4JYAF

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4jyaF00
1HNXF 1CQMA 2ZM6F 4LF5F 1GH8A 4DV7F 2UUCF 4DUZF 4DV5F 5LMNF 2HHHF 1CQNA 1IJFB 1HNWF 4JI7F 3ZZPA 2UU9F 4DV3F 1XMQF 4X65F 4DUYF 1B64A 4JI8F 4DV1F 1IBKF 2VQEF 1HR0F 4DV4F 4NXMF 5LMUF 1N33F 2YY3A 2UXDF 4YY3F 2UXBF 2RJZA 4JI2F 4JI0F 1J5EF 1XMOF 2E5LF 4JI3F 2UUAF 1G1XA 1VMBA 4JYAF 1F60B 1IBMF 4NXNF 4JI5F 1RISA 1HNZF 2BXJA 1FJGF 4B3RF 1N34F 4LF4F 4LF9F 4DR4F 4X64F 4JI6F 4X62F 4LF7F 2KJVA 1QJHA 1LOUA 5IWAF 4DR5F 1N32F 1XNRF 3R3TA 2VQFF 4DR7F 4LF8F 3T1HF 4JI4F 4DV6F 1N36F 1G7CB 4JV5F 2UXCF 2J5AA 1IJEB 4DV2F 3OTOF 2BVZA 2KJWA 2B7BB 2F4VF 4JI1F 2B7CB 4AQYF 4X66F 1FKAF 1IBLF 2UUBF 4LFAF 4B3MF 4LF6F 5AJ3F 5BR8F 4DR1F 4GKJF 4KHPF 3T1YF 4K0KF 4B3TF 4DV0F 1XNQF 4DR3F 4LFCF 1I94F 4DR6F 4GKKF 4OX9F 4YHHF 4LFBF 4DR2F 4B3SF
chains in the Genus database with same CATH superfamily
3I0RB 4HTIA 3QBCA 1BQMA 4ZPWR 2JZ5A 4OZLA 2C22A 1VQMS 5KFVA 2BQRA 3S7RA 3RW7A 1CQNA 1TK5A 4DN9A 4YR0A 3G8TA 1XQIA 1B64A 2VF3A 3D9BA 1F9FA 2VFTA 3TARA 2HHHJ 3M8RA 1NEEA 4ECYA 3W8PA 1PGZA 1EP4B 2MZJA 5M2PA 2MZTA 2WSEC 1RT6B 1LOUA 3RRKA 3MMJA 1TFWA 1KQSR 1KFSA 3CC2S 4ZVUB 5JVHQ 1UW4A 3KLHB 3AXMA 1M1KT 1TFYA 1NK0A 1I3OB 2B3TB 2F4VF 4CLLA 1S1VB 1JNZB 4Q2MA 4NASA 4MK7A 2RF2B 1TMMA 2QLFB 4N47A 3X3UA 1RYRA 4ED7A 2PD1A 3C66A 3SXLA 2GS8A 5ADZA 1VIOA 1R8PA 3HHDA 1S5ZA 4NCGA 2JWNA 1T9WA 1FFWB 4ZVPB 2XO6A 3M8QA 4DUZJ 5ETPA 2QC3A 3PJ9A 3C15A 1SUQB 1Y5IB 3IRXA 4QR1A 3RB4A 3K8WA 1FA0A 3O3LA 1LK7A 2P9EA 1S6PB 2OMOA 1RU1A 2DKOB 2DGTA 2J9CA 4FP9A 3OHBA 3GJRB 3HSZA 3PKYA 2RDDA 4N77A 3VHQA 3OFHA 3Q8UA 1NK5A 2F63A 2ZD1A 2QEXS 2HHSA 3QWUA 1YJWS 4JI4F 3FC9A 1QSYA 1QE1B 5LJ3Y 3ZZZA 2NZ4A 1HWLA 1Q7LB 4UY85 4RW4A 2E1MC 4ZVEA 4XIUA 3TUIC 5RUBA 3HHKA 2GX8A 3BO3A 4GMKA 3CCLS 2DNRA 4DV0F 2DGVA 1Y11A 1MNEA 5BYQA 1D9DA 4DR1J 1HBUB 1S59A 1RT2B 2VFRA 5C42B 2RH3A 1KOOA 4BWJA 3D7SB 5KFXA 1RT4A 2I9SA 5D6GA 4YMEA 2NUUG 3MM7A 4X4OA 4HACA 2J7UA 3LGMA 1FCAA 1NSPA 2JC0A 2W9CB 2RS8A 2YX7A 3CDBA 3GIRA 4XTTA 1WSVA 4A8WA 2HVZA 3Q22A 2KJVA 5IT4A 3JYTA 3PHEA 1DQ8A 3M32A 5KFUA 4DZDA 1SVDA 5J2NB 1LXJA 1RT5A 4Q8FA 1ELOA 3PW5A 2VZ9A 4G3IA 3GB0A 1U1LA 3AH6A 1RT7A 2MGZB 1KLMB 3GLJA 1V6HA 2EBEA 5HP1B 4QWBA 3J7YU 3ZZYA 2A6MA 5T41A 1ZM4A 2G0CA 1QAXA 1F5CA 4B3SF 2BOPA 2HK2A 2NQPA 3KNGA 1BWVA 1TUGB 1F2GA 1QAJA 5D0HA 4KQZA 2VFVA 1XMQF 3UDEA 3JS9A 1IKWA 4JBCA 4C98A 2PI4A 1U8SA 4ICLA 2UVWA 3SSQA 1Z2ZA 4O4GB 4TYBA 3OLBA 1Y10A 3HULA 5DZ7A 2QYGA 1S9EA 4I1TA 4NXNF 1U8WA 3QT8A 2W24A 1IXKA 1J5EJ 1MN7A 3HVAA 3IBCB 3HVRA 1FNXH 2ZJQQ 2PI5A 3CD6S 2FVPA 1FRHA 2DCLA 4K5RA 3HFZB 4CQ1A 2X7IA 7FD1A 3CPWR 1J27A 2KFZA 3QRPA 2QTWA 3RBDA 5CYJA 2KN4A 3FFIA 3LWMA 4ZN3A 3CJ8A 3HLUA 5HK4A 2HGMA 2CPEA 2Z2YB 3AD7C 4F3OA 4DR2F 2ZJRQ 2V0NA 2IIHA 3CCQS 1LFWA 4KE5A 2E7WA 2ZVSA 3H4BA 1D3WA 4DV5F 3US5A 2D7SA 4I2QA 4K4WA 4FDFA 1IM4A 1LK5A 4CO2A 2OEMA 4CLYA 4ZDNA 1KVJA 2VBZA 4RUHA 4MH8A 4X65J 3O2IA 5IQQA 3WZ0A 3ZXWA 1DAXA 4NZ7A 3HK2A 4HDHA 4ANDA 4NLVA 1OSDA 2CQ2A 4B9VA 4NMLA 3SDEB 4P73A 5D4OA 1ZBTA 3TA1A 1BY9A 3VAMA 1SH2A 2K06A 1VK8A 4X66F 5IC4B 2PEHA 2D69A 2WW8A 3J7Z5 1HI8A 4ZHRA 2G4BA 4Y0FA 1ZA2B 8ATCB 4EMDA 2RU9A 1DTQB 2E5GA 4N8NA 1S1WA 2QL5B 5A0YB 4DBQA 1ZZNA 3P6YC 3M2RB 5KG7A 1VI7A 4TVAB 1RCXB 3B8HA 4X4TA 3T6JA 3PNIA 2MQMA 4FN5A 1VQOS 1UMJA 4ZCIA 1I94J 4DSKA 3DDKA 3RG6A 1HNXJ 5F8MA 1A6LA 3BSCA 1EETA 3VAJA 1TKZA 3KNAA 3GSDA 4JV2A 1IM6A 4E8UA 1PO6A 3A8KA 4K8RA 4QBUA 3KUGA 4CH1A 3FEXB 3CMQA 2VH7A 4NLWA 4PEOA 4QYZK 1Y5LB 4IFYB 2IA0A 1FKAF 3RRGA 4AL7A 3ILOA 2V2KA 4DV2J 1N5YB 2LQJA 3CJ0A 4F4KA 