4JY4A

Crystal structure of human fab pgt121, a broadly reactive and potent hiv-1 neutralizing antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
DISVAPGETARISCGEKSLGSRAVQWYQHRAGQAPSLIIYNNQDRPSGIPERFSGSPDSPFGTTATLTITSVEAGDEADYYCHIWDSRVPTKWVFGGGTTLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broadly neutralizing antibody PGT121 allosterically modulates CD4 binding via recognition of the HIV-1 gp120 V3 base and multiple surrounding glycans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PGT121 heavy chain
total genus 45
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jy4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jy4A01
3JUZA 1KV3A 1ZSDA 4L9LA 5KSBF 1K4CA 3MBEA 3PGDB 5IJKC 4K2UL 2A9ML 4TSCH 3OZ9H 2NPLX 1B6DA 4GKNB 1JFQL 1MI5B 1XFPA 4KDVA 4PJHE 4QT5A 1EK3A 4HD9A 4N8VA 4OFVA 4WY7H 2IG2L 1DSFH 1WAAF 4BSVA 1VGEH 3BN3B 4PRHA 3MRQB 2BNRB 3VDBA 3HAEG 3BJLA 1MI5D 4XI5D 5GRVK 3D0LA 1MH5A 4FNLL 5CAYB 2OCFD 3RWIA 1H5BA 1S8DB 3HI1B 4J4PC 1WFTA 1PYWB 2ZJSL 2GAZB 5CP7A 5TPWH 4WU7B 5E9DB 4PJCE 1TJGL 2FX9L 2OBGA 3NCYS 4MD5B 4NKMB 3NACH 4D0CB 3G5XA 2N1KA 5ILTH 3GB7A 5HI5D 5MERB 1QSZA 4P5TA 1RJZA 3L3HA 1S7WB 3RGVD 2WBJB 4JPKH 1EVTC 1VA9A 3U0WH 4OLZH 3HI5H 4NHUA 1CGTA 2PO6A 5GS0C 1YPZF 4U6XA 1W8OA 2GT9A 3AMKA 1AE6H 5E5UB 3B3IA 1FZOB 1KYOJ 2CK0H 4JREC 3RWHB 3SBWC 2HFFB 1LEIA 3VA2C 4K94H 1KN4H 2AJXH 5TFSL 1IEAA 3WL9A 1V3LA 1P4LA 1EGJH 2GITB 3MRFA 4WUUA 2ESVB 3IDJB 3DVNB 3SY0A 2XV6B 2DI8A 2X41A 2DICA 1Q72L 2DWEA 4PRBA 3ARFD 5D6DC 1P5VA 1TPXC 1KT2A 1ZLUK 4OCWH 3LPFA 4D9LH 3AY4C 5DK0A 4A6YL 5LBSH 3K0WA 4MAYA 2X1XR 3UTOA 2BVOA 4LGRB 1Q9LA 1A22B 3AREB 3Q0HA 3C8KA 3S35L 4Y4FC 2ATPB 1HIMH 2EICA 4NQSA 2VB5A 1V3JA 3LDBC 4JQXC 3D0LB 3BDYH 4MXQC 1TFHA 3FONB 2D9CA 3E3QE 4CMHC 3QIUB 4PD4J 5BQ7B 4K07A 5DWUH 1T1YB 25C8H 3MCLH 4GW5B 4NC1E 1OP5K 5IR1B 1B3JA 3D39B 5DK2A 3ZE2E 1UWGL 1MCLA 1I7TA 1ZT7B 3NCJH 4EDWL 2CJUL 3TNMA 1PAMA 3CFEA 3X14A 2AV7B 5IBLC 1NGWB 1HDMB 2VJXA 3QEUA 3DV4A 1BBJB 3VRIB 4WY7L 4IS6B 5H35B 3OWEA 3ULVL 5JORA 4OGYH 1S7WA 4XCEA 3BUTA 3VH8G 1SY6H 3DGGB 4JQIL 4PJIF 1NDMA 3VGGA 5J6HA 1VESA 1WCQA 1RHFA 3PP3K 5D93C 1E4KA 5CMAA 4OAWB 1E4JA 4N5UA 5D1XC 3FFDB 1F02I 1G7HA 4O02H 5KZCD 3NABL 4P9ML 1DANT 2H2SC 5GXBB 1CFSA 3GSVB 3V9FA 2D7TL 2XTJD 4FQCH 3GSOA 4R4FL 3V6OC 3VG9C 3QFJA 3RVTD 2CRZA 2H8PB 4XXCA 5IVXE 3F8UB 1RK0A 1WIPA 2YHGA 1J8HA 1DVFA 3FN0H 3C6LC 4JO2H 1YEGH 3INUH 3CVHB 4IRSA 1U58A 3O2VH 4GBXB 3ARFA 4H26A 4PGDB 1CK0L 1QHOA 1D9KB 1I1FA 5C0AB 1U2CA 3TH3T 3C5ZC 4NWUL 5HGGS 4MXQD 5DVMA 1KTLA 1OAYL 3MRPB 3RVWC 4RQQA 3TBVA 4NKDB 1AHWB 2FATH 5ICXB 4LARL 4HJ0C 1WK0A 3HR5A 3MROA 1KCUL 2VABA 4OTXH 1CR9H 4J3WA 4Y1AD 2QADD 5CIPA 5F1KC 1PDKA 1I7TB 4LCWB 1QPPA 1F58H 2G5RA 3BEWA 5J13C 1CG9B 4DQOL 5C86A 1LNUB 3DV4B 3V5KB 3UTSE 2P8MB 4JKLA 4F8QA 2UY6A 3TO4C 2QLVB 1KJ3L 3S35H 3S34L 2JE8A 5ILTL 3LN9A 4NSKA 1T20A 4P2RE 1YNLH 4IDJL 5C0DB 3IXTA 4QHLB 2EXYD 3O11A 3P73B 4S0TD 3CDGA 5FYJU 3SHSA 3FAXA 5IM7B 3OBAA 3EYFA 3THML 1G7PA 3LQAH 1FYHB 4ELMF 3CLEL 3GMPB 3MJ7B 3VFGH 5JQ6L 3ZKMD 1OHQA 3MRDA 1S7SB 4HS6B 3RWCB 3RWJA 2VDOL 3MODL 4P3CH 4BELD 3V0VA 1TVHB 2IANE 1BIHA 3GZKA 4GRWE 3G04B 1JNHA 3FQWA 3K8MA 3PV7A 1T83C 2CMRH 2VLKE 5CJ8A 3LRSA 3SDDC 4W4OC 4OI8A 2JB5H 2FL5B 5FM5M 5A2LH 4I18B 4XAKD 1FNLA 4MXVF 4LLQA 4EOWH 5FXCH 1BP3B 4BUGA 1FJ1B 2X4RA 4GKZA 1Q94A 2AJVH 2IADA 1JWSB 3CXDL 4AL8L 4PRPB 2CLVB 5I1JL 1M7IB 1OY3B 4MMZC 4EI5A 2AXFA 1S7XB 3MNWB 3WIIL 4RIRA 4HLZH 2W9DH 3BH8B 2ZUTA 5CIPB 1FVCB 3UJTL 2A0LD 4LU5L 1U8NA 4PGEB 4X0KA 4OLEA 2PUQT 4LRIA 1CG9A 2EDFA 3NPSC 5DJ8B 4JGUA 2W65B 5I1IL 5MP6L 3RKDC 4YC2C 1EHLL 2D31A 4F7PB 1NUNB 5EU5A 1JV5B 4MJ6B 3CSYA 4WI2A 5DQJA 1MCEA 1RUAH 2K7QA 1P7HL 4LVEA 4DKAA 3GSNA 3V4UL 1TJGH 4MDJB 3DRTA 5KOVC 1N4XL 1OGTA 2NY6C 4UUJA 1Q9WA 5L7XH 1RJYA 4JE4B 4WHDA 4WW1B 3EOAA 3GJFH 4G8FB 5FAAA 2CUIA 2Z35A 4XXCC 1T66D 4J6RL 4QHMB 2NZIA 1EXUB 4ENED 4N0YH 3C8HA 3OAYK 4MWFA 4MS8C 2O5XL 2EDOA 1A6WL 1BREA 2QSTA 5DJ0B 2AERT 3V6OE 4H0IA 4LSUH 4M8VA 4PJ7B 1YMMB 3T3PE 3UTPE 2HN7A 4KROB 3QAZB 1A3LH 3PNWA 4PUBH 1DUZA 1MCQA 4I13B 4UDUB 3TA3C 3SGJC 4QRTB 5A2FA 5EU4B 5GRUH 2ORBH 2L4OA 1SJXA 1CXIA 1A7QL 2LFGA 1G6RB 4ORGB 4TRPH 4F3FB 8CGTA 1HSBB 3VXUD 3HB3C 3HC3H 4U1LA 1TJHL 2OS7A 4PRPA 2CLZA 1P9MA 1WVZA 3GI8H 4FMKA 5CCKH 1MF2L 5EBWA 4ONHB 1ZLWK 4MCZB 1IQDB 1AO7A 4Z7UE 5MENB 4XTRD 1WITA 1BECA 4U1IB 2NY3B 2A73A 1KBGL 3FO1B 2PW1B 3G5YA 5D2NB 2CGRL 1NL0L 2B4CL 1G9NH 1HCFX 1JPSL 3GSUB 4U3XA 2ICEB 3VG9B 4JO2L 1E28A 5JOPD 4KHXH 4XZUB 4R8WL 3DI3B 1MFNA 4NO0B 4HLZG 5AZEL 3MRRB 1BJ1J 3RY5A 1UJ3C 1CFNA 2OMBA 3ESVF 4UI2A 4GRLC 4L5FH 4DKDC 5KVDL 4M1DH 4LSTH 4JHAL 3RVXC 1FO0H 2DM7A 1TZIB 4O5LL 3DUHA 1A02N 2Q76A 3VH8B 3V52H 5DT1L 4HG4J 4R26L 1ZVHA 5JDJA 4G8FA 1U8IB 4I0PA 5IB5B 1G7LB 1PZ5A 4GO6B 1BQLL 4J4PA 2ITCA 5F6HI 3TFKC 3KPRD 1S9WB 3QUMB 1XCQA 4KVNL 3RTQB 4UDTA 5IMMB 5DC0A 1QQDB 4PJ7E 4CW1A 5GRJH 2FHFA 2HT3D 2XWJA 3I3DA 2NY2D 2VR9A 1RULL 5JMRA 1V3MA 2VTFA 5HHQB 4APQD 3S8WA 5E1AB 4K7PX 3BW9A 3RX7A 1B2WL 4XHJD 5L9DL 5F9WB 1IZJA 4JFOA 2EDTA 1ZLWH 2YC1B 1AY1L 3IKCA 