJJA 2VLRD 2Q20A 2ZCKL 5I2IA 1AGDA 3MTRA 1RZKL 1U42A 2YRPA 3NABH 4J3TA 4FQJL 3HC0B 2DAVA 1HN1A 2G9HB 4X6DB 4F57L 3BWAB 4O2FB 4PRHD 4UV4H 3TA3A 1LQSR 4CVZA 4GW1B 5GGQH 1XH3B 3LMJH 3ZDXE 4K2UL 2D03H 1HYRC 1V8HA 3MJGX 4M61B 4ONHB 3O9WC 5FM5M 3MXVL 1EEQA 3S36L 2OJEA 2Z31B 1FNEB 4Z5RB 4B0MM 4P2YA 4BJLA 1U58B 4JCLA 2Y9RT 2HP4A 3QIWD 1XFPA 4LLMB 3SQOL 4JR9H 2GAZA 4IRZL 4P2OD 3V0WL 1AKJB 4FFVD 1OAYH 4IJ3B 1CGWA 2D3VA 3RPIB 3BEWA 3TPKA 4D0CA 5KZCB 4M48H 4POUB 1T1WB 3BUYB 4WJ5A 5DGRA 5GZOC 1F00I 5I1CH 1BQLH 3EYFB 3O8XC 4M5ZL 3OB0H 1YEKH 4WW2F 4LSUH 1BD2D 1TTUA 3CGTA 3E3QC 5HYSA 1U8LB 1KTDA 3GSWA 5C3LD 2C3VB 5B8CA 3C60D 4X0KB 2HLFD 3MYJB 1L7TL 1LP9F 2E27H 5J1SC 4ODXB 4D0DB 4NNXB 4K7PH 2W9DL 5FA4A 4QXTB 1MJUH 3QFJD 5T33H 3R06B 3HZVA 4J7RA 1KCRH 1UJ3A 1CLYH 1AR1D 1D5MA 5ENWA 3GK8H 1FDLL 3SDXB 4Z18A 1KCLA 2X4RA 4O5LH 3LEVH 3RVVC 4WI7A 3P4OB 3O6MH 3UYPA 4PJ8C 3O6FA 2Y36L 5E2WL 3MROB 3QB7C 1RHHB 2QQKL 1FVDB 2K7PA 5CEZH 3MODL 1HNFA 3EJZC 1DDHB 3MLSL 1S7TA 3MLRL 3S34L 3VFUB 3QCVL 3WXWL 3BN3B 4ZD3H 3VXNB 3PNWB 1S3KH 2ATKA 1YMHB 4KHXH 1WFOA 2FSEA 2CO7B 1X5GA 2A0LD 2CIIB 1S7SB 2BC4A 3GI9L 5GRZA 1MHPL 2DICA 1W0YT 3QPXL 4OTXL 2EEAA 3D2UB 5DTFA 4L3ED 2V5MA 3DRQB 3H9SB 4FMFA 1YEIH 5DHVB 4AY0A 4JM2A 3RZCA 3MRLB 4RFOL 1N7ML 4PJ5B 4G9DA 2GJ6D 5LWYL 3UCRA 5E2UH 4ELMB 3MV9D 4L4TB 3HG1D 4H88H 4MAYC 2MQ3A 3ULUD 3O11B 1MRFH 2EE3A 4NBZB 3IDNB 4L3AA 3U7YH 2OL3H 2QV2A 3HS0B 3UYRH 5FYKU 2GW5A 2XG4A 3IF1A 3F12A 2H1PH 3QEUA 4F33B 2X44D 5B3NA 1GC1L 1MH5A 3TBSA 3PQYD 1RFDL 2YWYA 4UT6L 3FFDB 1BZ9B 4F15C 2J5LC 3C5ZB 5IR1A 2P24A 1AI1L 4WCYH 5HYSG 5IB5B 1J7VR 2DBJA 4HKBB 2UWEA 4G9FB 4LCWE 1RK0B 3QHZH 4AL8L 4G8GB 3T3PF 1UYWL 4TTDC 2EH8L 5IJKA 3NPSB 2YWZA 3S7GA 3TZVB 3ULVC 3C9NB 2JF1A 1SVZA 2V7HB 1PD6A 1CFVL 2HFFA 1MCPL 4I5BA 1F2QA 3HE6A 1GOFA 1MHEB 3G5VA 1EMTH 3S3PA 4U1JA 5DRNA 1KLUA 5DRXB 3VD7A 5E7FA 4P5KA 5FXCH 4XPGL 4M1CD 4JDTH 3OXSB 4EDWL 3V52L 1FO0A 3L3KA 5SX5H 1U8HB 5HI3D 3PGFL 1A1OB 1MAMH 3Q48A 5ADPL 1MF2H 5J13C 3CSPA 3GFUA 4ZAKD 4YDKL 3E6HA 4PLJC 5DF0A 1WAAE 3WHE1 2V17H 2X9YA 3FOLA 5EORH 3TPUA 2Z93B 1MIML 4PJCE 1G1YA 4RMSA 3L3JA 1NL0L 1KUMA 1VACA 3JVGA 1CFNB 3ROLB 1CDUA 3U0PB 5BJTB 3H8NA 5I18L 4CU6A 2PXYC 3EOBA 3QHFH 1KCSL 5FHAL 3KPNB 3O0RL 3GMRB 2BXZA 3RPKA 3V4UH 4HLZH 2VLKE 1QR4A 3GSQA 1F6LL 3QEQE 3BQUC 1DQDH 1CFQA 2P8MA 1ZK9A 1CK0H 3PWNA 2C1OA 5C0CB 1IE5A 2A9NL 3OAUH 1WC7A 4HT1L 2A77L 3FO2B 4GRLA 1I8IB 2BVQB 5L6YH 1CVSC 3U6RB 5KG9B 4ZNEA 1KJMB 1U3HB 3IFOA 4R3SB 4R0LC 1A1NB 2GKIA 2V2WB 4GS7C 2F53E 1NGQH 4Q58C 4S1QH 2PO6D 3NIDF 4IM8A 2P5EE 4YHPB 3TBTB 3DX6B 3UBXA 3NACL 4G5ZH 2X10A 1I1YB 3BGAA 3LB6D 4OCRL 4Q6IA 4X7SL 1MCQA 3RWGA 4K71B 4P4KD 3ZE1F 1PKQB 5LGJA 4XPHL 3MRHA 2R8SH 4MB4A 2J3SA 5FYLL 3FZUC 5A3IC 3VFRA 2V2TB 2K1MA 1SJXA 5MEOB 1YDPA 1DBJH 4HDIB 2D7MA 4FQ1H 1IM9D 4QTHB 5GGRB 1ACYH 2WBJC 2X9WA 2IANB 3RUGF 1TITA 4OQTL 4S1SH 1HH9A 4KJWC 5HDBE 4ODWB 3PV6B 4EUPG 4L3CB 5LXGL 