4JYAE

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4jyaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jyaE02
4JYAI 5GMEA 3LNUA 3JAMC 4WUBA 1ZM4A 4DV7I 2UXCE 4M2ZA 1T4NA 1DARA 1VISA 2X7IA 5L3JA 4LF5I 1Z0BA 4LFBI 2LUPB 4USMA 4DR3I 1HNZI 1Z0TA 4JYAE 4DV0I 1Z0WA 4X8WA 1MU5A 4DV7E 1PKPA 1XNRI 1MX0A 4LF5E 4LFBE 1T4LB 2L2KB 1B62A 1HNZE 1HNWI 1Z59A 4DV0E 3ADLA 1J5EI 3B82A 4DPUA 3V5RA 2HKEA 1GQEA 1N32I 5A2QC 2CZ9A 4GKJI 3PYEA 1XNRE 2HK3A 3H4LA 3K17A 1IBMI 2HFUA 1S16A 2X36A 4EMDA 1ZM3A 4Z7YA 1HNWE 1J5EE 2RS7A 4WYQB 5IT9C 2UXBI 2WW4A 1N32E 1Z5BA 1IBME 2E5LI 1ZBTA 4DXLA 2F4VI 4P52A 2BM1A 2B7VA 1XNQI 4X65I 1UILA 3OTOI 4DR5I 2UXBE 1D6TA 4OOGC 4MYUA 2R42A 1FNMA 3VYYA 2UUBI 2IHR1 2E5LE 2JVAA 2V2QA 1I94I 2F4VE 4LFAI 3ZZ0A 2R3VA 1FI4A 4JI4I 2BV3A 2NA2A 2UU9I 3WU5A 1S4EA 5A2QQ 4JI5E 3HULA 4X65E 1QZRA 4DR5E 1RREA 4B3SE 1STUA 2L33A 2UUBE 2ZM6I 3PYGA 3ADIA 2NUFA 2J7KA 3F0NA 1I94E 3B8HA 4LFAE 3QT5A 4FWHA 4DR7I 3ZZUA 2UU9E 4X62I 5IT9Q 4FN5A 2AJ4A 2OI2A 4DV1I 1PIEA 2BM0A 3GONA 1HR0I 4ZVIA 2Q2EB 2ZM6E 1OJ4A 4GKKI 4JI0I 4DR7E 4JV5I 4X62E 4DUYE 1O0WA 4DV1E 3T1HI 2XEXA 1HR0E 5GMDA 2NUEA 2DEIA 4UT4A 1NHHA 4GKKE 2DIXA 4JI0E 4USKA 1N36I 4JV5E 1KKHA 3T1YI 4PRXA 3T1HE 4B3TI 4HACA 1IBLI 4NXMI 2ZBKB 4DV4I 4DUZI 4X66I 3J80Q 4DPXA 1N36E 4JI2I 1MG7A 2HKJA 3T1YE 4X64I 5LMUI 4WFTA 4B3TE 1RQ0A 3WU3A 1IBLE 4HYMA 4NXME 3ZKBA 4DV4E 4DUZE 2V2ZA 4X66E 1X47A 1ZXMA 2CPNA 1ZM9A 1IBKI 4DV2I 4UTGA 1NHJA 4B3MI 4JI2E 1Z0EA 2B7TA 4YY3I 4X64E 5LMUE 1U2RA 3J7Yp 4Z7CA 4DV3I 4JI8I 1H72C 1YYOA 4LF8I 1H7SA 1Z0GA 1IBKE 3PYFA 4DV2E 3LLHA 1Z5AA 4B3ME 4K0KI 4YY3E 1N0VC 4DV6I 4JI5I 5LMNE 1XMQI 4B3SI 1H74A 4DV3E 2MDRA 4JI8E 1WUUA 2JY9A 2LRSA 4LF8E 4HACB 2V8PA 4K0KE 1KIJA 4DV6E 4LFCI 1UHZA 2A2CA 4M1KA 1XMQE 5FLXQ 2ZITA 4ED4A 3J81Q 1QU6A 4XTJA 3ZZTA 2LJPA 4FW9A 2YT4A 4DU7A 5IWAI 3J80C 1RR9A 4DUYI 2VQEI 4LFCE 2LUQA 1FJGI 1WHQA 1EA6A 2V34A 2EFGA 4WUDA 2L3JA 4DV5I 1RC7A 4DR2I 5IWAE 2VQEE 1N0UA 1FJGE 2B3TB 1FWKA 4LF7I 3PYDA 4DPTA 4YHHI 1EI1A 2UXDE 3ZM7A 1N33I 2HFSA 1J26A 5CFFE 1FWLA 1KTVA 2N3HA 3ZKDA 3C4BA 4DV5E 4RPFA 4LF6I 4KHPI 4PU9A 4JI6I 4DR2E 2LTRA 1HNXI 2LBSB 4B3RI 4LF4I 3ADGA 4LF7E 1BKNA 4LF9I 4KQVA 4YHHE 4MYTA 2HHHI 1N33E 2VQFI 2LTSA 4JI7I 1PVGA 1ELOA 1NHIA 1UEKA 4LF6E 4URLA 4KHPE 2UUAI 4JI6E 5LL6R 1HNXE 3HTXA 4B3RE 2GS8A 4LF4E 4LF9E 2N3GA 2HHHE 2VQFE 5FLXC 3J81C 2DB2A 1ZXNA 4JI7E 1T4OA 1YZ9A 2L2MA 2V2VA 2DMYA 2UUAE 4JI3I 4DR3E 5BR8I 1H73A 5LMNI 1XMOI 4DU8A 4DPYA 4WUCA 2RSMA 2LJHA 4DR1I 3C4TA 1XHKA 4JI1I 4P7AA 2L2NA 1FKAE 4HY1A 1X48A 3K1JA 4JI3E 1WHNA 5BR8E 3LPSA 3JAMQ 1XMOE 4M30A 4HXZA 3CWVA 2EZ6A 1N34I 4DPWA 1X49A 3P1XA 4GKJE 2DEJA 4DR1E 4DR4I 4JI1E 3B78A 1K47A 2UUCI 4DKKA 1KVKA 1Z5CA 2A2DA 2NPFA 4I3HA 3J7AM 2VF3A 2L3CA 1N34E 1ZM2A 4OX9I 1Z0VA 3V2UC 4FWDA 4AQYI 4NXNI 4FWGA 4DR4E 2UUCE 2HK2A 2E1RA 4JG4A 2RS6A 1EKZA 3J7AG 1YYWA 2NUGA 3LTOA 3QT6A 1XNQE 3OTOE 2UXDI 4R1FA 4OX9E 1B63A 3QT7A 1DI2A 4AQYE 4PRVA 4DR6I 1A6FA 4NXNE 3M6AA 2KHXA 3QT8A 4JI4E 2RTXA 3D4JA 3VYXA 1NZ0A 2UXCI 1H7UA 3Q1QA 4DR6E 1Z0CA 3ADJA 3WU6A 3WU4A 1YYKA
chains in the Genus database with same CATH superfamily
4JYAI 2EMLA 5GMEA 2CGEA 3THOB 3LNUA 2KONA 3JAMC 3C6MA 1L4SA 2MKDA 1ZM4A 4WUBA 4DV7I 4O43A 2UXCE 3OMLA 4M2ZA 1T4NA 1DARA 1VISA 2X7IA 5DRRA 5L3JA 4BA2B 4R2RA 4LF5I 1Z0BA 4LFBI 3EQ1A 1X3CA 2LUPB 3P3EA 5ELWA 2YTGA 2GPIA 4R2AA 4USMA 4DR3I 1Z0TA 3PS2A 1HNZI 4BC7A 4JYAE 5ADZA 4DV0I 4R2EA 1Z0WA 3L7ZB 4ZYEA 2LO3A 4X8WA 3BBGA 2Z5BA 3DD6A 4N3OA 1OYPA 2EWLA 2EL5A 1YFHA 1MU5A 3EPHA 4DV7E 1RMDA 4N4RB 1PKPA 1N3GA 1ZR9A 4WSGA 1XNRI 3RMPA 2FTXB 4F9AB 1MX0A 4LF5E 4LFBE 1T4LB 2L2KB 1F2IG 4AIDA 5K36B 2YTNA 1B62A 1HNZE 1HNWI 5A6BD 2V88A 3TQMA 1Z59A 4DV0E 2ELYA 3ADLA 2CG9A 1J5EI 2JR1A 2JT2A 3B82A 4DPUA 2EOHA 3V5RA 4L8NA 2GQ0A 5C0XB 2HKEA 1GQEA 2CSHA 5A2QC 2EOOA 2CZ9A 4GKJI 1N32I 3PYEA 5AC4A 1XNRE 2HK3A 3H4LA 2K7IA 3K17A 2R76A 2EQ1A 2EMWA 1IBMI 4OO1E 2RQLA 2HFUA 1S16A 2X36A 4BCAA 2IESA 1T39A 2ODRD 2EMGA 2R1FA 5EKWA 4EMDA 2FGGA 1ZM3A 4Z7YA 2Q8UA 2VESA 3JU0A 2YZTA 1HNWE 3KZZA 2HJJA 2JEAB 3IWBA 1J5EE 2LE2A 1X6EA 2RS7A 4WYQB 5KL6A 2EM4A 3P3GA 4FW6A 5IT9C 1QNTA 2BA1D 2UXBI 5A69A 2WW4A 1KYQA 2DLQA 1N32E 2BR2B 1Z5BA 5DRPA 1IBME 2V86A 2E5LI 1ZBTA 3EPJA 2IERA 2Z5CB 4DXLA 2F4VI 4TUGA 2YTJA 4P52A 3HKMA 