1DFBL 4H1LG 3K1KC 4NZUH 1J1XL 3E2HC 3TF7C 5I15L 2CDGA 3V4VH 5KVMC 1FNFA 5JOFB 1F4WH 4Z0BH 2VITA 2HMID 3ILPB 4CADA 2CIKA 3F7PC 1OLLA 3MJ8B 4X80L 5FCUL 3MRKB 3IJYA 1BBDL 3O81A 3X12A 3O4LB 4PJBF 4JHWL 4F7MA 3DX9A 3I85A 1T21A 5DD6B 4Q9RH 1C08A 3EFDH 2EIBA 3KPSB 4A6YB 4F8TA 3T4AB 4NJAH 4XP4L 5D2LF 1XIWC 1FL3B 2EIZA 3QFJE 3SE4A 4MB3A 3VWJD 2MWCA 3S9DB 5CJXC 3WUZA 3UTZB 4UNVA 5EZJB 1I7ZB 5HVHB 2BY0A 5FYJD 3KJ6L 3H7LA 1MJUH 3QQ3B 1XH3B 2GW5A 4MAYB 2NY6B 1R5IB 1UENA 3WIIH 5DRXB 4IDJH 3MUGA 4HCRH 4OGXL 4YFEA 2VXSH 1MLCA 3LN5A 5B3JE 3T0AA 1IC7L 3QUZD 3T0ED 4YUEL 5LVEA 4XCYB 3VFUA 1TENA 1QRNE 2H26A 3QCUL 1F6FB 1TIUA 5EG6C 1MCCA 2VZUA 4YHNA 2ADIB 5E1AA 4QCIA 4Y5YC 3G6JB 4FZEH 1PD6A 4LVNC 3KPRE 2YD5A 4MQSB 5HDBE 2YSSB 1NCCL 1Y6KR 2MTPA 3AU1A 2LU7A 1ZLVK 2XZCL 2NLJA 3G6AB 1F4AA 3LKQB 1FZMB 3CDCA 4Y16C 3DYPA 3IKCB 4JB9L 5CD5C 2WLYA 3TNNB 2HFTA 2G5BB 1LQSR 2VLRD 5F72S 3TO4D 4PTUA 4JKKA 3CSGA 1D5XA 5E5MA 5GPRA 3TZVB 5ESQB 5EOTB 2W38A 3DVGA 2XPGA 2NXYD 4L4TE 4JFDB 4LSVL 4M93B 5T5FH 2DQUL 4BK5A 4PP2B 2I9TB 2ZUQB 3PQYB 4LSSH 4PJBE 2G2RB 5JO5B 3DX8A 2XRAL 2Y5TB 4NNPL 3BQUD 3RWEA 4X7CC 4OZGA 4PJXF 3GSOB 2VYRE 3C2AH 1HHIA 1SBSL 5KW9H 4LPUA 4M48L 4M00A 4M6MH 4LSQL 3T77A 5FDWA 2OYPA 2IGFL 4B5EA 5EZJA 1E4XL 2FYYA 5DJDB 1Q0XH 4N0FB 4MJ4A 3LKPB 1JWUB 1ZHLA 2AW2A 1OGAB 1A14H 4QXGH 1MAKA 3VXME 3HG1E 4LKXA 5DFWH 2Q87A 5IMOA 1IGML 2ENYA 5E6YA 3TJEL 5E8EB 5AD0B 1DQJB 4O2EB 3V4PH 4E41A 1RZKC 5T1DL 4PREA 4YAQB 3WMSA 2OI9C 3LH2L 3RVTC 1YDPB 1MCDA 5KANG 2A77H 2Y07L 4Y5XB 4WU5A 2YD7A 3L6FB 4R4NC 4XP1H 4YDIL 4HQQL 3BWUC 3IKKA 2BNQA 1OCWL 5DA0B 5I1GH 5EOQH 5GZOC 2Y7QA 4ALAL 1N6QH 1EAPA 4U0QB 1W0WA 1TCRA 3Q2CA 5TDPA 3QUXB 4GG6A 4JN1L 25C8L 1RHHB 5BCAA 4JPKL 3O11B 5KVEH 4P2OA 3JWOL 4YDJB 4OCYL 1HXYB 4XMKL 4WI5A 4X9BA 5J3HC 3UDWC 2ZOLB 1CTOA 1CWVA 1K4CB 2NY4D 1TJHH 1C5DA 4IDLA 3ZL4L 2Z4QA 1NLDL 3MXWH 3O6LH 2FEEL 3M8OL 3S3JA 3L3GB 2P5EA 4LHUG 4XPAH 2BC4A 3FT3B 4BFIB 3RU8H 3MV9A 3HE7A 4MGXA 3BISA 4P5TC 5K9OB 2FZ3B 4FFWD 5GS0H 4YXLL 4PBVC 1YN7B 2OTWA 4NNYB 4KZDL 1OGAA 1RUMH 3O8XB 1NGPL 2CUMA 4GXUM 4LAQL 4QRPA 4U4BA 4X6DE 2UWEF 3W5MA 5E8EA 3NPZB 1WZMA 4IRJB 4FQLH 3EYUH 4D0CA 2F54D 3DHMA 3H9SA 3LD8C 1FJ1A 4JG1H 4K7PL 4LRIC 3N1MC 3FB6B 2UYLA 2DLIA 5D7LA 3WXWH 1LO4H 5CBEA 4MJIB 1A0QL 1HEZB 2OM5A 3V52L 1BEYL 3O2VL 2NW3A 2XY1A 3L5XL 3PL6D 1M7DB 1DBJL 1UH2A 2HVKB 4N0UE 5K9KB 1JMZA 3M1BB 4OD2A 3ARQA 2QR0B 4KI5C 1U9KA 1GXEA 1V7MH 4NQXA 4PJEA 3EBAA 4QYOA 3CFJA 5D7IB 3TLRA 1FV1A 5K9JH 1BIIA 1VHPA 2HFFA 3Q48A 1KJ2A 2XKSA 3MLWL 3T4YA 4IRJD 5LBSL 1JK8A 1DR9A 4FZ8H 1JN6B 1W2KT 2FATL 2HT3C 1ZA6B 2LE9A 1MHEB 4MDIB 3FOLA 4PJGF 3HUJF 4UT9L 5IGXH 1CXEA 5DEGA 2VLKA 1FC1A 3FAWA 3VJ6B 4IMLB 4XWGL 4HK3N 3D69B 1UKSA 2DWEB 4J3TA 4X7EC 4KVCL 4P59L 4ODTL 1ZEAH 3BYTA 3KWWA 1C16A 1H8OA 5M94B 1FH5L 3F58L 3OJ2C 3HNSH 1YQ2A 1U92B 3QJHB 2GSIB 3HC4H 1N6QL 3CXHJ 5T3XD 1RZKH 4CL7A 5IBUG 2E6QA 3RIFF 3WFDH 4Z76B 5C0CD 1QR1A 3ALPA 4M5ZH 3QIUA 1NEZB 1DLHB 4BFGA 3UAJC 5F7DA 1BJ1H 4NQED 5DK3A 4N5ED 1AGFB 3QUXD 5IESH 4UT6L 1MRDH 1INDL 5F88A 4P5TB 4DOHB 4JKWA 1P69B 4HUWA 5FEBA 2AKRA 2PYED 3C5ZB 4TUOB 2BRRH 3GKZA 4X5WA 1RQ5A 4OBRA 3FKUS 4DK3A 5ALCL 4P9MH 1BZ7A 3BHBA 1OVZA 5FKAB 1JNJA 5KAQF 1HQRA 1VPOL 1RIHH 5L88L 4P23A 5IHBA 3OKNB 5F96H 2LU4A 3W39A 3AB0B 4NNPH 3TCXA 5BS0B 1DEEA 5CLTA 4X7SL 5I1DA 4YHKH 1U41A 2Z8VC 1OP3K 5ICYB 2YOCA 1P1ZB 1XGQB 5T1KB 2Y07H 3WLWC 2O61B 5J89A 3O9WB 4WUUB 5ECJE 3PDGA 3R1GL 4OLYH 4G8IB 1L7IH 2ICEA 1XR8B 3V6OA 3MCLL 4TQEL 2G9HB 3T2PA 1KLUA 3MRRA 3W0WD 4LPXA 5J13B 2ZCKH 4ETYA 3ARFC 2YS4A 1AI1H 5MHSD 4QRUA 3LS5H 3I6GB 1EJOL 4RMTA 5DJAA 2XZAH 1FHGA 2PR4L 4J8RB 4N8VG 2C4XA 1ZK9A 5IK3A 1SYVB 1WBXA 3EYQD 1QBMH 1S9WA 4PJ8B 3NFSL 1BD2E 4LRNH 4AEIL 4HHAB 4HUKB 4AG4L 2ZZUT 3MLTB 4H20H 1F6AA 1AHWA 3MV7B 4KAQH 3DURA 1GC1C 4LOUD 3VFPA 4OD1H 4PRIE 4NC0B 1A7BA 1MFAL 1UACH 3TNMB 3LQAC 3NGBC 2FR4B 1TETL 4JRYB 1RI8A 2ICES 3KDMB 2XN9D 1KJVA 4UT7H 1UB6A 3LB6C 3ZDYF 1BZ7B 3BHBB 1SYSA 1MJ8L 1KEGH 4L1HA 3DLQR 4G7VH 5F9JA 4QY8B 4KJQC 3O2DL 1A7OH 5DJZA 2B1AL 2A74B 2WQ8A 3MCKA 4MB4A 2CIKB 3NIGE 4OKVB 3TT1H 4Q6YA 1XF4B 2DD8H 5SWSA 2NY7H 4NRXA 4JQXA 1YEKH 5L0QC 4L8CA 5TE6L 3WLBB 3BXNB 5HHOB 1E6JL 3JUYA 4KI5E 5GS0L 3KS0J 3T08A 4NFBA 3V95A 3UPCA 3OJVC 1DVFB 1VERA 4RWYH 3ARWA 3QHZH 3IU4H 2X9XA 3RUGB 3VXMA 1MFBL 2R2BB 1PX4A 2X7LA 2FX8L 4X8JA 3RZCC 4WI9A 1MLBB 2ADJA 4WENB 5J11C 1BJ8A 2OQJA 3O3BB 3RNQA 2QV2A 2BDNL 3QNZA 1NQBA 4Z7OF 1I9RL 4HUNB 5DRNB 1AXIB 4FQXB 3H9HB 4NNXA 5DRXA 4GQ9H 4JY4B 3BIAX 3QDJD 4ZSOE 4ZS6C 4EXPX 1QSED 1Q94B 5HPMA 3LMJH 1JWSA 2XNAB 3K46A 3ZMRA 4ZFFB 5SWZB 2H26B 3P4LA 1XF5A 5AYUH 5SWSD 3RI5K 3QEGL 3BO8A 5JW3H 4O5LH 4APQC 5DD5L 1RURH 2ESVE 5F3BB 4PJAA 5DMKB 2AAVA 1DDHB 2NY2C 4FQIL 1ZMYA 5DHVB 5D7JC 4PB0L 2AJYL 1SQ2N 1UWXK 2EYRA 2DBLL 2NXZD 3E8UL 4YGVA 12E8L 4DKFL 4PRID 3T1FB 4CVZA 5C0ND 4UIKH 4KZDH 5FUOH 4JREB 1FPTH 3FB7A 3VU2A 2E6JA 4UBDD 3AS3A 5D2LA 1IEBA 3DO3A 4ZUVB 1FCCA 2FBJL 3REVB 3CD4A 3HPLB 4K8RH 3VXRB 4S1QL 5HHOA 4XP9H 1H3VA 4DUXA 3PIQB 4HFWB 3UBXG 1RK1A 4BK4A 4U1GC 1NMBH 5ETUA 3QWOB 4R2GB 4JY5L 3H9SE 4XC3H 