2CLVA 3IDMA 1F4WL 3U1SH 3LKPA 3KDMA 2A74B 2CKBB 2Y23A 1T7XA 1X5FA 3C08H 1FFPB 1OPGL 3C6LB 4UBDD 1MCNA 1MJ7L 3L7EB 3QUMH 4U6YB 1T7YA 1A47A 5E4EB 1GJIA 2XKNA 3QUYB 4NCC1 4YXKL 3U4BL 3LKQB 4OF8A 5I19H 4V2BA 4OFIA 2N56A 3WCYA 4ORZC 4IOFC 3C6SB 1E6JL 1SJHB 4MCZA 4QHUB 3MREB 4ZXBB 4F9PC 5ID0B 4LSRL 4NCC2 4EI6B 4NC1C 4Z8FH 5FCUH 5GS0C 5E7BA 1ONQB 3RAJL 3KHQA 1F42A 3UTPE 5HBBA 1DQQB 1HYSD 4MJ5A 3IDGB 5FGRA 5DEZA 3BP4A 4LARH 3STLB 3UBXG 2NZ9D 1J0HA 2BSTA 2LV4A 1E4KA 1LHZA 3EOTH 1E27B 5IVXA 3TFKC 1F3JB 3EO0B 4P59L 1OP3H 2ATPA 3MJ8A 4MGXA 5BQ7B 3LEYH 4Y8AA 3MRBA 4WTXA 1UFUA 2ITDB 2W60A 2YA2A 3JV6A 4H20H 2Z31C 1C16B 4HUMB 3MZGB 1UB6B 1GGUA 2QBWA 2VYRE 1HKFA 3D85D 3MV11 4IJ3C 3L9RA 4QRRA 5BV7B 3DBXA 2WQ8A 4G6JL 2B1AL 1K4CB 1A22B 3ZT7A 2HFGH 3M07A 2UY7A 5KAQF 2BNRD 3LVEA 2RJMA 2KBGA 3O6KH 4HLJA 1Q9KB 3PJSA 4WFEE 1I1AD 5F7YC 5C07D 2FGWH 1DN2A 3PWUB 5GHWH 1NCWH 4QRPD 3ARQA 4X5LA 4D9LH 2BMKB 4ODBD 4HAFA 4JO3L 4PY8I 3VFMA 3FB8A 3PWLB 1CL7H 3FHAA 3DRTA 1MFEL 2APFA 2LABA 2Z8SA 5MEPA 4ZOBA 4TNWK 4YR6A 3SDCA 4O51B 3QRGL 5GGVL 5FECA 5KSBB 1WBZA 1D6EA 5LQBH 5C0AD 4ISVB 4P5TA 1U8MB 3GHBL 2H8PA 3X3FH 3T2OA 4OF6A 1MLBB 1ZE3C 3K74B 4ZUVA 1U8PA 3AUVA 4U6XB 1AP2B 4GRWB 5F9OL 4LCCB 4XZUA 4KK5D 2F54A 4N0CD 5CINL 4UQ2A 1YN6A 1MY7A 1XGQA 1FHGA 5E5MB 3STBA 3MLXH 3NCYS 2OJZL 4XB8A 2YC1B 4OCMC 1VGKB 3K2UL 3W9EA 5CZVL 1NGWA 2AJUL 1MI5B 1KGCD 2NY0B 1K8IB 4JFHE 1Q1JL 4PR5A 1T66D 1B0WA 1ZMYA 1NSNL 3E3QE 4UQ3B 5F9JA 2FEDD 4QRSB 1HHIA 1XF2B 1HDMB 2GK2A 3C5ZC 3VFVB 5C0RH 1UB5B 5HVFB 1HIMH 3QJFB 4FXGB 2VITB 2VQ1A 3G08B 4CN1A 1BFVL 1DBMH 1HQ4B 2OZ4L 4RMUA 3VWJA 2DQIH 4M7LT 4Y89A 4RAUB 2Y06H 2OX5A 2X6MA 4F3FA 1LEIA 3U82B 4L4VB 3DVNB 5FM4A 3HMXA 3NPSC 3TZVC 3D3VA 2DI9A 2PR4L 2PYFB 4HPOL 2HJLA 1T20A 1JJUA 1D7FA 4L8DB 4NFCA 4TQEH 3WFCH 1VENA 5IKCA 3CX5J 5GJSL 2DF3A 3SKUD 5DVKA 5E8DL 4DCQB 1SYVB 4M3KB 3RIAK 4LLVA 4Y5VA 4WV1B 2BVYA 3QJHB 1C5CL 1R5VA 3VWKB 2Z9TA 1VGEL 4OFYD 5HDQL 3O4LA 3VA6A 3CXHJ 3IJSB 4YEFA 1RIUH 2H32A 5F1OB 5FFLA 2B4CC 3DUUA 2VIRB 5F44A 1QBAA 3VGDA 5JHLH 3REVA 1ZHKB 1U93A 1XGYH 3HI5L 2BNUB 4QHNA 5E2TH 1SYSA 2YUZA 5E6ZA 1EVUA 4LVOB 4NQDE 3BYTA 4OZIF 4C83B 1OAXL 1IAIL 2A73A 4FFZL 3EYSL 1S7UB 1MWAB 5JR1H 3SDYH 4RAVB 3WNNA 5CP7B 3W0WE 4EXKA 3QXUA 2XWTB 1WCBB 1OM3L 1TJIH 3KG5A 4HCRH 5DK0B 3DVFA 4XPBH 5KVDH 4CVWA 3QT2A 4LAQL 1F8TL 1QO3B 2R0ZH 2QHRL 1FV1A 1S78C 5BS0A 5EB9A 4FQ2L 2IPUK 1U3HC 1VADB 3IDJB 3ULVE 2DM2A 3WS3B 1JI1A 5L2KD 2GSIA 4A6YL 4HWZB 3TC9A 3PXHA 5ITFB 5TQ2H 4WO4B 4DK3A 1F6AB 2DQTL 4OUOA 1MCWM 4FABH 2H3NA 1RHFA 2ESVA 1G9MC 2YRLA 3WFHB 4X9IA 1U8OA 1IILE 1W0VA 1CR9H 4K71C 5D9SA 1D9KA 1TXKA 2IFGA 4OCSL 2CRMA 1SQ2N 1I1FB 2ZCHL 1V3KA 5FM5O 1UXSA 5I1GL 3LKSA 3RWIB 1YUHB 4U7SA 3MBXH 3TT3L 1TCMA 1IGJB 1X6LA 3KPRB 4KRPB 5DMGD 4EOWL 2VXUH 4OT1H 5K9OB 1YQVL 4I48B 3EGSB 2ZCLL 1PZ5A 4JFEA 5DEFA 4Z7QF 5BXFA 2FX8L 4QHLA 2P7TB 3JV4A 3MRDA 2AXFB 2FBJH 3AMKA 3MV8E 3QFDB 3LH2H 1YMMD 