2CJKA 4TQSA 4QJVA 5D0RA 1YJUA 3J81j 4F0HA 3LOUA 2HHTA 1FJCA 2QLXA 4PG8A 4XPEA 2H1YA 1KOHA 2OPRA 1K9MT 3NLCA 1HMVA 3EVWA 2VPZB 2BA9A 3G6VA 5E5NA 3NS7B 2HNZA 1IBCB 5E3QA 2FY8A 1U09A 3G71S 4H54A 1HWUA 3CCVS 4OYZA 3CDUA 3DCAA 4USKA 3E8OA 1FRMA 1KTQA 3BS9A 3BGLA 1KVKA 1JLFA 1XK8A 3OTDA 4LF7F 3GIIA 1TTHB 4Q2LA 4KC5A 4LBHA 4NE9C 2OO4A 4X62J 2FDNA 2OAUA 2K3IA 1CC8A 3GYGA 4WP9A 2CIMA 2CFXA 4OZNA 5L1KA 3TZYA 1QAIA 3CD0A 6FDRA 2DR6A 3N6MA 4C8KA 2Z4PA 2DNZA 1HHSA 2BYCA 2DXFA 3F44A 1GX6A 4R5PA 3C6TB 3DMJB 1X4FA 4FF3A 4DLGA 4ED8A 3K58A 2CQ4A 3M30B 3IFEA 4G65A 3NL0A 2PIIA 3E01A 3C6UB 2XLIA 4I7FA 1NDPA 2H5IB 3MUTP 5I4MA 5KFRA 5BXIA 3M9NB 2XS7A 3N28A 3FCHA 1HI1A 3ITHA 4KO0B 3ICLA 1S6QA 4CO5A 1R27B 1UPMB 4DCPB 3MCOA 4IUFA 2MKIA 1YRUA 2J9EA 4KHMA 4LBIA 4QYRA 3HJVA 2F9JA 1OYDA 4M63A 1HNVA 2NSBA 2VG7B 2BW2A 1N32J 1H7WA 4P2XA 2QMUB 4U67Q 1S9GA 1YI2S 1L3VA 2HAFA 5IZHA 2VG5B 2FB0A 3MM9B 3G87A 4PYAA 3CCUS 2VHGA 2BDPA 3MMCB 4KGZB 2KXFA 1R3NA 2MQ8A 2RHQB 1RGVA 3RBZA 3OR2B 3BO2A 2LEPA 4GO5X 3UVJB 1RAAB 1LWEB 4LFCF 3QNWB 2GJFA 4ELUA 4DFKA 1CJUB 3L7UA 4OZJA 5EUHA 5H9FK 1UVLA 1W7WA 4ILLA 2NZCA 1P9YA 4DV3J 4LIRA 4IQXA 2Y0BB 3M2UB 5IM0A 3PO4A 2DR9A 1MU2B 3KLGB 3BBFA 2FUG9 2RDIA 2HRUA 1VRQC 1XMOJ 4M94A 1RAJA 2BW7A 5L9XA 4H4KC 3I87A 5EWEA 5HVFA 4KFBB 2UUAF 1AUDA 5IT0A 4EBDA 3TA2A 3AQPA 2WONA 1HA1A 1BD6A 2KYXA 3UN5A 3TEHB 2XMAA 1WC0A 3MXHP 1FK9A 1U0HA 4OI0A 2IPOB 4KHRA 2JC1A 1UAWA 4NLYA 1HLWA 3CCJS 1FE0A 2IBOA 5AE3A 2XS2A 2B8QA 4YB5A 2IRYA 3GU0A 4PRFA 3MPUB 4V1Ak 4TLQA 4MJKA 4N41A 3Q8VA 4RZRA 2EFGA 2LXUA 1XR5A 4OI3A 4UT4A 3OL9A 2RMLA 5ETLA 4DUTA 2IY5B 2ACMA 2EW9A 3KG4A 1QE1A 4WU3A 4TNOA 1RAEB 1U2FA 4C4WA 4J7CA 1UVNA 4FF1A 2CVIA 2V8GA 2O01C 1J5OB 1FDDA 2UVVA 2DR5A 2YNHA 4TY8A 1F1BB 3DM2B 1HNZF 5C25A 5EN1A 4ECUA 3L09A 1JK9B 4JI2J 4RW9A 2N4CA 3TUPA 1RT2A 2V8VA 2HS4A 2ZHAA 1FT8A 5CAAA 4ZP9A 2AW0A 3T9NA 1OMSA 1VCTA 2PFDA 2XI2A 1LW2A 2OFHX 4LF4J 1EX8A 2FVRA 2B5JA 2HHPA 2GVDA 1RAOA 3G4SS 4UOGA 4OYOA 3IAM9 2W9CA 3AB2B 5DM7Q 1ZH5A 1FRJA 3VGTA 4QR0A 2A3JA 1SQFA 4OI6A 3MR5A 4HVZA 2XI3A 1RAHB 4F02A 1NO8A 1N0VC 2CPXA 2MKKA 3QGPA 1IKVA 2HS3A 3UW1A 3CUNA 1KLMA 3S8SA 5ITHA 1TL7A 2C3YA 2GO9A 1ZAXA 2OSQA 3CJ3A 2E5LF 3QLHA 4EBCA 2VFUA 3DOLB 3KUEA 1IBMF 5KT2A 3KHHA 5ETNA 3RBXA 4HHJA 1Q95G 3VTIA 2AF6A 2BJDA 3EVOA 1TL1B 2XG8A 1ZA1B 3LP0B 4FPIA 4PG7A 1W2BR 4NWBA 5KG6A 4NPOA 2Y1LB 4X2BA 5L1IA 1X0PA 4ITSA 3LH2S 4F7VA 5C5JA 2VC1A 1T9XA 2JEFA 1JLEA 4U7UD 3VZIA 4MYTA 4O4GA 3T5HA 2Y1JA 4B9SA 3MAQA 2LDYA 3ENVA 2R7QA 3EPIA 5ETOA 1XNQF 4LRCA 3BGUA 4YDDB 3BSNA 2YPYA 2H65B 4CIOA 2N7YA 4Q45A 3QIPB 5EHHA 1NKCA 2ROEA 1U1NA 1FFSB 2ZBRA 3HJFA 3KK2B 3HM9A 2J6SA 2XMUA 4PXCA 5A8WB 2U2FA 4F50A 4ED2A 2ZHBA 2O1PA 4OI4A 1WOPA 2CPJA 1Y7PA 4DEZA 3H42A 3OJSA 3MCMA 4ED4A 1RU2A 4EO6A 2BXJA 1HQUA 3T19A 3DKDA 1NB2A 1TQLA 4JI6F 1HYSB 1M1HA 1RHRB 4OYPA 3KK1A 3KTQA 2R8GA 5IC6B 2QO3A 2EBGA 2V4JA 3MFHA 1RLCL 1VBYA 3RRHA 1U1KA 1VQ6S 3FGVA 3MDFA 2XLKA 4J90A 3FK4A 3RAXA 1A9NB 2DJWA 1M5VC 4HLBA 5HQLA 1NB7A 1WF1A 3OXFA 3DRSB 1QSSA 3KDNA 2H5JB 4CLWA 5FD1A 4K4SA 3HHLC 2KM8C 1VQNS 3SDEA 1OY6A 3PIOQ 2G2OA 4NEYA 3J80Y 1B0VA 2W2OP 5D77A 4W90B 2AHOB 2DGQA 1SIZA 2CNNB 1LXNA 4X4NA 3MPDA 4K59A 1FDAA 3PYFA 4IYQA 2NXUA 2WBRA 4NLPA 1LEOA 1Y3JA 1TKXB 2BOAA 4TU8A 3VALA 2W7PA 1PYSB 2DEIA 4ZLNA 2J8AA 2R2UA 3EGZA 3WX8A 3M8PA 1S97A 3MF5A 3DLGB 1VQ5S 2ZVIA 2AEMA 5D4PA 1N36F 2FJDB 1RBLA 2D3UA 2P2CB 1X8DA 2HSEB 4KH0B 2RILA 4GC6A 2XMTA 3A8EA 3OFEA 4EU0A 4B3MF 1N6QA 2FHMA 1CULB 1WSRA 2F4VJ 4DPTA 3UCZP 1SJRA 4C11B 2C28A 3MM5B 2YPZA 1CS4B 