4ELMB 1T83A 3D3VA 4HC1H 1S5IL 4KJYA 4Z78B 5I8KH 5CZVH 2J88H 4MVBD 3QRFM 1F42A 2Y36H 2PXYB 1N59B 1VCAA 2EDDA 4Z5RB 5FYKL 1MIEL 2C9AA 5EOCH 5A2IH 1HHGB 3V6ZB 2C3VA 1JE6A 3PNWB 3UAJD 3KYOA 1BF8A 5FIEA 1T5WA 2HH0H 4KUZH 1RAMA 2I27N 3WXVH 3SKNB 3QXVA 5FM8A 3HZVB 5IB1B 4KUCD 3OKKB 4DEPC 4LFHG 2CH8A 2Z93A 4MA8L 4Y19A 5DZNA 2DQEH 1NCWH 1KB5L 4M4RA 4OCWL 5C07B 4EI5D 1MFBH 1QD0A 4NO5A 2FRGP 5DMKA 3OB0H 1P4IH 3FO1A 4JFFB 3SO3B 1MWAB 5LG1A 1FFNB 2I60H 4Z77B 2NXZC 5EU5B 5HDQH 4MJ6A 2BSRB 5B3JF 4F15C 4LLDA 3TCLB 3CX5J 1E28B 1JFQH 4GW4A 1N0XL 3GSNB 4TN9A 1AFVH 4PGBB 1HH6A 1X7QA 3IAPA 1VGKA 4X6DB 1RUQH 3FQNB 2HRPH 5IFJA 3C60C 3ECBA 3HG1A 3BMWA 1HYSC 2DQTL 2NX5A 5I74C 3G08B 1JZ4A 1CE6A 2Q7YB 3MLZH 4APQB 3NIDF 3NFSH 3PF2A 1EUTA 3DIFA 2B5IC 2CKNA 4KGLA 3ULUL 3MOBL 3OKMA 1XGTB 4KKCC 2X10A 4LCIH 4RAUB 4LPVA 5FYLH 5L0QB 5CBAB 4ZUTB 2APVA 2CPCA 3NACL 3QIWA 3D6GA 4KJYB 5FA3B 4OCMC 1QFHA 4K3EL 5HI3C 4QTIH 2HFGH 3OKLB 1NCAH 3QO0B 1F45A 3I6KB 2UZYB 2C3XA 5I66A 1T3FB 2EC9U 2NX5E 4XBEL 4NBZB 1A7RH 3RY4A 3K8LA 3WS6A 1F00I 3RZCB 1KTKE 5HYIA 1TVBB 1JZ3A 4RCAA 4LLVA 2MQ0A 3SOBL 4NOBA 3S4SB 2EDBA 1DLFL 4Z7QE 4UU9A 5I18L 3B9KA 4PY7B 2VXSL 1DL7H 2BCKA 4NYLA 3MMEA 3PP4L 5KOMC 2YUWA 5CBEB 4HIIB 1S7QA 2KKQA 2NY0B 5D7LE 5D2NA 4ZNEE 3A6CH 2R1YB 1DBBL 2R0KH 3DBXA 1IILE 4FHBD 4WI3A 3MJ8A 1CLYH 3GK8L 1S7TA 4GRMB 4XZUA 4PJ5E 3KPRA 4G8GB 4ZAKA 3DSNA 4HPYL 3L3JB 4KMTL 4H0HB 4HIEA 4P0DA 3TVMA 3ZKNC 3MJ9L 4HW6A 2F9BT 4Y4HC 3QUZB 3T0EB 1Z3GH 1OT1A 2V2TA 2H32A 3HUJE 2OJZH 5H2BA 3PHQA 4RZCA 2LVCA 3VJ6A 1K3ZA 1U93A 5DRWB 4XH2B 3MJ6A 1AGBA 2NNAB 1KNOB 4HUXA 1JMXA 2X89A 3CK0H 2QSVA 1DQLH 2Q6WA 3BDBA 5LKNA 2R0LL 5T3ZL 4LGPB 3OGCA 4J3VA 1UM6H 3D18B 5ANME 4YBQC 3C60A 4LMQI 4ZODA 5HHOE 3I75A 4Z76A 1MHHB 1HOCB 3TA3B 4W4OA 3FL7A 2XZQH 2OJEA 3P77A 4F7CB 4KV5E 3CDFA 4LGSB 5TE4L 4U1JA 4YXHH 5GS2H 1IGIH 5E56A 3ES6B 4LLVB 1V05A 1UJTA 3WE6B 4WCYL 3ZKQD 3GDBA 4NN6C 2DQIH 4LCIL 4HGMA 2PW2A 2D7TH 3B9KD 4FQCL 2VITB 3PWPA 4WW2C 2OR9H 3TH4T 5CJQL 3TPUA 4K7FA 1RV6X 4POUB 1WZLA 3AXLB 1T2JA 4UQ2B 1NAKL 1I9IL 5E8PB 5KVFL 1SEQH 1MHCA 2PO6B 4YFDB 1JHKH 1VEPA 2VC2H 1D5IH 5HHPA 5FYJE 3U0PB 3QG6B 2NXYC 1R0AH 1T1XA 2A2QT 2YZ1A 1A3QA 4JFZH 1ZHNB 2WIIA 4NQTA 1B0RA 4M9OA 4I9WD 1CI5A 1FN4A 2XQBL 2CJUH 1MCBA 4C83A 3PXJA 2D0GA 3T77B 4ODSL 3FO9A 4JVUA 4MD4B 1RUKH 2XKUA 3V5DA 4AY0A 3BPLC 4JFQA 5DHVH 4UAOC 3QI9C 5DJDA 1F11B 4G7YH 1B4RA 3OKOA 1BPVA 1JWUA 5KTEH 3KYNA 3I6GA 2R0ZH 2VIRA 4Y4HD 4RDQG 1KPVB 3LEYL 2M26A 2M8XA 1Z9MA 3SDDD 3NPSB 2HVJB 3MV8B 1YEIH 5A43C 3UMTA 4XP1L 4YDIH 4WWKB 4JFFE 1MY5A 2XACC 4NQSB 2IAMD 1UKTA 2RFXB 2VL5B 3UYOD 5FOBB 3P0YH 2DMCA 2X44D 4Y4KA 2F54E 4GBXC 1OD7A 4K23L 3OKEA 1FZMA 3L6FA 3NBNA 1AO7E 3INUL 4D9QD 2ILLA 3ZYOA 3RUGE 1BOYA 3QULB 2E7HA 3CCHB 5F89B 2G5BA 2QQQA 3KYKL 3N9GH 4QKXB 3MZGB 1IL1B 3N06B 5DMGD 1RZGA 3TZVA 3C6SA 4YE4H 2AABH 4ZSOB 5J0BA 5E6ID 3MOQA 2KH2B 4HBCL 5JLZA 1K4DB 2CKBA 1FNAA 3NTCH 4NQCB 3B3IB 3KPOA 4FFVD 2BJMH 2V5SA 4QRSA 5FYLD 4JO1H 2NYYC 3L3DB 4CMMB 4P2RA 2Q8AL 3W11C 4ZTPH 1GSMA 4PGCA 3TBTB 1QVOB 2HG5A 1OARL 2BRRL 2A77L 3IS1X 4MQXD 1BQHG 1FBIL 1WWCA 3L9RB 3FTGA 4GRLA 2QADC 4Z7WA 3B9VA 1YPZB 4LLWA 5DS8B 4LAQH 4HPYH 4X4XA 4C56A 4OM0H 3DWTA 2P44B 2YBRB 4HJ0D 3O8XC 5JHDA 1S8DA 3HI1A 4OV5B 2ZUSA 1YN6A 2NR6C 4XHJC 2BNRE 3CFIC 5E9DA 3CFDA 1NAKH 4ZTOL 4MNQA 3QFDA 3PP4H 1FL6B 3HNTH 5C0CE 5CSZB 4HMEA 1RZJL 4WFHD 1BWWA 3HNSL 3TO4B 1GOFA 4JRYD 3QEHA 5C0BA 5BQ7A 1J5OL 1NDGB 1GGIL 1M6OA 4JJ5B 4JFZL 2XXMB 4NQEE 5HI5C 1LEKA 1GH7A 1K8IA 4HH9A 4OF0A 3DXAB 4WUKL 4F58L 5CGYC 5I0DA 3ARGC 2I9LA 3I3BA 4OKDA 2X1WL 3R8QA 3BQUB 4DKEH 3FO2A 4F80A 5JNYA 4Z0XA 1E4XI 4OD2B 4EIGB 1RD6A 1DDHA 1WTLA 3ZT7A 3ALXA 5EFIB 1FV1B 4UNTA 4ZO8A 5ITBH 1NDMB 5DUBA 2R56H 4S1SH 2CKBH 2L7UA 2APBA 4WCYH 4OFKA 2OTUA 4B41A 1L7TH 3ZE0E 2EDNA 4PLJC 4PRBB 4JDZB 1BM3L 1T20B 2L7JA 3IRZA 3KPOB 4V2CB 4KH2A 1IEBB 3VI3F 5D7LD 4J1UA 3JWDL 1JIBA 4PGCB 1A3LL 1EEQA 5C0FB 2BFVH 1S7RA 3MRCA 4LLUB 4NRZB 3KXFB 4OB5L 2FD6H 2DQJL 2JJSC 3QIWC 1DE4A 4M9PA 2EH8L 3VXSA 2AJUH 2C26A 1U92A 3QJHA 5L2KB 1KTDA 1K3IA 4GAYA 4ZOEA 1EHAA 4F7TA 3EZ8A 4ZD3L 5HI4D 5IR1A 3AS0A 3WIHL 1BFVL 3OPZL 2XQBH 3QUYC 1VB9A 4UMGA 5C70A 2FECI 3C9NA 3VWKA 2YN5A 2F53E 1UZ8A 5A2JH 2R4SH 3E6HB 1G0XA 2OI9B 2VLJA 4RGNC 3QCVH 2H1PL 4I18A 1M71B 4WFED 4NT6B 1D5MB 5IVZB 1ZEAL 5HYEA 2W91A 5EC2A 3VRLE 3DX6B 4OLWL 5KSBE 1G7JB 1EO5A 3GIVB 4P23B 4P99A 3QIUC 4KDWA 2HT2D 1CXHA 1F4HA 4K3DH 4NN7C 3STLB 4JQVA 1HCVA 3VFOA 1INEH 3SDAA 3VD5A 5CJOL 4HCRL 3TZVC 2LU3A 3E0GA 1T0NB 4R0LC 3U4BL 1UEMA 2GIYA 5DUBB 2ORBL 1OAQH 3STZB 3TT3H 1NKOA 2XZAL 3X13B 5ANMA 4Y16B 4DVRH 2OLDA 1RUPL 3V2AR 2WSKA 5DUPH 5FV1L 4WUKH 3RVUD 4F58H 1G7MA 5TQ2L 3WHXA 3H7BB 3H0TA 4H5SA 4PGDA 5TE7L 3P0GB 1SMOA 2WBJC 1XIWB 2IBBA 4WDIA 4KTEH 5L88H 2YMXH 3ARDA 1CCZA 1RJYB 3LKRB 4WW1A 1OGAE 4KGJA 1S7SA 4K3JL 2HLFC 3HRZA 5EU3A 4YZFE 5CBAA 1A47A 3RWJB 1NL0H 1CFVH 1UA6L 4M4PA 3Q6GL 1MH5B 3RJQB 2RJMA 1FBIH 4ODWA 1RZJC 3MROB 2X6MA 1NBZA 5I8OH 4ZFOB 3MV7A 3E2HB 1YA5A 2B4CC 3A67H 4HUWB 3LS4L 1OLZA 1N5YL 3Q5YA 1ZOXA 5GGSB 4PJ8D 4KJQD 4XX1G 5FCUH 1AQDA 