1W72H 2H9GA 4KHTH 4XAWH 1A14L 32C2B 1EX0A 2JCCB 4GT7A 1ZHNA 2AW2A 3LV3B 4XAKE 3QCTL 3IAGC 4W6WB 4L8SB 3MNWB 3V7AE 3C6LC 4L8BB 3JZ7A 1T7ZA 4YXLL 1F97A 5E4EC 1VPOH 1KN4L 5A2IH 1ZSDA 1P7QA 4NT6A 1Q9WA 4PB9H 3QUYC 5C0FA 5TF0A 1AE6H 3T0AA 5IESL 2ARJB 2DIBA 2XQYK 1UKQA 1JNJA 1NEZG 4QTIL 1OAKL 5E08L 4ZXBC 5DJ8A 4GAJL 1ERNA 1S7WA 1KN2L 5GGTL 4OV6F 4EBQH 5C1MB 3MLWH 5HI4C 1NCAH 1ADQH 4K3DL 2WZPD 4P9ML 2H2PC 1HKLH 5CJOL 4I18A 5I75B 4KJPC 4WWID 4YHZL 1N64L 2OTUA 2HN7A 5SV4A 4PV9A 4X7CC 3HI6L 3RZWA 4DZBA 2NW3A 1G7HB 2GFBB 1INQA 3L5IA 4XGZA 2AKRA 3LRGA 2VDRH 3DSNA 4HQQL 1CFTB 5H2BB 3WLBA 3FT3A 1GPOH 1BEYL 4PRID 5T3ZE 4OGYL 4HWNA 4NQEE 5T1LD 4FQXB 1EXUA 4XBEH 2EICA 2DKMA 4OLZL 4OSUH 4CADA 3INUH 4OIAA 3QIBD 3MACL 5IVOA 2CDFA 4NO3A 5BV7C 1CGSH 4XBGA 3QQNA 3O3AB 5SWQA 3L5JA 3SJVB 2O61A 2LVCA 2AV1B 3SGJA 1KPVB 3MLUH 4HIJA 3GMQB 1F4XL 4NKMA 4TVSa 5I1AA 3HUJE 4HS8H 3IS0X 4YPGB 3ZYZA 4KJYB 5D7KE 4YHOH 3BZ4A 2PKDA 5E24E 4NO0A 3P0YL 1SY6H 3UTTE 4BZ2L 1UM4L 3MGTA 5JUEH 4OZHB 1CZ8L 1GZQA 2OP4H 4U0RB 2HT2D 4NC1E 3PHOA 5L9DH 4HPYH 3PABB 4M6AA 5C71A 3N85H 4F9LC 5JW3L 5I17B 5E6ID 1MIEH 4X6DE 4URTB 4H8WL 1A7OH 5HGDB 4NRXB 4ZFZA 3EDJA 5AG8A 4RA3A 1IFHL 3FN0L 1DN0B 2EXWD 1C7SA 5C0JB 3VXTA 3WL9B 1UCBL 1LEKA 2R23A 2X1PA 3MV7B 4LCCC 3CNKA 5B4MC 4PRBA 1TVBA 4MSWB 3S3JA 1ITBB 5H37H 5H35A 4XVSH 5DK2B 1S9YB 4HFWB 2G75A 4HXBH 5C0GA 2B20A 3MLVL 3GSOB 4G8IB 3VRIA 3PXJA 1PY4A 1X4YA 2EEDA 5D2LB 3TYGL 5FUOH 1A7PL 1G0YR 2IADB 1C12B 2NY0C 4LEXH 3E6FA 3F7PC 3V7MA 1UH4A 4HIXH 4MJ6A 3RHWK 5T1MB 4X8JB 3KPPB 1JK8A 4YZFE 2K9UA 3NCYP 5JW4N 3ES6A 4M7LL 12E8H 3I9GL 3NOIA 3RVUC 3SN6N 4QRQA 2ZNXA 3ARRA 1FZKB 4F58L 4UT9L 1MNUH 1QRNB 4PGBB 3T0WA 5FHBH 3EHBC 1GOGA 1ZHLA 3OX8A 3R0NA 2X2YA 4WEBH 2CJUH 2VLKA 1I1RA 2EXYD 1QPPA 4NQTA 3QEQA 5A16B 4H1LB 3A6BH 3ARSA 4JN2A 4MJIB 5ESQB 3ILQC 5LCVL 2R4SH 1OWWA 4LPTA 2WP3O 1NCBH 1KIUA 3MMEB 4LASH 2DMBA 2IPTL 1RUAH 1UA6H 4LFHG 5IFHH 2K3TA 3O41A 4HFUH 1YY9D 1U92B 3FQWB 1KB5A 3DSFL 3LZFH 4CUCA 4YDVA 4CNIB 3X13A 4HS6B 2NQCA 4WV1C 3JWDC 2JJTC 4G6ML 3VWKC 1J8KA 3W82A 1M6OB 4X6EA 4AT6A 4PJEB 1CGVA 3JWOL 5CHNB 1QFWL 4IMLB 5I1DB 5DHXB 3OJVC 2IMMA 2JJUA 4PJ5E 1MELA 4OF3A 3TV3H 2IF7A 1IRAY 4XNMB 1GCFA 1Z9LA 2VXSH 3MLYH 4APQB 4LLUB 1G9NC 1QBBA 3P9MA 4G3YH 1ED3B 1JWUB 5AWNH 4DWHA 4KKAD 1T3FA 1BP3B 4LVOC 3FMGH 3QUZB 5J4MA 2B2XL 3JTTA 1EEUA 4UU9A 1FAKT 4JB9L 4PJIF 3QXWA 4KJQC 5F1NA 4EJ1C 1NGZA 1SMAA 4U1GB 2YUVA 3RIFK 5C9JB 4YFDB 2NXZD 2D7TL 4OB5H 4ZO6A 1JNNL 4FS0A 4G9FE 3W11D 1KJ3H 2EYTB 3PGDA 4G8GE 3SDAB 2IH3A 1JHKL 1I85A 3F7VB 3GMNA 1KEGL 1U8IB 1T2QL 4UIMA 3Q3GA 4D94A 1MCKA 2RQ8A 3VD9A 3UJTL 3WUZA 1A8JH 4GG6B 1EDQA 2YS4A 2GEEA 4WO4C 3KR3H 4NQXB 4O02H 1NDMA 1U2HA 1MCBA 2UYLA 1PG7H 4HK3N 2X5PA 4YH6A 3DGGA 2Z4QB 2AERT 5JTWA 3HMWH 1QFWI 1Q0XH 3T4YA 5K9JL 1B4JH 1IKFH 4XMPH 1FQ9C 2QSCL 2EDLA 3WIHL 4BKLA 5AG9A 3U2SB 1C08A 3PWJA 4HWEL 2EDJA 2YD1A 4M4PA 4XCFH 1LK3L 5B39B 2Y72A 1ZTXH 