2I5JA 5A8RA 2IFXA 3TX8A 1KHVA 3M2VA 4A8SA 3MI7X 3QZ8A 5EGYA 4M5JA 4WYWA 3TZWA 3HF5A 4B9NA 1RB0A 1GXTA 1WEYA 2ZH1A 2FZKB 1CJVA 2LXIA 3PACA 3R9LA 3POTA 4ZVHA 1HPZA 2EI5A 3OVSA 4YEAA 1NDKA 4JYAJ 4NXMF 2Z2LA 1TVRB 3DGPB 4OV1A 1S1UA 2CPYA 4OZ3A 1K44A 2HFUA 2XZWA 2DO0A 1REGX 1NJYA 4MKYA 4UF4A 3TRGA 5GVQA 4NLOA 4L76A 3G82B 3DLKB 5M2RA 1ZZFA 2J6TA 1K47A 3ET6A 1B99A 1RTDB 2QIFA 1ROFA 3R5DA 4JI4J 2FZCB 1RTIB 1VQKS 3P45B 3DLJA 2KKHA 2G0JA 3ISNC 3GZ7A 3A3OB 1WI6A 3OFFA 1SJ3P 4MKBA 3HZEA 3NCRA 2IRUA 3JAMY 1S4FA 1HBOA 1UCNA 2ZH5A 4M5HA 4DV0J 1R8BA 3KJVA 5GAEI 4C97A 1U2CA 2AGQA 3PY8A 2VG6B 1LNQA 2HBRB 5KFAA 2MYFA 4WFZA 2RSQA 2OLWA 3W63A 2RQ4A 5KT4A 4FBTA 4ZVGA 2AKWB 2RAQA 1S76D 1U0SA 2FJVA 2X1BA 4BCAA 2VDIA 2BKPA 2DIUA 1X5OA 1G1XA 1ICEB 1M5KC 3UO0A 3DMJA 2W9BA 2ZOMA 1JJCB 3E2EA 2FJEB 1FESA 2LA4A 4D3HA 3PIPQ 1FKPA 2KJWA 1JXVA 4USHA 2AIRB 4M8LA 5E3AA 3BN7A 1DBDA 2V34A 5LOQA 4V19J 2ASLA 2QV6A 3CO9A 3BR8A 2R3VA 3TI0A 1IKYB 1FX4A 2B4PA 4PXBA 2W7OA 1JX4A 5KFBA 3R97A 4NI2B 4FXDA 1SI9A 2X1GA 1BQXA 4DUYJ 1FVQA 2WTFA 3C46A 4U95A 4A8XA 1KS2A 2AGOA 4B3SJ 1H74A 4EYIB 1RAGB 4CWBA 5KFHA 4JI8F 2Q3PA 1JLCA 1UZDA 5F0WA 4FKYA 3CJSA 2PMZD 1E6VA 2YNIB 3UFCX 2V4RA 1XMQJ 1YBTA 3D2WA 2ZUGA 3W65A 1XR6A 1P1TA 1AFIA 4OHWA 4MK8A 1CJUA 4ID5A 2J0QD 2X3GA 2J76E 4DPOA 1FHTA 3H40A 1V3RA 4NXNJ 4KGVB 1YZ7A 2Y9HA 1GTHA 2ROPA 4K7QA 5IV4A 3KLFB 3BR9A 5KT7A 1M1GA 2GQQA 3MEGA 3QFHA 3DOKA 2XYGB 4PG6A 2CDRB 1NPRA 1OYEA 4HR2A 3OTOF 1U1QA 3H5YA 2DXDA 2VFSA 5CABA 2O66A 4KV8A 1JXEA 1U6ZA 3EMTA 3L7PA 2E44A 2Z58B 2CA9A 1EKRA 4YQWA 4P74A 2VBWA 1TKDA 2HVDA 5BYSA 4P2FA 2BBEA 3D0GE 4P52A 4CLPA 4DHVA 4DR2J 5I42A 3KMQA 2BKNA 3GG1A 1JLQB 4QW8A 3FBEA 1RWMB 4DV5J 3BKTA 3D0IE 3MMAA 2YTCA 4K4XA 4RNHA 3BBCA 2JFKA 2D3ZA 2K3KA 3VV2B 1NJIT 2AQ4A 5EWFA 3ZZUA 2A1BA 3GYNA 1M0SA 4EYHB 3QT7A 1C4AA 4HH0A 4JB8B 3NNHA 4LF9F 4C3KA 2OPQA 1R7IA 2ERRA 2LA6A 1IR1A 4USJC 4DQPA 3PJWA 3T5JA 1FE4A 2FTRA 3MUMP 3I55S 1NHUA 1X31C 3TW0A 6AT1B 3LWLA 4M5MA 2CQ1A 1Q86T 1GT8A 2P5VA 1QM9A 3KOAA 1HWIA 2CG8A 4XDCA 5EDWA 1GNKA 1S79A 1QVGR 4ED5A 3J7A1 4H4OA 1RWNB 4X66J 4B9LA 2FGCA 2G0IA 3BEGB 1Z2LA 3QWPA 2H5EA 2K8GA 5DS7A 2C42A 1JJHA 3FEYB 1RT3A 1NJWA 5JVGQ 4A46A 1TV6B 1D0EA 3DRPB 1RI7A 1A7GE 1VFJA 5F8NA 3H90A 4DV1F 5IT9Y 3V5RA 4ZIVA 1EHWA 3UD4P 3KHRA 2EFNA 1CJTA 4F2SA 1FJGF 2EK6A 2RVJA 1VQSA 4EGLA 3BM7A 2GA7A 1L3SA 2IA6A 1N54B 1NSAA 2CQBA 2J0SD 4CLTA 5FDLB 4CI0B 1XJWB 3VAIA 2IM2A 4KY3A 3TNVA 1FX2A 3GIMA 5B0DA 1SC3B 3BYPA 4LFAF 2XEXA 4OHZA 1FRXA 2G2YA 3RR7A 4WFAQ 3ZTPA 2VOPA 4RW8B 4O3SA 5HL7Q 4DR6F 4O44B 3RAMA 3MR6A 2W9AA 3DYAB 2DVIA 1NJXA 1C0TA 4Q43A 2DBBA 2HMIB 5B0BA 4HYKA 2E9ZA 1B70B 5LT5A 2GMJA 5B7WA 1HQEB 4RO0A 1Q16B 2J0XA 1WNEA 2A0FB 4Q8EA 2ILZA 3GE9A 1RWVB 1VMBA 4C0OC 2NUHA 3QIPA 1UA0A 2AYBA 1AT1B 2HWIA 1BMQB 3BGRB 5A2QY 2XMJA 2W4DA 4ZITA 1UTAA 2M8HA 4LF7J 3NGKA 4IRDA 1VISA 3ZFVA 4ZVTB 2CPDA 3OL6A 4QWAA 3KLVA 3DI6B 1NK7A 4J9OA 4LVOP 1SKRA 4P9SA 5B09A 3AOCA 3D6FB 3MAAB 3V6DA 5KFZA 4ZPVR 2DYAA 3SCIE 2ZFHA 4PWWA 4LFBF 2GIQA 3S6EA 4P6QA 2YWWA 1RDRA 4OYBA 5L46A 4X4SA 3M7VA 5L38A 3JSMB 4ER8A 2BR0A 4F3QA 4DV4F 1L5UA 2BRLA 4U96A 3VVTA 3Q8PB 4DL4A 3C14A 3D3BJ 2WZ1A 3M6WA 1OY8A 2M70A 2D3O1 3ZZOA 2BZ2A 3DRSA 4TXSA 1U48A 5CA5A 1RP5A 3W3SA 5SUHA 1RWUA 2DY1A 3PXGa 3PRVA 1WC4A 3HSDA 1VQ9S 3G6XA 4MKVA 2OPPB 1VRUA 2ZBQA 4DL0C 1T11A 4LRDA 5K8MA 4DPUA 2HBYB 2VBXA 3SQGA 2CDQA 3A13A 4CO4A 2KYZA 3IBFB 4GKJF 1LV5A 4ZJOA 2VKRA 3H20A 5K20B 5HLFA 2MZSA 4FYDA 2J9DE 2KXHA 3NXZA 3L9ZA 3SI8A 3A8JA 3HX9A 3DLGA 4LFCJ 1CQMA 3PO5A 4YDXA 5F3ZA 2KT3A 4DX7A 