3ARBB 4JLRA 2R9HD 3FN0L 1IEHA 3PWJA 4HAGA 3BDYL 3QEQB 4DCQA 1T22A 3LSOB 1SVZA 1FGNL 2X4QA 3VFWB 2ARJA 2IG2H 5DJYA 4LHUB 4OIIL 5INCA 3H8NA 3GMRA 3K4AA 2J88L 1EJOH 1I3RB 1JRHL 3BKML 3QEQD 1MFEL 5JIIA 2GT9B 2DRUA 4KQ3H 3DETD 5C3TA 3FQUA 2VL4A 4WFEE 3GHEH 4HAFA 3U0TB 4PYHA 5HYJA 4GT7A 4IIQA 4JDVA 4PJ7F 4HEME 2BSTB 3VXOB 5HYSB 4KK6C 5L8JB 2F5BH 2V2WB 1KG0B 3HLAA 12E8H 4DKFH 3O0RL 2BVEA 1L0YA 1NGYB 4IOFC 3MBXH 15C8L 2J4WH 2DQEL 4MSWA 2E8YA 3HZKB 1OSZA 1X5ZA 2IFFL 3LRSB 5FO8B 7FABH 4GG8B 1KJ2L 2WP3T 2RGSA 4P5MA 3CUPB 3HE6B 5C08D 3AREA 2AJZB 1NMAL 5FO9B 5BO1H 1JGUL 3NCJL 3RGHA 3WNOA 1SBSH 1NC4B 5IV2B 5KW9L 2FEEI 4FQXA 3T2NH 2J5LB 2P5WA 2VDML 4JM2D 4EXKA 1G84A 4G5ZL 2DTSA 5DQ9A 1KN4L 2AJXL 3VW3L 3F7VB 1I3UA 1N26A 5C07D 1Q9KA 4W70A 4EI5B 4IOIB 5TE6H 4QRTA 1I1AC 2YD3A 2V7NA 2CDFB 1OW0A 5HI4C 1HH9B 3FO0H 1X5GA 2Q86B 4X0KB 4PGEA 3B8SA 4LPCA 1T1WB 3PV6B 5C09B 2DQDH 4PJAB 2DQGL 1NGWA 1YJDL 4PJ9C 1WC7A 3QIWD 4FFYL 2FH8A 1I75A 2M2DA 4Q9QH 1IC5L 4XCEB 2P8LB 1U8PA 4JJHA 4YGVB 3DGGA 5DMIL 2BOCB 3GMRB 3RPKA 1NFKA 2PYEE 5D2NC 4QTIL 1KPRA 3AXLA 4MD0B 3CH1A 4HZLB 5AAWA 2EDWA 3OJDB 1QSEA 4TVPH 4PBXA 1U95A 2IBZX 4BSWA 3W9EA 2P4AB 2Y36L 1A64A 1UJ3B 4YEFA 2BOBA 2KZ1B 5C0RH 5EOCL 2GKIA 3JTSA 3S3SA 4HX1A 4ZUSA 2PTVA 3L7FB 2V9TA 3HUJA 3CVHA 4ZXBC 3SDYH 1HK6A 1BHGA 3QI9B 2AJYH 3QNZB 2HT4C 3O6FC 2IWGA 5CEZL 2J3SA 5DC4B 3W0WE 4AQ1B 5KAQG 1X4YA 4R7NB 4W6XB 5FUCC 3UTPD 2Y06H 1OB1A 2XKNB 5FO9A 3RTQA 4TVPE 3GMNB 3VFNB 4QTHB 4E42B 4Z8FH 2QSQA 5GRWA 1TZHB 3KNBB 4U0RC 3PJSB 2FBJH 5SWZA 5EORL 2X4UA 1BGXH 4PTTA 2ATKA 2ID5A 3NFNB 5IOPB 1NPUA 4JPVH 4TSBL 3H6JA 5D1QD 4J2XA 3VXRE 5IEHB 2DKMA 1YQVL 4J3UA 5BZWA 2K7PA 3RJDA 1EEUA 4JN1H 5DHYA 3QDGE 1C5CL 4YHLL 2J8UF 2YD1A 2HRPL 2YUZA 4NZJA 2Z8SA 3LHPL 4HIXH 3J8F7 5F7FA 2BSRA 2FIRT 2BOCA 4WV1C 1MIEH 1RZGB 3OB8A 3VE0B 1LGVA 2Z9TA 5E8OB 2AEQL 4RDQF 4PJ5D 3REVA 1R24A 2DWDA 3CNKA 2JCCB 5IVXF 4JFDA 3BKMH 3DUSB 5E6IC 3PIQA 4HFWA 5DRZB 4JDTL 4E0RB 2NY1B 3IDYB 4MNHA 3ULUF 4HLJA 4L8SA 4EKXA 3HNVL 3RWEB 1WFNA 1W0VB 1CLZH 1RVFH 3MLWH 3I3EA 3O9WC 2W0FA 1KUMA 4BQ8A 3Q6FB 1X4ZA 4K3DL 4KKAD 5JTWA 4L3CB 4W81A 3MACL 3NA9H 1I8MB 4XPFL 5GGQL 1CT8A 4XCCL 3CFKA 1QKZH 3QO0A 4PJGE 4EN3A 5I16B 5I66B 4LSRH 3SPVB 1YNKH 3R06A 4JVWA 1NCBH 1Z5LB 2IADB 3RIFK 4Z7UA 2WZPD 3VWJB 5AD0A 4NO0D 3LQAL 4OV6F 3SKMA 4XI5C 4O2EA 1GC1H 1CGXA 1YEHH 3G6JA 4ZDHB 3SKOA 3PWUA 1XGUA 2NX5D 1PGRB 1UM4H 3KPSD 4BFBD 3DRQA 2LTQC 1IKNA 3FQRA 4B0MM 1NGXA 1FYTB 2CIIA 5F7YC 2VDPH 4KMQA 2DQCL 2GJ6B 4GLRI 3RVVC 3ISWA 5FHAH 3DBXB 5BVJA 1U8HA 3IETB 4HWZA 3MRIB 4OLXH 3S5LB 4ZG1A 3B43A 4GW1A 3RIAF 4C57C 4ODTH 4PGBA 1OTTD 4IRZH 2EE3A 5ALCH 5IF0B 5SWQA 4WFGE 1UB5A 2N7BA 3V5HB 2VKXA 4XP6L 4LBEA 1TCRB 3BGFB 3DMMD 2OTUB 4PRPE 2WANA 5JA8B 4EI6B 1BGXL 1FGVH 3ZKXC 2LV4A 1O5DT 2FSEB 2H32B 4PS4L 1I8LC 3RFZC 3ULUE 1EXUA 1MI5A 1DQQA 2R1XB 4K55A 2VXVH 3VXUA 1IAKA 4MZ3A 4NZUL 1FGNH 2HP4A 5BZDB 3KYKH 5EO1B 4ODVL 5FA3A 1VEOA 5DJ0A 3ARRA 1EFXB 4KK8D 4AMKL 4PLKC 1BF2A 5AAMA 3TP4A 3TBWA 2VISA 1BQUA 1YC7A 1AO7D 4YHNB 3EOTH 1IAIL 4QCIB 2NZ9D 4FA8A 1HOCA 2YKLH 3VGAB 1LK3H 4NNYA 1QBLL 2XYCA 5I16A 5J6GA 4GAGH 5DTFB 2EDYA 3ARYA 3VXQA 1M7XA 3LKQA 3O0RH 1FG2B 3OHXB 5FUCE 5L2KD 3H3BC 4FNLH 4P4KD 1XEDA 3HI6H 3ME0A 1AIFB 1BOGB 4Z8FL 2NZ9C 5IJVA 3V7MA 5KBNC 5TF1L 4GSDL 1A6VL 2YA2A 1EDQA 2A73B 1G7JA 3H2WA 1QLRA 4X6BB 4MNQD 2Z91B 3ZT5A 5E2WH 2A6KB 2GJ6E 2HVKA 3OG4B 4RMVA 1U8HB 3STLA 4Z9KB 3C08L 4QLRA 3IFPA 1C5BH 3B5GA 4L4TD 2F54A 1FL5A 1F4XL 3S7GA 3MTRA 1JPGA 4XNXH 4MQ7B 1B4JL 4U3CA 3U0WL 3E6FA 5I1LB 4X7DC 4DUVA 5BJTB 1MJ8H 1KEGL 4TRPL 2VR4A 3SGJA 8FABB 4M7KH 4TYUA 4HIXL 3K3QA 5DRWA 5IW3A 2GHWB 4M93C 3QEGH 2BSSB 3U9UA 1DUYA 4G80A 1BBDH 2Q76B 2RR3A 3N50A 1IGYA 3NTCL 2XI9A 5HGAA 3QDGD 2EH7H 1VENA 5DK0B 3O6ML 2VUOA 5EBLB 5EZLA 1J18A 1IAKB 2DBLH 2HKHH 3BEVB 4HUVB 2X89D 1F3JB 2YD8A 1P2CB 1HHJB 1EO8L 3ETBF 5I19H 2KL6A 3QH3B 1YQVH 1U8QA 3MSPA 2ZUVA 3NABH 2VC2L 4D9LL 5D9SB 5HYJE 3WIFB 2CRMA 4OLZL 4V1DE 4MJID 1ZANL 4QRPB 4QXUH 3NAAL 1G6RL 4M3KB 5GGVH 3VXRD 1QSFB 3F5WA 4DOHE 4P5KB 2VDLH 5KS9F 2N4IA 2N56A 4L9DA 1TQBC 2UYLB 3ET9F 5EC1A 4P4KA 1HEZA 4DJMA 4Y89A 3CAFA 4FG6D 3C6SB 2PXYD 1HYSD 4N0CC 1URLA 4NQEA 2GCYA 4BZ2H 2OK0L 3QDGB 4NPYA 3SDCD 2V2XB 3JV5A 5I8CB 5D71L 5JA9A 4FQ1L 1T1XB 2QKIB 5DD3L 5T3XH 1IGJA 3H3PL 4PJEE 5I17A 4Y7MA 4YGAB 1P1ZA 1XGQA 4I4WB 2YWYA 1JPGB 1JK8B 4MNGA 2F74A 1IAMA 5C8JA 4ZFZA 5TH2A 4MNQE 5GGQH 1T7XA 5EBMB 4O02L 1OWRM 5EO9A 1F11A 3GSNL 1ZSDB 4E5XB 3MGTA 4U1KB 4PRAA 2CR6A 4PR5B 1ED3A 5CZKA 1WBYB 1KPVA 1D3CA 4C56E 1I8KA 2V9RA 4R2GC 4OFDA 3VCLB 5B22A 3WDHA 5DD0H 1PKOA 1MY7A 1JBJA 4X6CE 4QXTA 4PRHB 1T2QL 5GS1C 2DIBA 4JGJA 3S37H 4IHOB 1NANH 5INDA 1IKFH 5KVEL 4NO3B 1DLHA 5EWIL 2VQ1B 3SDAC 5JUEL 2DQTH 2NY5C 3MLTA 5JZ7D 1HNGA 5SV3A 4JY6B 1SMAA 2BNQE 1N5AA 5E8NA 5DVOA 1U8OB 3LEXA 1QR4A 3BQUA 1BFOA 2FBOJ 1BMGA 4KTYA 3BI9X 3HZMB 4L8SC 1HNFA 4OCRH 4P2CG 5T1LB 2VSDA 3QDME 3KJ6H 3V5KA 1DVFC 5D5MB 3TNNA 1KJ2B 4ODXB 4JEGB 1K4DA 1WFOA 3B2UD 2GFBA 2WBJA 4G8GE 2H6PB 4XPFH 3PHOA 1SJHB 1EHNA 4NHUB 2VLKB 5JIKA 1PJ9A 2BNUA 5FO7B 1EEYB 1OT2A 3D69A 