4IZKB 1A1LA 2EM7A 3VHTB 1JK2A 2V89A 2EMCA 2G7HA 2BM1A 2B7VA 1G2DC 1TN9A 1XNQI 3H1CA 4X65I 1UILA 3OTOI 1YPNA 4BS9A 2UXBE 2BA0G 2GO4A 2DRPA 4DR5I 1D6TA 4OOGC 4MYUA 2R42A 1FNMA 2YTDA 3VYYA 2UUBI 2IHR1 3H09A 2EE8A 2E5LE 2JVAA 1IMUA 4R2SA 2YU8A 2F4VE 2V2QA 1I94I 4LFAI 1KJKA 2PO2A 3ZZ0A 2EMFA 4WSPA 5A6JA 2R3VA 1FI4A 4JI4I 2BV3A 2C39A 3M85G 2NA2A 2AE8A 5EL9A 2EOMA 2UU9I 3WU5A 5AE3A 1S4EA 4BBYA 3IWDA 4OO1F 5A2QQ 4JI5E 3F6GA 1IQSA 3HULA 4X65E 1QZRA 2GHFA 1ZBQA 2YSPA 4P7DA 4DR5E 1RREA 2O1TA 1STUA 4B3SE 2L33A 3EPLA 4I8OA 4MDTA 1YH8A 2EM9A 2YRKA 1DGCA 2UUBE 2ZM6I 3PYGA 3ADIA 4QNKA 2NUFA 5JEAE 2J7KA 3F0NA 2PRTA 3DJWA 2EMAA 1I94E 3B8HA 4LFAE 3QT5A 4FWHA 2PNLA 4DR7I 2YRMA 5IXMB 4WX9A 4GQUA 4NBQA 3ZZUA 3THNA 2UU9E 4X62I 5IT9Q 4FN5A 2V8QB 2AJ4A 3QG5C 3BIDA 2YU5A 2OI2A 2EM0A 2MKNA 4DV1I 1PIEA 2BM0A 2EPCA 4FW7A 3GONA 4IS9A 1HR0I 2L8TA 4ZVIA 2Q2EB 3VK6A 2ZM6E 1OJ4A 2RPCA 4GKKI 2EOXA 2YTPA 4LTYA 4L5NC 4JI0I 3M7ND 2HGHA 1A1FA 1MGTA 4DR7E 2C37A 3M99B 4JV5I 3F6HA 4X62E 1PDAA 5C0XD 2EOFA 2EOQA 4DUYE 5DRQA 1O0WA 3Q6NA 1P42A 4DV1E 2EN3A 3T1HI 4IFDE 1WRJA 1A1KA 1PJQA 1DQ3A 2EPUA 2YRHA 2JPAA 1HK7A 1HR0E 2XEXA 3U1KA 5GMDA 4MLQA 2JXPA 2NUEA 2HC5A 3BF2A 2DEIA 1NHHA 3GMEA 4UT4A 4GKKE 2DIXA 4JI0E 4OO1A 4USKA 3CDIA 2NN6E 1N36I 4JV5E 3L00A 3NZKA 1KKHA 3T1YI 5K36E 4PRXA 3PRYA 5JEAF 1MEYC 2EPRA 2EOZA 3KWRA 3T1HE 2PO2B 4B3TI 4HACA 1IBLI 2C39B 2ZBKB 4NXMI 2WP8B 4WPYA 4DUZI 1E3PA 4DV4I 1WJPA 4X66I 2EMXA 3IWCA 4IJDA 2JEBA 2RSIA 4ZYDA 3J80Q 1Y5YA 4DPXA 1N36E 2WNRA 2JOBA 4X9JA 1MG7A 2F1DA 2F8BA 2HKJA 4JI2I 2BBGA 2ELZA 3T1YE 4OZEA 4X64I 5LMUI 4WFTA 4B3TE 2J65A 1NCSA 1RQ0A 3WU3A 1IBLE 1X6FA 2L6MA 3ZOQB 4HYMA 4NXME 2M1SA 2N8XA 3ZKBA 2EJ4A 4DV4E 4DUZE 4GZNC 2V2ZA 3P06A 4X66E 2DGCA 3KZYA 4KZSA 1X47A 2WBUA 2EPXA 4RH8A 1ZXMA 2CPNA 1ZM9A 3K6QA 2O1WA 1IBKI 4IFDF 2ENHA 2IOQA 4DV2I 1E3HA 4UTGA 1NHJA 4IZJA 4B3MI 4FW4A 4JI2E 1Z0EA 3GLLA 2B7TA 4YY3I 4AIMA 4X64E 3M85D 5LMUE 1U2RA 2DSYA 4IFDC 2E72A 2MC5A 3J7Yp 4GEQB 4Z7CA 4DV3I 2C37B 4JI8I 1NEIA 2NN6F 2C38A 1H72C 1YYOA 2EN2A 3P3CA 4LF8I 1H7SA 1Z0GA 5JEAA 1IBKE 1A1JA 3PYFA 3ECRA 4HEIA 4DV2E 3LLHA 1Z5AA 4B3ME 4K0KI 2NN6C 2YTIA 3FIGA 4YY3E 1N0VC 4DV6I 4JI5I 5LMNE 4LU9A 4MLVA 2JWOA 1XMQI 2I9IA 2PNZA 4B3SI 1H74A 2PO0A 4DV3E 2V85A 1BBGA 3MSWA 2MDRA 4JI8E 1AAYA 1WUUA 2EN6A 2Z5BB 4BA1A 2JY9A 2LRSA 2WBTA 2NABA 4LF8E 5KL4A 4HACB 1A1GA 2I13A 2V8PA 4K0KE 1BBOA 2JE6A 1KIJA 4BHBA 4DV6E 4LFCI 1GZ6A 1UHZA 1WXRA 3P76A 2A2CA 2ENCA 2EOIA 4M1KA 1XMQE 1A1HA 1IQOA 4DMIA 4LPFA 5FLXQ 1ZU1A 2ZITA 5KL7A 2LV2A 2JEBB 4FW5A 4ED4A 3J81Q 3AUZA 1QU6A 4IFDA 4P78A 2WNRB 4OO1C 3L7ZA 4XTJA 4LCHA 5DNXA 3ZZTA 2GLIA 2VF1A 4MU1A 1AH5A 4F54A 2LJPA 4FW9A 4LCGA 2YSOA 3CDJA 2YT4A 4DU7A 4RHBB 5IWAI 1G2FC 1EH7A 3J80C 2EM8A 1RR9A 4DUYI 2DLKA 2VQEI 4LFCE 3BGHA 2NN6A 2EM3A 2LUQA 1FJGI 2EN7A 1A1IA 2CVEA 5K36A 2YTOA 2V87A 2WCC3 1WHQA 1OYRA 4OKGA 2YTFA 1EA6A 2V34A 4LCFA 2EFGA 1B69A 4R2PA 4WUDA 2L3JA 4DV5I 2O1VA 2GO3A 4LOMA 4F9CB 4BHCA 5C0XA 1RC7A 4DR2I 1PJSA 2EL6A 4ZYGA 5IWAE 4WXCA 4TUIA 4Q35B 3HPZA 4Q28A 2VQEE 2EN8A 1N0UA 2C38B 2EPAA 4R2DA 1FJGE 2B3TB 1FWKA 4LF7I 3GCMA 2EMHA 3MHSC 3PYDA 4U3DA 4DPTA 4YHHI 1EI1A 2UXDE 3ZM7A 1N33I 2HFSA 3EPKA 1JK1A 1J26A 2EPMX 5CFFE 1FWLA 1KTVA 2JEAA 2N3HA 3ZKDA 3C4BA 1P47A 1UDOA 4U3BA 4FK5C 4DV5E 2M9AA 3JTZA 4MU4A 4RPFA 2B9DA 4PU9A 4LF6I 4KHPI 2PO0B 4JI6I 5DNLA 4DR2E 1X6HA 2LTRA 2BR2A 1HNXI 2PO1A 2LBSB 1R6MA 4WXDA 4J3DA 4M9VC 4B3RI 4LF4I 2Z5CA 3ADGA 4BA1B 4LF7E 1BKNA 4LF9I 2EPZA 4KQVA 2EMKA 4YHHE 4IZKA 4MYTA 2A25A 2LCEA 2Z5EA 3HQ1A 2HHHI 2EM5A 1N33E 4MU0A 2VQFI 2LTSA 3PS3A 2JE6B 2YTQA 5JEAC 5C0XE 4JI7I 4O5GA 3HXLA 1X5WA 2M7QA 5A6BA 1BB8A 1PVGA 1SFEA 4F6NA 1ELOA 1NHIA 1UEKA 4LF6E 4URLA 4KHPE 2UUAI 2EMBA 2EORA 5LL6R 2WBSA 1SR9A 4JI6E 5AASA 1HNXE 2IOPA 2H36X 3C6KA 4IFDB 4OO1D 1XXEA 1VI7A 3HTXA 1EH6A 4B3RE 2GS8A 4MQYA 4LF4E 1Y6ZA 2ENAA 4LF9E 2EPPA 2LVHA 2N3GA 1PJTA 2HHHE 3M7NG 4NHRA 2VQFE 2EP3A 4AM3A 5FLXC 3J81C 1T38A 1YUIA 2BA0D 2DB2A 2YTEA 1ZXNA 4JI7E 2EN1A 1T4OA 2NN6B 1YZ9A 2FV4B 2L2MA 2V2VA 2DMYA 2UUAE 2EMYA 1USVA 4JI3I 4M0VA 4DR3E 2EL4A 5AC5A 5BR8I 1H73A 5LMNI 1XMOI 3KRNA 2JOXA 5FWKA 4DU8A 4DPYA 4WUCA 5TSEA 3HJCA 2RSMA 2EOYA 1Y60A 2LJHA 5T6JA 4O4KA 2LJUA 5A6KA 2O1UA 4DR1I 3C4TA 1XHKA 2EPLX 2O3ZA 4JI1I 4P7AA 3UHMA 2EM6A 