1ZPWX 2V8HA 4PKDB 4DLEA 3OVBA 4NCGB 1Y0HA 1Q8BA 2DRDA 2HW3A 2XY6A 4LR7A 2CUYA 3SSSA 1RSCA 5H9EK 4WP8A 1S77D 2HGLA 2FVCA 2XHCA 1YVFA 3TEGA 3M8QB 3K5MA 2UUAJ 3HVWA 2LQ9A 4KAIA 3CJTA 3CJKB 8RUCA 1SQEA 2QE5A 2V2VA 1FRKA 3IRXB 3H5XA 3DHXA 4NX9A 5HI7A 2ZH4A 1WKLA 1U2RA 4DG1A 1FJEB 1EIYB 4LSNA 2CQDA 1JLBA 5HQ8A 4KYZA 3W61A 4YHHJ 5F41A 1FWLA 4ID8A 1NCLA 3V4MA 3PYGA 4HI2A 4RW4B 1RBAA 3KHGA 2VONA 3OQ2A 4NEZA 3BQ2A 3RB6A 1H0HB 4P7VA 1PG5B 3CGIA 2CG4A 2EFPA 5KG0A 1RTIA 2R7WA 2KFYA 2CYYA 1AZSA 1YJRA 2YNGA 2E7VA 3UDCA 2XSFA 3NEKA 3EX7B 2BJ3A 1KEKA 1HW9A 4ZPAA 3U1MA 1RT4B 3QPIA 3MM7B 3G8SA 4A48A 1D9AA 3VZHA 4HACB 2DHSA 3LUYA 1HNZJ 1SKUB 2HQFA 2VG6A 3ELHA 5KG3A 4IRCA 3W7BA 3W2WA 2CJBA 3MPVA 5B0AA 3PFOA 3JYTB 3O5TB 5AJ3F 2NSCA 2DH8A 1WOOA 3TR5A 3NBPA 3THTA 3W2VA 3M05A 3U27A 4WE1A 3V6HA 1VRTB 4P2MA 2XCAA 1RT5B 5D0EA 1UVKA 3IS9A 2JX2A 2G9OA 1VBZA 4A4JA 2PT0A 5J2PA 1RACB 1RT7B 5DG8A 2CVEA 4UUWA 5B0GA 3T6BA 1XIQA 1C1CB 4CH0S 1HNWF 3I0SA 2JDJA 2J8SA 2YXLA 1C1BA 5K8NA 5HO4A 4PABA 4WK1A 5CYMB 3FVYA 3WHIA 3I5BA 3KFWX 4ZKAA 3FJ2A 2JLGA 4P2SA 2MMYA 2DGSA 1SC1B 3TO8A 2NYHA 2YWGA 3D0HE 2HRYA 2DK2A 2HEKA 1S99A 2E5LJ 1IKWB 2M0GB 5KFIA 1IBMJ 4GVBA 4ICLB 4QWCA 1RWOB 4ZVSB 1S9EB 5DLFA 4C7QA 3SCLE 1JKHA 1WF2A 3TQEA 2DR8A 2OP5A 2JEIA 1PILA 3IGNA 2F1FA 3RTVA 1NKEA 4LF6F 3CC7S 2BM0A 3CXCR 2ZNYA 2LCWA 2A18A 3IMQJ 5CXTA 3ENAA 2YKPA 1S57A 1QAYA 5HJYA 2GIRA 4WFXA 4EK2A 4BWMA 1SH0A 2DXEA 3EUNA 3T3FA 5CZVA 2QG9B 1KDNA 2P6SA 4C6AA 4ECSA 1KQFB 3NMRA 2R7XA 3R6GB 4I68A 2I1RA 4L73A 2ZZTA 3UWTA 1JXLA 4I2QB 3FBFA 3F0NA 2OTLS 1QJHA 3KXDA 4HDGA 3U02A 4H4KA 3J81U 2DGWA 4JI6J 1YJNS 2J5AA 3DLBA 3ULHA 3K57A 4U8YA 1RCOB 4N8OA 2BVZA 5EX3A 4AQYF 4AE5A 4ZJQA 2AYEA 1B7FA 2XNQA 1PCAA 1PKUA 4K50A 2CXEA 3AJ1A 3KK3A 1LW0A 3RAQA 2GVZB 5JJBA 3PTWA 2MKJA 4DSIA 3I6PA 2KXNB 3GQCA 2JLEA 3K89A 1U1OA 2BE7D 4QU6A 4Y6IA 4EBEA 4UOHA 4AT1B 2ZM6F 1K8AT 2HNDA 1UEVA 1QSLA 5KG4A 3GILA 2VA3A 4OJHA 1TP7A 1NDCA 1WEZA 1NM2A 1S1WB 4TKTA 2H4WB 4WIIA 4PQAA 2R7OA 2GHPA 4LSLA 4WP3A 4OX7A 1T95A 4YB1P 3H25A 2V50A 4IOAQ 1RE1B 3JTOA 3NG8A 5JXSA 3D68A 1PJ5A 2F8HA 1JMTA 2ZOGA 2W01A 3FRYA 2ZBPA 4O3PA 3ZNJ1 2ROGA 1TV6A 2KRRA 7AT1B 2W2NP 1YDLA 1FRIA 5GAEU 4LIWA 2CNOB 1T8EA 3BGFA 2NCKL 5ETVA 4I69A 1TKZB 1N48A 3AXKA 1K0VA 2M4MA 1N36J 2KG0A 2BJEA 3F56A 5KFJA 1H6KX 1S1XA 4IOBA 4B3MJ 3GFYA 1Y00A 2DD8S 3BPDA 4GVLA 2KHDA 1QUPA 1WC1A 3IM8A 3F41A 2I0XA 2EKNA 2HNYA 1YBUA 2V63A 4CYUA 3K8VA 2QFIA 4IG3A 4JV0A 1V5VA 5B0CA 1B3TA 2YX4A 3IBWA 4C8NA 2QMXA 1YRXA 1P1LA 5I3UA 2AV5A 2N4DA 2WB1D 4NXMJ 4RW8A 1LQ9A 3PZPA 4O44A 2OPRB 1PBUA 4RBUA 3HSGA 1HMVB 1EQMA 4DR4F 2B8PA 3CSKA 2R7SA 2ZH7A 3ZZRA 1TL3A 4YFUA 1SBRA 2HMIA 5E33A 5DDQC 2AZ3A 3T9ZA 4LREA 1U25A 3ZTSA 1LWCA 3FQKA 2Z2MA 2DNLA 2M8DB 2OKQA 1NHKL 2XYHB 1JLFB 4IFVA 1OJ4A 1CEZA 1FTCA 4IH7A 4UOCA 4B3TF 4IG0A 1VHFA 3QZ7A 3JQMA 3EZUA 2CQHA 3PYEA 4M5IA 4ECVA 2RUGA 5IV3A 2ZUAA 2CPFA 3L95X 4BC9A 3FEZA 2LU1A 1P8GA 1PJ7A 2OMLA 5DETA 1PBAA 2ZC3A 4ZP7A 4JV1A 1KSPA 2OELA 1IJFB 3R7NB 3MM8A 2HS0A 4AXJA 2KL8A 1VQYA 1WI8A 1YTYA 4ANCA 4R5PB 3FCVA 1FI4A 3ILIA 1DRZA 1R0CB 3PCOB 4TN2A 3E01B 3PFEA 4I7FB 4NLRA 1QDUB 5KFPA 4ZCLA 2HAIA 4FNHA 4IO9Q 3CCWA 2VDHA 3ITHB 4ZP8A 4JI1J 4U7UK 4DV6F 1OSCA 1S6QB 4QR2A 1MWQA 3FRZA 3QGGA 2A2CA 2H48B 4ES3A 1O51A 4J9SA 2UUBF 3D1HA 3C2PA 3BDEA 3GG0A 2VC0A 4DJBA 4O3QA 2DR7A 3ZO7A 1HNVB 2Z30B 3Q23A 1CVJA 4Q44A 4PZVA 2CADA 4HT7A 4ECQA 1O8BA 9ATCB 1S9GB 4FYYB 4IH6A 1DLOA 1RHQB 4CP5A 2OTJS 1UWBB 1UP1A 4ZIWA 4C48A 4LF5F 3FCWA 2OPPA 2DCUB 2IM0A 4CLSA 4YS2A 3DRRA 3MUVP 3RW6A 1I1GA 