4JYAE

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4jyaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4jyaE02
1YZ9A 1N32E 1J26A 4JI4E 1H73A 1KKHA 4X65E 2ZBKB 4DUYI 4JV5E 4YHHE 1RQ0A 1OJ4A 4WYQB 4DV0E 3PYDA 5A2QQ 1MU5A 4LFCI 4EMDA 1FJGE 4DKKA 5IT9Q 2DMYA 1O0WA 4ZVIA 1FI4A 2HHHI 3VYXA 1ELOA 5LMUI 2UXBE 5LMNE 4DV1I 4M2ZA 4PU9A 2CZ9A 4DPWA 1N0VC 2V2QA 2HK2A 3GONA 2KHXA 2BM1A 1FKAE 1Z5CA 5BR8I 3K17A 1WHQA 1GQEA 3J7AG 2JY9A 1WHNA 2L2NA 4YY3I 4JI0I 4FWDA 1BKNA 2R42A 4K0KI 4DR7I 2NUFA 1XNRE 5FLXC 5CFFE 1XHKA 4JI2E 2LTSA 3T1YI 4DV2E 2R3VA 4LF6E 1H74A 5IWAI 1IBLE 4LF4I 4JI1I 1QZRA 4DR4E 2L3CA 3WU4A 4B3ME 4WFTA 1XMQI 3J81C 3WU3A 1UILA 4NXMI 1XNQI 2UU9I 4B3SE 1D6TA 2E5LE 1FNMA 1ZXNA 1Z0VA 4DV4E 2A2DA 1WUUA 1N32I 3PYFA 4OX9E 4JI4I 3QT7A 4JI5E 4X65I 2JVAA 2X7IA 4X64E 1YYWA 2ZITA 4JV5I 2F4VE 1ZXMA 4YHHI 1Z0BA 4FN5A 2XEXA 4X66E 4DV0I 3ZM7A 2L2KB 1I94E 1S4EA 2DIXA 3LNUA 1FJGI 4DU7A 2RS7A 2DB2A 2UXDE 4R1FA 2ZM6E 2GS8A 2UXBI 4UTGA 1Z0WA 4JI3I 4NXNE 5LMNI 1X48A 3F0NA 2V2ZA 1UHZA 3LTOA 3V5RA 3K1JA 4DR5E 1YYOA 1X49A 2L3JA 3T1HE 1PKPA 3ZZTA 1IBME 3D4JA 3JAMQ 2LJHA 4JI8E 1XNRI 4M30A 2J7KA 4JI2I 3J80C 3QT6A 2RS6A 4DV2I 1Z5AA 4LF6I 4LFBE 1QU6A 1IBLI 1NZ0A 4DR4I 1N33E 3WU5A 2VF3A 4B3MI 2EZ6A 4HACA 1Z0GA 3ADIA 2IHR1 4DR3E 2B3TB 4PRVA 4B3SI 2B7TA 4ED4A 2Q2EB 4DXLA 2E5LI 4DV4I 3HTXA 1RREA 2AJ4A 4OX9I 4LFAE 2HK3A 4JI5I 3V2UC 4JI6E 4B3TE 4X64I 2F4VI 4X8WA 2RTXA 2LUPB 2UUAE 4DV6E 1Z59A 4DV3E 4X66I 3PYGA 2V2VA 1I94I 5GMDA 4WUBA 2UXCE 2HFUA 4DPYA 5A2QC 1N0UA 1Z0TA 2UXDI 2BM0A 4B3RE 4JI7E 1FWLA 5IT9C 2YT4A 2NPFA 3WU6A 2ZM6I 4GKKE 4LF9E 4NXNI 1N36E 4MYTA 1ZM9A 1ZBTA 4DR5I 3T1HI 1HR0E 2HKEA 3ZKBA 4MYUA 2VQFE 1IBMI 2DEJA 3QT8A 3OTOE 2VQEE 4DR1E 4JI8I 2NUEA 1Z0EA 1H7UA 1PIEA 1HNXE 3QT5A 4I3HA 4P7AA 4YY3E 4Z7CA 4LFBI 3PYEA 2MDRA 2LRSA 1J5EE 4LF7E 2A2CA 3ZZUA 3C4BA 1T4OA 1N33I 1ZM3A 4WUCA 1ZM4A 4KHPE 4DR2E 4URLA 2X36A 4DPUA 4DR3I 1T4LB 4LF4E 4X62E 4Z7YA 1B62A 1STUA 2HKJA 1NHJA 4LF8E 4LFAI 4JI6I 4B3TI 3M6AA 4JYAE 2NA2A 2UUAI 2L33A 4DV6I 1HNZE 4DV3I 4FWGA 4USMA 2OI2A 1NHIA 3B82A 2UXCI 1H72C 4DV5E 1U2RA 2UUBE 1RR9A 3LLHA 5FLXQ 1T4NA 4B3RI 4WUDA 4JI7I 1IBKE 4HYMA 2NUGA 4DR6E 4DPXA 4FWHA 4GKJE 4M1KA 4GKKI 3ZZ0A 3H4LA 2V34A 4LF9I 1N36I 4LF5E 4USKA 4XTJA 2UUCE 3J7Yp 3B78A 3J81Q 4OOGC 2LUQA 1ZM2A 1MG7A 2LBSB 5GMEA 4DUZE 3ZKDA 1HNWE 1HR0I 2LJPA 4JI3E 1XMOE 2BV3A 2VQFI 4PRXA 3OTOI 2VQEI 4AQYE 1N34E 4DR1I 3JAMC 4DV7E 4HY1A 4HXZA 1NHHA 4KQVA 4DUYE 1HNXI 2DEIA 3HULA 1B63A 3ADGA 4DU8A 1UEKA 1J5EI 2CPNA 4LF7I 4LFCE 1KTVA 1DARA 4KHPI 4DR2I 2HHHE 3ADJA 1KVKA 1DI2A 5LMUE 4X62I 2LTRA 4DV1E 2N3GA 4JG4A 2RSMA 4LF8I 2WW4A 2N3HA 3J7AM 1Z0CA 1X47A 5LL6R 2E1RA 4JYAI 5BR8E 3C4TA 3VYYA 1HNZI 2V8PA 2B7VA 1K47A 4HACB 4RPFA 4JI0E 4DV5I 3Q1QA 4FW9A 2UUBI 4K0KE 1VISA 4DR7E 1EA6A 2EFGA 3CWVA 4DPTA 3J80Q 1IBKI 1FWKA 4DR6I 3P1XA 4P52A 4GKJI 3T1YE 1MX0A 4UT4A 5L3JA 5IWAE 4LF5I 3B8HA 4JI1E 1H7SA 2UUCI 1S16A 3ADLA 2HFSA 4DUZI 1EI1A 1XMQE 1HNWI 1XMOI 4NXME 1XNQE 1PVGA 2UU9E 1KIJA 1A6FA 1Z5BA 4AQYI 1EKZA 2L2MA 1RC7A 1N34I 3LPSA 1YYKA 4DV7I
chains in the Genus database with same CATH superfamily
1YZ9A 2NN6E 1N32E 1J26A 1X3CA 4JI4E 1H73A 1KKHA 4X65E 2ZBKB 4DUYI 4F54A 4JV5E 2DLQA 4FW7A 1SR9A 2EM5A 4YHHE 1RQ0A 2V86A 2V88A 2BA0G 2YTGA 4WYQB 3ZOQB 1OJ4A 5ELWA 2EN1A 5C0XB 3Q6MA 4MU4A 4DV0E 1JK2A 3PYDA 2F8BA 5A6JA 5LLQA 5A2QQ 3MHHC 1MU5A 4LFCI 4EMDA 2GQ0A 2EMAA 3H09A 4R2AA 2JWOA 1FJGE 4DKKA 2BBGA 4GEQB 3P76A 5IT9Q 2DMYA 1O0WA 5KL2A 4ZVIA 1AH5A 4R2PA 2WNRB 1FI4A 2BB8A 1RHYA 4IFDA 2HHHI 3VYXA 1ELOA 4ZYHA 2LMZA 4AM3A 5A6BD 3CDIA 5LMUI 1BBOA 1TN9A 2EPPA 2YU5A 2UXBE 2K7IA 3M99B 2CVEA 4IFDE 3RMPA 2EOSA 4LOMA 5LMNE 2GO4A 4DV1I 3THOB 3GMEA 4M2ZA 1YUIA 2ENAA 4PU9A 5JEAC 2CZ9A 4DPWA 2LE2A 1N0VC 2Q8UA 2NN6D 4BA2B 4R03A 2RQLA 5A69A 2HK2A 2KHXA 4MLQA 2V2QA 1IQSA 4X9JA 3GONA 2BM1A 2EQ3A 1FKAE 3BBGA 4R2CA 5JEAD 5FWKA 2EWLA 4BMJA 1Z5CA 4J8ZA 2C38A 5BR8I 3K17A 3MHSC 1TF3A 2WBUA 2MC5A 2L6MA 2NN6F 4KWYA 4O24A 1WHQA 2EOEA 1YH8A 2YRMA 2C39B 5JEAF 1GQEA 3J7AG 3VHTB 1WHNA 2JY9A 2L2NA 2YTJA 4YY3I 3U1KA 2JXPA 4I8OA 1Y6ZA 3BIDA 4FWDA 4JI0I 1P47A 1BKNA 2J65A 2R42A 1EH6A 4K0KI 4R8OA 1PJSA 2NUFA 4DR7I 1XNRE 2FV4B 1WXRA 3M85D 2EQ0A 1N3GA 5FLXC 5CFFE 4F2JC 1YUJA 4JI2E 1XHKA 2LTSA 3P3GA 1T38A 5F3WA 