1I4FA 5KOVC 1S7RA 4KRPC 4PRDA 4M6OL 2F15A 2XZCH 3NCJH 2QHLA 5FGSA 3RVWC 1F2XK 1RUPL 3AY4C 1QSFB 5DJ0A 4Y4KA 3V6ZA 3HZKA 4MQXC 1MFBH 5HPMB 5IJVB 4C4KO 1CD1A 5EUOE 1PW3A 3DUSA 3ALPA 3CFKB 4LCYA 4L8SC 3BPLB 4Y16B 3RTQA 5FYJH 1V5JA 4M6ML 5DUML 5EA0H 1MOEA 3OG4B 5C0CE 4JJHA 2UZIH 3MNZB 3KPMB 2ILLA 4JLRB 1OTUD 3T77A 1BFOB 1XIWA 3MUJA 3ARUA 4UTBH 5D2NB 4HJ0D 1CGUA 1CU4L 4ZDHA 1KJ2A 2PTTA 1RZKC 2IG2L 3HLAB 4Z77A 4X5WB 3VD5A 3HPLB 4NN5B 1J9CT 2A6KA 2J8UA 4X7DC 1HOCA 3IFLH 1T1ZA 1ZHBA 1CXHA 5I71B 2C3GA 1RUKL 1FIGL 3V79C 4JN1H 3TYFB 5KW9L 2R1WA 3ESUF 2FIRT 4DKAA 1MCSA 3QAZB 4PG2C 2DYPD 3NTCL 3P0VL 5I75C 1PKQE 1XF4A 3O45B 2E8YA 3MCLL 3LQAC 3H2WA 3OJ2C 4GG8B 4CN6A 3RWDB 5KVGL 5GSRA 5F7WC 3UTOA 4C56B 1S5HB 3FTGA 4DKEH 3GRWA 5I15H 1S7VA 3VCLA 2IANE 2HJKB 5LGKA 2W0FB 5CD3A 3O9WA 3T09A 1ZA3B 4FQXC 4FG6C 2YZ8A 1LO0H 3IU4H 2XNAA 5D5MB 4JRYD 1X4ZA 3U9PL 1OARL 3QNXA 3FHQA 1FBIH 4TSCL 4PYHA 1E6OL 1RMFH 3D25A 1SBSH 4R90H 3BIKA 5GGVY 1IEAB 2R4RL 1EJ6A 2IH1B 3MRMB 3BMVA 4EN3D 4IHOA 4ZTPH 1FZJB 4AEHH 1NC2D 3O8XA 1PAMA 2R0WL 4RFEB 1D5BB 2CK0H 4R8WL 1RZJC 4CAGA 5DZOA 15C8L 2XWBA 3VDAA 4O2EB 2Y7QA 3RWHB 4U0RC 1G7MB 1RVFH 2G60H 4F7EA 1EHLH 3TA3D 4HJGB 2VERN 3EO9H 3O2WH 3BDBA 1YEGL 5FCSH 5K59F 3I6GA 4Z0BH 3GB7B 3GMMA 3IFNH 3VI3E 3FJTA 2DL2A 5F71A 2FX9H 3RL1A 2X4TA 2DQUL 3AVEA 4RBPH 2EDXA 2WIIB 1XZ0A 5TFSH 3NABL 1F11A 2RR3A 1J8HB 1NUDA 4HIHA 2XKUA 4KH2A 4LSVL 2XZZA 4I3SL 4M5YH 1NAML 3V6FA 1QYGL 5DZNA 1XGUA 3F8UB 5I6XB 3GHEH 4EI5D 1W8NA 5DQ9A 5HHVH 2D9QB 1UACH 1YN7A 4HKJB 5GGQL 1U8NA 4WWKB 2D03L 3V4VL 1ORSA 3RBGA 3S37L 4QF1A 4RSVA 1RUQL 1T6VN 1OSZA 2KZWA 2AV7A 1LMKA 3WSQH 2VDQL 2HRPH 5TE4H 2ARJQ 3CCHB 2OS7A 3T1FB 2P8LA 4JR9L 1QR1B 5A2JH 4HAGA 3GJEB 4MAYA 2C1PB 3LQZA 1UQSA 3WE6B 4JO1H 4NNYA 3H7BA 3L3DA 4NJ9L 4FZ8H 3QWQB 5FYJD 3ARWA 5EZOL 5I1CL 2VAJA 1QSED 3K2MC 4GXUM 1ZLUK 2KQNA 4KUZL 4LIQL 3ARZA 1YEKL 4WW1B 4NQDA 4LSUL 4HF5H 4FOMA 3CX2A 3O6FD 5SWSB 1T4KA 4WW2B 1XR9B 2E27L 4ACPA 1P7KB 3MBEB 3MPCA 4K7PL 5D1XD 1JNHB 3OSKA 1N26A 3B8SA 5KSBE 1LP9B 5T33L 5FOBB 1KCRL 2JIXA 1DUYB 3I2CH 4K8RH 4GKOA 4K7FA 3VXPA 4D9RE 1XMWA 4JM2D 3RZCD 4AIZA 4FQHB 5DJDB 4GRWE 5F89B 2ICCA 5CIPA 6CGTA 2HTKD 2EO1A 4UTAH 3VI4F 5GS2H 1QHPA 2MPAL 3QCUH 4NPYA 4NO5B 3V95A 3U30B 1S3KL 4MVBC 1MAKA 4U1KA 3GSRB 5HGBB 1ZVSB 2VC2L 3H9YA 1HZHL 4JKMA 3TN0B 4I0PB 2GUOB 3I75B 3TO2A 1EFXB 4U1IA 4JKWA 5C08B 4APQC 5D1ZA 3ARGB 5IB1B 2DQHL 1MI5E 5IGXH 4IOSD 4IBLT 1WAAF 4R26H 4HIIA 4H88L 3U9UA 4N9GB 3QUZC 4ZYKB 3QEHB 2AGJH 4KGLA 1MRFL 3E0GA 1FP5A 3FFCB 3U7YL 4LDEB 3QI9B 2APTA 3UYRL 3TESA 1KXVC 3MV8A 4U1GC 1B0RA 5T1KB 1YNKL 5BCAA 4QHMB 1LDSA 3SPVA 4TNVK 4WUKH 3BD5A 3G9VA 1WQVT 2ED7A 4WEMB 4BQBA 3SDAC 3HE6D 4EKXA 2ICES 4DEPB 2FB4H 3L3HA 1P4IH 1QLFB 4U1SA 4I0KA 4EEEA 4O4YL 2ZJSL 1UCTA 2BVOB 1RJYB 5F96H 3QHZL 3NAAL 3MRCA 3TGXA 1DSFH 2Q8BH 2R1YA 4U33A 2AJVH 3TIDB 3OAZK 1YJDC 4QNPF 3RBSA 2W0LA 5EOQH 2XY1A 3F5WB 3MRGA 5GIRA 