2CT1A 2L2NA 5K36F 3UK3C 1UDNA 2V83A 4IS1C 1FKAE 4HY1A 2K4VA 4F6MA 1X48A 4J8ZA 3K1JA 4F9BB 2EOJA 2MDGA 4JI3E 4ISAA 1WHNA 5BR8E 2EMIA 2JP9A 3LPSA 3JAMQ 2EOSA 1XMOE 1UDQA 5K36C 4M30A 4HXZA 5C0XF 2EN4A 3CWVA 4IZJD 2EZ6A 1N34I 4OO1B 2EQ3A 4FW3A 2EPOA 1YHCA 4DPWA 1X49A 4NZVA 3P1XA 4GKJE 1UBDC 3B4TA 4BMJA 2PO1B 2DEJA 1OYSA 2LT7A 2YWQA 4DR1E 4DR4I 5AE1A 4JI1E 3B78A 5C0XC 1K47A 2UUCI 4DKKA 2J7JA 1KVKA 1Z5CA 2A2DA 3MHHC 4MU3A 4KWYA 4BC9A 2BB8A 2EPNA 2NPFA 5KL3A 2D9HA 4I3HA 4BA2A 4QNJA 5JEAD 3J7AM 1YUJA 4F2JC 2VF3A 2YPNA 2L3CA 1N34E 2CTDA 3HPSA 4R2QA 1ZM2A 4OX9I 1Z0VA 1GTKA 4FWDA 3V2UC 4AQYI 2EMZA 5DNYA 4NXNI 4FWGA 4DR4E 2DMIA 2MC6A 2UUCE 3U1YA 4R8OA 2HK2A 2L92A 2LMZA 4PRVA 2BA1G 3DF6A 2E1RA 2WP8A 2RS6A 5LLQA 1EKZA 3J7AG 4JG4A 1YYWA 2NUGA 3K85A 3PS1A 3LTOA 3QT6A 1XNQE 2E1MA 2EQ0A 1R6LA 3OTOE 2UXDI 3AV0A 4R1FA 1YSAC 2KOUA 4OX9E 1B63A 5A6AA 2VRDA 4AQYE 1DI2A 1Y4UA 1Y4SA 3QT7A 4IZJB 1A6FA 4DR6I 4NXNE 2EPKX 4O24A 3Q6MA 2M4IA 1UN6B 3M6AA 1RHYA 4IFDD 4ZYHA 2KHXA 5AE2A 3QT8A 4JI4E 1TF3A 2RTXA 3LMLA 1ZAAC 2VE7C 1TF6A 2WZOA 4R03A 5DROA 3D4JA 3VYXA 2ODRC 2EM2A 1NZ0A 5JEAB 2EOEA 5KL2A 2UXCI 1H7UA 3Q1QA 2NN6D 5KL5A 1EH8A 4DR6E 1Z0CA 3ADJA 5K36D 1UDSA 2ADRA 1LLMC 3WU6A 2PNMA 1USUA 2JYAA 4HTGA 4R2CA 2PNZB 5IV8B 1Z1BA 3WU4A 5F3WA 1YYKA
chains in the Genus database with same CATH topology
4JYAI 5GMEA 2CGEA 3LNUA 2KONA 3JAMC 4WUBA 1ZM4A 4DV7I 2UXCE 3OMLA 4M2ZA 1T4NA 1DARA 1VISA 2X7IA 5L3JA 4LF5I 1Z0BA 4LFBI 2LUPB 4USMA 4DR3I 1HNZI 1Z0TA 4BC7A 4JYAE 5ADZA 4DV0I 1Z0WA 4X8WA 2Z5BA 4N3OA 2EWLA 1MU5A 4DV7E 1PKPA 1XNRI 3RMPA 2FTXB 4F9AB 1MX0A 4LF5E 4LFBE 1T4LB 2L2KB 1B62A 1HNZE 1HNWI 2V88A 1Z59A 4DV0E 2CG9A 3ADLA 1J5EI 2JR1A 3B82A 4DPUA 3V5RA 4L8NA 2GQ0A 2HKEA 1GQEA 1N32I 5A2QC 2CZ9A 4GKJI 3PYEA 1XNRE 2HK3A 3H4LA 3K17A 1IBMI 2HFUA 1S16A 2X36A 4BCAA 2ODRD 4EMDA 2FGGA 1ZM3A 4Z7YA 3JU0A 2YZTA 1HNWE 3IWBA 1J5EE 2LE2A 2RS7A 4WYQB 5IT9C 2UXBI 2WW4A 1N32E 1Z5BA 1IBME 2V86A 2E5LI 1ZBTA 2Z5CB 4DXLA 2F4VI 4TUGA 4P52A 4IZKB 2V89A 2G7HA 2BM1A 2B7VA 1XNQI 4X65I 1UILA 3OTOI 4DR5I 4BS9A 2UXBE 1D6TA 4OOGC 4MYUA 2R42A 1FNMA 3VYYA 2UUBI 2IHR1 3H09A 2E5LE 2JVAA 2V2QA 1I94I 2F4VE 4LFAI 3ZZ0A 4WSPA 2R3VA 1FI4A 4JI4I 2BV3A 2NA2A 2UU9I 3WU5A 5AE3A 1S4EA 4BBYA 3IWDA 5A2QQ 4JI5E 3F6GA 3HULA 4X65E 1QZRA 2O1TA 1ZBQA 4DR5E 4P7DA 1RREA 4B3SE 1STUA 2L33A 4I8OA 2UUBE 2ZM6I 3PYGA 3ADIA 2NUFA 2J7KA 3F0NA 3DJWA 1I94E 3B8HA 4LFAE 3QT5A 4FWHA 2PNLA 4DR7I 3ZZUA 2UU9E 4X62I 5IT9Q 4FN5A 2V8QB 2AJ4A 2OI2A 4DV1I 1PIEA 2BM0A 3GONA 1HR0I 2L8TA 4ZVIA 2Q2EB 3VK6A 2ZM6E 1OJ4A 4GKKI 4LTYA 4L5NC 4JI0I 4DR7E 4JV5I 3F6HA 4X62E 4DUYE 1O0WA 3Q6NA 4DV1E 3T1HI 1DQ3A 1HK7A 1HR0E 2XEXA 5GMDA 2NUEA 2DEIA 4UT4A 1NHHA 4GKKE 2DIXA 4JI0E 4USKA 1N36I 4JV5E 1KKHA 3T1YI 4PRXA 3PRYA 3KWRA 3T1HE 4B3TI 4HACA 1IBLI 4NXMI 2ZBKB 4WPYA 4DUZI 4DV4I 4X66I 3IWCA 3J80Q 4DPXA 1N36E 2JOBA 1MG7A 4JI2I 2F8BA 2HKJA 3T1YE 4X64I 5LMUI 4WFTA 4B3TE 1RQ0A 3WU3A 1IBLE 2L6MA 3ZOQB 4HYMA 4NXME 2M1SA 3ZKBA 4DV4E 4DUZE 2V2ZA 3P06A 4X66E 4KZSA 1X47A 1ZXMA 2CPNA 1ZM9A 3K6QA 2O1WA 1IBKI 2IOQA 4DV2I 4UTGA 1NHJA 4IZJA 4B3MI 4JI2E 1Z0EA 2B7TA 4YY3I 4X64E 5LMUE 1U2RA 2DSYA 2MC5A 3J7Yp 4GEQB 4Z7CA 4DV3I 4JI8I 1H72C 1YYOA 4LF8I 1H7SA 1Z0GA 1IBKE 3PYFA 4DV2E 3LLHA 1Z5AA 4B3ME 4K0KI 3FIGA 4YY3E 1N0VC 4DV6I 4JI5I 5LMNE 4LU9A 2JWOA 1XMQI 4B3SI 1H74A 4DV3E 2V85A 3MSWA 2MDRA 4JI8E 1WUUA 2Z5BB 2JY9A 2LRSA 4LF8E 4HACB 2V8PA 4K0KE 1KIJA 4DV6E 4LFCI 1GZ6A 1UHZA 1WXRA 2A2CA 4M1KA 1XMQE 4DMIA 5FLXQ 2ZITA 4ED4A 3J81Q 3AUZA 1QU6A 4P78A 4XTJA 3ZZTA 2VF1A 4F54A 2LJPA 4FW9A 2YT4A 4DU7A 5IWAI 3J80C 1RR9A 4DUYI 2VQEI 4LFCE 2LUQA 1FJGI 2V87A 1WHQA 1EA6A 2V34A 2EFGA 4WUDA 2L3JA 4DV5I 2O1VA 4F9CB 1RC7A 4DR2I 5IWAE 4TUIA 3HPZA 4Q28A 2VQEE 1N0UA 1FJGE 2B3TB 1FWKA 4LF7I 3PYDA 4DPTA 4YHHI 1EI1A 2UXDE 3ZM7A 1N33I 2HFSA 1J26A 5CFFE 1FWLA 1KTVA 2N3HA 3ZKDA 3C4BA 4DV5E 3JTZA 4RPFA 4LF6I 2B9DA 4PU9A 4KHPI 4JI6I 4DR2E 2LTRA 1HNXI 2LBSB 4B3RI 4LF4I 2Z5CA 3ADGA 4LF7E 1BKNA 4LF9I 4KQVA 4YHHE 4IZKA 4MYTA 2Z5EA 2HHHI 3HQ1A 1N33E 2VQFI 2LTSA 4JI7I 3HXLA 2M7QA 1PVGA 1ELOA 1NHIA 1UEKA 4LF6E 4URLA 4KHPE 2UUAI 5LL6R 4JI6E 2IOPA 1SR9A 5AASA 1HNXE 2H36X 3HTXA 4B3RE 2GS8A 4LF4E 1Y6ZA 4LF9E 2N3GA 2HHHE 2VQFE 5FLXC 3J81C 2DB2A 1ZXNA 4JI7E 1T4OA 1YZ9A 2FV4B 2L2MA 2V2VA 