3T1YI 4DV2E 4IFDD 4O4KA 2R3VA 4LF6E 5DNLA 1H74A 5IWAI 1IBLE 4M0VA 1EH7A 4TUIA 3NZKA 4F9CB 4JI1I 1QZRA 4DR4E 2BR2A 2PO0B 3U1YA 4HTGA 4KZSA 2HGHA 4IZJA 1A1JA 1EH8A 2L3CA 2DLKA 2GO3A 2NN6B 3WU4A 5DRRA 1WJPA 2YZTA 4B3ME 4WFTA 4F6NA 1MGTA 1KYQA 2ENCA 3J81C 2O3ZA 3GLLA 4BA1A 5JEAB 4IFDF 2JE6A 3P06A 5T6JA 2ODRD 2JOXA 2V85A 3WU3A 5DNYA 1UILA 4FW4A 4NXMI 1XNQI 2UU9I 3HPSA 4B3SE 1X6FA 5DRPA 1B69A 1D6TA 2E5LE 1FNMA 1ZXNA 1Z0VA 4DV4E 2A2DA 3PS3A 1WUUA 4QNJA 1N32I 3PYFA 4OX9E 4JI4I 3M7ND 3QT7A 3Q6NA 4JI5E 1OYSA 4X65I 2JVAA 1A1IA 4X64E 2X7IA 1YYWA 2ZITA 4JV5I 4R2DA 2F4VE 3K6QA 3GCMA 4LPFA 1ZXMA 2JPAA 1OYPA 1Z0BA 4MQYA 4FN5A 2XEXA 4YHHI 2EMKA 1E3PA 2JT2A 5C0XC 3THNA 4O5GA 1Y5YA 4BCAA 2YSPA 4X66E 2O1UA 4FW5A 4DV0I 3ZM7A 4IFDB 4WSGA 2L2KB 5KL7A 2C37A 1I94E 1ZU1A 1S4EA 2DIXA 2GLIA 3H1CA 2V89A 3LNUA 1FJGI 4DU7A 2RS7A 2DB2A 2JOBA 3JTZA 1A1GA 2UXDE 2PRTA 1MEYC 4P7DA 2VF1A 4R1FA 2LCEA 2PNZA 2YTNA 2GPIA 1Y4UA 3AV0A 2Z5EA 2ZM6E 2GS8A 2A25A 2WP8B 2UXBI 4UTGA 1Z0WA 4JI3I 5KL6A 2DSYA 4NXNE 5LMNI 1X48A 5K36A 3F0NA 4IJDA 2V2ZA 2Z5BB 1UHZA 2EOZA 2DRPA 3LTOA 3V5RA 5K36E 2YRHA 3K1JA 1A1FA 4DR5E 1YYOA 1X49A 2L3JA 3T1HE 4FW6A 1PKPA 2BA1D 4U3DA 2EL5A 2EMZA 3LPSA 2EPKX 3ZZTA 1IBME 4ZYDA 2IESA 4R2QA 3C6MA 2R76A 3D4JA 3JAMQ 2V8QB 2LJHA 2PO1A 2EP3A 4JI8E 1KJKA 2N8XA 2YWQA 2EPOA 2EOQA 2EM2A 5DNXA 1XNRI 1BB8A 1G2DC 4LCGA 2YSOA 4M30A 2J7KA 1YSAC 2KONA 4IZKA 3J80C 4JI2I 2VESA 3QT6A 4F6MA 1GZ6A 2RS6A 4DV2I 1Z5AA 4LF6I 2JE6B 4LFBE 1QU6A 1IBLI 1NZ0A 4DR4I 3IWDA 2EMXA 1N33E 2NN6C 2O1VA 3WU5A 2EQ1A 3CDJA 2YTQA 4HEIA 2VF3A 2LV2A 2EZ6A 4AIMA 2FTXB 1X5WA 2LO3A 5AE2A 4WSPA 4HACA 1JK1A 1Z0GA 3ADIA 3J81Q 4MLVA 2IHR1 4DR3E 2YTDA 2GHFA 2EOYA 2B3TB 2EOJA 4PRVA 4B3SI 2EL4A 2B7TA 4ED4A 2Q2EB 4DXLA 5K36F 1NEIA 3BGHA 4LF4I 4NZVA 4MU1A 2E5LI 2G7HA 3EQ1A 2YTEA 4DV4I 2YTFA 3HTXA 1RREA 2AJ4A 2IOPA 4OX9I 1YFHA 1X6EA 1T39A 4LFAE 2HK3A 4JI5I 3V2UC 4JI6E 4B3TE 2V87A 4X64I 3M85G 2JEAB 5A6AA 2NABA 4LU9A 2F4VI 4X8WA 2RTXA 1ZR9A 2LUPB 2EN3A 2UUAE 4DV6E 4IFDC 5TSEA 3UK3C 2EOMA 4F9AB 1DGCA 4DV3E 2LJUA 1Z59A 2J7JA 1Y4SA 3PYGA 2V2VA 3PRYA 2PNZB 4X66I 2I13A 4OZEA 1I94I 1Z1BA 4WXDA 5GMDA 4WUBA 2UXCE 2HFUA 2EN7A 4DPYA 5A2QC 1A1LA 1N0UA 1Z0TA 2CGEA 4BHCA 2UXDI 3DF6A 3JU0A 1UBDC 2VRDA 2PO0A 2K4VA 4B3RE 2BM0A 2EPNA 4JI7E 5KL5A 5IT9C 1FWLA 1SFEA 3C6KA 2YT4A 2ODRC 2NPFA 4NHRA 3WU6A 2ZM6I 4GKKE 2EMBA 4LF9E 4NXNI 4OO1E 1N36E 2EM0A 2PNLA 4MYTA 2EM7A 1NCSA 4R2SA 4GZNC 4RHBB 2EOIA 1VI7A 1ZM9A 2CSHA 3HJCA 5KL3A 2EMWA 5EKWA 1ZBTA 4BS9A 4DR5I 3T1HI 2PO1B 3L00A 1IQOA 1HR0E 2MDGA 1A1HA 2HKEA 3ZKBA 1GTKA 4MYUA 5AE1A 1XXEA 3EPLA 1USVA 2VQFE 2WNRA 1IBMI 3ECRA 2JP9A 2DEJA 3QT8A 3OTOE 2EJ4A 3K85A 4ISAA 2VQEE 3FIGA 1R6MA 4TUGA 1UDSA 1ZAAC 2JR1A 4DR1E 2IERA 4JI8I 2NUEA 1Z0EA 2MC6A 3KWRA 2DMIA 4BBYA 2YRKA 2EOXA 2EM3A 3VK6A 3DJWA 2M7QA 1H7UA 3EPJA 1PIEA 4BA2A 2EPXA 1HNXE 3QT5A 2L8TA 4I3HA 1YHCA 4P7AA 1QNTA 4IZJD 4YY3E 1Y60A 3BF2A 4B3MI 4Z7CA 4LFBI 4OO1D 3PYEA 2MDRA 2LRSA 4P78A 1J5EE 4LF7E 2A2CA 2L92A 3C4BA 2EOOA 1T4OA 2M9AA 3ZZUA 1R6LA 2HC5A 1N33I 2C38B 1UDOA 2AE8A 1ZM3A 4WUCA 1ZM4A 4KHPE 4FK5C 2BA1G 4OO1F 2CTDA 4BC9A 4DR2E 4URLA 4ZYEA 2X36A 4DPUA 4DR3I 1DQ3A 2HJJA 1T4LB 4LF4E 4X62E 4Z7YA 2EM4A 1B62A 2Z5CA 1STUA 3PS2A 3MSWA 2HKJA 1NHJA 4ZYGA 5A6BA 3L7ZA 4N3OA 4LF8E 4LFAI 2RPCA 5DRQA 4JI6I 4B3TI 2MKDA 3M6AA 2EPRA 2EORA 1UDQA 4JYAE 2NA2A 2EMLA 2NN6A 2PO2A 2UUAI 2L33A 2BR2B 4DV6I 4L5NC 1HNZE 5JEAA 2O1TA 4IZJB 5DROA 4DV3I 2M4IA 4FWGA 4USMA 2OI2A 1NHIA 4OO1B 2M1SA 2YU8A 4Q28A 4BA1B 5JEAE 3B82A 1PDAA 1H72C 4DV5E 2UXCI 2WBSA 1U2RA 2JEBA 5K36C 1HK7A 2UUBE 1RR9A 3LMLA 3LLHA 5ADZA 5FLXQ 1T4NA 2LT7A 4R2RA 4B3RI 4WUDA 4JI7I 2EM9A 2EM8A 1IBKE 4IS9A 5K36D 5AC4A 4HYMA 2ELYA 2NUGA 4DR6E 2EN4A 4DPXA 4FWHA 2R1FA 4GKJE 4M1KA 4GKKI 3IWCA 3H4LA 2V34A 3ZZ0A 3QG5C 4LF9I 2BA0D 1N36I 2H36X 3HQ1A 4LF5E 4USKA 3AUZA 4XTJA 2E72A 2MKNA 2UUCE 1RMDA 3J7Yp 3B78A 4DMIA 2EL6A 4OOGC 2LUQA 1ZM2A 1MG7A 2EPZA 2LBSB 4DUZE 3P3CA 5GMEA 4OO1A 3ZKDA 1HNWE 3DD6A 4OKGA 4M9VC 3TQMA 1HR0I 2LJPA 4R2EA 2ADRA 4JI3E 3IWBA 1YPNA 4IS1C 1XMOE 2C37B 3PS1A 2BV3A 2VQFI 4BC7A 2I9IA 4PRXA 3OTOI 2VQEI 4AQYE 2JYAA 1N34E 2WP8A 3JAMC 4DR1I 4DV7E 2EN8A 3HKMA 4HY1A 1L4SA 4HXZA 1NHHA 2KOUA 4KQVA 3KZZA 2Z5BA 4DUYE 3KZYA 1HNXI 3OMLA 2DEIA 3HULA 5K36B 1B63A 2EN6A 