1Q79A 1SH3A 4C8MA 1FFGB 1N34J 2E1PA 4JI8J 3HHLA 4JI0F 1XERA 2J6UA 2BUNA 5IM0B 2QSFA 5F8JA 4USIA 3QT6A 2IJRA 3WC2A 4DOZA 4UW2A 1Q81T 1PC4A 3GSIA 1A0OB 4A8YA 3Q8QB 2IDEA 3CC4S 3OPKA 4PUOA 2VQFF 1WG1A 2C2NA 2B9EA 3W5ZA 5A76A 3I4PA 3OLAA 4IOCQ 3MURP 5IXUA 2Z57B 1VC6A 2WONB 2EWHA 2WW4A 5FLXU 2LEAA 2DH9A 2WVBA 3W62A 4RR5A 3UI3A 3OTOJ 1OO0B 4BBYA 1V3SA 2YWHA 2MZRA 3R27A 1FK9B 4CTAA 3MCNA 1S0VA 4NA3A 1U0HB 1BC6A 4USUA 4OJGA 2FJAB 3CJKA 2MJNA 2VASA 2NR0A 5T14A 3GYXB 2AU0A 4Z2XA 3SEOA 1DHMA 1YSJA 3L3CA 1T03A 3HPOA 3N6NA 3N01A 1U47A 4TU7A 4MKAA 2L9WA 4DL7A 2FYXA 5BYRA 2HLUA 4CLUA 1UEKA 1OQ3A 1BWEA 4LVNP 4BHQA 5GMKa 2AJQA 4QIGA 1G3OA 1MMNA 3BF4A 4J9PA 5JMNA 1HBNA 3EDRB 4GC7A 3SBMA 4LF9J 2YNHB 5GAHI 4TY8B 1WELA 3QJLA 4ED3A 5A8KA 1FXDA 2ZITA 1MN9A 1VGYA 4BDPA 4OZ5A 2AYGA 5C25B 2YKOA 3N0VA 1MROB 5DRKA 1UJ6A 4RW9B 4URGA 1SJQA 4PQUA 4O3NA 2W7AA 1LW2B 4YR2A 1S0OA 2IC3A 2LYVA 4C8LA 2B5JB 2HVHA 2GVDB 3RR8A 1N4LA 4IR1A 2JNJA 2LQ8A 2XZTB 1SIWB 3ILLA 5LSOA 3UQSA 2MQQA 3A3NB 2OPSB 5L1JA 2PE8A 4FYVB 3UDLA 1Q5VA 2MDAA 4DN0A 1REVA 3DLEA 1FEEA 3QO9A 1BGXT 2E1RA 2XHWA 4DV1J 4KBIA 2Y1IA 3SV3A 2R2SA 1UFLA 1VRTA 3NAHA 3BV8A 4OYMA 1IKVB 2KU7A 4X64F 2YKMB 4C0BA 2IYGA 1LKZA 2ADCA 1FJGJ 1FWPA 4ENOA 1EQ0A 3JSBA 2OI2A 1TL7B 3R8YA 1C1CA 1N8RT 1WKKA 3H2UB 3BREA 2FVSA 3QLHB 4NA2A 1H2TZ 2HZVA 5KFCA 1PYOB 5CYMA 1UVJA 4Q0BA 2QA1A 4DL6A 4V19X 4YR3A 3P96A 3PHTA 2PN6A 4Y34A 4OI1A 3MWBA 1D1UA 5G0RB 3Q86A 4DQQA 4ETXA 4LFAJ 2OFGX 2FIUA 2ZWPA 1JLEB 2MEWA 4WZQA 1KVIA 2V9KA 2EK1A 2UV8A 4CLFA 3UN3A 5E3RA 4DR6J 5E0OA 1FF2A 5H1SV 2CJAA 2YQ0A 1WHYA 2MXYA 1KN6A 2Y3YA 1R0AA 3TZXA 2B4UA 2CQIA 4WCEQ 3M1VA 1N5VA 4R0JA 3RZAA 1HWJA 4RW7A 4OHYA 1F5BA 1FVSA 2B9YA 3GCWP 2V4QA 1ZAVA 2DNNA 3KKFA 3OD2A 2ASDA 2XTJP 1SB6A 1QTMA 2HVEA 4OYXA 2HBQB 2C2MB 2GAHC 3ENQA 3TOQA 2J7WA 2YBVA 4I64A 3SZ2A 1HQUB 2W2QP 1IVZA 3AAWB 5HMWA 3KK1B 2RE1A 3WBZA 2MHEA 3W9IA 1RWPB 1JJ4A 2V4JB 1RT1A 3CCES 4DL3A 2W8KA 3BQ1A 3MMBA 4YB7A 4J9QA 1RAFB 1FEHA 1NMEB 4OQJA 3N4WA 1VQ4S 1VR6A 9RUBA 1WHVA 2R9LA 5CYQA 3GV5B 1RTJB 2HQCA 3IR7B 2MY8A 4LFBJ 1UKUA 2AEJA 3HDSA 1XC9A 1VJWA 4DFJA 2B9WA 4RWWA 5HANA 4DFPA 4DV4J 2VBYA 3UD3P 2GVZA 2C2ZB 1U4BA 4JI5F 4TU9A 4M5DA 3QRRA 4ZLPA 3SSRA 4DF8A 3M9OB 3R1LA 3IGVA 3W1YC 2O5DA 4DXLA 1VBKA 2HHVA 2Y0SD 3NNCA 3CO0P 2J7KA 3M8PB 4HKQA 3KHLA 2RS2A 3FZ2A 4OHXA 3R2DJ 4ILMA 1NBEB 4L3KA 3DOMB 1UW9A 4GKJJ 4WF9Q 4NZ6A 1KD1T 3FKBA 5CZXA 4NLXA 3GIJA 3DXBA 1O6XA 1YZ6A 2XS5A 1N6QB 3AFGA 4NRUA 1R0BG 1F9EB 4DU8A 1B4SA 4X4QA 2K1RA 3LP1A 4PPZA 5C24A 2G1HA 4ZOSA 1Q5YA 3TX0A 2I5JB 4F04B 5A8RB 3FMWA 3M2VB 2RQKA 2R8KA 3SFUA 1X5SA 2DGUA 2E5HA 1SJFA 3CMAS 2YKQA 3IWXA 5EWGA 3PW4A 3VAHA 1CJVB 1YBAA 3POTB 2G13A 2KG1A 1HPZB 2XSJA 1CJKB 2JVRA 4PXEA 1RUSA 3T1HF 3HP6A 3GR1A 1TR0A 4NL5A 1S1UB 2HZCA 3OW2R 4MAKA 2C3OA 5BJRA 3OT9A 4ZPBA 3G8QA 3QJPA 4K4TA 3JQJA 2WHOA 4NYZA 4USWA 1P27B 4WTYA 5L39A 2XNRA 2DGOA 3G96A 3OJUA 1S72S 3ET6B 2NXNA 1LWXA 1L3TA 4HHUA 4N76A 4LR8A 3GIKA 5HBMA 3V6JA 4DV7F 2FQQB 2Q1LA 3KUHA 4YY3J 1U26A 2WVDA 4DV3F 3OFGA 3GFHA 4Q5VA 1HBOB 3EGWB 2YWEA 4J9KA 3KJVB 5F8GA 3MOJB 2RJZA 3HVTB 4G1PA 3I31A 4EO8A 1XMOF 3R2CJ 1F60B 4HTJA 3T41A 2BQUA 2X1AA 2X3DA 3JTNA 3D28A 2LKZA 4ZLJA 2DPIA 1U6FA 2WVFA 5H9FJ 3EPGA 2RRNA 2ZZNA 4ZLLA 2GCFA 1HHTP 1FO1A 5K14A 1X4AA 2A2DA 1B0TA 5D15A 3CW2C 2W9BB 4LSZB 1EJ7L 2HYIB 4MK9A 1ZS6A 2F3JA 3MTJA 2ZBCA 2MZQA 1HBMA 2MLXA 4EUVA 1GQEA 5AJ3J 2KI2A 1IN0A 1FKPB 1FXLA 2L3MA 3RGIA 2AD9A 4Q7AA 4LBPA 1KHWA 3I82A 2W4CA 3OTCA 4WJBA 1ZTWA 4PWDB 3KLEA 2W2PP 4QIFA 2ATCB 1NAQA 1HNWJ 2GHVC 1IR0A 