2J2ZA 4WI2A 1DL7H 5J3HD 3BMWA 1HXYB 4I77H 4RQQB 4OCXH 4X7TA 1JHTA 1OP9A 4MJ4A 3DX8A 3HNVH 4P23D 4O9HH 5JHDD 1R5WA 1EO8H 3QDJD 4ALAL 2X9XA 2M26A 1AIFB 3FCTB 4M03A 5IMOA 1MF2L 3KPOB 1OD7A 3MCKB 1IAOB 2CH8A 1JE6A 2MCPH 1AHWB 4OLYH 3ILPB 5I1KH 4UDTA 5EORL 1AQKL 4I0CC 4S1RL 5EWIH 3NIFF 1GH7A 2W1NA 4GRLD 5IW1B 1JPTL 3QO0B 3BPLC 1T1XB 4KPHH 4Y16C 4PREA 3G5XB 4L29B 1CGYA 5T3XE 4J3UA 2GCYA 4PJBF 3GIVB 5BZWB 4TULH 4MA7H 1NANH 2GIYA 3THML 3V4UL 1WV7T 3WN5B 1ND0A 5D2NC 5DK3A 5C8JB 5F3HA 5IIEA 4PLKC 3HUJA 3DUHA 3BZFA 2IQAA 4MD4B 1AXSA 3OAUL 4NN5C 3OKMA 3V7AG 5EBMB 2AEPH 2BSRB 3IFPB 5I71C 3FONA 1WWAX 2XZAH 5IQ9A 1EEYB 1RSFA 3QAZC 2KQMA 1WEJH 3QA3B 1A7RH 1T5XB 4NJAH 4U1LB 2MKLC 1DJSA 4R7NA 1UWXH 5KVFL 1HSAA 1IGMH 1EERB 1NCDH 2G9HA 3CJJA 3RFZC 4X6DA 1XGRA 5BRZB 4OFPA 5I1LA 3BWAA 1NLBL 1TZGL 4FQLH 4O2FA 4ZPTA 1O7VA 3GDBA 2HMID 1RULL 2H26B 3KPRE 5A1AA 4KQ3H 1MCRA 3V6OC 1JTPA 1TZIB 4M61A 4ONHA 5DD5H 3EYUH 4HWBA 3B9KB 5DR5H 5ID1B 2A9MH 4UIKL 2Z31A 1FNEA 2N7BA 4Z5RA 4LBEA 1ACYL 4K94L 3WHXA 3SKOA 4XX1E 1IARB 4LLMA 4CL7A 1AGFB 3MJ9A 3U4AA 1AKJA 3DVGB 1FNSH 4N1HB 4OLUH 3RUGB 3RPIA 4HC1A 3BIAX 2LTQB 2YK1H 3MXWH 3U1SL 4BFBD 5ILTH 5DJYB 5HHNB 3HMXH 1MCFA 3C08L 4I9WE 3QUML 4RMWA 2VZ1A 2O5ZL 4PBXA 2VLLB 4E42A 1U8LA 2C3VA 4U1HB 1CYGA 3DHJA 1WT5C 4ESKA 1N2RB 4ZTOL 3U46A 5HHQA 3FT2B 4FQIL 4NKDB 4XHQA 2BOCB 5FYJU 2FR4B 4NNXA 4BK5A 5I19L 2CKBH 5I0ZA 2AJ3B 4QXTA 3R06A 1RI8A 2R2HB 1MFDH 3KPLA 5MEQB 3FO0H 1ZGLP 2H32H 3EDEA 4LGRB 5FCUL 1D5XA 4DVBB 4NKOB 2JB6B 2O93L 1OP5H 2IEPA 2VB5A 4LAJH 3U83A 3MROA 1RHHA 1FVDA 3ARDB 4BK4A 3BKYH 4QRRD 5C0DB 3ZSTA 1DDHA 3VD4A 3VFUA 2LAAA 4TUJA 3EOTL 5C3TA 4PLOB 2FJHB 4F8TA 4KFZC 4X4YB 4WWKC 4BFGA 1S7SA 1UXWA 3H42L 4RFNB 2FO1A 2NR6C 2V5SA 5DHVA 2E3VA 2F5AH 1FL5A 2BSSA 2VRAA 3SOBL 3OXRA 5MP6H 5C2BH 4PJ5A 1H3XA 5E2JA 2DN7A 2HJFB 3MJ7A 2EDOA 1CIDA 2VR5A 2NY5L 3B5TA 5GS1A 4OZGF 4JREB 3IDNA 4XCEB 1AO7E 1WK0A 2PYEA 5F7DA 2JB5L 5MERB 4UINH 3HS0A 3QWRA 1OGTB 2YOCA 4OZHE 3SDCD 1IC1A 1TJHL 4KZEL 5HHOB 1ZLWH 3BPCB 4IOIB 4WW2C 2KDGA 3O6KL 4PJDF 4P5TD 4FFWC 3V0AC 3MBEC 4RGOL 4MNHB 4YAQB 3DYOA 4JFDA 4D9LL 2G5BA 4HKBA 4G9FA 2W07A 3EDKA 3FQRB 2OSLB 2F54D 4G8GA 2H6PB 2CLRB 3V5DA 6FABL 4QWWC 3PF2A 1B90A 1IGFL 3GJFK 1MREH 2WAHA 4LP5A 3TZVA 3C9NA 5DSCB 5E8PB 4AEIH 3MV7E 2I27N 1KLGB 5LAXA 1EEZB 3VFNA 4BZ1H 1Z3GL 3C8HA 2NW2B 3CFBB 1MHEA 5TE6H 3U30C 1MUJA 4JPWH 5DRXA 3X3FL 3EYOB 3WXVH 1JV5B 5LBSH 1X5LA 3VXRA 3DXAB 2I07A 4G8EB 1U8HA 4I0PC 4U1MA 3TN0C 3NZHH 4TVPE 5D2LE 3C5SB 1V3MA 1ZLVH 3ARGC 3MRKA 4Y1AB 4OLXL 3MLXL 3I6KA 4NM4L 4X99A 2Z93A 3UTZB 2V2XA 3TIEB 5E8EB 3HB3D 4JQVC 4Y19E 4X98A 3WMSA 2IQ9H 1NFDA 1G6RL 4FNLH 3VWJD 5FIEA 1KOAA 1X5HA 3GMLA 3EFDH 2GT9B 2R56H 4QXUH 4LEOB 3QI9C 2OK0H 5BJTA 3U0PA 4K07A 1TZHB 4ODHH 2ZOLB 3VXSB 1QRNE 5E0QA 3KPNA 5EUOA 4KK8C 5EIIB 1CDCA 5TDPB 4UT7H 3RVTC 4OBSA 1WWWX 4PP2B 1FFRA 5DURB 1DQMH 4X4ZA 4DEPC 4MJIE 5C0RL 1CT8B 1CL7I 3BKJL 1AJ7H 