3ADGA 2YPNA 5IV8B 4DU8A 2D9HA 1XMQI 1UEKA 1J5EI 2CPNA 4LF7I 1LLMC 3KRNA 2EPUA 4LTYA 4LFCE 2EPCA 1KTVA 3EPKA 1UN6B 2FGGA 4FW3A 1DARA 2CT1A 2Z5CB 4MU3A 4KHPI 5C0XA 3M7NG 4QNKA 2DGCA 4U3BA 2F1DA 3HPZA 4DR2I 2HHHE 3L7ZB 1WRJA 2EMFA 3ADJA 1KVKA 2RSIA 1DI2A 1ZBQA 1UDNA 5C0XE 5LMUE 4X62I 2EMYA 2EE8A 2LTRA 2EOFA 4F9BB 1X6HA 3F6HA 4DV1E 1AAYA 1IMUA 2YTPA 1OYRA 2N3GA 2PO2B 4AIDA 4JG4A 2PNMA 2RSMA 2EMGA 4LCHA 4GKJI 4IZKB 4LF8I 1BBGA 3P3EA 2WW4A 2N3HA 3J7AM 2EN2A 1Z0CA 1F2IG 4RH8A 1X47A 5LL6R 2E1RA 1A1KA 5BR8E 4BHBA 4JYAI 2JEBB 3C4TA 3VYYA 1HNZI 4O43A 2V83A 4MU0A 2VE7C 2V8PA 4OO1C 5KL4A 5A6KA 3B4TA 1TF6A 2B7VA 1K47A 2EPMX 4HACB 3EPHA 2WZOA 4JI0E 5IXMB 4RPFA 2EMHA 4FW9A 4DV5I 3Q1QA 2UUBI 4K0KE 4WXCA 1G2FC 3HXLA 1VISA 4DR7E 1EA6A 2EFGA 2WBTA 5AC5A 2O1WA 3CWVA 5EL9A 4DPTA 3J80Q 1FWKA 2E1MA 3F6GA 2C39A 5AE3A 1IBKI 2CG9A 4J3DA 4DR6I 2EM6A 2ELZA 3P1XA 5C0XD 4P52A 2B9DA 1PJTA 3T1YE 4GQUA 4NBQA 2JEAA 4WX9A 2EMCA 4L8NA 1MX0A 1P42A 4UT4A 5L3JA 1USUA 5IWAE 2YTOA 4Q35B 4LF5I 3B8HA 4JI1E 4N4RB 1PJQA 1H7SA 4WPYA 2UUCI 1S16A 3ADLA 2HFSA 4LCFA 2EMIA 2IOQA 4DUZI 1EI1A 5C0XF 1XMQE 1HNWI 2WCC3 5AASA 2ENHA 2EPAA 2YTIA 1XMOI 1E3HA 4NXME 2EPLX 1XNQE 2LVHA 2UU9E 1PVGA 1KIJA 4MDTA 1A6FA 1Z5BA 4AQYI 1EKZA 2L2MA 1RC7A 1N34I 2EOHA 1YYKA 3UHMA 4DV7I
chains in the Genus database with same CATH topology
1YZ9A 1N32E 1J26A 4JI4E 1H73A 1KKHA 4X65E 2ZBKB 4DUYI 4F54A 4JV5E 1SR9A 4YHHE 1RQ0A 2V86A 2V88A 1OJ4A 4WYQB 3ZOQB 3Q6MA 4DV0E 3PYDA 2F8BA 5A2QQ 1MU5A 4LFCI 4EMDA 2GQ0A 3H09A 2JWOA 1FJGE 4DKKA 4GEQB 5IT9Q 2DMYA 1O0WA 4ZVIA 1FI4A 2HHHI 3VYXA 1ELOA 2LMZA 5LMUI 2UXBE 3RMPA 5LMNE 4DV1I 4M2ZA 4PU9A 2CZ9A 4DPWA 2LE2A 1N0VC 4R03A 2HK2A 2V2QA 3GONA 2KHXA 2BM1A 1FKAE 5FWKA 2EWLA 4BMJA 1Z5CA 4J8ZA 5BR8I 3K17A 2MC5A 2L6MA 1WHQA 1GQEA 3J7AG 2JY9A 1WHNA 2L2NA 4YY3I 4I8OA 1Y6ZA 4JI0I 4FWDA 1BKNA 2R42A 4K0KI 4R8OA 4DR7I 2NUFA 1XNRE 2FV4B 1WXRA 5FLXC 5CFFE 1XHKA 4JI2E 2LTSA 5F3WA 3T1YI 4DV2E 2R3VA 4LF6E 1H74A 5IWAI 1IBLE 4M0VA 4TUIA 4LF4I 4F9CB 4JI1I 1QZRA 4DR4E 4KZSA 4IZJA 2L3CA 3WU4A 2YZTA 4B3ME 4WFTA 1XMQI 3J81C 3P06A 5T6JA 2ODRD 2JOXA 2V85A 3WU3A 5DNYA 1UILA 4NXMI 1XNQI 2UU9I 3HPSA 4B3SE 1D6TA 2E5LE 1FNMA 1ZXNA 1Z0VA 4DV4E 2A2DA 1WUUA 1N32I 3PYFA 4OX9E 4JI4I 3QT7A 3Q6NA 4JI5E 4X65I 2JVAA 2X7IA 4X64E 1YYWA 2ZITA 4JV5I 2F4VE 3K6QA 1ZXMA 4YHHI 1Z0BA 4FN5A 2XEXA 2O1UA 4BCAA 4X66E 4DV0I 3ZM7A 2L2KB 1I94E 1S4EA 2DIXA 3LNUA 2V89A 1FJGI 4DU7A 2RS7A 2DB2A 2JOBA 3JTZA 2UXDE 4P7DA 2VF1A 4R1FA 1Y4UA 3AV0A 2Z5EA 2ZM6E 2GS8A 2UXBI 4UTGA 1Z0WA 4JI3I 4NXNE 2DSYA 5LMNI 1X48A 3F0NA 2V2ZA 2Z5BB 1UHZA 3LTOA 3V5RA 3K1JA 4DR5E 1YYOA 1X49A 2L3JA 3T1HE 1PKPA 3ZZTA 1IBME 3D4JA 3JAMQ 2V8QB 2LJHA 4JI8E 1XNRI 4M30A 2J7KA 2KONA 4IZKA 3J80C 4JI2I 3QT6A 2RS6A 1GZ6A 4DV2I 1Z5AA 4LF6I 4LFBE 1QU6A 1IBLI 1NZ0A 4DR4I 3IWDA 1N33E 3WU5A 2O1VA 2VF3A 4B3MI 2EZ6A 2FTXB 5AE2A 4WSPA 4HACA 1Z0GA 3ADIA 2IHR1 4DR3E 2B3TB 4PRVA 4B3SI 2B7TA 4ED4A 2Q2EB 4DXLA 2E5LI 2G7HA 4DV4I 3HTXA 1RREA 2AJ4A 2IOPA 4OX9I 4LFAE 2HK3A 4JI5I 3V2UC 4JI6E 4B3TE 2V87A 4X64I 4LU9A 2F4VI 4X8WA 2RTXA 2LUPB 2UUAE 4DV6E 4F9AB 1Z59A 4DV3E 4X66I 1Y4SA 3PYGA 2V2VA 3PRYA 1I94I 5GMDA 4WUBA 2UXCE 2HFUA 4DPYA 5A2QC 1N0UA 1Z0TA 2CGEA 2UXDI 3DF6A 3JU0A 2K4VA 4B3RE 2BM0A 4JI7E 5IT9C 1FWLA 2YT4A 2ODRC 2NPFA 3WU6A 2ZM6I 4GKKE 4LF9E 4NXNI 1N36E 2PNLA 4MYTA 3HJCA 1ZM9A 1ZBTA 4BS9A 4DR5I 3T1HI 1HR0E 2HKEA 3ZKBA 4MYUA 5AE1A 1USVA 2VQFE 1IBMI 2DEJA 3QT8A 3OTOE 3K85A 2VQEE 3FIGA 4TUGA 2JR1A 4DR1E 4JI8I 2NUEA 1Z0EA 2MC6A 3KWRA 4BBYA 3VK6A 3DJWA 2M7QA 1H7UA 1PIEA 1HNXE 3QT5A 2L8TA 4I3HA 4P7AA 4IZJD 4YY3E 4Z7CA 4LFBI 3PYEA 2MDRA 2LRSA 4P78A 1J5EE 4LF7E 2A2CA 2L92A 3C4BA 3ZZUA 1T4OA 1N33I 1ZM3A 4WUCA 1ZM4A 4KHPE 4BC9A 4DR2E 4URLA 2X36A 4DPUA 4DR3I 1DQ3A 1T4LB 4LF4E 4X62E 4Z7YA 1B62A 2Z5CA 1STUA 3MSWA 2HKJA 1NHJA 4N3OA 4LF8E 4LFAI 4JI6I 4B3TI 3M6AA 4JYAE 2NA2A 2UUAI 2L33A 4DV6I 4L5NC 1HNZE 2O1TA 4IZJB 4DV3I 2M4IA 4FWGA 4USMA 2OI2A 1NHIA 2M1SA 4Q28A 3B82A 2UXCI 1H72C 4DV5E 1U2RA 1HK7A 2UUBE 1RR9A 3LMLA 3LLHA 5ADZA 5FLXQ 1T4NA 4B3RI 4WUDA 4JI7I 1IBKE 4HYMA 2NUGA 4DR6E 4DPXA 4FWHA 4GKJE 4M1KA 4GKKI 3IWCA 3H4LA 2V34A 3ZZ0A 4LF9I 1N36I 2H36X 3HQ1A 4LF5E 4USKA 3AUZA 4XTJA 2UUCE 3J7Yp 3B78A 4DMIA 3J81Q 4OOGC 2LUQA 1ZM2A 1MG7A 2LBSB 5GMEA 4DUZE 3ZKDA 