3O4OB 5DSCB 1B0GB 4JG0L 4ONGH 5T1KD 3TBSA 5I8KL 2QKIA 5F7EL 1IM3A 3EDDA 2O93L 3K74B 3G9AB 3FTGB 3MV8D 3WJLA 5C0IA 4IBLT 4CN4A 3RA7H 1KN2H 2W07A 3VXSE 4ODUA 3QR2A 2VDRL 3S96B 3FT2A 5JHDB 3JTSB 3RWCA 5I1HL 3MX0A 2DLEA 5FUZH 5HGBB 4P46C 5DJAB 2EXWD 3AS1A 5CP7B 3VFSB 1QFWL 5FUOL 2YPLB 4N9OB 3SJVB 2DM4A 2ADJB 1A7PH 1IGTA 1OD9A 4PJBA 1CDYA 4KHTL 2YXFA 4TUKL 3PWNB 5FYLL 4NP4L 4NZTH 4NO2A 4UT9H 4PLNC 4L3EA 1JPFB 3T65A 5AWNL 4S1QH 1ADQA 3HB3D 1NFDE 3DARA 2VE6A 4G3YH 5L6YH 4IRSD 4EQ2A 2JF1A 4IJ3B 4P2OD 5D70L 2NY5L 3VGBA 4JKMA 1A2YA 5EUOA 2X4OB 4OCYH 2O61A 5B4MC 3HC4L 2XG4A 1ONQA 2Z92A 3P4OA 3L5JA 2QADB 4YPGA 1SYSB 1AKJD 1BBJA 3QEQE 5FK9B 4XAWH 35C8L 5IB4A 3GBLA 3JTTA 1LE9B 2BNQD 4RGNB 1MCJA 3MCKB 1ROWA 3LKNB 3MUHL 3QSKB 4V1DD 4Q74A 4UOW0 2D7QA 5ID0B 1T80A 4J1UB 4YDJA 1INQB 3FFDA 1DBBH 1IT9L 1OGTB 2R0KL 4GKNA 4FXGA 1P7QB 4JVPA 3UJIL 4ZUVA 4C4KO 1CU4L 1XF2A 2AXGB 5C1MB 5CILL 3V0WH 1HHKA 2GQHA 2YPLE 3SJVE 1I1AA 3GJFA 2BVOB 4G9DB 4KI1A 2NMSA 3VRLF 1LP9F 4OF7A 3B2VH 5IHZB 3F6IA 3A67L 4XCNA 5IUSA 4WHYG 3ULVE 3HRZB 1LMKA 2F5BL 3JXAA 3P4MB 4P3DA 2IQ9L 3NCEB 5CINL 5KSAD 3DURB 2BXZA 3C9NB 3VWKB 15C8H 2J4WL 4TPRH 3O8XA 1A0QH 4PY8I 2UZIH 1F90L 5D72H 2GTZA 5E2JA 2EXYC 3U1SL 5JXAL 3EJYC 4NNXB 4H25A 3LV3A 5CWSA 4JY4A 3V6ZA 4EEEA 5KVDH 1KJMB 4DVRL 4PJ8C 1IAII 4OD3H 3R0NA 4XPGH 3CFEB 3KLAA 3X14B 1P84J 3VXTB 1P4BH 4J12A 1A9EB 1KN2L 4JLRB 1IAOA 4H0GA 2E9WA 1KCSL 2JELL 3SKMB 1G0YR 4U6XB 1J0IA 4DCQB 3O45B 5I73B 5ACLA 1QRNB 4P46A 3CX5K 2DQHL 2X4QB 3CSPA 3I6LE 5MENA 4KWUA 1LO2H 1A7QH 1V3KA 3DRQB 5K59F 1SVCP 2XZQL 3FZUD 4WWKC 3K4ZA 4L8CB 1CDHA 1RUML 1A7NL 5HVFB 1PLGH 2AK4A 3WNPA 3PHSA 1AGDA 3JWNC 1OL0A 1T03L 1R6VA 3EO9L 4EVNB 2H8PA 5FGBC 3VD3A 4RNRA 1UACL 1X5FA 4YHKL 4RGOL 2B4CH 2P5WE 3CFCL 2WNGA 4K23H 1GIGL 4TTDD 2HJLB 3P30L 4F2MA 3VMPA 5GGUA 5B8CA 4OZHB 4FXKB 5IHLB 1IKFL 1TQCC 4LSPH 4ZQKA 1A6AB 1S78D 3IGAA 4GLRH 1FIGL 3H9HA 4LVOB 4G8GD 4JO3H 2DBJA 1FZKA 4P46D 1U8MA 4TSCL 6FABH 1TITA 1ZT7A 4R96B 1YEDA 4NN5B 2F5AH 4IOIA 4JO1L 3T0WA 4WW2B 5GGSA 2W92A 1QA9B 4PYGA 3TV3H 3SCMA 3PGFL 4H25B 5DFTA 1Q72H 3IDGA 3HMXH 4TNWK 4Z7VE 1QBML 3ARZA 1NCDH 4PRDB 3LSOA 5SWZE 5C09A 1FG2A 1QRKA 3R1GH 4DN4L 1FH5H 3LZFH 1HN1A 1RZ8A 1MCOH 5F9DC 3BIKA 4NKQB 1DQLL 4NO5B 3AMLA 3FB8A 3GJFK 3DV6A 5I76B 3GMOB 3L5WB 3OL2A 4RBPH 3O9WA 3T2NL 1XR8A 5I1HH 1REIA 1ZWIB 3MCG1 3D39D 2SEBB 2LQRA 4TULL 3OAZH 3VI4E 4MSWB 2CO7B 2NW2A 4H26B 4X80H 3OKDA 5BW7C 4HT1L 4GG6F 5FO8A 1YY9D 1CE1L 3QNYA 5DURB 5K59E 4MA7L 4Z5RA 3KPMB 3UXFA 3FCTA 3G04A 3MLXH 2MKLC 1BLNB 2VZOA 2G60L 4KRPD 1N0LA 3D25A 5E4IA 1OTSC 1Y6NR 1AGBB 2NNAA 2P47B 3QHZL 4X4ME 1WCBA 4AIZA 4X6DF 5C08B 1MLCB 2J5LC 5KVFH 4OCSL 3VFTB 1XCTB 3UC0L 5D70H 4E42A 4MCYA 3QH3A 1CFQB 1F6AB 2V7HA 1J12A 3MO1A 4U7MA 1FYTD 1S7XA 3MNWA 5DJCB 3UTSB 3ULVC 3O3DB 2JJTC 1MCWW 1T1WA 2DM3A 1RZFL 2YK1L 4FQ2L 3SCMB 4K71C 4KU1A 1WEJL 3TWCL 5EIIB 1AGCB 2EDJA 2CD0A 3OR6B 2PN5A 4OUUB 4L1DA 4Y2OA 3L3KA 1C7SA 3RL2B 5C09D 3MMEB 1VGEL 1QEWB 3FJTA 3QA3B 4FS0A 4ELKB 5J3HD 2DYPD 4Y5XC 1DN2A 3LKSB 1AJ7L 5GGRY 5DD5H 1G7PB 3TBYA 4DZBA 3O6FB 4MDJA 1GJIA 5DI8A 1XF4A 1V8HA 2G2RA 2RCSL 5EUOF 3MJ7A 4ZS7L 1YYLH 2ADGA 2VH5L 1MREL 1OTSD 1AHWC 1CLOH 1HHIB 1Q9OA 4M6OL 5MEOA 2R56L 4MAYC 3L7EA 4KKCD 1ZHKA 1L0QA 3WEXA 4X8JB 5SX4H 1Z0MA 1U3HA 3C09C 4P9HH 2VZSA 1J11A 1YEJH 5CZXD 1KIRB 4WWID 3U4BH 4NRYB 3QP3A 1A6PA 5C08A 4YIQA 3U6RB 5IW6A 4OGYL 2D03L 1QQDA 1ACYH 4KJWC 2BERA 4U1LB 3GRWL 5DO2D 2NY3D 4HS3A 3EKCA 4LCUA 1QNZH 3VWJA 4NO3A 2C1OB 1F2QA 2R0WH 3BO8B 4MLSA 3WIHH 1CL7I 3D85A 4F9LC 5C2UB 4GQPH 4ODHL 5E2UH 3EOTL 5FOBA 4UB0H 4C4KT 5C6TH 3PXHA 4EI5C 5F7NC 1S7TB 4GRMA 3OAUL 1NUDA 1AR1C 3MODH 1X9QA 2DLFL 2YC1A 2H1PH 5CEZD 2L0DA 2A1WL 4ZPVA 2OL3A 5GZOD 1UZ6E 1U3JA 2GSGA 5IMLB 3TVMB 1VSCA 4JFYA 4FTVD 3BE1H 2Y72A 4NQCD 4CRPA 5TDPB 1UWEH 1CFNB 5DVKA 1RHHA 4JFPA 1SM3H 1IGFH 1UM5L 1BD2A 4DZBB 4FABH 4Y8DC 3IDMB 4EN3D 1HXYA 3L95B 3UX9B 3N1FC 3KPSA 4A6YA 1KYOK 4LCYA 4WTZG 1OWWA 2W0FB 4MZ2A 3NZHL 4C83B 1OP5H 3WXVL 4I77H 3PDDA 5HHXH 3IDNB 1CD9B 5IJKA 4MD4A 4I0KA 2AXJA 2EC8A 5FHAL 3HR6A 1U3HB 1NLBL 5LCVH 3TO2A 1HSBA 2CKBL 4KKBD 1G9ML 3I9GH 3WFZA 3UO1H 1FFRA 3RBSA 5E5RB 1R5VA 3LN5B 2MNUA 5D1ZD 2G60H 2CR3A 1HE7A 2CDEB 3IB4A 1IM9A 2R69H 1C5BL 3MYZA 2PW1A 1M6OB 4JJ5A 4K7FB 5D1ZB 5MEPA 1KCVL 5DZLA 2DQFB 5GSVB 4YHML 4UV7H 4WI4A 1KGCD 2XA8H 4OQTA 5A16B 1P7KB 4H1LA 4QXWA 1QP1A 5HDLA 5D7IA 4KRNA 4MB5A 3QUML 2D7OA 1PY4A 4XMPH 3EO0A 4XPBH 5F93C 3WN5B 3TYGH 1T21B 1UB5B 4XGZA 4LLDB 3IFPB 4GW4B 4KZEH 2AP2A 3T4AA 3CZFB 1FORL 4FQQB 4HJJL 1CQYA 5IB4B 1UYWL 4MJ5B 4XVTH 3LKNA 2FEDD 4OLUL 8FABA 1V7ML 4I1NB 3LAFA 5KS9A 3RP1A 3EUUA 43CAA 3MGOA 4XP5L 1I7ZA 4FXGB 4A2MA 1QVOA 2OP4L 1TXKA 1NCAL 4HDIA 3LRHA 4MA3A 4PRHD 1RIHL 1XGTA 3MFFB 4RAUA 4M6AA 5BXFA 4Q0XH 4NQVA 5JDSA 4RMUA 3QPXL 3NOIA 2EC9T 4KRMB 5EBGA 3EOYG 4U49A 4LHJB 1G9MC 5L2JA 3QWQB 4OZGF 1PVHA 2CO6B 5HHNA 3NVQA 3MLRL 2FCBA 5D1XA 3QDMD 2XQYG 4PP1C 3ZHDA 3P11H 1OQXA 4NN7B 3TT3L 4DK6A 4R7DB 1EMTH 4TULH 1H3PH 4K3HA 4PV8B 2B1HH 3HE7C 1EAJA 3QULA 1ODAA 4GXUN 5ERWA 4UU9B 2VWEE 3GB7B 1K8IB 4JRXA 5KSVA 