2HVIA 1NH7A 1IQTA 4M5NA 4J37A 1PAEX 3UDVA 1JLCB 1UWBA 3GCXP 1E6VB 4F67A 3FQLA 2F40A 2O3DA 3Q2SC 3NS5A 3VAFA 2CZVC 2QA2A 1WDTA 2IVMA 4ID5B 1MLAA 2LMIA 1DTTA 5T7LA 3GV7B 1SL0A 2NS1B 1Q78A 2XB2D 5K9FA 4EZ6A 5CQGA 1OPZA 4K5SA 5B08A 3VF0B 1JIHA 2H3EB 4QIVA 4LF6J 4CT8A 3MEGB 3DOKB 3AA8A 3KWMA 4DX6A 4J9VA 1PIEA 2OD6A 3TAPA 4KV8B 5L1LA 1SC6A 5D78A 4EEYA 4OV6A 1IQZA 2ZC4A 2RQMA 2J0WA 4OYIA 4C8OA 1LWFA 2WSFC 3OL8A 4IDKA 4MTPA 3R5AA 5KOWA 5J1PA 2FLNA 2JJ4D 1EAYC 1SJ1A 5F8IA 2BRKA 4DSFA 1ZM2A 5I42B 3CJQA 1T94A 1OPIA 3MEEA 3MMAB 4G6VB 3NCPA 1S49A 2YWFA 2DO4A 2WOMA 2OJ3A 1KC8T 3TWZA 2VU5A 1RJJA 3D6MB 4DCJB 2DHHA 1OY9A 2BJ1A 3Q8YA 2OPQB 4O3RA 3N9UC 4YB6A 4AQYJ 2GGPA 1R6VA 4OX8A 1FNOA 4DR3F 5KFQA 4OLPA 5LJ5Y 4LQ9A 3W9JA 2PDAA 4IQMA 2VOOA 3D66A 4H4OB 3OVAA 1MROA 2IM3A 2ZM6J 1X7VA 3KG1A 1IBKF 2R8JA 1NXIA 2MKSA 2ZWOA 2AJ1A 3NAIA 4DDFA 3T5LA 5K5MA 1UVMA 2VD3A 1RT3B 4NLUA 2CNKB 4WFBQ 2RKIA 3TA0A 2DEJA 1R8AA 4G1QA 1JLGB 3TUZC 3ZC4A 5U47A 1U1RA 2HFOA 1RAIB 3PR5B 2OPSA 2KTQA 2C2EA 1WG4A 3MZIA 3CF5Q 1VS3A 1H2UX 3E3XA 1Q8KA 1YKWA 1CJTB 4ECZA 2ABYA 4WKRA 4F3MA 3EXYA 4P71A 3M8WA 2IHR1 1U24A 4URQU 1X0FA 1UWAA 3WDOA 3D54A 4OMFG 1XTZA 2KT2A 2AJ2A 3L4BC 2H4YB 4B9TA 4U9RA 2YKMA 3R7SB 4O23A 3LPYA 2COLA 1OQ6A 3OTEA 5AXMA 1R8HA 2PMWA 4OI2A 4ATNA 4UZCA 1Q82T 5DGAA 4F4YA 4ZN1A 3HMJG 1W2IA 1HWKA 2AZ1A 4Y00A 2SXLA 5DDRC 2UUWA 2HFSA 2QYCA 1U02A 1C2PA 2OSRA 5G0RA 2FVQA 3Q24A 3CT9A 1TL4A 1GAOA 3OSPA 1F5AA 3EDQB 1C0TB 2BE2A 4JI3F 5EX0A 5CHCB 4B3RF 4H4MA 1DY3A 2LU2A 5ETKA 1HQ2A 2E29A 3RBEA 1HD1A 2PGCA 4DR4J 5KG1A 2CJYB 1DQ9A 2B7CB 2N7CA 4I56A 3CWJA 5G4DA 1GX5A 3AQOA 2C3UA 2QA4S 1UETA 5J2QA 3PW2A 2JVOA 1PC5A 2XQCA 1NJZA 1M5HA 3RB0A 1T05A 4GKKF 3HHNB 2APOA 4OX9F 2M7SA 3IAS9 1Q7YT 4B3OB 1G6BA 4B3TJ 3UCGA 5AXNA 1HNIA 2DNYA 1VOMA 2Z8QA 3CNQP 4BLGA 2XY5A 4F0KA 3V6DB 1UFKA 2BABA 3HXMA 2VQEF 5F3TA 2D41A 3GP9A 3M6XA 1R43A 4I6AA 3OUYB 3HFKA 4ZCMA 3PEJA 3B78A 1N5QA 3QT5A 1ZM9A 4JYAF 4QW9A 3M8ZA 2VV5A 4F25A 1F2HA 2BM1A 1FRLA 1NPPA 3K2YA 4YP3A 1T02A 1RTJA 2ZH6A 3TAQA 4PWUA 1WOSA 4DR7F 4LF8F 3UD5A 3C14B 1S12A 3D1QA 3RJMB 5M2UA 1KTVA 2WB4A 4NYOA 2CQ3A 2YNFA 3GJTB 4S0MA 3THPA 5I3PA 5KT6A 2FD2A 5KFLA 4AYBD 4DV6J 5KFOA 3HT3A 2I8EA 1N5TA 4NLDA 2JL9A 5KFNA 2LP4A 1IKXB 4KJIA 3KJNB 2UUBJ 1VRUB 3MHYA 3PVXA 4X4UA 2Z2ZA 5F8LA 1OS5A 4OJ1A 3EJMA 1N56A 2CPHA 2N3LA 3SQGB 2CJ9A 3R5CA 3S01A 3UR0A 3LPEA 2MJUA 1RWXB 4B17A 1BQNA 3AY0A 3TJ9A 5HLFB 4JI7F 5GAHU 4P72A 4LF5J 4ZA1A 2L08A 2H51B 1DZ5A 4NLGA 2HURA 5DDPC 5HMYA 1NZAA 4N56A 4QWDA 2MZ1A 2AJ0A 3TAMA 1UL3A 4WU2A 3DOMA 4CT9A 1RA6A 3ZZTA 3L7OA 4JI0J 4QZVB 2XC9A 4K4UA 3U1NA 3BO4A 3V81A 3EXCX 4O4RA 5HVHA 3QRQA 3NGUA 5HJXA 4WXOA 2ZE2A 3PR4A 2E7XA 1RHUB 1SC4B 2VQFJ 2KH9A 1D8ZA 3CIMA 3GR0A 1UZHA 3P5BP 2Z56B 1HHQA 2B9XA 2XMVA 3M6VA 4QPXA 4BS2A 1F3FA 1CJKA 2IAJB 1WC6A 1YRTA 2QZ8A 2F8EX 1C0UA 3DLHA 4DG1B 2P9CA 2HHWA 4LSNB 2DIVA 5K8PA 1VC5A 1JLBB 1FKOB 2IMWP 2DHXA 2ZKUA 1N52B 2BE9B 3ZZPA 3MGJA 4CO1A 4DUYF 1TUWA 5LMUF 1ZETA 1K1QA 2YKNA 4OIXA 3PRDA 4Y2KA 2AX1A 1U1PA 3SFGA 4IRKA 4FF2A 3K5NA 4Y2IA 3SV4A 1SCJB 3DLLQ 4DR5F 1PSDA 5FIIA 1AZSB 2YNGB 5KFGA 3BGOP 3AOAA 1XBWA 3PV8A 3EYZA 5J2MA 2ZH2A 3EE3A 5J1EB 2OGUA 3THVA 2CNLB 3D6HB 4AD6A 2C2OB 3HD2A 1H72C 3MECA 2BX6A 3H59A 3HKZD 3N5BA 2JEJA 2R2RA 2I38A 3HVTA 4WK3A 1ZOTA 3DN9A 4A47A 4UY8T 2QRRA 1AYEA 4ZPTR 4ECXA 4K0KF 2YX1A 4ZVFA 2E5JA 1SV5A 2ASJA 2K7JA 3W2WB 3QGIA 3KLIA 3OL7A 1J2VA 2POKA 3NBPB 5LMNF 3W2VB 4RNFA 1SKSA 3HSJA 2PO4A 4WE1B 3A3PB 3IS9B 3O44A 3CE8A 5C2CA 5J2PB 3AOBA 5DG7A 2CJXB 5KFMA 4RX6A 4RW6A 3R1HA 1E6YA 