1HNWE 1HR0I 2LJPA 4JI3E 3IWBA 1XMOE 2BV3A 2VQFI 4BC7A 4PRXA 3OTOI 2VQEI 4AQYE 1N34E 4DR1I 3JAMC 4DV7E 4HY1A 4HXZA 1NHHA 2KOUA 4KQVA 2Z5BA 4DUYE 1HNXI 3OMLA 2DEIA 3HULA 1B63A 3ADGA 4DU8A 1UEKA 1J5EI 2CPNA 4LF7I 4LFCE 4LTYA 1KTVA 2FGGA 1DARA 4KHPI 2Z5CB 3HPZA 4DR2I 2HHHE 3ADJA 1KVKA 1DI2A 1ZBQA 5LMUE 4X62I 2LTRA 4F9BB 3F6HA 4DV1E 2N3GA 4JG4A 2PNMA 2RSMA 4IZKB 4LF8I 2WW4A 2N3HA 3J7AM 1Z0CA 1X47A 5LL6R 2E1RA 4JYAI 5BR8E 3C4TA 3VYYA 1HNZI 2V83A 2VE7C 2V8PA 2B7VA 1K47A 4HACB 4RPFA 2WZOA 4JI0E 4DV5I 3Q1QA 4FW9A 2UUBI 4K0KE 3HXLA 1VISA 4DR7E 1EA6A 2EFGA 2O1WA 3CWVA 4DPTA 3J80Q 1IBKI 1FWKA 2E1MA 3F6GA 5AE3A 2CG9A 4DR6I 3P1XA 4P52A 2B9DA 3T1YE 4GKJI 1MX0A 4L8NA 4UT4A 5L3JA 1USUA 5IWAE 4LF5I 3B8HA 4JI1E 1H7SA 4WPYA 2UUCI 1S16A 3ADLA 2HFSA 2IOQA 4DUZI 1EI1A 1XMQE 1HNWI 5AASA 1XMOI 4NXME 1XNQE 1PVGA 2UU9E 1KIJA 1A6FA 1Z5BA 4AQYI 1EKZA 2L2MA 1RC7A 1N34I 3LPSA 1YYKA 4DV7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZ9 A;  1N32 E;  1J26 A;  4JI4 E;  1H73 A;  1KKH A;  4X65 E;  2ZBK B;  4DUY I;  4JV5 E;  4YHH E;  1RQ0 A;  1OJ4 A;  4WYQ B;  4DV0 E;  3PYD A;  5A2Q Q;  1MU5 A;  4LFC I;  4EMD A;  1FJG E;  4DKK A;  5IT9 Q;  2DMY A;  1O0W A;  4ZVI A;  1FI4 A;  2HHH I;  3VYX A;  1ELO A;  5LMU I;  2UXB E;  5LMN E;  4DV1 I;  4M2Z A;  4PU9 A;  2CZ9 A;  4DPW A;  1N0V C;  2V2Q A;  2HK2 A;  3GON A;  2KHX A;  2BM1 A;  1FKA E;  1Z5C A;  5BR8 I;  3K17 A;  1WHQ A;  1GQE A;  3J7A G;  2JY9 A;  1WHN A;  2L2N A;  4YY3 I;  4JI0 I;  4FWD A;  1BKN A;  2R42 A;  4K0K I;  4DR7 I;  2NUF A;  1XNR E;  5FLX C;  5CFF E;  1XHK A;  4JI2 E;  2LTS A;  3T1Y I;  4DV2 E;  2R3V A;  4LF6 E;  1H74 A;  5IWA I;  1IBL E;  4LF4 I;  4JI1 I;  1QZR A;  4DR4 E;  2L3C A;  3WU4 A;  4B3M E;  4WFT A;  1XMQ I;  3J81 C;  3WU3 A;  1UIL A;  4NXM I;  1XNQ I;  2UU9 I;  4B3S E;  1D6T A;  2E5L E;  1FNM A;  1ZXN A;  1Z0V A;  4DV4 E;  2A2D A;  1WUU A;  1N32 I;  3PYF A;  4OX9 E;  4JI4 I;  3QT7 A;  4JI5 E;  4X65 I;  2JVA A;  2X7I A;  4X64 E;  1YYW A;  2ZIT A;  4JV5 I;  2F4V E;  1ZXM A;  4YHH I;  1Z0B A;  4FN5 A;  2XEX A;  4X66 E;  4DV0 I;  3ZM7 A;  2L2K B;  1I94 E;  1S4E A;  2DIX A;  3LNU A;  1FJG I;  4DU7 A;  2RS7 A;  2DB2 A;  2UXD E;  4R1F A;  2ZM6 E;  2GS8 A;  2UXB I;  4UTG A;  1Z0W A;  4JI3 I;  4NXN E;  5LMN I;  1X48 A;  3F0N A;  2V2Z A;  1UHZ A;  3LTO A;  3V5R A;  3K1J A;  4DR5 E;  1YYO A;  1X49 A;  2L3J A;  3T1H E;  1PKP A;  3ZZT A;  1IBM E;  3D4J A;  3JAM Q;  2LJH A;  4JI8 E;  1XNR I;  4M30 A;  2J7K A;  4JI2 I;  3J80 C;  3QT6 A;  2RS6 A;  4DV2 I;  1Z5A A;  4LF6 I;  4LFB E;  1QU6 A;  1IBL I;  1NZ0 A;  4DR4 I;  1N33 E;  3WU5 A;  2VF3 A;  4B3M I;  2EZ6 A;  4HAC A;  1Z0G A;  3ADI A;  2IHR 1;  4DR3 E;  2B3T B;  4PRV A;  4B3S I;  2B7T A;  4ED4 A;  2Q2E B;  4DXL A;  2E5L I;  4DV4 I;  3HTX A;  1RRE A;  2AJ4 A;  4OX9 I;  4LFA E;  2HK3 A;  4JI5 I;  3V2U C;  4JI6 E;  4B3T E;  4X64 I;  2F4V I;  4X8W A;  2RTX A;  2LUP B;  2UUA E;  4DV6 E;  1Z59 A;  4DV3 E;  4X66 I;  3PYG A;  2V2V A;  1I94 I;  5GMD A;  4WUB A;  2UXC E;  2HFU A;  4DPY A;  5A2Q C;  1N0U A;  1Z0T A;  2UXD I;  2BM0 A;  4B3R E;  4JI7 E;  1FWL A;  5IT9 C;  2YT4 A;  2NPF A;  3WU6 A;  2ZM6 I;  4GKK E;  4LF9 E;  4NXN I;  1N36 E;  4MYT A;  1ZM9 A;  1ZBT A;  4DR5 I;  3T1H I;  1HR0 E;  2HKE A;  3ZKB A;  4MYU A;  2VQF E;  1IBM I;  2DEJ A;  3QT8 A;  3OTO E;  2VQE E;  4DR1 E;  4JI8 I;  2NUE A;  1Z0E A;  1H7U A;  1PIE A;  1HNX E;  3QT5 A;  4I3H A;  4P7A A;  4YY3 E;  4Z7C A;  4LFB I;  3PYE A;  2MDR A;  2LRS A;  1J5E E;  4LF7 E;  2A2C A;  3ZZU A;  3C4B A;  1T4O A;  1N33 I;  1ZM3 A;  4WUC A;  1ZM4 A;  4KHP E;  4DR2 E;  4URL A;  2X36 A;  4DPU A;  4DR3 I;  1T4L B;  4LF4 E;  4X62 E;  4Z7Y A;  1B62 A;  1STU A;  2HKJ A;  1NHJ A;  4LF8 E;  4LFA I;  4JI6 I;  4B3T I;  3M6A A;  4JYA E;  2NA2 A;  2UUA I;  2L33 A;  4DV6 I;  1HNZ E;  4DV3 I;  4FWG A;  4USM A;  2OI2 A;  1NHI A;  3B82 A;  2UXC I;  1H72 C;  4DV5 E;  1U2R A;  2UUB E;  1RR9 A;  3LLH A;  5FLX Q;  1T4N A;  4B3R I;  4WUD A;  4JI7 I;  1IBK E;  4HYM A;  2NUG A;  4DR6 E;  4DPX A;  4FWH A;  4GKJ E;  4M1K A;  4GKK I;  3ZZ0 A;  3H4L A;  2V34 A;  4LF9 I;  1N36 I;  4LF5 E;  4USK A;  4XTJ A;  2UUC E;  3J7Y p;  3B78 A;  3J81 Q;  4OOG C;  2LUQ A;  1ZM2 A;  1MG7 A;  2LBS B;  5GME A;  4DUZ E;  