1NLDH 3MXWL 1YECH 3HE7D 4W68A 1XGYH 4HIIA 4WO4C 5F9WC 3NGBB 4IRSC 4N0UA 1DQDH 4KK9C 2HTKC 2MHAA 4P4RA 3DVGB 3ARUA 4OBSA 3GIVA 4GAJH 4QF1A 4PP2A 1FL5B 5EOCJ 4F7EA 1HQ4B 3EJZD 1E27A 1OW0C 2A6DB 3JV6A 3KPQA 4OCSH 3DX8B 4TUKH 1J8HD 4JPIA 1KB9J 3ZDZE 1ZHBB 4OZHE 3IDIB 1FAIH 2AJSL 4DAGH 2KUTA 1MI5E 4HKBB 4XNYL 4YK4B 2XZZA 5LXGH 3BKCL 5E08H 3BT2H 4LHUD 2X1PA 3S98A 5IG7B 1D6EA 2PO6D 3RNKA 3U46A 2BMKB 1AC6A 3L5XH 1EX0A 4QRUB 4O51A 1G7MB 3PQYE 1MQKH 2NYYD 4M7JL 1D6VL 2X1QA 3A6CL 4K7PY 3X11A 4U6TA 4OT1L 3VXSB 1LEGA 3KJ4B 3MJ9A 2BY1A 5EU6A 5IMOB 2JB6B 1C1EL 3FT3A 3VFUB 4BFIA 1ORQB 1DQJA 2DQGH 4MAUL 1B0WA 5C6TL 3H9SD 4HH9B 3W2DH 1YN7A 5DD1L 4OF3A 5ESVB 5INDB 4PRHE 3LRGA 4ONFL 3ZTNL 1K85A 2FWOA 1NSNH 3GMQA 2WLZA 4NKMA 4Q6IB 5CEZH 2AV1B 2DJSA 2E8ZA 4LEOB 4U1JB 4XWGH 4ZFOA 1UCBH 5I8EB 1FO0B 3QG7H 3U7YL 4GBXD 1RJZB 2GK0A 5JW5A 1A4JA 4L4TB 4N0YL 2BNQB 5EFIA 3ZYJA 5ESQA 1EAPB 2XPGB 5JIHA 3QJFB 3EGSA 4OZFH 1RZ8B 4ODXA 3WFCH 5L9DH 4JM4H 5JHDD 4TVPD 2MHAB 4P4RB 5J6HB 1ZVSB 3RWHA 2EE6A 4R3SB 1QLFA 4X99B 1AD0A 3B9EA 4NRXB 5TQ0H 1OM3H 1P4LB 3CU1A 3U0PA 4MQTB 5HHXL 3CMOH 4MHHG 4Y1AB 3GRWH 3HI5L 2C5DC 5FUZL 3SQOL 5C0GA 3A6BL 3U4AA 1FRGH 2R8SH 3IDIA 4IIQC 2P49B 4QOKD 4YXHL 2VLKD 4WNQB 9CGTA 2DDQH 4P23D 3LKPA 3ZDYE 2DQDL 4JZNB 2AEQH 3WHXB 5CJ5A 4L8BA 4UB0L 2BJML 4JFXB 3FRUA 4OFPA 3RNKB 2VDPL 2FX9H 2VQUA 3KWWB 4ZO7A 1OSPH 5AWNH 1RSFA 2JCCE 1H15A 3QDJA 4H8WL 2XOTA 4XNZB 2GSIA 5HD8C 2AJZA 4IRJC 1D5IL 5CIPH 3BPOC 2DL2A 3I02B 4GW5A 4L3AA 5E00B 1NC2B 4JG0H 5H94B 4MHHI 1ORSA 2D4FA 1OF2B 3TIEB 5J12C 3RGVB 4Z95H 2W9EL 5B39G 4X9FA 2X4TB 2HKFH 5DQ9B 1OP3H 3F7VA 3T0BA 3BKJL 4OGZA 1FO0L 3QFJD 4OLVH 3G5ZA 2B20A 1J10A 2YPKB 4PJDE 3PL6C 1CD0A 4OF6A 3CFJB 4HV8A 3ARXA 3VD7A 1IL1A 1FIGH 1CDCA 3LMJL 4WV1A 3DETC 3FOMA 3N85H 5E2VL 4DN3L 5E99H 2R0ZL 1C12B 5JW3L 2QJDA 1EEYA 1IGMH 2O5ZH 2QTEA 1JNLL 4NSKB 5FKPB 3DVIA 2P7TA 5EU6E 3EYVA 3U0TA 5HYJB 2WWMD 3H3KA 2DIJA 3HMWL 5E6IA 5IQ7L 4ZO6A 4L8DA 3N1QC 3OAYH 5IFHL 1WLHA 4N9GB 3H0TB 2ZUXA 1AD0B 4H5SB 3SE4C 3HPLA 1DQDL 4MX7B 3QFJB 1QSVA 4TSBH 2A9NL 1RK0B 2ICWB 3RL1A 3STBA 1KB5H 4PRIA 4QWWC 1YPZA 3QWOA 5DS8A 4M5YL 1UJ3A 4QRRB 3MLSH 4PB9L 4WI8A 3U1SH 3BP7A 5E70A 5B8CC 4XCNB 2JJSA 2R1WA 3QXDB 1L6ZA 1NEUA 1X3DA 2DKUA 4IJ3C 1DJSA 2BP3A 4LPWA 1N8ZB 4X4YB 4EDWH 1F4YL 1SJEB 3F7YB 4FFZH 1VDGA 4HBCH 2V9QA 1A1MA 5E4EB 5D7SH 1OAXH 5I71C 4KKBC 5TFSH 7CGTA 5DO2C 1T4KB 4I3SL 3PWJB 2DQCH 5CZVL 5FYKE 4NJAL 2KPNA 4QTHA 1CD8A 3MC0A 5J8OA 4RBPK 2W59A 2WK2A 2XWBB 4U1SB 4RISH 2UZXB 2OP4H 4JCMA 5HY9A 5BS0A 1Y0LB 3D85B 4Z0XB 1AQKH 1RIVL 2MOVA 3GUTA 4YPGB 3OAZK 4WGVB 4Z7NF 2VLMD 3D9AL 4IEFB 4YXLH 1U8PB 4JM2B 2C4FU 4XCCH 2E7LA 2R2HA 3HI6L 2P24A 2QSCH 3GO1L 4F7PA 1AP2B 4Y19D 3BMVA 5IM7A 3WN5C 3FFCA 3GIZH 1QSEB 3VFMA 1YC8A 1XF2B 4FZEL 3RY6A 1RPQA 2Q7YA 3GJFB 1YNLL 1KCSH 3HCVA 5CEYB 1TNMA 3DIFB 1F4XH 3RVWD 5J4MA 4AIOA 4JB9H 1XAUA 1T6VN 5K93A 2NXZB 1MFEH 3N85L 4P2QE 3KHQA 3A6BH 2X7LB 2ZCHL 1EBAA 4D9RD 1NANI 4LNRA 1FNGA 1MCWM 2FL5A 2DDQL 2AJ3B 3C2SA 3TN0A 4LSSL 3EYSL 4R90L 4QNPE 1DUZB 4UDUA 2VLJB 2FLBT 4OIBA 2P46B 1R3HB 1FGVL 1KJ3H 1F3DH 1X5YA 2A9NH 3S4SA 4JFHE 3TGXA 3V8OA 1PW3A 3IYLW 2BFVL 2D0FA 4O9HL 1A6UH 4XBPA 4JFED 5ICYA 4C54A 1NBYA 1P7QD 5DF0A 3ZLQC 4MCZA 4HWBH 5GZND 1WBZA 2FGZA 3QNXB 5JHLH 3SDAB 5C7XL 3G5YB 3K4DA 5EO0A 1AGDB 5IT2L 2CUHA 4PJFF 2DM2A 3VE0A 1K5NB 2I07B 4EBQH 2XTJB 4HX1B 2P24B 4ZUSB 1NSNL 1GGTA 3FFCB 2B39A 1K2DA 1PSKH 3NFPB 5F7WC 1N3NA 2HFGL 1NCWL 4ODHH 3PDOA 4XH2A 3QUYB 4BH7B 1TPXB 3IGAB 1KNOA 1SYVA 1H5BC 1WBXB 4NZRL 4ZAKD 4RMQA 3MJ9H 4NFDA 1MVUB 3VFNA 5JPNA 1N5YH 1J1PH 1G7LA 4Y4FD 4M8QB 2OXHA 5BZDA 5JW4R 3T1WA 4S1RL 4ZPTB 1W8NA 2JIXA 3TWCH 4PTTB 5C9JB 3RWGA 1UWEL 2GUOA 3D39A 2EO9A 3WIHA 2VISB 3GIZL 4EN3B 1KJVB 5HHMD 3SE3C 5EA0L 3TJHC 5DJCA 4M7KL 1JYXA 2AEPH 3UPAA 5KSBA 5E99L 4JHAH 4OCLC 4F37F 2R8SL 4NFCA 1VFAA 4PJHF 1T2QH 3SDYL 5EBWB 3BIKB 3PWLA 4FFVC 4R0LB 2YN3A 4LPYA 5GJTL 2EYTA 5IFHH 3OXSA 1HZHL 3EJYD 2V5RA 4OM1L 2VH5H 1HINH 1KB5A 2AGJH 4U6VH 1X5AA 1F6LL 4PJDB 3QO1B 5HGDA 3S36H 1H3XA 4JN2A 2OL3H 4AZ8A 1DN0A 5HHVL 3RWDA 4JFFA 2EKSB 2ADFH 4FXLA 2JJVA 5HHPB 2ICWI 4OD1L 3RZWA 5FYJH 4PV9A 2AJVL 2ADGB 2I5YL 1K5NA 2I07A 2X70B 3HLAB 3D9AH 3RX8A 3OKDB 1R3KB 2NY4B 5L2KE 1NGYA 3HG1D 5C6PB 5DJ6B 5MEOB 5GS1B 5E8DL 2IH3B 4M5ZL 1MPAH 1CTNA 3ROOA 1R5WB 5CHNB 4ZXBD 5HVHC 5IW1A 2J8OA 1I8MA 1D6EB 1DQQB 2E5EA 2R1XA 3QUYA 3VXUB 2E6PA 2YD9A 4S11A 2HWZH 4UINH 1IGYB 4LSTL 2C3WA 4KXZH 3MFGB 4D8PB 4PG9A 4NKDA 3NIGF 4FQHB 4LHQB 5F3HA 1JPST 2JK5B 3SDXB 2HRLA 2P5WB 1ZLUH 1PZUB 3BEVA 3BGMB 1XF5B 5T3XL 3RTQC 2HLFD 4W6YB 2VL5A 1YY8B 2WWMC 1QG3A 2YD2A 4F9LA 3C6LA 4P2OC 2FWOB 1CDIA 4OZ4A 5C07A 1EO7A 1G9NC 5EIIA 4KQ4H 3OR6A 4XVJL 2GJ6A 3WSQH 1CLZL 1RVFL 3RL2A 4M5YH 2GTWA 3ZE1E 1H3UA 1J0ZA 1RY7B 5IJVB 4O00A 5DVLA 5C0AE 1WZKA 3NCCB 2GSGB 5IMLA 1U8JB 1T7ZA 5I75C 4MD0A 5J11B 2CKBB 4FOMA 5ISZA 4F7MB 1PQZA 5I71B 4JN2B 3ZKXB 2FO4A 3DGCR 1GZQB 4MJIE 5EWIH 1MWAH 4NPYB 3KPRB 4IMKC 4U2ZA 4G43B 4U1NB 1Q9OB 5HXMA 1DQTA 1FNSH 3HFML 2P45B 3OKMB 4HS6A 2BHYA 5ITFB 4ELME 3UTZA 1YECL 2ERJC 2DD8L 3OB0K 2A38A 