1A2YA 5C0CA 5CEXB 5I8CB 1I7RB 1M7IA 4YXHH 2BVQA 2DQIL 3CZFB 1HH6A 1KJMA 3O4LD 1WFUA 4R3SA 3KNBB 3ET9F 3MYZA 4NO2B 3BI9X 1B6UA 1A1NA 2VZ3A 4BELD 4PRHB 1MFCH 1EHAA 4JDVB 3UTSB 2QQLH 5E94B 3I84A 4PJEE 1BWWA 1I1YA 3P2TA 4KY1H 5F7UA 2YPVH 5CKGA 3F58L 4XCYA 3VFWB 3WIIL 5E03A 3ZT5A 4E41B 4Q9RH 1RZ8B 2Z92A 3O2VH 2DQDH 3UYOD 1RIUL 1RAMA 1VEOA 3EAKA 1AHWC 4Y4FB 3KWWB 3VRJB 5MEOA 3F7QA 5I9QB 1ETZA 2B8OT 5GGRA 4N90D 2IANA 4WHDA 3IS1X 5DFVC 4G80B 4M1GL 4ODWA 5CFHA 1WITA 5BS0D 3MRPB 3PV6A 4L3CA 1MQ8A 2IALA 2ZP0T 3TWCH 3C60B 4LMQI 1DE4B 4G6AD 4N1CA 1JGLL 2AEQL 2A74A 3CDGB 1ZGLB 5JR1L 4XI5C 3GSNH 2MQCA 3SDYL 5EFIB 3WNMA 3WN5C 4L5FH 3DIFB 1WBXB 4HCRL 2ESVD 4JM2F 1Q9LB 5KVDL 1YY8B 4L9LB 3LKQA 3AS1A 2R0ZL 4GG6E 1D9KD 4HK0A 1CDIA 3HR5B 5CS7A 1IGTA 1SJHA 3IXAB 2ORBH 3FQUB 1Y6NR 3MREA 3RWFB 2J6EL 4Z95H 3V0VB 1JGUH 3TVMC 4EI6A 3ZE2F 2ICWA 1U0QA 2ZUWA 2SEBB 4RAHA 5F7LB 1DQQA 1K9TA 2GYSA 4FABL 4JFED 4OD2A 1MSPA 1Z6JT 5GRYA 5HYEA 2HG5B 1IGCL 1CR9L 3OKDA 2EIEA 2YXFA 1INEL 5C7XH 1H8OA 2RCSL 1H3VA 3B2VL 3EO0A 1J05B 2HVJA 4M00A 2UWEF 1R3KA 1QSFE 3B9KC 4JVWA 4Y8DC 1F58L 2QR0B 3CVHH 2FHBA 3BFOA 4K9EH 4CDHA 1C16A 2HLAB 5IEHA 4OT1L 1J11A 3MRJB 4ZS6C 2XQBH 3JXAA 4EDXB 3DMMA 4ZODA 3MFFA 3LH2L 3TNNA 2YKLL 2LTQC 1EUUA 4KHTL 25C8L 4MQSB 1HHGB 3OZ9L 1Y0LA 5TH2B 5J57B 4OFKA 4CW1B 3GIZL 3QIUD 3N9GH 4ETQB 1XF1A 3IGAB 1BOYA 5DC4B 1FVCB 5EU4A 3RKDC 1VPOL 3OQ3B 3H0TA 1JGVH 1HHKA 4GO6B 4R96B 4U6TA 1G7JA 4MXVF 3P4MB 4Q0XH 4H8WC 1R0AH 3WBDA 1XGPA 3BRFA 3IETB 3PWVB 4GH7B 4DK6A 2KKQA 2BMKA 4RNRA 3EZ8A 4LQFH 3OGCB 2EC9U 1IGYB 4H25B 5CJ5A 2B39A 4ODTL 4F9LA 3FT4B 2PW2A 2QQNL 3WFBH 1NCAL 3TBVB 5L2JB 5KSBA 3H9ZA 1AGCB 3CVIH 3JSSA 4DTGH 4F37F 4BSVA 4C56E 2BVEA 5E1HB 2ZCKH 2NY4B 4DQOH 1RZKH 3ARDC 4M7ZB 1KIPA 4FQJH 3CH8A 4MS8D 3V6OE 3A0OA 4NKQB 4U6XA 4F57H 1A7NH 4NZDA 1A7QH 1NUFA 2DJSA 4RFNC 2YD7A 5D5ME 2WP3T 1JF5A 3FRPA 4ZOAA 4LKCB 2VDRL 3IDXL 3NFNB 1GPOL 4K2UH 3UPRB 3EJYD 4NO0D 4K7PY 4XBEL 1ZT4B 3MXVH 3ARBA 3DROB 3S36H 3INUL 4JREC 3AROA 1VGKA 5F6HJ 4NQVA 4QOKB 4JY5L 2AJSL 3LEXA 3QQ3A 3SQOH 1MI5A 2MOVA 4JFXB 5I1HL 1K8IA 4J4PC 3FQTA 4LFHD 3MLUL 3RY6A 3HFMH 1YC8A 1CGTA 1V3JA 4HS8L 2ICEB 5GSVB 4YHOL 2EZ0D 2VXTL 4M3JA 4M5ZH 1HDMA 4OGAD 1SY6L 5I8EA 1DFBL 4LVEA 4WNQB 2YD9A 4MCYB 3QJFA 1HEZB 5CJ8A 1HE7A 5JUEL 2ZPKL 1L7TH 2WINB 3K8LA 3RVXD 1T0PB 4RAUA 5F8RC 2A2QT 1VKXA 2HWZL 4M9PA 5EUKA 3D5OF 5ICYB 3R1GL 5F7FA 3N85L 3DVNA 3UX9B 1L0XA 3SDXF 3VFTB 1J1OH 1J8HE 1FAIH 2APVA 2VH5H 4W81A 3CFIC 5E2VH 5EH1A 1BBDH 1A7OL 4P4KB 3JWOC 1P84K 3OBAA 3WFEL 3I50L 1JP5A 1PEZA 3QG7H 4DCQA 1BD2A 1I8LC 4RRPG 3TBYB 3U4EB 5GPRA 4KK6D 2EDBA 4WV1A 2IGFH 1AQDA 3EFFA 3MODH 4WY7L 3VWKA 4D9QE 2OCFD 3O81A 3MLRH 2R69L 2Z8WC 1JPGA 3QCVH 3SE9H 1XCQB 4M7KH 1JWSB 5JW5A 2VIRA 2Q7NA 3BHBB 4XP5L 1MHPH 2FCBA 1N5AB 4OTXH 1I1CA 2OL3B 3FRPG 4ELMF 2B0SL 3D1MC 3DURA 1AH1A 3NBNA 2J8OA 4XBPB 5GZNC 1N7MH 2BHYA 2VLKD 2EE2A 4GW5A 3QEQD 1UZ6F 4LEXL 5CKAA 