3ZKD A;  1HNW E;  1HR0 I;  2LJP A;  4JI3 E;  1XMO E;  2BV3 A;  2VQF I;  4PRX A;  3OTO I;  2VQE I;  4AQY E;  1N34 E;  4DR1 I;  3JAM C;  4DV7 E;  4HY1 A;  4HXZ A;  1NHH A;  4KQV A;  4DUY E;  1HNX I;  2DEI A;  3HUL A;  1B63 A;  3ADG A;  4DU8 A;  1UEK A;  1J5E I;  2CPN A;  4LF7 I;  4LFC E;  1KTV A;  1DAR A;  4KHP I;  4DR2 I;  2HHH E;  3ADJ A;  1KVK A;  1DI2 A;  5LMU E;  4X62 I;  2LTR A;  4DV1 E;  2N3G A;  4JG4 A;  2RSM A;  4LF8 I;  2WW4 A;  2N3H A;  3J7A M;  1Z0C A;  1X47 A;  5LL6 R;  2E1R A;  4JYA I;  5BR8 E;  3C4T A;  3VYY A;  1HNZ I;  2V8P A;  2B7V A;  1K47 A;  4HAC B;  4RPF A;  4JI0 E;  4DV5 I;  3Q1Q A;  4FW9 A;  2UUB I;  4K0K E;  1VIS A;  4DR7 E;  1EA6 A;  2EFG A;  3CWV A;  4DPT A;  3J80 Q;  1IBK I;  1FWK A;  4DR6 I;  3P1X A;  4P52 A;  4GKJ I;  3T1Y E;  1MX0 A;  4UT4 A;  5L3J A;  5IWA E;  4LF5 I;  3B8H A;  4JI1 E;  1H7S A;  2UUC I;  1S16 A;  3ADL A;  2HFS A;  4DUZ I;  1EI1 A;  1XMQ E;  1HNW I;  1XMO I;  4NXM E;  1XNQ E;  1PVG A;  2UU9 E;  1KIJ A;  1A6F A;  1Z5B A;  4AQY I;  1EKZ A;  2L2M A;  1RC7 A;  1N34 I;  3LPS A;  1YYK A;  4DV7 I; 
#chains in the Genus database with same CATH topology
 1YZ9 A;  2NN6 E;  1N32 E;  1J26 A;  1X3C A;  4JI4 E;  1H73 A;  1KKH A;  4X65 E;  2ZBK B;  4DUY I;  4F54 A;  4JV5 E;  2DLQ A;  4FW7 A;  1SR9 A;  2EM5 A;  4YHH E;  1RQ0 A;  2V86 A;  2V88 A;  2BA0 G;  2YTG A;  4WYQ B;  3ZOQ B;  1OJ4 A;  5ELW A;  2EN1 A;  5C0X B;  3Q6M A;  4MU4 A;  4DV0 E;  1JK2 A;  3PYD A;  2F8B A;  5A6J A;  5LLQ A;  5A2Q Q;  3MHH C;  1MU5 A;  4LFC I;  4EMD A;  2GQ0 A;  2EMA A;  3H09 A;  4R2A A;  2JWO A;  1FJG E;  4DKK A;  2BBG A;  4GEQ B;  3P76 A;  5IT9 Q;  2DMY A;  1O0W A;  5KL2 A;  4ZVI A;  1AH5 A;  4R2P A;  2WNR B;  1FI4 A;  2BB8 A;  1RHY A;  4IFD A;  2HHH I;  3VYX A;  1ELO A;  4ZYH A;  2LMZ A;  4AM3 A;  5A6B D;  3CDI A;  5LMU I;  1BBO A;  1TN9 A;  2EPP A;  2YU5 A;  2UXB E;  2K7I A;  3M99 B;  2CVE A;  4IFD E;  3RMP A;  2EOS A;  4LOM A;  5LMN E;  2GO4 A;  4DV1 I;  3THO B;  3GME A;  4M2Z A;  1YUI A;  2ENA A;  4PU9 A;  5JEA C;  2CZ9 A;  4DPW A;  2LE2 A;  1N0V C;  2Q8U A;  2NN6 D;  4BA2 B;  4R03 A;  2RQL A;  5A69 A;  2HK2 A;  2KHX A;  4MLQ A;  2V2Q A;  1IQS A;  4X9J A;  3GON A;  2BM1 A;  2EQ3 A;  1FKA E;  3BBG A;  4R2C A;  5JEA D;  5FWK A;  2EWL A;  4BMJ A;  1Z5C A;  4J8Z A;  2C38 A;  5BR8 I;  3K17 A;  3MHS C;  1TF3 A;  2WBU A;  2MC5 A;  2L6M A;  2NN6 F;  4KWY A;  4O24 A;  1WHQ A;  2EOE A;  1YH8 A;  2YRM A;  2C39 B;  5JEA F;  1GQE A;  3J7A G;  3VHT B;  1WHN A;  2JY9 A;  2L2N A;  2YTJ A;  4YY3 I;  3U1K A;  2JXP A;  4I8O A;  1Y6Z A;  3BID A;  4FWD A;  4JI0 I;  1P47 A;  1BKN A;  2J65 A;  2R42 A;  1EH6 A;  4K0K I;  4R8O A;  1PJS A;  2NUF A;  4DR7 I;  1XNR E;  2FV4 B;  1WXR A;  3M85 D;  2EQ0 A;  1N3G A;  5FLX C;  5CFF E;  4F2J C;  1YUJ A;  4JI2 E;  1XHK A;  2LTS A;  3P3G A;  1T38 A;  5F3W A;  3T1Y I;  4DV2 E;  4IFD D;  4O4K A;  2R3V A;  4LF6 E;  5DNL A;  1H74 A;  5IWA I;  1IBL E;  4M0V A;  1EH7 A;  4TUI A;  3NZK A;  4F9C B;  4JI1 I;  1QZR A;  4DR4 E;  2BR2 A;  2PO0 B;  3U1Y A;  4HTG A;  4KZS A;  2HGH A;  4IZJ A;  1A1J A;  1EH8 A;  2L3C A;  2DLK A;  2GO3 A;  2NN6 B;  3WU4 A;  5DRR A;  1WJP A;  2YZT A;  4B3M E;  4WFT A;  4F6N A;  1MGT A;  1KYQ A;  2ENC A;  3J81 C;  2O3Z A;  3GLL A;  4BA1 A;  5JEA B;  4IFD F;  2JE6 A;  3P06 A;  5T6J A;  2ODR D;  2JOX A;  2V85 A;  3WU3 A;  5DNY A;  1UIL A;  4FW4 A;  4NXM I;  1XNQ I;  2UU9 I;  3HPS A;  4B3S E;  1X6F A;  5DRP A;  1B69 A;  1D6T A;  2E5L E;  1FNM A;  1ZXN A;  1Z0V A;  4DV4 E;  2A2D A;  3PS3 A;  1WUU A;  4QNJ A;  1N32 I;  3PYF A;  4OX9 E;  4JI4 I;  3M7N D;  3QT7 A;  3Q6N A;  4JI5 E;  1OYS A;  4X65 I;  2JVA A;  1A1I A;  4X64 E;  2X7I A;  1YYW A;  2ZIT A;  4JV5 I;  4R2D A;  2F4V E;  3K6Q A;  3GCM A;  4LPF A;  1ZXM A;  2JPA A;  1OYP A;  1Z0B A;  4MQY A;  4FN5 A;  2XEX A;  4YHH I;  2EMK A;  1E3P A;  2JT2 A;  5C0X C;  3THN A;  4O5G A;  1Y5Y A;  4BCA A;  2YSP A;  4X66 E;  2O1U A;  4FW5 A;  4DV0 I;  3ZM7 A;  4IFD B;  4WSG A;  2L2K B;  5KL7 A;  2C37 A;  1I94 E;  1ZU1 A;  1S4E A;  2DIX A;  2GLI A;  3H1C A;  2V89 A;  3LNU A;  1FJG I;  4DU7 A;  2RS7 A;  2DB2 A;  2JOB A;  3JTZ A;  1A1G A;  2UXD E;  2PRT A;  1MEY C;  4P7D A;  2VF1 A;  4R1F A;  2LCE A;  2PNZ A;  2YTN