2DMYA 2UUAE 1USVA 4JI3I 4M0VA 4DR3E 5BR8I 1H73A 5LMNI 1XMOI 2JOXA 5FWKA 4DU8A 4DPYA 4WUCA 3HJCA 2RSMA 2LJHA 5T6JA 2O1UA 4DR1I 3C4TA 1XHKA 4JI1I 4P7AA 2L2NA 2V83A 1FKAE 4HY1A 2K4VA 1X48A 4J8ZA 3K1JA 4F9BB 4JI3E 1WHNA 5BR8E 3LPSA 3JAMQ 1XMOE 4M30A 4HXZA 3CWVA 4IZJD 2EZ6A 1N34I 4DPWA 1X49A 3P1XA 4GKJE 4BMJA 2DEJA 4DR1E 4DR4I 5AE1A 4JI1E 3B78A 1K47A 2UUCI 4DKKA 1KVKA 1Z5CA 2A2DA 4BC9A 2NPFA 4I3HA 3J7AM 2VF3A 2L3CA 1N34E 3HPSA 1ZM2A 4OX9I 1Z0VA 3V2UC 4FWDA 4AQYI 5DNYA 4NXNI 4FWGA 4DR4E 2MC6A 2UUCE 4R8OA 2HK2A 2L92A 2LMZA 3DF6A 2E1RA 4JG4A 2RS6A 1EKZA 3J7AG 1YYWA 2NUGA 3K85A 3LTOA 3QT6A 1XNQE 2E1MA 3OTOE 2UXDI 3AV0A 4R1FA 2KOUA 4OX9E 1B63A 1DI2A 4AQYE 1Y4UA 3QT7A 1Y4SA 4IZJB 4PRVA 4DR6I 1A6FA 4NXNE 3Q6MA 2M4IA 3M6AA 2KHXA 5AE2A 3QT8A 4JI4E 2RTXA 3LMLA 2VE7C 2WZOA 4R03A 3D4JA 3VYXA 2ODRC 1NZ0A 2UXCI 1H7UA 3Q1QA 4DR6E 1Z0CA 3ADJA 3WU6A 2PNMA 1USUA 3WU4A 5F3WA 1YYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA I;  5GME A;  3LNU A;  3JAM C;  4WUB A;  1ZM4 A;  4DV7 I;  2UXC E;  4M2Z A;  1T4N A;  1DAR A;  1VIS A;  2X7I A;  5L3J A;  4LF5 I;  1Z0B A;  4LFB I;  2LUP B;  4USM A;  4DR3 I;  1HNZ I;  1Z0T A;  4JYA E;  4DV0 I;  1Z0W A;  4X8W A;  1MU5 A;  4DV7 E;  1PKP A;  1XNR I;  1MX0 A;  4LF5 E;  4LFB E;  1T4L B;  2L2K B;  1B62 A;  1HNZ E;  1HNW I;  1Z59 A;  4DV0 E;  3ADL A;  1J5E I;  3B82 A;  4DPU A;  3V5R A;  2HKE A;  1GQE A;  1N32 I;  5A2Q C;  2CZ9 A;  4GKJ I;  3PYE A;  1XNR E;  2HK3 A;  3H4L A;  3K17 A;  1IBM I;  2HFU A;  1S16 A;  2X36 A;  4EMD A;  1ZM3 A;  4Z7Y A;  1HNW E;  1J5E E;  2RS7 A;  4WYQ B;  5IT9 C;  2UXB I;  2WW4 A;  1N32 E;  1Z5B A;  1IBM E;  2E5L I;  1ZBT A;  4DXL A;  2F4V I;  4P52 A;  2BM1 A;  2B7V A;  1XNQ I;  4X65 I;  1UIL A;  3OTO I;  4DR5 I;  2UXB E;  1D6T A;  4OOG C;  4MYU A;  2R42 A;  1FNM A;  3VYY A;  2UUB I;  2IHR 1;  2E5L E;  2JVA A;  2V2Q A;  1I94 I;  2F4V E;  4LFA I;  3ZZ0 A;  2R3V A;  1FI4 A;  4JI4 I;  2BV3 A;  2NA2 A;  2UU9 I;  3WU5 A;  1S4E A;  5A2Q Q;  4JI5 E;  3HUL A;  4X65 E;  1QZR A;  4DR5 E;  1RRE A;  4B3S E;  1STU A;  2L33 A;  2UUB E;  2ZM6 I;  3PYG A;  3ADI A;  2NUF A;  2J7K A;  3F0N A;  1I94 E;  3B8H A;  4LFA E;  3QT5 A;  4FWH A;  4DR7 I;  3ZZU A;  2UU9 E;  4X62 I;  5IT9 Q;  4FN5 A;  2AJ4 A;  2OI2 A;  4DV1 I;  1PIE A;  2BM0 A;  3GON A;  1HR0 I;  4ZVI A;  2Q2E B;  2ZM6 E;  1OJ4 A;  4GKK I;  4JI0 I;  4DR7 E;  4JV5 I;  4X62 E;  4DUY E;  1O0W A;  4DV1 E;  3T1H I;  2XEX A;  1HR0 E;  5GMD A;  2NUE A;  2DEI A;  4UT4 A;  1NHH A;  4GKK E;  2DIX A;  4JI0 E;  4USK A;  1N36 I;  4JV5 E;  1KKH A;  3T1Y I;  4PRX A;  3T1H E;  4B3T I;  4HAC A;  1IBL I;  4NXM I;  2ZBK B;  4DV4 I;  4DUZ I;  4X66 I;  3J80 Q;  4DPX A;  1N36 E;  4JI2 I;  1MG7 A;  2HKJ A;  3T1Y E;  4X64 I;  5LMU I;  4WFT A;  4B3T E;  1RQ0 A;  3WU3 A;  1IBL E;  4HYM A;  4NXM E;  3ZKB A;  4DV4 E;  4DUZ E;  2V2Z A;  4X66 E;  1X47 A;  1ZXM A;  2CPN A;  1ZM9 A;  1IBK I;  4DV2 I;  4UTG A;  1NHJ A;  4B3M I;  4JI2 E;  1Z0E A;  2B7T A;  4YY3 I;  4X64 E;  5LMU E;  1U2R A;  3J7Y p;  4Z7C A;  4DV3 I;  4JI8 I;  1H72 C;  1YYO A;  4LF8 I;  1H7S A;  1Z0G A;  1IBK E;  3PYF A;  4DV2 E;  3LLH A;  1Z5A A;  4B3M E;  4K0K I;  4YY3 E;  1N0V C;  4DV6 I;  4JI5 I;  5LMN E;  1XMQ I;  4B3S I;  1H74 A;  4DV3 E;  2MDR A;  4JI8 E;  1WUU A;  2JY9 A;  2LRS A;  4LF8 E;  4HAC B;  2V8P A;  4K0K E;  1KIJ A;  4DV6 E;  4LFC I;  1UHZ A;  2A2C A;  4M1K A;  1XMQ E;  5FLX Q;  2ZIT A;  4ED4 A;  3J81 Q;  1QU6 A;  4XTJ A;  3ZZT A;  2LJP A;  4FW9 A;  2YT4 A;  4DU7 A;  5IWA I;  3J80 C;  1RR9 A;  4DUY I;  2VQE I;  4LFC E;  2LUQ A;  1FJG I;  1WHQ A;  1EA6 A;  2V34 A;  2EFG A;  4WUD A;  2L3J A;  4DV5 I;  1RC7 A;  4DR2 I;  5IWA E;  2VQE E;  1N0U A;  1FJG E;  2B3T B;  1FWK A;  4LF7 I;  3PYD A;  4DPT A;  4YHH I;  1EI1 A;  2UXD E;  3ZM7 A;  1N33 I;  2HFS A;  1J26 A;  5CFF E;  1FWL A;  1KTV A;  2N3H A;  3ZKD A;  3C4B A;  4DV5 E;  4RPF A;  4LF6 I;  4KHP I;  4PU9 A;  4JI6 I;  4DR2 E;  2LTR A;  1HNX I;  2LBS B;  4B3R I;  4LF4 I;  3ADG A;  4LF7 E;  1BKN A;  4LF9 I;  4KQV A;  4YHH E;  4MYT A;  2HHH I;  1N33 E;  2VQF I;  2LTS A;  4JI7 I;  1PVG A;  1ELO A;  1NHI A;  1UEK A;  4LF6 E;  4URL A;  4KHP E;  2UUA I;  4JI6 E;  5LL6 R;  1HNX E;  3HTX A;  4B3R E;  2GS8 A;  4LF4 E;  4LF9 E;  