4C83A 4HIXL 4KK9D 4XVUC 1BIIB 2M1KA 3G5ZA 5SWSE 2Z91B 5IMKA 3P3YA 4P3WA 4RAVA 5CP7A 1I7ZB 4JFPB 2XWTA 1WCBA 1MNUL 1LP9E 4WUUB 1GC1H 2F53D 1SBBA 1RFDH 4C4KT 4FQQB 4LF3B 2P5ED 4UT6H 4CMMA 2ENSA 2I9LB 5DD0L 1AI1H 4X4XA 1WISA 3HG1A 1L0YA 3IDJA 2NLJB 3PUCA 3WS3A 5IK3B 1J0IA 5M95B 2DJUA 4AL8H 2Y6SD 2DQCL 3QR2A 5IFHL 2EH8H 3DV6B 3UP1A 2ADJA 3SGKA 2R1XA 3LZFL 3WFHA 1C5BH 1S7QB 1IBGH 4ZFGH 5C08E 1SEQH 2NX5B 4FFYH 5EG6C 4Z7WB 3DHMA 1UH2A 2AK4E 4FFVC 1D5IL 2EYRB 3RWIA 4HHAA 4EDWH 4UV7L 1YUHA 3QXAA 4Y4FC 3V52H 2DI8A 1BGXL 1NC4A 2D9CA 3KPRA 3PGFH 4N0UB 4NBYB 4E0RB 3MLYL 2XWJB 1JZ2A 2F5BH 4HKXB 4I48A 3SCMB 5EZLB 3PL6B 3PV7A 3NCMA 4YHIB 3Q5OA 3N1FC 5A2FA 1Z9SA 2ZG3A 2BX5A 4Y2DB 1I9IL 2AXFA 3FMGL 3C60C 2R9HD 2XTJB 1JTOA 32C2A 1CE6B 2A6DA 1IEHA 4XNXL 5KSAB 2P45B 1Q8MA 3MNWA 1FNGB 4L8BA 1HILB 5I18H 4ODVL 3KLHC 4UUJB 3CUPA 1KT2B 3JTSB 1AR1C 5FHAH 1H0DB 4PJIB 3VDBA 1DQLL 3O0RH 1AC0A 4OB5L 4L9LC 3TLRA 5DMKB 1FFNB 1KJ3L 3GBNL 2QTEA 5DVLA 3J7HA 1DVFA 1JN6B 1VCAA 1T22B 2FECL 4LRNH 2A77H 5C2UB 4X5XB 2NZIA 4X4ME 3T3PE 7FABL 5BW7A 5IB2B 4KKBC 4O02L 4U7MA 4YNYB 2A0LC 1S8DB 5LVEA 2L7JA 1VFBB 4Y4KD 5GS3A 3LKNA 2NNAB 5ACZB 1Q0XL 3NACH 1G7QB 1ORQB 1B4JL 1IKFL 3FO9B 4U2ZA 3EUUA 4GKSB 4OCRH 4X7SH 1H5BB 4YWGL 2GFBA 3EO1B 4JFYB 4XWGL 3RTQD 1H15B 2WSKA 4XPHH 5INCA 2R2BB 1OOAA 3TM6A 3N1PC 5FYLH 2AQ1A 2XZCL 4P5MA 4FQXA 2PO6A 1XIWD 4PIRF 5J9PB 1JWMB 4QGTA 3QUMB 4KVCH 3O3AA 4OQTH 1Q9OA 3T0EB 3WD5L 2FEEL 2EE9A 1QHOA 3AREA 3VMPA 1WGOA 4WFED 4R97B 4ELKA 3GMQA 2CUMA 5ICZA 2P44B 5FYJL 4K3HA 3LKRB 4HX1B 1F4WH 4YPGA 4KJYA 5FA3A 3E2HC 1AO7A 1F3DJ 2Z8VC 4H26A 4XX1G 4NZTL 4U49A 1MJ7H 1TENA 5D7LE 4PJ9B 5CIPH 5MENB 4UTBL 4ZSOB 4UDUA 4OZHA 3CH1A 4YXKH 4XP4L 3L3OA 4Y4HA 5EU5B 3U4BH 4YHML 1NLDL 3PABA 2EC9T 1ZV5A 2GI7A 2LE9A 5GISH 5I17A 3KLAA 3NIDE 4RX4A 3BUTA 3L3IA 5HGDA 4LSRH 4JN1L 5BRZE 4NRXA 3O9WD 3T0XA 3U36B 4I13B 2NY4C 1N59A 4M7ZC 4R9HA 3DYMA 2WWMC 3G6DL 2C3XA 1JYVA 2X4QB 2YR3A 3ZE1E 1Z5LB 2E7BA 5E5RB 1OTSD 4DKEL 3ZHLA 4JGMA 1S9YA 1J1PH 5DK2A 3H6JA 3U7AA 4BSWB 3F7YB 3UJIH 4P59H 3P11L 5GZOD 3GSOA 3O8XD 4JFHD 3EJJX 1CXLA 2FEEI 3RUGE 2VO5A 2X89A 3PDGA 3N06B 2ZUSA 5IB3A 2DQEH 1C12A 5FF6B 5DRZA 3E8UH 1FBIL 1Q0YL 1CXEA 3ZKND 4HV8B 3D0VB 1RMFL 1SBSL 4R90L 5T1MA 4Z7VF 1LNUB 3KPPA 3SEPA 2UY6A 4LVNB 5HHMB 4Y19A 4ZTPL 3M8OL 2B1AH 2EIZB 3MRQA 4AM0B 1I8KB 3GKZA 2J7LA 2CK0L 3RVVD 5I76A 4PJ8D 2BY3A 1I7UA 2P5WB 4GJTB 1ACZA 2X1QA 2G60L 1LD9B 1UWGL 3EO9L 3QH3A 4H1LA 5EPMB 2X4OB 4MJIA 1FO0L 1OAUL 4P4KC 4JO3H 4MB3A 2FX9L 5EOCL 3O4OB 5IP4A 2CDEB 3QUXB 9CGTA 3FQWA 5FYKE 5GGVH 2EDEA 3D48R 4CNIA 1VEMA 2D7NA 1VFMA 3G04A 1I1AA 4MAYD 5DQJA 1A6WH 4PJEA 1KV3A 1JZ5A 1UACL 3MSPA 5IOPA 1TDQA 5IMLA 4TTGA 5F1KC 2JK5B 4NQDD 2K7QA 1YMMB 7CGTA 2J4WH 5CINH 1ED3A 1JWUA 4WIQA 2HRPL 1DEDA 4UBDC 3BEVB 5TF1L 4PJXA 2NTSP 1LE9A 1UH3A 3TH4T 3MGAA 4YDLC 4JY6A 4JO1L 3K2UH 5HHOE 4F7CB 3ALWA 4PGDB 1Z9OA 5DS8B 2JIXD 1Q1JH 1QUNA 5C0EA 