A;  2GPI A;  1Y4U A;  3AV0 A;  2Z5E A;  2ZM6 E;  2GS8 A;  2A25 A;  2WP8 B;  2UXB I;  4UTG A;  1Z0W A;  4JI3 I;  5KL6 A;  2DSY A;  4NXN E;  5LMN I;  1X48 A;  5K36 A;  3F0N A;  4IJD A;  2V2Z A;  2Z5B B;  1UHZ A;  2EOZ A;  2DRP A;  3LTO A;  3V5R A;  5K36 E;  2YRH A;  3K1J A;  1A1F A;  4DR5 E;  1YYO A;  1X49 A;  2L3J A;  3T1H E;  4FW6 A;  1PKP A;  2BA1 D;  4U3D A;  2EL5 A;  2EMZ A;  3LPS A;  2EPK X;  3ZZT A;  1IBM E;  4ZYD A;  2IES A;  4R2Q A;  3C6M A;  2R76 A;  3D4J A;  3JAM Q;  2V8Q B;  2LJH A;  2PO1 A;  2EP3 A;  4JI8 E;  1KJK A;  2N8X A;  2YWQ A;  2EPO A;  2EOQ A;  2EM2 A;  5DNX A;  1XNR I;  1BB8 A;  1G2D C;  4LCG A;  2YSO A;  4M30 A;  2J7K A;  1YSA C;  2KON A;  4IZK A;  3J80 C;  4JI2 I;  2VES A;  3QT6 A;  4F6M A;  1GZ6 A;  2RS6 A;  4DV2 I;  1Z5A A;  4LF6 I;  2JE6 B;  4LFB E;  1QU6 A;  1IBL I;  1NZ0 A;  4DR4 I;  3IWD A;  2EMX A;  1N33 E;  2NN6 C;  2O1V A;  3WU5 A;  2EQ1 A;  3CDJ A;  2YTQ A;  4HEI A;  2VF3 A;  2LV2 A;  2EZ6 A;  4AIM A;  2FTX B;  1X5W A;  2LO3 A;  5AE2 A;  4WSP A;  4HAC A;  1JK1 A;  1Z0G A;  3ADI A;  3J81 Q;  4MLV A;  2IHR 1;  4DR3 E;  2YTD A;  2GHF A;  2EOY A;  2B3T B;  2EOJ A;  4PRV A;  4B3S I;  2EL4 A;  2B7T A;  4ED4 A;  2Q2E B;  4DXL A;  5K36 F;  1NEI A;  3BGH A;  4LF4 I;  4NZV A;  4MU1 A;  2E5L I;  2G7H A;  3EQ1 A;  2YTE A;  4DV4 I;  2YTF A;  3HTX A;  1RRE A;  2AJ4 A;  2IOP A;  4OX9 I;  1YFH A;  1X6E A;  1T39 A;  4LFA E;  2HK3 A;  4JI5 I;  3V2U C;  4JI6 E;  4B3T E;  2V87 A;  4X64 I;  3M85 G;  2JEA B;  5A6A A;  2NAB A;  4LU9 A;  2F4V I;  4X8W A;  2RTX A;  1ZR9 A;  2LUP B;  2EN3 A;  2UUA E;  4DV6 E;  4IFD C;  5TSE A;  3UK3 C;  2EOM A;  4F9A B;  1DGC A;  4DV3 E;  2LJU A;  1Z59 A;  2J7J A;  1Y4S A;  3PYG A;  2V2V A;  3PRY A;  2PNZ B;  4X66 I;  2I13 A;  4OZE A;  1I94 I;  1Z1B A;  4WXD A;  5GMD A;  4WUB A;  2UXC E;  2HFU A;  2EN7 A;  4DPY A;  5A2Q C;  1A1L A;  1N0U A;  1Z0T A;  2CGE A;  4BHC A;  2UXD I;  3DF6 A;  3JU0 A;  1UBD C;  2VRD A;  2PO0 A;  2K4V A;  4B3R E;  2BM0 A;  2EPN A;  4JI7 E;  5KL5 A;  5IT9 C;  1FWL A;  1SFE A;  3C6K A;  2YT4 A;  2ODR C;  2NPF A;  4NHR A;  3WU6 A;  2ZM6 I;  4GKK E;  2EMB A;  4LF9 E;  4NXN I;  4OO1 E;  1N36 E;  2EM0 A;  2PNL A;  4MYT A;  2EM7 A;  1NCS A;  4R2S A;  4GZN C;  4RHB B;  2EOI A;  1VI7 A;  1ZM9 A;  2CSH A;  3HJC A;  5KL3 A;  2EMW A;  5EKW A;  1ZBT A;  4BS9 A;  4DR5 I;  3T1H I;  2PO1 B;  3L00 A;  1IQO A;  1HR0 E;  2MDG A;  1A1H A;  2HKE A;  3ZKB A;  1GTK A;  4MYU A;  5AE1 A;  1XXE A;  3EPL A;  1USV A;  2VQF E;  2WNR A;  1IBM I;  3ECR A;  2JP9 A;  2DEJ A;  3QT8 A;  3OTO E;  2EJ4 A;  3K85 A;  4ISA A;  2VQE E;  3FIG A;  1R6M A;  4TUG A;  1UDS A;  1ZAA C;  2JR1 A;  4DR1 E;  2IER A;  4JI8 I;  2NUE A;  1Z0E A;  2MC6 A;  3KWR A;  2DMI A;  4BBY A;  2YRK A;  2EOX A;  2EM3 A;  3VK6 A;  3DJW A;  2M7Q A;  1H7U A;  3EPJ A;  1PIE A;  4BA2 A;  2EPX A;  1HNX E;  3QT5 A;  2L8T A;  4I3H A;  1YHC A;  4P7A A;  1QNT A;  4IZJ D;  4YY3 E;  1Y60 A;  3BF2 A;  4B3M I;  4Z7C A;  4LFB I;  4OO1 D;  3PYE A;  2MDR A;  2LRS A;  4P78 A;  1J5E E;  4LF7 E;  2A2C A;  2L92 A;  3C4B A;  2EOO A;  1T4O A;  2M9A A;  3ZZU A;  1R6L A;  2HC5 A;  1N33 I;  2C38 B;  1UDO A;  2AE8 A;  1ZM3 A;  4WUC A;  1ZM4 A;  4KHP E;  4FK5 C;  2BA1 G;  4OO1 F;  2CTD A;  4BC9 A;  4DR2 E;  4URL A;  4ZYE A;  2X36 A;  4DPU A;  4DR3 I;  1DQ3 A;  2HJJ A;  1T4L B;  4LF4 E;  4X62 E;  4Z7Y A;  2EM4 A;  1B62 A;  2Z5C A;  1STU A;  3PS2 A;  3MSW A;  2HKJ A;  1NHJ A;  4ZYG A;  5A6B A;  3L7Z A;  4N3O A;  4LF8 E;  4LFA I;  2RPC A;  5DRQ A;  4JI6 I;  4B3T I;  2MKD A;  3M6A A;  2EPR A;  2EOR A;  1UDQ A;  4JYA E;  2NA2 A;  2EML A;  2NN6 A;  2PO2 A;  2UUA I;  2L33 A;  2BR2 B;  4DV6 I;  4L5N C;  1HNZ E;  5JEA A;  2O1T A;  4IZJ B;  5DRO A;  4DV3 I;  2M4I A;  4FWG A;  4USM A;  2OI2 A;  1NHI A;  4OO1 B;  2M1S A;  2YU8 A;  4Q28 A;  4BA1 B;  5JEA E;  3B82 A;  1PDA A;  1H72 C;  4DV5 E;  2UXC I;  2WBS A;  1U2R A;  2JEB A;  5K36 C;  1HK7 A;  2UUB E;  1RR9 A;  3LML A;  3LLH A;  5ADZ A;  5FLX Q;  1T4N A;  2LT7 A;  4R2R A;  4B3R I;  4WUD A;  4JI7 I;  2EM9 A;  2EM8 A;  1IBK E;  4IS9 A;  5K36 D;  5AC4 A;  4HYM A;  2ELY A;  2NUG A;  4DR6 E;  2EN4 A;  4DPX A;  4FWH A;  2R1F A;  4GKJ E;  4M1K A;  4GKK I;  3IWC A;  3H4L A;  2V34 A;  3ZZ0 