4L75A 2AEFA 2MHNA 3I0SB 1C1BB 4HI1A 5KFDA 2AJFE 3QAUA 1VC0A 2NPIA 4I0WA 4X64J 1DURA 2CJQA 4XO0A 4PWDA 3FMBA 4F4XA 3VVUA 2MB0B 3G86A 4WKYA 1X4CA 3EGNA 1X9MA 4GVBB 5C2GA 2FY1A 3JB9k 3VAGA 5CD4A 3M6UA 4UUXA 3M9MB 3MCSA 1X4GA 3PJXA 2RHSB 2MQLA 2KRBA 1JKHB 4O0NA 1VBXA 2E1CA 4PG4A 5KFKA 3AD9C 3GONA 1EKSA 2P9GA 3EGVA 3PM9A 4USMA 1Y5NB 1RLDA 4R8UA 2ILYA 3SYZA 3CCSS 1DJ0A 1NDLA 3PYDA 2BQ3A 2B51A 2C2RA 3KDOA 1HD0A 1JLAB 1RHKB 3CJ5A 1G2EA 2HZAA 1ZM3A 4DQRA 3N6LA 2OIHA 2AT1B 2F4FA 3IC1A 4QPTA 5IS2A 1Y3KA 5LL6d 1MMLA 4RL1A 1UJ4A 2LEBA 2H54B 1SXLA 2MSSA 1MW7A 2PEBA 2RD5C 1ZAWA 1XNRF 2VL1A 2UVRA 2BKOA 1T3NA 5GAGI 4TLRA 4JV5F 4KPCA 1AA1B 4GRSA 2GMHA 1S1TA 1ULRA 2V2QA 2KFNA 2VPWB 3FSIA 4B9MA 4U7CA 2HQDA 5LXRA 1WORA 2EG2A 2G1DA 3CCTA 1YJVA 1RYSA 4YN3B 2NLWA 4XPCA 3DDIA 2XMWA 1SL2A 1JQGA 4TY9A 2MQNA 1YLXA 3TVZA 2CQPA 2DISA 2FHOB 1RHMB 4RUCA 4J91A 3KK3B 1LW0B 3TQ1A 3LW5C 3A1YG 1S6OA 2HPUA 4NCBA 5AT1B 2KDOA 1G4CA 4ALZA 2HNDB 2V5HG 3U7JA 4LRBA 3NY0A 3KMSA 4OHVA 3H8YA 2V9WA 1RABB 4JI5J 1B0PA 4LSLB 2MPUA 2F9DA 1BUXA 2QL9B 2XWYA 4RUAA 5F0UA 5L9NA 2WVCA 4RU2A 4WPAA 1FXRA 5KAKA 4DF4A 4ELVA 5IQ6A 2JRSA 1R89A 1JLGA 1GXLA 1L3KA 1QVFR 4CRJA 3J7ZT 4CM0A 5KT3A 4PG5A 4ES1A 5D3GA 1T3OA 4Y2MA 1D8YA 2LVWA 3MM6A 4WBFA 1O0PA 3K17A 2UUCF 5MAOA 3V4IA 1CG2A 1S1XB 2CPZA 5D8HB 4C2MA 4KKOA 1NHVA 2KHCA 3H0PA 1N33F 2B6AB 2LQ5A 3TP2A 4MFBA 2UXDF 2Q43A 2GO8A 3FBBA 4AL5A 4NLTA 2QMWA 2FHKA 2ZEJA 2FJWA 2HNYB 3PG9A 2A6OA 4CYUB 4KR0B 3CEDA 4IG3B 4M95A 3VGSA 5THWA 3I5AA 3PEHA 1GMWA 1V9OA 1DFDA 2XYPB 2V8PA 5GADI 4R25A 5HN0A 1I5OB 2C1EB 1TELA 4HL9A 5I3UB 6FD1A 3LAMA 2JEGA 2KVQE 3T1HJ 2EC2A 3C16A 5HSPA 2R42A 1H38A 3I0RA 4YOEA 3M4XA 4QCLA 1TL3B 2DY9A 1D9FA 2FC9A 2UUTA 1EB0A 4MIAA 1NK4A 1T9VA 4PAAA 3KYLA 1K0TA 1LWCB 1WHWA 5ETQA 3UNYA 1HIYA 4L74A 4DU7A 5I3QA 3HKWA 1EP4A 4IFVB 4NRTA 3C19A 2ALYB 2OHDA 5SZTA 4IG0B 1RT6A 4DV7J 3NWGA 3E51A 2R8IA 2LLZA 3D67A 1VQ8S 2EFOA 3KLHA 1FJ7A 4EI2A 3M8YA 1KKHA 3OXLA 2RU3A 4U6PA 4B3OA 3MM8B 1AW0A 1S1VA 2HBZB 4J9NA 4KIAA 2RF2A 2U1AA 4M1KA 3VAKA 4NLQA 3I9ZA 3OR1B 4FPRA 5ETMA 4DL2A 3IP0A 3HHLD 1NRKA 3CCMS 3H98A 1WTFA 5LSLA 3CD7A 3OUYA 3NGSA 2XLJA 4UQGA 3RU0A 1WACA 1VK3A 2XMMA 3UN2A 4HEA9 1W25A 2W8LA 4A8FA 4YHHF 1FD8A 5H9EJ 3VWSA 2MKYA 2QSWA 2KO1A 2D9PA 1SUQA 1DARA 2HWHA 4A8OA 5KFTA 3P49B 2IBKA 1S6PA 3ZNUA 4QIWD 4YUDA 1ACMB 4KGMA 1DLOB 1PAUB 2UXBF 1IKXA 2NREA 5LM7E 3Q83A 3DRRB 1M5OC 3N5FA 3HI9A 3QGHA 2FJBB 2B43A 4ECTA 2CZ4A 2ZKTA 4MT1A 4CLZA 4QOTA 2JSXA 1K73T 1JNRB 3KG0A 1RKJA 3W64A 1M5SA 3HHLB 4UQTA 2KM8B 3SCJE 3ZTOA 2DRBA 1GXUA 2HHXA 1HBUA 2EVZA 2GJIA 3SCKE 1Q8IA 4J5OA 5C42A 4B9UA 2VPXB 1WHXA 3AB4B 4PUOB 3NP5A 1F6TA 3CDEA 2D1CA 2ZNZA 1URRA 4E98A 4RJVA 1APSA 3TVKA 4UZBA 2QLWA 3CJ2A 3G6ES 4HH1A 2M3DA 3MAHA 3FBCA 4C3LA 3WIUA 2UU9F 4OLOA 3NGDA 2UVUA 4CTAB 1KQGB 1MSWD 1YJ7A 2X1FA 1HR0F 4OX6A 4RLEA 3OSNA 1H3DA 4U8VA 3G6YA 3B4DA 1XWLA 3PDNA 3PW7A 2D9OA 5J2NA 3MR3A 1T03B 2IAJA 3ISND 3IWLA 1D09B 3P5TL 4ELTA 2NPFA 4CDIA 2WAQD 1FWKA 2MGZA 1FKOA 1U6BA 2LECA 3ONQA 1OIAA 5HP1A 1X4DA 5KFSA 4Y2AA 2RNEA 4A8KA 4Y65A 3ILJA 5AE2A 4I6WA 2O67A 4O0IA 3I4HX 3IO1A 4C9DA 1HBNB 1H98A 4DFMA 3T1AA 3DXSX 4OYWA 2HQ3A 1ZYQA 3CJ4A 1IWAA 5F8HA 3I56S 5A8KB 2E66A 3VQSA 4WYLA 1NZ8A 1JWWA 4DR3J 4L72B 3T5KA 4PQUB 2VODA 5J1EA 1Y4ZB 2VA2A 4NOHA 3AA9A 2IC3B 4USVA 1O5JA 1TMJA 2YQ1A 4IR9A 2GAGC 4P10A 1PJ6A 3J81Y 2QN6B 4TQRA 5HMZA 3QFWA 4KGXB 1IBKJ 1NK6A 3JTPA 5DO2A 3N79A 1URNA 3LANA 4Z7CA 4Z37A 1RISA 1REVB 4F26A 3UPFA 2DNQA 3DLEB 2JFDA 3UR3C 3QO9B 3BYRA 3D1OA 1WKJA 3MFIA 2IM1A 4ES2A 5JUMA 