4ENEC 4EJ1C 1RIVH 3V0VB 5EUKA 4X4MA 2WWKO 3UPRA 4AEHH 2XFXB 3FMGH 3HAEH 1MUJA 1PSKL 3MRGB 2BRQA 1ZHLB 4E5XA 5BMFL 5GIRA 2ZG1A 4N90E 4IRZL 4E41D 4QRQA 2JK5A 1C5CH 2XRAH 3OMZA 5FYJL 4JRXD 1ES0B 1NJ9A 5BV7B 1I1CA 4RFNB 2CDEA 3TA3A 4LEXL 4JRWA 2YSSA 3BT2L 3OXRA 2OJEB 3I50L 2A0LC 2ED8A 5F7UA 1RUKL 3BDXA 1ETZA 4M61A 1MVFA 1S5IH 3QCTH 1I8IA 1BQLH 3AAZB 3QIBD 1H3GA 5B39B 5LGKA 1EUUA 1KIQA 3QDMB 1ZVYA 4L4VE 4BM7A 4GJTB 1ADQL 5T1LA 3K7UA 5F1OB 5IFJB 3UTQA 5D5MA 2VAAA 1DQML 3GSXA 4R90H 4UQ2A 3WS3A 4KK9D 1PQZB 4ONFH 4UUJB 1JCKA 1MJUL 5KS9B 3EOAB 1JF5A 43CAB 3VXSD 4HIHB 5L6YL 3MLUL 4RRPA 1EH9A 4S1RH 5T3ZE 3BX7C 1RJLB 3T0VA 4UQ3B 5IB3B 4LLAA 1FFOB 4DZ8A 2IPTL 2WBJD 4LKCA 3F6LA 3CSBA 5EUKB 3MGTB 4U1KA 1ZAGA 4K8RC 3RWIB 3UPRB 4Y5VC 3CXHK 3T0EE 2GAZA 3KYMB 4M6NH 4RGMC 2JJUA 3U9PH 3EOBA 5J1SC 3CDYA 1FLRH 4N0CD 1WIOA 3VXPA 1MPAL 1YEEH 5GIRB 2XG5A 3E6HA 5FYKU 3D2UB 1HZHH 3HS0B 3B9KB 1CDBA 1E4XH 3JV4B 4TUJB 5HYQA 1UXSB 4HK3J 1A3RL 4OT1H 3LD8B 1FLTX 3C60D 3VGDA 5D1ZA 5MEPB 2NXYB 4HG4K 4WU5B 3ESUF 5CILH 5T5FL 3H9ZA 4YNYA 6FABL 5D7LB 1JPFA 3MNZB 1B90A 3K80A 1AXTH 3MUJA 3GNML 4Y4KB 2VE6B 2APWA 1BFOB 3QDGA 1H3WM 1BZ9B 1MOEA 5T33L 5I8CA 3EIFA 4JZOB 3AROA 1J0KA 5E8PA 1MNUH 4RGOH 1PKQA 4M48H 1BVKB 4B7IA 1E6OH 3MV9E 3O4LD 4MJ5A 5MENE 1LK2A 3QG6A 1J88A 1M4KA 1BIIB 4DN4H 2X40A 5TJWK 5BOPA 1B6UA 4P5TD 1KCLA 5JIPA 1MAML 5FA4A 4NQCA 1MHEA 2V5MA 3MRNB 3VFRA 1IM3B 5ELIA 3VH8A 3QUKB 2FGWL 3CVIH 3FO9B 4I0PB 2R29H 3L3DA 1NCCH 1BD2D 3U30C 3BD3A 1PZ5B 3V7AE 2ITCB 2DQHH 3ULSA 2AQ3A 3C6LD 4LARH 3S96A 4K71B 3HAEA 5EPMB 3V7AG 1LO0L 4JGMA 1EFXA 3ZE1F 4LDLB 4AM0B 3QHFH 3TBWB 1ZTXL 1FNSL 4WUUD 5FGCE 5CEXB 3DTXB 4WTWA 5D1XB 3BZFB 4WWKA 2H9GA 2VLRA 2WUBL 4KY1L 4HUUB 3DHJA 3CFDB 3TPKA 2AJ3A 3GBNL 5DZOA 5GSRB 5I74B 4IRJA 1XR9B 4MNQB 3LEXB 1AGEB 2PYEA 4YDKH 3D2UA 4NO2B 4R2GD 5I30H 1AGFA 1U3ZA 5A1AA 3C2AL 1R3HA 4XNQB 1R3LA 4HGWB 3VRIA 5SX5K 2AKRB 1KLFA 3P30H 3QEQA 3IF1B 3C5ZA 4TUOA 4X5WB 4OZIB 1JHTA 2ZSWA 1AKJB 4D0BA 2IPTH 5AUMB 1KEMH 4NBYB 3DPBA 1J86A 3M1BA 3O3EB 4LHUA 5INCB 1K8DA 4Y4KD 3D0VB 1QLRB 5CFHA 1JVKA 1Q0XL 5F8QC 1RUPH 4OI9A 5GGTL 1ITCA 5JLZB 1E4WL 1G7IA 1J05B 4KROD 3QXUA 3IDXL 4JZOA 1GHFH 4RWHA 3VXNB 4PUBL 4F57L 5HSFA 5DJ2B 5EO0B 2FHBA 4XPAL 2KZWA 2BY2A 4TTGA 1NFIA 1M05A 3BZEB 2FB4L 3B9KC 3MV11 1OAUH 4I0PC 1RIUL 3FMGL 2NR6D 2G9HA 5ID0A 4ZOCA 4OUOA 4QHUB 1MJJB 4WNQA 1J0JA 5J12B 1AJ7H 4O2FA 5MEQB 3FB5A 1NMCC 4JO4L 2C4FT 1NUGA 2QBWA 3LZFL 3BD5A 1IGCH 4XC1H 1KB9K 1NH6A 3HHRB 4PJHB 1KPUA 3DJ9A 3ULSB 3CUPA 3HE6A 1KACB 3F62A 4F2MB 4BSVB 2NY0C 2DMKA 3VRJB 1YMME 1NC4A 2I24N 5GS3A 2RIKA 3QWRA 4BQ6A 1KTDB 2ITDA 3GSQB 5FECA 2HJFB 4OZGE 3GMQB 4LFHD 4LEOA 3JWOH 4M1DL 3IAGC 3VFPB 1BVZA 5EZOH 3K1DA 2Y5EA 5BRZE 2A83B 4PJXB 2RB8A 5T1MA 5M7QA 1JGEB 1QLEH 1KC5H 1A1NA 2W60A 4ZS7H 1AKJA 4D0BB 3MLXL 4MA1B 1A6ZA 4AEHL 5EC2B 1MRDL 1K8DB 2EYTB 2J8UE 3IXTB 2IFGA 4JZJC 3MXVL 1KPRB 2F8OA 4LPTA 3S97C 1ZGLP 1FZJA 5H37G 4NUJA 3QO1A 2Y5TA 4Y1AA 4OJFH 5J56B 5CUSH 2E9IA 5JOPE 4P3WA 5MHSE 5F96L 3FT4A 2R0LH 1ULVA 2V5TA 5D6CA 3SDCA 1I1AB 3GHBH 3WFHB 1AC0A 3U7WH 5BO1L 4U1GB 5IFAH 1ZWIA 1MJ7H 2X2YA 1MCSA 4X6CA 2VDLL 2FYYB 3GSWA 3BN9C 4TVPL 1IGFL 3T04D 3HZYB 1NGQL 3EYOA 3QFDB 4WRLA 1EZVY 3SO5A 3WFEH 1S9XB 4YE4L 4NQUA 4RMSA 1QFPA 2C3HA 4P23C 2VDNH 2PCPA 2NTFB 4KZEL 4HHAA 5E00A 5EU3B 4FQ1H 1GYAA 5E7FA 4FFYH 5IP4A 4Q9RL 1UADC 3WDJA 4KI5F 3ILQC 5I1EH 2QQNL 5KN5B 1ZA3B 1XCTA 3SN6N 2IAMB 4KK8C 1JNNH 4ERSH 5K33A 5GRJL 1JHKL 1U6AL 4PRDA 3GSNH 4H20L 4DW2H 5K9QG 3MNVA 5ESAA 2IQ9H 2W60B 1CFBA 2P8PA 2BVYA 2GFBB 3GFUA 1QYGL 4JM2A 4OFIA 3EYVB 4N8CL 3MRJB 3T1FA 2OX5A 1I4FB 5D7SL 3U83A 4N9GA 3L3IB 3N1GC 1JF1B 3J7HA 3BSZL 4JRXE 2X9YA 2FX7L 5LAXB 5JW4Q 2VLME 1Q9WB 5I15H 2IPKB 2VDKL 5EIQA 2VUYA 2Z35B 4FXKA 4WHCA 1XF3A 3L3GA 1XIWA 3WFHA 1AXSA 4O2CA 2CK0L 2GJJA 4LRNL 4NIKB 5D96B 1XT5A 4AEIH 4BH8B 3S35X 1QLEL 3HE7B 2UUDK 3FT2B 1RK1B 2ED7A 3SE3A 4BSJA 2D2OA 2IANA 1HKFA 1D5ZB 5DMJB 3AM8A 1F13A 4YDVA 1E6JH 4QRRD 2AGJL 2RHEA 2EO1A 3P0YL 2HLAA 1JWMB 4CBPA 1R3IH 4WW2A 4JFDD 1NBZB 4XXDB 5E03A 3I2CH 3MRHA 1SEQL 1UQSB 2NY5H 3V79C 1NMCB 3T8XA 2C3VB 1QBAA 3SDAD 4U7SA 1BZQK 1R0AL 3O2WH 4X7TA 3BH9B 3FB6A 4NRYA 1H8SA 4NQDA 3FN9A 3WO4B 3B5HA 4Q2ZA 1GIGH 4TPRL 1II4E 3P9MA 2QQLH 4I3RH 5F3BA 3PWUB 2DYPA 1MQ8A 4YXKH 2NY7L 2EDKA 3MA7B 1CXFA 5FF6B 2IH1B 1LNUA 3SO3C 4XPGL 1HWHB 4PIRF 1R3JB 4AEEA 3DYOA 1PBYA 3VXOA 1A21A 4DVBB 5ANMB 4U1MB 1RURL 3R4DA 4JFEE 2UVEA 3UTTA 1QTYT 3DUUB 5F9AC 1HINL 1W0YT 1IQWL 1WV7T 4D9RE 1G6VK 3ZKSD 3VA6A 2UUDH 4NKOA 1EEZB 5FHBL 2AXGA 2LTQB 3L95A 1M1SA 1YMHA 1U0QA 4GG8A 4BH8A 5LWYH 2CLRA 4XP6H 3CIQA 5EN2A 4K3GA 4X5XA 3QUMA 5EO1A 4BQCA 5EOQL 1T89A 3QPQC 4AYFA 2B1HL 5JPMB 2WUCH 1CFQA 4ZUTA 4ZMAT 5SX4I 5LXGL 2VRAA 4K94C 1NEZA 3CFCH 5TDNA 1FAKT 4LCWD 1OTUD 2VN4A 3I6KA 3RZCD 2DTMH 3BGFC 5IW6B 3BWAB 3KLAB 1D5BA 4GAJL 3CLEH 1A9EA 2D7MA 2FJFA 1M7IA 3KLDA 1I3VA 1YMMD 3EAKA 1BAFL 3GMLA 4NQDD 3P3YA 4LF3B 3FQUB 3W2DL 3MPCA 2F5AL 5HHME 3UBXI 4XWOC 4R4FH 3IDYC 4PJFA 5JW4N 2DAVA 5FV2A 4JDVB 3QQNA 4ZYKB 5HYSA 1QFWI 4PJDA 4XPHL 1NAMB 3P4NB 1NMBL 4Y5YA 4I5BA 