A;  3QG5 C;  4LF9 I;  2BA0 D;  1N36 I;  2H36 X;  3HQ1 A;  4LF5 E;  4USK A;  3AUZ A;  4XTJ A;  2E72 A;  2MKN A;  2UUC E;  1RMD A;  3J7Y p;  3B78 A;  4DMI A;  2EL6 A;  4OOG C;  2LUQ A;  1ZM2 A;  1MG7 A;  2EPZ A;  2LBS B;  4DUZ E;  3P3C A;  5GME A;  4OO1 A;  3ZKD A;  1HNW E;  3DD6 A;  4OKG A;  4M9V C;  3TQM A;  1HR0 I;  2LJP A;  4R2E A;  2ADR A;  4JI3 E;  3IWB A;  1YPN A;  4IS1 C;  1XMO E;  2C37 B;  3PS1 A;  2BV3 A;  2VQF I;  4BC7 A;  2I9I A;  4PRX A;  3OTO I;  2VQE I;  4AQY E;  2JYA A;  1N34 E;  2WP8 A;  3JAM C;  4DR1 I;  4DV7 E;  2EN8 A;  3HKM A;  4HY1 A;  1L4S A;  4HXZ A;  1NHH A;  2KOU A;  4KQV A;  3KZZ A;  2Z5B A;  4DUY E;  3KZY A;  1HNX I;  3OML A;  2DEI A;  3HUL A;  5K36 B;  1B63 A;  2EN6 A;  3ADG A;  2YPN A;  5IV8 B;  4DU8 A;  2D9H A;  1XMQ I;  1UEK A;  1J5E I;  2CPN A;  4LF7 I;  1LLM C;  3KRN A;  2EPU A;  4LTY A;  4LFC E;  2EPC A;  1KTV A;  3EPK A;  1UN6 B;  2FGG A;  4FW3 A;  1DAR A;  2CT1 A;  2Z5C B;  4MU3 A;  4KHP I;  5C0X A;  3M7N G;  4QNK A;  2DGC A;  4U3B A;  2F1D A;  3HPZ A;  4DR2 I;  2HHH E;  3L7Z B;  1WRJ A;  2EMF A;  3ADJ A;  1KVK A;  2RSI A;  1DI2 A;  1ZBQ A;  1UDN A;  5C0X E;  5LMU E;  4X62 I;  2EMY A;  2EE8 A;  2LTR A;  2EOF A;  4F9B B;  1X6H A;  3F6H A;  4DV1 E;  1AAY A;  1IMU A;  2YTP A;  1OYR A;  2N3G A;  2PO2 B;  4AID A;  4JG4 A;  2PNM A;  2RSM A;  2EMG A;  4LCH A;  4GKJ I;  4IZK B;  4LF8 I;  1BBG A;  3P3E A;  2WW4 A;  2N3H A;  3J7A M;  2EN2 A;  1Z0C A;  1F2I G;  4RH8 A;  1X47 A;  5LL6 R;  2E1R A;  1A1K A;  5BR8 E;  4BHB A;  4JYA I;  2JEB B;  3C4T A;  3VYY A;  1HNZ I;  4O43 A;  2V83 A;  4MU0 A;  2VE7 C;  2V8P A;  4OO1 C;  5KL4 A;  5A6K A;  3B4T A;  1TF6 A;  2B7V A;  1K47 A;  2EPM X;  4HAC B;  3EPH A;  2WZO A;  4JI0 E;  5IXM B;  4RPF A;  2EMH A;  4FW9 A;  4DV5 I;  3Q1Q A;  2UUB I;  4K0K E;  4WXC A;  1G2F C;  3HXL A;  1VIS A;  4DR7 E;  1EA6 A;  2EFG A;  2WBT A;  5AC5 A;  2O1W A;  3CWV A;  5EL9 A;  4DPT A;  3J80 Q;  1FWK A;  2E1M A;  3F6G A;  2C39 A;  5AE3 A;  1IBK I;  2CG9 A;  4J3D A;  4DR6 I;  2EM6 A;  2ELZ A;  3P1X A;  5C0X D;  4P52 A;  2B9D A;  1PJT A;  3T1Y E;  4GQU A;  4NBQ A;  2JEA A;  4WX9 A;  2EMC A;  4L8N A;  1MX0 A;  1P42 A;  4UT4 A;  5L3J A;  1USU A;  5IWA E;  2YTO A;  4Q35 B;  4LF5 I;  3B8H A;  4JI1 E;  4N4R B;  1PJQ A;  1H7S A;  4WPY A;  2UUC I;  1S16 A;  3ADL A;  2HFS A;  4LCF A;  2EMI A;  2IOQ A;  4DUZ I;  1EI1 A;  5C0X F;  1XMQ E;  1HNW I;  2WCC 3;  5AAS A;  2ENH A;  2EPA A;  2YTI A;  1XMO I;  1E3H A;  4NXM E;  2EPL X;  1XNQ E;  2LVH A;  2UU9 E;  1PVG A;  1KIJ A;  4MDT A;  1A6F A;  1Z5B A;  4AQY I;  1EKZ A;  2L2M A;  1RC7 A;  1N34 I;  2EOH A;  1YYK A;  3UHM A;  4DV7 I; 
#chains in the Genus database with same CATH homology
 1YZ9 A;  1N32 E;  1J26 A;  4JI4 E;  1H73 A;  1KKH A;  4X65 E;  2ZBK B;  4DUY I;  4F54 A;  4JV5 E;  1SR9 A;  4YHH E;  1RQ0 A;  2V86 A;  2V88 A;  1OJ4 A;  4WYQ B;  3ZOQ B;  3Q6M A;  4DV0 E;  3PYD A;  2F8B A;  5A2Q Q;  1MU5 A;  4LFC I;  4EMD A;  2GQ0 A;  3H09 A;  2JWO A;  1FJG E;  4DKK A;  4GEQ B;  5IT9 Q;  2DMY A;  1O0W A;  4ZVI A;  1FI4 A;  2HHH I;  3VYX A;  1ELO A;  2LMZ A;  5LMU I;  2UXB E;  3RMP A;  5LMN E;  4DV1 I;  4M2Z A;  4PU9 A;  2CZ9 A;  4DPW A;  2LE2 A;  1N0V C;  4R03 A;  2HK2 A;  2V2Q A;  3GON A;  2KHX A;  2BM1 A;  1FKA E;  5FWK A;  2EWL A;  4BMJ A;  1Z5C A;  4J8Z A;  5BR8 I;  3K17 A;  2MC5 A;  2L6M A;  1WHQ A;  1GQE A;  3J7A G;  2JY9 A;  1WHN A;  2L2N A;  4YY3 I;  4I8O A;  1Y6Z A;  4JI0 I;  4FWD A;  1BKN A;  2R42 A;  4K0K I;  4R8O A;  4DR7 I;  2NUF A;  1XNR E;  2FV4 B;  1WXR A;  5FLX C;  5CFF E;  1XHK A;  4JI2 E;  2LTS A;  5F3W A;  3T1Y I;  4DV2 E;  2R3V A;  4LF6 E;  1H74 A;  5IWA I;  1IBL E;  4M0V A;  4TUI A;  4LF4 I;  4F9C B;  4JI1 I;  1QZR A;  4DR4 E;  4KZS A;  4IZJ A;  2L3C A;  3WU4 A;  2YZT A;  4B3M E;  4WFT A;  1XMQ I;  3J81 C;  3P06 A;  5T6J A;  2ODR D;  2JOX A;  2V85 A;  3WU3 A;  5DNY A;  1UIL A;  4NXM I;  1XNQ I;  2UU9 I;  3HPS A;  4B3S E;  1D6T A;  2E5L E;  1FNM A;  1ZXN A;  1Z0V A;  4DV4 E;  2A2D A;  1WUU A;  1N32 I;  3PYF A;  4OX9 E;  4JI4 I;  3QT7 A;  3Q6N A;  4JI5 E;  4X65 I;  2JVA A;  2X7I A;  4X64 E;  1YYW A;  2ZIT A;  4JV5 I;  2F4V E;  3K6Q A;  1ZXM A;  4YHH I;  1Z0B A;  4FN5 A;  2XEX A;  2O1U A;  4BCA A;  4X66 