2N3G A;  2HHH E;  2VQF E;  5FLX C;  3J81 C;  2DB2 A;  1ZXN A;  4JI7 E;  1T4O A;  1YZ9 A;  2L2M A;  2V2V A;  2DMY A;  2UUA E;  4JI3 I;  4DR3 E;  5BR8 I;  1H73 A;  5LMN I;  1XMO I;  4DU8 A;  4DPY A;  4WUC A;  2RSM A;  2LJH A;  4DR1 I;  3C4T A;  1XHK A;  4JI1 I;  4P7A A;  2L2N A;  1FKA E;  4HY1 A;  1X48 A;  3K1J A;  4JI3 E;  1WHN A;  5BR8 E;  3LPS A;  3JAM Q;  1XMO E;  4M30 A;  4HXZ A;  3CWV A;  2EZ6 A;  1N34 I;  4DPW A;  1X49 A;  3P1X A;  4GKJ E;  2DEJ A;  4DR1 E;  4DR4 I;  4JI1 E;  3B78 A;  1K47 A;  2UUC I;  4DKK A;  1KVK A;  1Z5C A;  2A2D A;  2NPF A;  4I3H A;  3J7A M;  2VF3 A;  2L3C A;  1N34 E;  1ZM2 A;  4OX9 I;  1Z0V A;  3V2U C;  4FWD A;  4AQY I;  4NXN I;  4FWG A;  4DR4 E;  2UUC E;  2HK2 A;  2E1R A;  4JG4 A;  2RS6 A;  1EKZ A;  3J7A G;  1YYW A;  2NUG A;  3LTO A;  3QT6 A;  1XNQ E;  3OTO E;  2UXD I;  4R1F A;  4OX9 E;  1B63 A;  3QT7 A;  1DI2 A;  4AQY E;  4PRV A;  4DR6 I;  1A6F A;  4NXN E;  3M6A A;  2KHX A;  3QT8 A;  4JI4 E;  2RTX A;  3D4J A;  3VYX A;  1NZ0 A;  2UXC I;  1H7U A;  3Q1Q A;  4DR6 E;  1Z0C A;  3ADJ A;  3WU6 A;  3WU4 A;  1YYK A; 
#chains in the Genus database with same CATH topology
 4JYA I;  2EML A;  5GME A;  2CGE A;  3THO B;  3LNU A;  2KON A;  3JAM C;  3C6M A;  1L4S A;  2MKD A;  1ZM4 A;  4WUB A;  4DV7 I;  4O43 A;  2UXC E;  3OML A;  4M2Z A;  1T4N A;  1DAR A;  1VIS A;  2X7I A;  5DRR A;  5L3J A;  4BA2 B;  4R2R A;  4LF5 I;  1Z0B A;  4LFB I;  3EQ1 A;  1X3C A;  2LUP B;  3P3E A;  5ELW A;  2YTG A;  2GPI A;  4R2A A;  4USM A;  4DR3 I;  1Z0T A;  3PS2 A;  1HNZ I;  4BC7 A;  4JYA E;  5ADZ A;  4DV0 I;  4R2E A;  1Z0W A;  3L7Z B;  4ZYE A;  2LO3 A;  4X8W A;  3BBG A;  2Z5B A;  3DD6 A;  4N3O A;  1OYP A;  2EWL A;  2EL5 A;  1YFH A;  1MU5 A;  3EPH A;  4DV7 E;  1RMD A;  4N4R B;  1PKP A;  1N3G A;  1ZR9 A;  4WSG A;  1XNR I;  3RMP A;  2FTX B;  4F9A B;  1MX0 A;  4LF5 E;  4LFB E;  1T4L B;  2L2K B;  1F2I G;  4AID A;  5K36 B;  2YTN A;  1B62 A;  1HNZ E;  1HNW I;  5A6B D;  2V88 A;  3TQM A;  1Z59 A;  4DV0 E;  2ELY A;  3ADL A;  2CG9 A;  1J5E I;  2JR1 A;  2JT2 A;  3B82 A;  4DPU A;  2EOH A;  3V5R A;  4L8N A;  2GQ0 A;  5C0X B;  2HKE A;  1GQE A;  2CSH A;  5A2Q C;  2EOO A;  2CZ9 A;  4GKJ I;  1N32 I;  3PYE A;  5AC4 A;  1XNR E;  2HK3 A;  3H4L A;  2K7I A;  3K17 A;  2R76 A;  2EQ1 A;  2EMW A;  1IBM I;  4OO1 E;  2RQL A;  2HFU A;  1S16 A;  2X36 A;  4BCA A;  2IES A;  1T39 A;  2ODR D;  2EMG A;  2R1F A;  5EKW A;  4EMD A;  2FGG A;  1ZM3 A;  4Z7Y A;  2Q8U A;  2VES A;  3JU0 A;  2YZT A;  1HNW E;  3KZZ A;  2HJJ A;  2JEA B;  3IWB A;  1J5E E;  2LE2 A;  1X6E A;  2RS7 A;  4WYQ B;  5KL6 A;  2EM4 A;  3P3G A;  4FW6 A;  5IT9 C;  1QNT A;  2BA1 D;  2UXB I;  5A69 A;  2WW4 A;  1KYQ A;  2DLQ A;  1N32 E;  2BR2 B;  1Z5B A;  5DRP A;  1IBM E;  2V86 A;  2E5L I;  1ZBT A;  3EPJ A;  2IER A;  2Z5C B;  4DXL A;  2F4V I;  4TUG A;  2YTJ A;  4P52 A;  3HKM A;  4IZK B;  1A1L A;  2EM7 A;  3VHT B;  1JK2 A;  2V89 A;  2EMC A;  2G7H A;  2BM1 A;  2B7V A;  1G2D C;  1TN9 A;  1XNQ I;  3H1C A;  4X65 I;  1UIL A;  3OTO I;  1YPN A;  4BS9 A;  2UXB E;  2BA0 G;  2GO4 A;  2DRP A;  4DR5 I;  1D6T A;  4OOG C;  4MYU A;  2R42 A;  1FNM A;  2YTD A;  3VYY A;  2UUB I;  2IHR 1;  3H09 A;  2EE8 A;  2E5L E;  2JVA A;  1IMU A;  4R2S A;  2YU8 A;  2F4V E;  2V2Q A;  1I94 I;  4LFA I;  1KJK A;  2PO2 A;  3ZZ0 A;  2EMF A;  4WSP A;  5A6J A;  2R3V A;  1FI4 A;  4JI4 I;  2BV3 A;  2C39 A;  3M85 G;  2NA2 A;  2AE8 A;  5EL9 A;  2EOM A;  2UU9 I;  3WU5 A;  5AE3 A;  1S4E A;  4BBY A;  3IWD A;  4OO1 F;  5A2Q Q;  4JI5 E;  3F6G A;  1IQS A;  3HUL A;  4X65 E;  1QZR A;  2GHF A;  1ZBQ A;  2YSP A;  4P7D A;  4DR5 E;  1RRE A;  2O1T A;  1STU A;  4B3S E;  2L33 A;  3EPL A;  4I8O A;  4MDT A;  1YH8 A;  2EM9 A;  2YRK A;  1DGC A;  2UUB E;  2ZM6 I;  3PYG A;  3ADI A;  4QNK A;  2NUF A;  5JEA E;  2J7K A;  3F0N A;  2PRT A;  3DJW A;  2EMA A;  1I94 E;  3B8H A;  4LFA E;  3QT5 A;  4FWH A;  2PNL A;  4DR7 I;  2YRM A;  5IXM B;  4WX9 A;  4GQU A;  4NBQ A;  3ZZU A;  3THN A;  2UU9 E;  4X62 I;  5IT9 Q;  4FN5 A;  2V8Q B;  2AJ4 A;  3QG5 C;  3BID A;  2YU5 A;  2OI2 A;  2EM0 A;  2MKN A;  4DV1 I;  1PIE A;  2BM0 A;  2EPC A;  4FW7 A;  3GON A;  4IS9 A;  1HR0 I;  2L8T A;  4ZVI A;  2Q2E B;  3VK6 A;  2ZM6 E;  1OJ4 A;  2RPC A;  4GKK I;  2EOX A;  2YTP A;  4LTY A;  