3UC0H 1KLGB 2XWTA 1S9KC 4CVWA 1FVEA 3UYRL 4KJPC 4JR9L 4PJ5A 2VZVA 4PPTA 4QXUL 3HZKA 3Q3GA 1EA9C 1UWGH 4HWUA 4QGTA 3L7FA 3LQZA 3QBTB 2BSSA 3U9UB 2ARJQ 2W9DL 4P5MB 3FFCD 4NKOB 1DBJH 1MVUA 5JPNB 4U05A 2DMBA 4QHKJ 1U3HD 2Y25A 2X4PA 1CQKA 2D4DA 2F19L 2QQNH 4LSDA 4ZPTA 2Y23A 5C9JA 3A6OA 1U8MB 1Z6JT 2X5PA 2X4SA 3LVEA 3ZL4H 3OKLA 4U6HA 4BUHA 1JZ7A 3TA3D 5IOPA 1VFBA 1QA9A 1P5UA 3HA0A 5EULV 4K8RL 3RTQD 1WC7B 5DFVC 3GRWA 4D94A 2A6JA 3MBXL 5F6IB 2MCG1 4X98B 4RX4A 1ZLVH 5CLWA 4LSQH 4XNQA 4PB9H 4HGWA 3UTSD 3BSZH 1QBBA 4KTDH 4Y4KC 1A7RL 4AT6A 2ZSWB 3LKOB 3RKPA 1ZANH 4RSVA 3O3EA 4Z95L 3SDDB 1SEBB 1XMWA 3MRLA 3AVEA 5SWSB 3KR3L 2J7LA 1QPXA 3CVHH 1DL7L 3WLBA 1T7WA 1ZT4B 3QDAA 4OZGB 1LDPH 4OCXL 4AEFA 5T3XE 1H9VA 3WL9B 3IS0X 5IESL 4RAVB 3PL6A 4C56D 5C8JB 1V5JA 2P5EE 3DVNA 3SY0B 3QI9A 5GS1A 1R3IL 2NW2B 1IGIL 5E94A 1G1CA 4LCCA 5CS7A 3SCMC 5CHNA 1FN4B 5I1KH 4WHTB 2DLHA 1FVDB 1RU9L 3MLVL 4G9FE 5CSBA 4JRYE 4PLJD 1ZGLB 2H2SD 4KKLD 4NQVB 2M1KA 1UG9A 3CH8A 4PJHA 3LDBB 3QHTC 1P53A 4D3CL 3VFTA 3X11B 5L2JB 4JQVC 3P40A 1SM3L 2XNAA 2V7HB 2XTJE 1T0MA 1KIPB 5TF0A 1AR1D 1PY9A 5IB2B 1NJ9B 2C7UB 3SGKC 2VDKH 4ZDHA 3IXAB 4WFFE 1JTPA 4JFOB 2A6JB 2A9MH 5E8NB 5D71H 4H1LB 2X05A 1FYTA 1S5HB 3VW3H 3ZKMC 2F15A 1JGEA 2HA1A 4I77L 1S9YA 1ACYL 3HC0A 1W0WB 1PKQE 3FRPG 4KKNA 3MV8E 4YBHA 3QUXA 4BYHA 1W72H 5D2LB 3AB0C 1N2RA 4HF5L 2B5IB 4N0RA 3ILPA 4CADB 3CLFH 1T1ZB 3NN8B 3MRLB 3RPIB 3O6FA 2J6EA 4OSUH 4WGWB 2ZUUA 3DX9B 1YEFL 2OR9L 1N6UA 3L5HA 4HWBA 2EEBA 2F54B 3NAAH 2Z31A 5T3ZH 1LP9B 3VFVA 3WKNA 2EDHA 2NTSP 2P5EB 1AY1H 5JOEA 2WMPA 2YEZB 5IB3A 2UVFA 2F53D 4PLOB 1BX2A 5GZNC 1JZ8A 4JFQB 2PXYA 4WHTA 3I84A 2CXKA 5AZ2L 1OAZH 2CRIA 5HVGB 4P2QB 4GUPB 5F44A 1CGYA 4M03A 3VFSA 1D9KA 2D9QB 3X3FL 2HVJA 3BN9D 3MV8A 4O58L 4XMLH 1CDUA 2PCPB 3QB7C 3ZSSA 4YIQB 4D0DA 1TVDA 4OCRL 4ETQA 1RFDL 3V6FA 2AK1L 4ZAKC 1LO0H 1KIPA 2ZSVB 5IIEA 4P2YA 5IB2A 4HS8H 3FQRB 1G9NL 4FTVB 1JI1A 4PJ9A 5I1AB 5L7XL 2VABB 3L1OH 2EDQA 1NBVH 1LWRA 2YR3A 2PXYC 4YNYB 4KY1H 1QSFA 3MLSL 1UM5H 1IBGH 4R4BA 2KBGA 1FFNA 1NC4D 1MAMH 1BZ9A 5JNYB 3TYFA 3MV7E 1HIML 1PKQB 2E7LC 1UH3A 3CVIL 1I9RH 1KXQE 4PJIE 5DD0L 1J1OH 4O4YH 3T2OA 1EV2E 3AREC 3LY6A 4MQ7A 4N8PA 1CGSL 3NIFF 4MDIA 1KCVH 3FOLB 4HKBA 2FSEA 1B88A 1KFAL 1H3TA 4NQEB 1U8LA 4HXBH 3CFBA 4H88H 1QLFB 3ARGA 3GKWH 5D1XD 3DXAE 3PE9A 1O7SA 4UT6H 5C9KA 4OZHF 1DUYB 2J8HA 2B2XL 1IGJB 2VLRE 5KANI 3MREA 5HGAB 2BNRD 4DZ8B 4LLWB 1IRAY 3LIZH 5C0FA 3KJ4C 3BPNB 3E3QC 4P9HC 4X4XB 4C56B 1UYWH 4CNIA 4PGZA 4HMCA 3SBWA 3WNNA 5F1SA 5BV7H 1KCRL 3FRUB 4RFNC 3S36L 3DO7A 5D9SA 1KELH 1IKNC 4Q6IA 1X5HA 5EU6D 2QQKL 3IU4L 1KOAA 2HTLC 1OAKL 3ARBD 1BM3H 4RFEB 3UYRH 3Q1SL 3RDTC 5BV7C 1J7VR 3Q5OA 1U91A 2WBWB 3ZHLA 1KJMA 2X4RB 4S1DD 4X4ZA 3R0MA 3BH9A 5MERA 3VMNA 1HI6B 1DBML 5LGHH 3MNZA 4YHOH 3RRQA 3TT1L 4XNUL 3MLRH 3KHOA 4G6JL 3G5ZB 1D5MA 5AUMA 2BXYA 3WD5L 3QI9D 3DX6A 1UKQA 5CKAA 4Y88A 4LCCC 2AS5M 4BA8A 3W81A 1A14L 4PJAF 4QXGL 4AMKH 1PG7X 4X99A 3IFLL 2WW8A 4QWWD 3FOMB 3ZSTA 3HNVH 4G8IA 2XT1B 4JKPL 3OG6B 4DKEL 4GS7C 1XGYL 3HKFA 4L3ED 2DB8A 4PB0H 4YBLB 5D1QB 3MZTA 3ROLB 4C59B 3BZEA 2LVEA 4GG6B 4RNRB 4Y16D 3MA9L 1MFAH 3ARDC 3GGWA 3PGFH 3S37X 3STZA 1MCIA 4ZTOH 1X6LA 1RMFL 2C1PB 1FPTL 3VFMB 4LLUA 3EHBC 3BD4A 4NRZA 3HNTL 2DQUH 4PR5A 3EZJB 4YHMH 2FLRT 4KPHH 1I7RB 4J7RA 1GGIH 4UIMA 3D18A 2I5YH 3JSSA 4MWFB 5HDQL 2EKJA 2AVGA 4LVHC 3I02A 3K81A 3C60B 1WWBX 1KXVC 4M43H 3C5JA 2OTWB 4KJPD 4LDEB 1CLCA 4IOSD 5IBTH 1QO3A 3EFFA 5FECB 2HN7B 5JXEC 3DO7B 4JM2F 3V6BR 4KDTC 1Q38A 4XVTL 4HXBL 1RUQL 2DL9A 1GAFH 5DK2B 1Z2KA 4NDMB 1IGTB 2YPKA 5GRXG 3S36X 4BQ9A 3RQ3A 4RWYL 4HV8B 1NCUA 4S1SL 1NAML 4L3EB 4Y8AA 5KG9B 1AD9B 1JGDB 5T5NF 3DSFH 4R4ND 4IS6A 3HE6D 5H35A 4LP4A 5KS9E 2EDEA 1NBQA 3EDEA 5HY9B 5FCSH 5A40E 3S5LG 4KRPB 1CICD 3GMMA 4Q9CA 3D39E 1HKLL 3W0WB 4MAYD 1MJ7L 3VGAC 3L5WA 1NFIB 2Q3AA 3KXFD 3JV6B 1Z9LA 4OB5H 4ZFZB 5TH2B 5I8OL 1A1OA 1LHZA 4JPIB 3QNXA 3OTTA 1D6VH 2WIIB 3JTTB 1EZVX 1O7VA 4OD3L 1KT2B 3MQIA 2WBKA 3BP7B 4KUCF 3D3VE 2IEPA 5MEND 4X6CB 1HHHA 3TJEH 5DJXA 5IVXB 2XZCH 1TZIA 3GSWB 4WDIB 1A9BA 3WYRA 1ZS8B 2AEIT 3ARDB 2MCPL 2R2CA 1OSZB 4GS7B 2ZKHH 3MLYH 4OIAA 4HJGA 3C8DA 1U8KA 4I2XB 4K8RD 3U82B 5E2VH 2DJ4A 4DN3H 1DZBA 1A4KA 4PRNA 5CP3H 5HJ3B 5GHWL 5KSAA 2MJWA 1U6AH 3P4MA 1VFOA 1CIDA 5EB9A 3O6MH 1IBGL 2XWBA 3V0AC 1LD9A 1EHXA 3BRGC 2RAMA 1JGLH 1FSKB 1X5KA 1CFVL 1UA6H 3HZMA 4UAOB 5IFAL 4I9WE 1JUFB 2GK0B 5JW5B 3HRPA 1H8NA 4OFYD 2ICCA 4YHPA 2HFEA 2EYRB 3UBXA 1B4JH 1Q1JH 5IBUB 2IBZY 2ARJB 5DJYB 3W9DB 1DVFD 3FQTA 1JGDA 2BK8A 2BVQB 2R2HB 1JTTA 5I1CH 5HVWA 1U36A 1LE9A 4JFEB 5DQDH 1MRCH 4W6WB 5IEKB 1F4YH 1V7NH 3ARED 1F2XK 1DBMH 5LGHL 2YPVL 4GOSA 5F7KC 5J06A 1SEBA 1I4FA 3TBYB 3L3OA 5GISH 3REWA 4P2RB 4ISVB 1JF1A 2D03H 5LAXA 3TBTA 1A1OB 5FGRA 4R97C 2IPKA 4B7LA 3B5TA 2AQ2A 4S2SA 3W9EB 4XVSL 3QXWA 1ADQH 4V1DA 2EIZB 1AXSB 1NAMH 3GHEL 4PV9B 5E2UL 3WJLC 1VADA 4F33B 4P3DB 1I1FB 2OZ4H 2AI0L 4WO4D 1A9BB 3CXDH 2IH3A 4S10A 4PJBB 2W9EH 1TVHA 4JM4L 3VMOA 4QOKE 3NZ8A 1VACA 1QYGH 3WDIA 1YZZA 1Y18B 1N0XH 5C6WH 3MUGB 1ND0B 1FZKB 5F7HA 1Q9KB 2E9JA 2WIMA 3GSRB 2V7NB 4G8EB 4QNPF 1CGWA