E;  4DV0 I;  3ZM7 A;  2L2K B;  1I94 E;  1S4E A;  2DIX A;  3LNU A;  2V89 A;  1FJG I;  4DU7 A;  2RS7 A;  2DB2 A;  2JOB A;  3JTZ A;  2UXD E;  4P7D A;  2VF1 A;  4R1F A;  1Y4U A;  3AV0 A;  2Z5E A;  2ZM6 E;  2GS8 A;  2UXB I;  4UTG A;  1Z0W A;  4JI3 I;  4NXN E;  2DSY A;  5LMN I;  1X48 A;  3F0N A;  2V2Z A;  2Z5B B;  1UHZ A;  3LTO A;  3V5R A;  3K1J A;  4DR5 E;  1YYO A;  1X49 A;  2L3J A;  3T1H E;  1PKP A;  3ZZT A;  1IBM E;  3D4J A;  3JAM Q;  2V8Q B;  2LJH A;  4JI8 E;  1XNR I;  4M30 A;  2J7K A;  2KON A;  4IZK A;  3J80 C;  4JI2 I;  3QT6 A;  2RS6 A;  1GZ6 A;  4DV2 I;  1Z5A A;  4LF6 I;  4LFB E;  1QU6 A;  1IBL I;  1NZ0 A;  4DR4 I;  3IWD A;  1N33 E;  3WU5 A;  2O1V A;  2VF3 A;  4B3M I;  2EZ6 A;  2FTX B;  5AE2 A;  4WSP A;  4HAC A;  1Z0G A;  3ADI A;  2IHR 1;  4DR3 E;  2B3T B;  4PRV A;  4B3S I;  2B7T A;  4ED4 A;  2Q2E B;  4DXL A;  2E5L I;  2G7H A;  4DV4 I;  3HTX A;  1RRE A;  2AJ4 A;  2IOP A;  4OX9 I;  4LFA E;  2HK3 A;  4JI5 I;  3V2U C;  4JI6 E;  4B3T E;  2V87 A;  4X64 I;  4LU9 A;  2F4V I;  4X8W A;  2RTX A;  2LUP B;  2UUA E;  4DV6 E;  4F9A B;  1Z59 A;  4DV3 E;  4X66 I;  1Y4S A;  3PYG A;  2V2V A;  3PRY A;  1I94 I;  5GMD A;  4WUB A;  2UXC E;  2HFU A;  4DPY A;  5A2Q C;  1N0U A;  1Z0T A;  2CGE A;  2UXD I;  3DF6 A;  3JU0 A;  2K4V A;  4B3R E;  2BM0 A;  4JI7 E;  5IT9 C;  1FWL A;  2YT4 A;  2ODR C;  2NPF A;  3WU6 A;  2ZM6 I;  4GKK E;  4LF9 E;  4NXN I;  1N36 E;  2PNL A;  4MYT A;  3HJC A;  1ZM9 A;  1ZBT A;  4BS9 A;  4DR5 I;  3T1H I;  1HR0 E;  2HKE A;  3ZKB A;  4MYU A;  5AE1 A;  1USV A;  2VQF E;  1IBM I;  2DEJ A;  3QT8 A;  3OTO E;  3K85 A;  2VQE E;  3FIG A;  4TUG A;  2JR1 A;  4DR1 E;  4JI8 I;  2NUE A;  1Z0E A;  2MC6 A;  3KWR A;  4BBY A;  3VK6 A;  3DJW A;  2M7Q A;  1H7U A;  1PIE A;  1HNX E;  3QT5 A;  2L8T A;  4I3H A;  4P7A A;  4IZJ D;  4YY3 E;  4Z7C A;  4LFB I;  3PYE A;  2MDR A;  2LRS A;  4P78 A;  1J5E E;  4LF7 E;  2A2C A;  2L92 A;  3C4B A;  3ZZU A;  1T4O A;  1N33 I;  1ZM3 A;  4WUC A;  1ZM4 A;  4KHP E;  4BC9 A;  4DR2 E;  4URL A;  2X36 A;  4DPU A;  4DR3 I;  1DQ3 A;  1T4L B;  4LF4 E;  4X62 E;  4Z7Y A;  1B62 A;  2Z5C A;  1STU A;  3MSW A;  2HKJ A;  1NHJ A;  4N3O A;  4LF8 E;  4LFA I;  4JI6 I;  4B3T I;  3M6A A;  4JYA E;  2NA2 A;  2UUA I;  2L33 A;  4DV6 I;  4L5N C;  1HNZ E;  2O1T A;  4IZJ B;  4DV3 I;  2M4I A;  4FWG A;  4USM A;  2OI2 A;  1NHI A;  2M1S A;  4Q28 A;  3B82 A;  2UXC I;  1H72 C;  4DV5 E;  1U2R A;  1HK7 A;  2UUB E;  1RR9 A;  3LML A;  3LLH A;  5ADZ A;  5FLX Q;  1T4N A;  4B3R I;  4WUD A;  4JI7 I;  1IBK E;  4HYM A;  2NUG A;  4DR6 E;  4DPX A;  4FWH A;  4GKJ E;  4M1K A;  4GKK I;  3IWC A;  3H4L A;  2V34 A;  3ZZ0 A;  4LF9 I;  1N36 I;  2H36 X;  3HQ1 A;  4LF5 E;  4USK A;  3AUZ A;  4XTJ A;  2UUC E;  3J7Y p;  3B78 A;  4DMI A;  3J81 Q;  4OOG C;  2LUQ A;  1ZM2 A;  1MG7 A;  2LBS B;  5GME A;  4DUZ E;  3ZKD A;  1HNW E;  1HR0 I;  2LJP A;  4JI3 E;  3IWB A;  1XMO E;  2BV3 A;  2VQF I;  4BC7 A;  4PRX A;  3OTO I;  2VQE I;  4AQY E;  1N34 E;  4DR1 I;  3JAM C;  4DV7 E;  4HY1 A;  4HXZ A;  1NHH A;  2KOU A;  4KQV A;  2Z5B A;  4DUY E;  1HNX I;  3OML A;  2DEI A;  3HUL A;  1B63 A;  3ADG A;  4DU8 A;  1UEK A;  1J5E I;  2CPN A;  4LF7 I;  4LFC E;  4LTY A;  1KTV A;  2FGG A;  1DAR A;  4KHP I;  2Z5C B;  3HPZ A;  4DR2 I;  2HHH E;  3ADJ A;  1KVK A;  1DI2 A;  1ZBQ A;  5LMU E;  4X62 I;  2LTR A;  4F9B B;  3F6H A;  4DV1 E;  2N3G A;  4JG4 A;  2PNM A;  2RSM A;  4IZK B;  4LF8 I;  2WW4 A;  2N3H A;  3J7A M;  1Z0C A;  1X47 A;  5LL6 R;  2E1R A;  4JYA I;  5BR8 E;  3C4T A;  3VYY A;  1HNZ I;  2V83 A;  2VE7 C;  2V8P A;  2B7V A;  1K47 A;  4HAC B;  4RPF A;  2WZO A;  4JI0 E;  4DV5 I;  3Q1Q A;  4FW9 A;  2UUB I;  4K0K E;  3HXL A;  1VIS A;  4DR7 E;  1EA6 A;  2EFG A;  2O1W A;  3CWV A;  4DPT A;  3J80 Q;  1IBK I;  1FWK A;  2E1M A;  3F6G A;  5AE3 A;  2CG9 A;  4DR6 I;  3P1X A;  4P52 A;  2B9D A;  3T1Y E;  4GKJ I;  1MX0 A;  4L8N A;  4UT4 A;  5L3J A;  1USU A;  5IWA E;  4LF5 I;  3B8H A;  4JI1 E;  1H7S A;  4WPY A;  2UUC I;  1S16 A;  3ADL A;  2HFS A;  2IOQ A;  4DUZ I;  1EI1 A;  1XMQ E;  1HNW I;  5AAS A;  1XMO I;  4NXM E;  1XNQ E;  1PVG A;  2UU9 E;  1KIJ A;  1A6F A;  1Z5B A;  4AQY I;  1EKZ A;  2L2M A;  1RC7 A;  1N34 I;  3LPS A;  1YYK A;  4DV7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...