4L5N C;  4JI0 I;  3M7N D;  2HGH A;  1A1F A;  1MGT A;  4DR7 E;  2C37 A;  3M99 B;  4JV5 I;  3F6H A;  4X62 E;  1PDA A;  5C0X D;  2EOF A;  2EOQ A;  4DUY E;  5DRQ A;  1O0W A;  3Q6N A;  1P42 A;  4DV1 E;  2EN3 A;  3T1H I;  4IFD E;  1WRJ A;  1A1K A;  1PJQ A;  1DQ3 A;  2EPU A;  2YRH A;  2JPA A;  1HK7 A;  1HR0 E;  2XEX A;  3U1K A;  5GMD A;  4MLQ A;  2JXP A;  2NUE A;  2HC5 A;  3BF2 A;  2DEI A;  1NHH A;  3GME A;  4UT4 A;  4GKK E;  2DIX A;  4JI0 E;  4OO1 A;  4USK A;  3CDI A;  2NN6 E;  1N36 I;  4JV5 E;  3L00 A;  3NZK A;  1KKH A;  3T1Y I;  5K36 E;  4PRX A;  3PRY A;  5JEA F;  1MEY C;  2EPR A;  2EOZ A;  3KWR A;  3T1H E;  2PO2 B;  4B3T I;  4HAC A;  1IBL I;  2C39 B;  2ZBK B;  4NXM I;  2WP8 B;  4WPY A;  4DUZ I;  1E3P A;  4DV4 I;  1WJP A;  4X66 I;  2EMX A;  3IWC A;  4IJD A;  2JEB A;  2RSI A;  4ZYD A;  3J80 Q;  1Y5Y A;  4DPX A;  1N36 E;  2WNR A;  2JOB A;  4X9J A;  1MG7 A;  2F1D A;  2F8B A;  2HKJ A;  4JI2 I;  2BBG A;  2ELZ A;  3T1Y E;  4OZE A;  4X64 I;  5LMU I;  4WFT A;  4B3T E;  2J65 A;  1NCS A;  1RQ0 A;  3WU3 A;  1IBL E;  1X6F A;  2L6M A;  3ZOQ B;  4HYM A;  4NXM E;  2M1S A;  2N8X A;  3ZKB A;  2EJ4 A;  4DV4 E;  4DUZ E;  4GZN C;  2V2Z A;  3P06 A;  4X66 E;  2DGC A;  3KZY A;  4KZS A;  1X47 A;  2WBU A;  2EPX A;  4RH8 A;  1ZXM A;  2CPN A;  1ZM9 A;  3K6Q A;  2O1W A;  1IBK I;  4IFD F;  2ENH A;  2IOQ A;  4DV2 I;  1E3H A;  4UTG A;  1NHJ A;  4IZJ A;  4B3M I;  4FW4 A;  4JI2 E;  1Z0E A;  3GLL A;  2B7T A;  4YY3 I;  4AIM A;  4X64 E;  3M85 D;  5LMU E;  1U2R A;  2DSY A;  4IFD C;  2E72 A;  2MC5 A;  3J7Y p;  4GEQ B;  4Z7C A;  4DV3 I;  2C37 B;  4JI8 I;  1NEI A;  2NN6 F;  2C38 A;  1H72 C;  1YYO A;  2EN2 A;  3P3C A;  4LF8 I;  1H7S A;  1Z0G A;  5JEA A;  1IBK E;  1A1J A;  3PYF A;  3ECR A;  4HEI A;  4DV2 E;  3LLH A;  1Z5A A;  4B3M E;  4K0K I;  2NN6 C;  2YTI A;  3FIG A;  4YY3 E;  1N0V C;  4DV6 I;  4JI5 I;  5LMN E;  4LU9 A;  4MLV A;  2JWO A;  1XMQ I;  2I9I A;  2PNZ A;  4B3S I;  1H74 A;  2PO0 A;  4DV3 E;  2V85 A;  1BBG A;  3MSW A;  2MDR A;  4JI8 E;  1AAY A;  1WUU A;  2EN6 A;  2Z5B B;  4BA1 A;  2JY9 A;  2LRS A;  2WBT A;  2NAB A;  4LF8 E;  5KL4 A;  4HAC B;  1A1G A;  2I13 A;  2V8P A;  4K0K E;  1BBO A;  2JE6 A;  1KIJ A;  4BHB A;  4DV6 E;  4LFC I;  1GZ6 A;  1UHZ A;  1WXR A;  3P76 A;  2A2C A;  2ENC A;  2EOI A;  4M1K A;  1XMQ E;  1A1H A;  1IQO A;  4DMI A;  4LPF A;  5FLX Q;  1ZU1 A;  2ZIT A;  5KL7 A;  2LV2 A;  2JEB B;  4FW5 A;  4ED4 A;  3J81 Q;  3AUZ A;  1QU6 A;  4IFD A;  4P78 A;  2WNR B;  4OO1 C;  3L7Z A;  4XTJ A;  4LCH A;  5DNX A;  3ZZT A;  2GLI A;  2VF1 A;  4MU1 A;  1AH5 A;  4F54 A;  2LJP A;  4FW9 A;  4LCG A;  2YSO A;  3CDJ A;  2YT4 A;  4DU7 A;  4RHB B;  5IWA I;  1G2F C;  1EH7 A;  3J80 C;  2EM8 A;  1RR9 A;  4DUY I;  2DLK A;  2VQE I;  4LFC E;  3BGH A;  2NN6 A;  2EM3 A;  2LUQ A;  1FJG I;  2EN7 A;  1A1I A;  2CVE A;  5K36 A;  2YTO A;  2V87 A;  2WCC 3;  1WHQ A;  1OYR A;  4OKG A;  2YTF A;  1EA6 A;  2V34 A;  4LCF A;  2EFG A;  1B69 A;  4R2P A;  4WUD A;  2L3J A;  4DV5 I;  2O1V A;  2GO3 A;  4LOM A;  4F9C B;  4BHC A;  5C0X A;  1RC7 A;  4DR2 I;  1PJS A;  2EL6 A;  4ZYG A;  5IWA E;  4WXC A;  4TUI A;  4Q35 B;  3HPZ A;  4Q28 A;  2VQE E;  2EN8 A;  1N0U A;  2C38 B;  2EPA A;  4R2D A;  1FJG E;  2B3T B;  1FWK A;  4LF7 I;  3GCM A;  2EMH A;  3MHS C;  3PYD A;  4U3D A;  4DPT A;  4YHH I;  1EI1 A;  2UXD E;  3ZM7 A;  1N33 I;  2HFS A;  3EPK A;  1JK1 A;  1J26 A;  2EPM X;  5CFF E;  1FWL A;  1KTV A;  2JEA A;  2N3H A;  3ZKD A;  3C4B A;  1P47 A;  1UDO A;  4U3B A;  4FK5 C;  4DV5 E;  2M9A A;  3JTZ A;  4MU4 A;  4RPF A;  2B9D A;  4PU9 A;  4LF6 I;  4KHP I;  2PO0 B;  4JI6 I;  5DNL A;  4DR2 E;  1X6H A;  2LTR A;  2BR2 A;  1HNX I;  2PO1 A;  2LBS B;  1R6M A;  4WXD A;  4J3D A;  4M9V C;  4B3R I;  4LF4 I;  2Z5C A;  3ADG A;  4BA1 B;  4LF7 E;  1BKN A;  4LF9 I;  2EPZ A;  4KQV A;  2EMK A;  4YHH E;  4IZK A;  4MYT A;  2A25 A;  2LCE A;  2Z5E A;  3HQ1 A;  2HHH I;  2EM5 A;  1N33 E;  4MU0 A;  2VQF I;  2LTS A;  3PS3 A;  2JE6 B;  2YTQ A;  5JEA C;  5C0X E;  4JI7 I;  4O5G A;  3HXL A;  1X5W A;  2M7Q A;  5A6B A;  1BB8 A;  1PVG A;  1SFE A;  4F6N A;  1ELO A;  1NHI A;  1UEK A;  4LF6 E;  4URL A;  4KHP E;  2UUA I;  2EMB A;  2EOR A;  5LL6 R;  2WBS A;  1SR9 A;  4JI6 E;  5AAS A;  1HNX E;  2IOP A;  2H36 X;  3C6K