5C9JA 3WJJC 3RWEA 3ULVD 1CBVH 5EULV 5F6HI 3PP3K 4ZQKA 3P4NA 2H41A 4I2XB 5FK9A 3S98A 3F7VA 1HYSC 2F74B 2MFNA 3GMOB 1V7NL 2OZ4H 2NZ9C 3SHSA 4HG4K 4OV5B 4GG6A 4NCDA 2X4PB 4H1LG 4GKNB 4CMHB 1A1MA 2Z4QA 2BNQB 4PLJD 4HPOH 2PR4H 1B4RA 2VABB 1YC7A 1S9VB 4BUGA 3DXAE 5GJSH 1RV6X 3ZDYE 5E8DH 3DGCR 4LQ1A 4LLYB 5J11B 4Y1AE 5DXWA 3MR9B 5F7MC 3OR6A 1C5CH 4OGXL 1VGEH 5D8JL 3MV8D 5HGAB 2ENYA 5EU6B 1WBYB 4XAKD 3SCMC 4TPRH 3PL6C 3SE4C 5D6CB 4B5EA 1QSFA 5IJVA 4Y2DC 3DECA 2RFXB 5E9DA 3VXSE 5HY9A 2XTJC 4GKZA 2AGJL 3ARYA 5KSAC 3L6FB 1YEDB 1OAXH 1IAIH 3T8XB 3BH8B 2BDNH 4FFZH 3EYSH 3LPWA 3KAAA 4AEFA 4P4RA 1YECH 5AD0B 3KPMA 4NQCB 1HK6A 3FB5A 4OBRA 3UTQA 5HYFA 1JUFB 2RIKA 1K6QH 4NGHL 2MQ0A 1OB1B 1F4YL 4X6FB 2C4FU 2XA3A 3KPSE 1A6UL 5IWLA 4PRHE 3VXMA 5ALCL 5JZ7C 1A6TB 4P9HH 3UTSE 3IU3B 3PE9A 1DLHB 4FQ2H 5F96L 1J0ZA 4ZFFB 3LY6A 1R3LB 3OR7A 4IS6A 4BFIB 4YHNB 3FZUD 2Q8BL 1D3CA 1TVDA 4CVXA 2AJVL 4XVJL 2CQVA 3LN4B 3NCBB 5EO1B 3ZZ1A 4R4NC 4A6YH 2Z0BA 3QULB 4PBWD 4WRLA 2ZSVA 4IRSB 4M02A 4N0CC 5EOQL 1OAQL 3O45A 4E41E 3CFDB 4M8QB 5T3ZD 4MWFB 1A4JB 4I77L 1H5BC 2JTDA 4OCXL 3HC4H 4Y5XB 3RWDA 3V9FA 3QP3A 5JPMB 1ZWIB 1NFIB 1WTGT 2C26A 3A6OA 4K3JH 5KSVA 1EO8L 4OCSH 5CBAA 1KENH 2ZCHH 4MA1B 1W72B 3IRPX 3LPGA 4OKVB 2XV6B 4PJHA 3TT3H 1OWRM 5I1KL 3GSUB 5D5MA 3VMNA 2GHWB 4JCMA 3QISA 1TLKA 2FEDC 1YQVH 3BW9B 3F6IA 2ZCLH 1DLFH 2FO4B 5CWSA 5D7KD 3T0EC 1EJOH 4M8VA 3IDIB 4PTUA 2JCCF 4OZIE 1RJLA 3IAQA 4R97C 1T0NA 4NHCL 4KPHL 3UTTD 4IOFD 1ES0B 3MRMA 3CDYA 5DWUL 2DDQH 3LAFA 4MNQB 5AUMB 1UEYA 4TULL 4NP4L 2WLYA 5GS0D 2MHAB 4RFEA 4PJ9C 4YXLH 2X4SB 1C8PA 3OPZH 3VE0B 1KN4H 4PJBB 4O2EA 3WNLA 1FL3A 1WT5A 3C5JB 3AXLA 2W65A 1X7QB 1G7MA 2EDKA 2DOCA 1T7VA 2BVTA 3WEXA 4HJGA 4IIQB 3R8BB 4KXZH 2FZ3B 3BOVA 3TNMB 2ZNWA 3N0PB 3TFKD 1OAKH 5E08H 3B9AA 4JANB 1KLFA 3OKYA 4W4OC 3Q0HA 4GAJH 1KN2H 1M71B 4JPIB 2WIIA 2Z31D 4K3DH 1J8HA 5EO9A 1IGML 4P9MH 1EK3A 1CFSA 5CJOH 3LS5L 1AKJD 4P48A 1YNTA 4XNYL 2A6JA 5KZCD 4XC1L 4N5UA 1OCWL 2NY5C 1MHCB 3HI6H 4HKJA 2HFEB 1LE5A 5DD5L 3TF7C 1MFAH 2GK0A 5DR5L 4U31A 1WICA 4HQQH 4NOBA 2VISB 1GXEA 1CICB 1BEYH 4Z7QE 4OF7A 2FGZA 1CDJA 1TVHB 3CCHA 3VMOA 4DKFH 2YMXL 4OLZH 2R2EA 1R6VA 3GBLA 5HYQB 3GJEA 3TH3T 2NXZB 5FO9A 3MO1B 4OLUL 1NANI 1DBKL 3D0LA 1H3PL 3QNZA 4LVNC 3MUZ1 4V1DB 3HMXL 1FIEA 5FKPA 43C9A 4M4RA 4WW1A 3K1DA 1VFAB 1U6AL 3CD4A 1KPRA 4WU5B 4Z78B 2VLJA 1KNOA 5CGYC 4PRIA 3K81A 5BO1L 3P0YH 2G2RA 2PUQT 4WW2A 5EBLA 5EIQA 1LDPL 1NBZB 3BO8A 3OF6A 1UM4H 4OIBA 5DFTA 2HKHL 1JNHA 2CRYA 5DZLA 1LP9A 2BRRL 1U8QB 1MFDL 4P0DA 4QCIB 3FO0L 2IBBA 3SQBA 3D2UD 4Z76A 3O4OC 4KRMB 4F7MA 3QUXC 3DLQR 1ZEAL 3CU7A 1BX2B 3MGOB 4PG9A 4H8WH 5DLML 4FQHA 5DJDA 5JW4R 2X1OA 3I3DA 4PJ5D 5F89A 5D6DC 4AZ8A 1N5YH 5JLZB 3I6LE 5DJXB 1IFHH 3FN0H 4I3GA 4JY4B 5M7QA 1DEEB 1GZPB 3CXDL 2DMKA 3BKYL 4NO5A 1IEBB 4GBXB 2D0HA 3QHTC 4NN7B 1UCBH 3GSRA 4GLRH 2NY3D 4ORGB 2J8UF 3B8YA 4XXDA 3RU8L 2GUOA 3QWRD 1EFXA 5C08A 3RX5A 3MRRB 3P9LB 5E6IA <