A;  4IFD B;  4OO1 D;  1XXE A;  1VI7 A;  3HTX A;  1EH6 A;  4B3R E;  2GS8 A;  4MQY A;  4LF4 E;  1Y6Z A;  2ENA A;  4LF9 E;  2EPP A;  2LVH A;  2N3G A;  1PJT A;  2HHH E;  3M7N G;  4NHR A;  2VQF E;  2EP3 A;  4AM3 A;  5FLX C;  3J81 C;  1T38 A;  1YUI A;  2BA0 D;  2DB2 A;  2YTE A;  1ZXN A;  4JI7 E;  2EN1 A;  1T4O A;  2NN6 B;  1YZ9 A;  2FV4 B;  2L2M A;  2V2V A;  2DMY A;  2UUA E;  2EMY A;  1USV A;  4JI3 I;  4M0V A;  4DR3 E;  2EL4 A;  5AC5 A;  5BR8 I;  1H73 A;  5LMN I;  1XMO I;  3KRN A;  2JOX A;  5FWK A;  4DU8 A;  4DPY A;  4WUC A;  5TSE A;  3HJC A;  2RSM A;  2EOY A;  1Y60 A;  2LJH A;  5T6J A;  4O4K A;  2LJU A;  5A6K A;  2O1U A;  4DR1 I;  3C4T A;  1XHK A;  2EPL X;  2O3Z A;  4JI1 I;  4P7A A;  3UHM A;  2EM6 A;  2CT1 A;  2L2N A;  5K36 F;  3UK3 C;  1UDN A;  2V83 A;  4IS1 C;  1FKA E;  4HY1 A;  2K4V A;  4F6M A;  1X48 A;  4J8Z A;  3K1J A;  4F9B B;  2EOJ A;  2MDG A;  4JI3 E;  4ISA A;  1WHN A;  5BR8 E;  2EMI A;  2JP9 A;  3LPS A;  3JAM Q;  2EOS A;  1XMO E;  1UDQ A;  5K36 C;  4M30 A;  4HXZ A;  5C0X F;  2EN4 A;  3CWV A;  4IZJ D;  2EZ6 A;  1N34 I;  4OO1 B;  2EQ3 A;  4FW3 A;  2EPO A;  1YHC A;  4DPW A;  1X49 A;  4NZV A;  3P1X A;  4GKJ E;  1UBD C;  3B4T A;  4BMJ A;  2PO1 B;  2DEJ A;  1OYS A;  2LT7 A;  2YWQ A;  4DR1 E;  4DR4 I;  5AE1 A;  4JI1 E;  3B78 A;  5C0X C;  1K47 A;  2UUC I;  4DKK A;  2J7J A;  1KVK A;  1Z5C A;  2A2D A;  3MHH C;  4MU3 A;  4KWY A;  4BC9 A;  2BB8 A;  2EPN A;  2NPF A;  5KL3 A;  2D9H A;  4I3H A;  4BA2 A;  4QNJ A;  5JEA D;  3J7A M;  1YUJ A;  4F2J C;  2VF3 A;  2YPN A;  2L3C A;  1N34 E;  2CTD A;  3HPS A;  4R2Q A;  1ZM2 A;  4OX9 I;  1Z0V A;  1GTK A;  4FWD A;  3V2U C;  4AQY I;  2EMZ A;  5DNY A;  4NXN I;  4FWG A;  4DR4 E;  2DMI A;  2MC6 A;  2UUC E;  3U1Y A;  4R8O A;  2HK2 A;  2L92 A;  2LMZ A;  4PRV A;  2BA1 G;  3DF6 A;  2E1R A;  2WP8 A;  2RS6 A;  5LLQ A;  1EKZ A;  3J7A G;  4JG4 A;  1YYW A;  2NUG A;  3K85 A;  3PS1 A;  3LTO A;  3QT6 A;  1XNQ E;  2E1M A;  2EQ0 A;  1R6L A;  3OTO E;  2UXD I;  3AV0 A;  4R1F A;  1YSA C;  2KOU A;  4OX9 E;  1B63 A;  5A6A A;  2VRD A;  4AQY E;  1DI2 A;  1Y4U A;  1Y4S A;  3QT7 A;  4IZJ B;  1A6F A;  4DR6 I;  4NXN E;  2EPK X;  4O24 A;  3Q6M A;  2M4I A;  1UN6 B;  3M6A A;  1RHY A;  4IFD D;  4ZYH A;  2KHX A;  5AE2 A;  3QT8 A;  4JI4 E;  1TF3 A;  2RTX A;  3LML A;  1ZAA C;  2VE7 C;  1TF6 A;  2WZO A;  4R03 A;  5DRO A;  3D4J A;  3VYX A;  2ODR C;  2EM2 A;  1NZ0 A;  5JEA B;  2EOE A;  5KL2 A;  2UXC I;  1H7U A;  3Q1Q A;  2NN6 D;  5KL5 A;  1EH8 A;  4DR6 E;  1Z0C A;  3ADJ A;  5K36 D;  1UDS A;  2ADR A;  1LLM C;  3WU6 A;  2PNM A;  1USU A;  2JYA A;  4HTG A;  4R2C A;  2PNZ B;  5IV8 B;  1Z1B A;  3WU4 A;  5F3W A;  1YYK A; 
#chains in the Genus database with same CATH homology
 4JYA I;  5GME A;  2CGE A;  3LNU A;  2KON A;  3JAM C;  4WUB A;  1ZM4 A;  4DV7 I;  2UXC E;  3OML A;  4M2Z A;  1T4N A;  1DAR A;  1VIS A;  2X7I A;  5L3J A;  4LF5 I;  1Z0B A;  4LFB I;  2LUP B;  4USM A;  4DR3 I;  1HNZ I;  1Z0T A;  4BC7 A;  4JYA E;  5ADZ A;  4DV0 I;  1Z0W A;  4X8W A;  2Z5B A;  4N3O A;  2EWL A;  1MU5 A;  4DV7 E;  1PKP A;  1XNR I;  3RMP A;  2FTX B;  4F9A B;  1MX0 A;  4LF5 E;  4LFB E;  1T4L B;  2L2K B;  1B62 A;  1HNZ E;  1HNW I;  2V88 A;  1Z59 A;  4DV0 E;  2CG9 A;  3ADL A;  1J5E I;  2JR1 A;  3B82 A;  4DPU A;  3V5R A;  4L8N A;  2GQ0 A;  2HKE A;  1GQE A;  1N32 I;  5A2Q C;  2CZ9 A;  4GKJ I;  3PYE A;  1XNR E;  2HK3 A;  3H4L A;  3K17 A;  1IBM I;  2HFU A;  1S16 A;  2X36 A;  4BCA A;  2ODR D;  4EMD A;  2FGG A;  1ZM3 A;  4Z7Y A;  3JU0 A;  2YZT A;  1HNW E;  3IWB A;  1J5E E;  2LE2 A;  2RS7 A;  4WYQ B;  5IT9 C;  2UXB I;  2WW4 A;  1N32 E;  1Z5B A;  1IBM E;  2V86 A;  2E5L I;  1ZBT A;  2Z5C B;  4DXL A;  2F4V I;  4TUG A;  4P52 A;  4IZK B;  2V89 A;  2G7H A;  2BM1 A;  2B7V A;  1XNQ I;  4X65 I;  1UIL A;  3OTO I;  4DR5 I;  4BS9 A;  2UXB E;  1D6T A;  4OOG C;  4MYU A;  2R42 A;  1FNM A;  3VYY A;  2UUB I;  2IHR 1;  3H09 A;  2E5L E;  2JVA A;  2V2Q A;  1I94 I;  2F4V E;  4LFA I;  3ZZ0 A;  4WSP A;  2R3V A;  1FI4 A;  4JI4 I;  2BV3 A;  2NA2 A;  2UU9 I;  3WU5 A;  5AE3 A;  1S4E A;  4BBY A;  3IWD A;  5A2Q Q;  4JI5 E;  3F6G A;  3HUL A;  4X65 E;  1QZR A;  2O1T A;  1ZBQ A;  4DR5 E;  4P7D A;  1RRE A;  4B3S E;  1STU A;  2L33 A;  4I8O A;  2UUB E;  2ZM6 I;  3PYG A;  3ADI A;  2NUF A;  2J7K A;  3F0N A;  3DJW A;  1I94 E;  3B8H A;  4LFA E;  3QT5 A;  4FWH A;  2PNL A;  4DR7 I;  3ZZU A;  2UU9 E;  4X62 I;  5IT9 Q;  4FN5 A;  2V8Q B;  2AJ4 A;  2OI2 A;  4DV1 I;  1PIE A;  2BM0 A;  3GON A;  1HR0 I;  2L8T A;  4ZVI A;  2Q2E B;  3VK6 A;  2ZM6 E;  1OJ4 A;  4GKK I;  4LTY A;  4L5N C;  4JI0 I;  4DR7 E;  4JV5 I;  3F6H A;  4X62 E;  4DUY E;  1O0W A;  3Q6N A;  4DV1 E;  3T1H I;  1DQ3 A;  1HK7 A;  1HR0 E;  2XEX A;  5GMD A;  2NUE A;  2DEI A;  4UT4 A;  1NHH A;  4GKK E;  2DIX A;  4JI0 E;  4USK A;  1N36 I;  4JV5 E;  1KKH A;  3T1Y I;  4PRX A;  3PRY A;  3KWR A;  3T1H E;  4B3T I;  4HAC A;  1IBL I;  4NXM I;  2ZBK B;  4WPY A;  4DUZ I;  4DV4 I;  4X66 I;  3IWC A;  3J80 Q;  4DPX A;  1N36 E;  2JOB A;  1MG7 A;  4JI2 I;  2F8B A;  2HKJ A;  3T1Y E;  4X64 I;  5LMU I;  4WFT A;  4B3T E;  1RQ0 A;  3WU3 A;  1IBL E;  2L6M A;  3ZOQ B;  4HYM A;  4NXM E;  2M1S A;  3ZKB A;  4DV4 E;  4DUZ E;  2V2Z A;  3P06 A;  4X66 E;  4KZS A;  1X47 A;  1ZXM A;  2CPN A;  1ZM9 A;  3K6Q A;  2O1W A;  1IBK I;  2IOQ A;  4DV2 I;  4UTG A;  1NHJ A;  4IZJ A;  4B3M I;  4JI2 E;  1Z0E A;  2B7T A;  4YY3 I;  4X64 E;  5LMU E;  1U2R A;  2DSY A;  2MC5 A;  3J7Y p;  4GEQ B;  4Z7C A;  4DV3 I;  4JI8 I;  1H72 C;  1YYO A;  4LF8 I;  1H7S A;  1Z0G A;  1IBK E;  3PYF A;  4DV2 E;  3LLH A;  1Z5A A;  4B3M E;  4K0K I;  3FIG A;  4YY3 E;  1N0V C;  4DV6 I;  4JI5 I;  5LMN E;  4LU9 A;  2JWO A;  1XMQ I;  4B3S I;  1H74 A;  4DV3 E;  2V85 A;  3MSW A;  2MDR A;  4JI8 E;  1WUU A;  2Z5B B;  2JY9 A;  2LRS A;  4LF8 E;  4HAC B;  2V8P A;  4K0K E;  1KIJ A;  4DV6 E;  4LFC I;  1GZ6 A;  1UHZ A;  1WXR A;  2A2C A;  4M1K A;  1XMQ E;  4DMI A;  5FLX Q;  2ZIT A;  4ED4 A;  3J81 Q;  3AUZ A;  1QU6 A;  4P78 A;  4XTJ A;  3ZZT A;  2VF1 A;  4F54 A;  2LJP A;  4FW9 A;  2YT4 A;  4DU7 A;  5IWA I;  3J80 C;  1RR9 A;  4DUY I;  2VQE I;  4LFC E;  2LUQ A;  1FJG I;  2V87 A;  1WHQ A;  1EA6 A;  2V34 A;  2EFG A;  4WUD A;  2L3J A;  4DV5 I;  2O1V A;  4F9C B;  1RC7 A;  4DR2 I;  5IWA E;  4TUI A;  3HPZ A;  4Q28 A;  2VQE E;  1N0U A;  1FJG E;  2B3T B;  1FWK A;  4LF7 I;  3PYD A;  4DPT A;  4YHH I;  1EI1 A;  2UXD E;  3ZM7 A;  1N33 I;  2HFS A;  1J26 A;  5CFF E;  1FWL A;  1KTV A;  2N3H A;  3ZKD A;  3C4B A;  4DV5 E;  3JTZ A;  4RPF A;  4LF6 I;  2B9D A;  4PU9 A;  4KHP I;  4JI6 I;  4DR2 E;  2LTR A;  1HNX I;  2LBS B;  4B3R I;  4LF4 I;  2Z5C A;  3ADG A;  4LF7 E;  1BKN A;  4LF9 I;  4KQV A;  4YHH E;  4IZK A;  4MYT A;  2Z5E A;  2HHH I;  3HQ1 A;  1N33 E;  2VQF I;  2LTS A;  4JI7 I;  3HXL A;  2M7Q A;  1PVG A;  1ELO A;  1NHI A;  1UEK A;  4LF6 E;  4URL A;  4KHP E;  2UUA I;  5LL6 R;  4JI6 E;  2IOP A;  1SR9 A;  5AAS A;  1HNX E;  2H36 X;  3HTX A;  4B3R E;  2GS8 A;  4LF4 E;  1Y6Z A;  4LF9 E;  2N3G A;  2HHH E;  2VQF E;  5FLX C;  3J81 C;  2DB2 A;  1ZXN A;  4JI7 E;  1T4O A;  1YZ9 A;  2FV4 B;  2L2M A;  2V2V A;  2DMY A;  2UUA E;  1USV A;  4JI3 I;  4M0V A;  4DR3 E;  5BR8 I;  1H73 A;  5LMN I;  1XMO I;  2JOX A;  5FWK A;  4DU8 A;  4DPY A;  4WUC A;  3HJC A;  2RSM A;  2LJH A;  5T6J A;  2O1U A;  4DR1 I;  3C4T A;  1XHK A;  4JI1 I;  4P7A A;  2L2N A;  2V83 A;  1FKA E;  4HY1 A;  2K4V A;  1X48 A;  4J8Z A;  3K1J A;  4F9B B;  4JI3 E;  1WHN A;  5BR8 E;  3LPS A;  3JAM Q;  1XMO E;  4M30 A;  4HXZ A;  3CWV A;  4IZJ D;  2EZ6 A;  1N34 I;  4DPW A;  1X49 A;  3P1X A;  4GKJ E;  4BMJ A;  2DEJ A;  4DR1 E;  4DR4 I;  5AE1 A;  4JI1 E;  3B78 A;  1K47 A;  2UUC I;  4DKK A;  1KVK A;  1Z5C A;  2A2D A;  4BC9 A;  2NPF A;  4I3H A;  3J7A M;  2VF3 A;  2L3C A;  1N34 E;  3HPS A;  1ZM2 A;  4OX9 I;  1Z0V A;  3V2U C;  4FWD A;  4AQY I;  5DNY A;  4NXN I;  4FWG A;  4DR4 E;  2MC6 A;  2UUC E;  4R8O A;  2HK2 A;  2L92 A;  2LMZ A;  3DF6 A;  2E1R A;  4JG4 A;  2RS6 A;  1EKZ A;  3J7A G;  1YYW A;  2NUG A;  3K85 A;  3LTO A;  3QT6 A;  1XNQ E;  2E1M A;  3OTO E;  2UXD I;  3AV0 A;  4R1F A;  2KOU A;  4OX9 E;  1B63 A;  1DI2 A;  4AQY E;  1Y4U A;  3QT7 A;  1Y4S A;  4IZJ B;  4PRV A;  4DR6 I;  1A6F A;  4NXN E;  3Q6M A;  2M4I A;  3M6A A;  2KHX A;  5AE2 A;  3QT8 A;  4JI4 E;  2RTX A;  3LML A;  2VE7 C;  2WZO A;  4R03 A;  3D4J A;  3VYX A;  2ODR C;  1NZ0 A;  2UXC I;  1H7U A;  3Q1Q A;  4DR6 E;  1Z0C A;  3ADJ A;  3WU6 A;  2PNM A;  1USU A;  3WU4 A;  5F3W A;  1YYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...