3GMGA 3BBBA 1G7CB 1KP6A 2EG1A 3BSOA 4F4WA 3LO3A 2R7RA 1T9YA 3KJFB 4DCOB 2CRLA 2MY7A 2XY7A 4DPXA 1KONA 4X84A 1UEUA 4KHPF 3CTRA 3IR6B 2L9NA 2H9ZA 5KT5A 5AE1A 1H73A 1QLNA 2CKWA 4Q0BB 2HIYA 2OEJA 2I6WA 2FHJD 2EFVA 3NWRA 3UCUP 2MQPA 2VIHA 1JB0C 1TU0B 4C8YA 1CSJA 1GEHA 3IWNC 4QWEA 1VQLS 5GMDA 4JI3J 1R0AB 2J9DA 1P6TA 1HARA 1GK8A 1FNMA 4B3RJ 3G9CA 3M1VB 2F5GA 1DTQA 5LXYA 2FLOA 4RW7B 5A0YA 3DRXA 3I9V9 2I2YA 2UXCF 1X5TA 3M2RA 4CZCA 4CNZA 4ED6A 2R7VA 1MG7A 1JLAA 4BC7A 2P8IA 2YVSA 4EWTA 4I67A 1XNQJ 2BV3A 7FDRA 4CCHA 1T9UA 3IG1B 2KZMA 1F0XA 2GFFA 2HLTA 2DNKA 4LRFA 3TZZA 4GKKJ 3WIVA 2KZZA 2EEYA 3ZZ0A 4ZPDA 2CQGA 3O6QA 4OX9J 2GW8A 1HW8A 4K4VA 2AX0A 2DTJA 4IH5A 4TYAA 3V6KA 1RT1B 5DQGA 2UV8G 2KT5A 3MMBB 2ZH9A 3CDAA 3PRBA 5L8RC 2RUSA 5A6PA 2AGPA 3DDNA 2IRXA 2DH7A 5CYQB 2QLJB 2VQEJ 2W2MP 5KG2A 1BHNA 5E2QA 3MD3A 3PX6A 2L48A 1PYTA 4PCQA 4IFYA 1YK9A 2GV1A 2GMLA 4PPDA 4P75A 5IWAF 4DSJA 4NMXA 1N5YA 1M90T 5IOLA 2HFNA 1VQ7S 3MEDB 2LFVA 4DR7J 4LF8J 1V3ZA 4M5DB 4ZVQB 5DQHA 3Q89A 3BH6B 4PXDA 4L3NA 3B82A 3TYTA 3ADAC 2K2PA 1T9TA 1RK8A 2XMKA 3IA0A 1RQ0A 2MKHA 5KOXA 4DZ6A 2BJ9A 2V69A 2HFVA 2LDIA 2UP1A 2WRMA 1YX2A 1ZPVA 3IR5B 2B56A 4ZK7M 1I6JA 2OD4A 3JSYA 4JI7J 4KT0C 4JP8A 1TK0A 5J1NA 3OHAA 1L3UA 5K8OA 3NOCA 1S9FA 3HO1A 1VYAA 2K1RB 3LP1B 4OL8A 5C24B 1Q8LA 3J80U 3G2XA 3PW0A 2EC0A 1T7PA 3TJAA 3O1LA 2P6TA 4KSEB 2GZOA 1NKBA 1YHQS 3C6TA 1T0TV 2B6AA 2XSJB 4JI1F 1KRPA 2ZBIA 3VR1A 4CH7A 4WZMA 1IBLF 4KB7A 4J9RA 3M30A 1TKTB 4PR6A 5BR8F 3QQCD 2YH1A 3C6UA 4F8RA 2LXFA 3JXOA 1K1SA 3T1YF 1RTHB 3O8WA 4AUKA 3VCDA 4K4ZA 4AFFA 2ZDOA 4DI6A 2Y8YA 3NCQA 4KO0A 5AXKA 3FNNA 1Q4RA 1NK9A 4ZS6A 3LTOA 2JLFA 4FZVA 3D6TB 2HHHF 4FYWB 3ISZA 1LFPA 4IKAA 4A8MP 5HMXA 5E3PA 4X4VA 4L6V3 2AP6A 2YY3A 1WDDA 2VG7A 5HBMB 1NLKL 3DGVA 1AB8A 4ANEA 5LMUJ 4WTOB 2W4PA 1WEXA 5FLXY 2QA4G 2OUGA 3A8IA 2XWXA 4XAKA 1N34F 3DRYA 2D74B 3AODA 2M52A 2VG5A 3MM9A 4RUBA 1VHIA 4UOFA 4O3OA 3MMCA 4JUZA 3NOGA 3H7HB 2LQBA 3OR2A 3UVJA 2DPJA 4DR5J 1LWEA 3RB3A 2XO7A 3M2UA 3A12A 1NPKA 1VLYA 2HG4A 1MU2A 3KLGA 4CM2A 3I5CA 4QIEA 5K14B 5GMEA 4KH1B 3R5JB 4K0KJ 1U7LA 3OR1A 3K5PA 1WF0A 3EZOA 4KFBA 4CNYA 1N88A 4DUZF 1FD2A 4LF1A 3GV8B 4LF2A 1HBMB 5GAGU 2VJVA 4QQBA 1YITS 5LMNJ 3LALA 3JAMU 2VB6A 4B02A 5E7OB 3J7AN 3H4DA 2VPYB 4M5LA 2HFZA 3KLEB 2JOQA 4JOUA 5D4NA 1MMDA 5KFFA 3IRWP 4KRWA 3HCXA 2R7UA 1NU4A 4F2RA 2MLZA 3DU5A 1FDBA 2PA3A 2RT3A 3SMZA 5A6WA 2L9DA 2HWTA 4C3MA 3LQVA 4DR1F 3TJ8A 3QJJA 1FTRA 5CCLA 2V6AA 3GPAA 5D0GA 2ALZA 4CO0A 2B0GA 1J5OA 1DTTB 5T7LB 4WXWA 3DC2A 1NSQA 4DS4A 4I2PB 3DM2A 2Z0GA 3JSRA 2EPIA 2L41A 2FLPA 3AJ2A 2KVIA 1F3VA 3F73A 1DQAA 2BEFA 4PYDA 2GHWA 1UVIA 2MSTA 1S0NA 1YQHA 1TK8A 1LWFB 3TVYA 2Q66A 4Y3CA 4IDKB 3BSAA 2B4OA 2WK4A 3LF0A 1S6UA 3MEKA 3SIPB 4MIBA 1XNRJ 2FLLA 3Q8RB 1AFJA 3B4MA 4KGKA 3LGHA 4GO7X 4JV5J 1RTZA 2C3MA 3AJDA 1NH8A 2FPHX 2ZHOA 5HROB 2RQCA 3MEEB 2ZH3A 4FNIA 2HKEA 3IM9A 3IN5A 5B0FA 1ITPA 2R4FA 4DWIA 2WOMB 3CCZA 4FXWA 2VUGA 3FSYA 3CMES 1XMBA 8AT1B 1TAQA 1YWXA 1RKIA 3GFXA 1YJ9S 5GADU 4FKXA 3DOLA 2GGPB 3Q0AA 4W98A 3LP2B 1S0MA 3EWGA 3M8SA 2YKAA 1TL1A 2BMBA 2E1AA 3LP0A 2VKZG 1Q1KA 4RU9A 3QSIA 2E9RX 3LA0A 1J5EF 5KFEA 2EXUA 3BKFA 1MWYA 3UNGC 4ZVOB 1GTEA 3MPWA 3QIDA 2FC8A 2QL7B 1QUVA 2NXCA 2XZDB 1UA1A 2OEKA 2M88A 2IVFB 1SKWA 2F8MA 2RKIB 1IJEB 1BLUA 3K5OA 4G1QB 1RADB 4ETZA 4W4MA 4USTA 5DQIA 3K59A 3KK2A 3NRBA 2M9KA 4LJMA 5HAOA 4J9LA 1GMVA 2V67A 5A8WA 2BJ8A 3U1LA 1WD6A 1NK8A 4ERDA 3RYLA 4F0MA 3QMQA 2E5IA 2HRTA 1HI0P 1GH8A 1MWZA 3TUJC 1NSKL 4K2JA 3UE2A 4F36A 2BANB 4X65F 1HYSA 2UUCJ 3W8GA 3B54A 2HHQA 3R7BB 4A8QA 5F9NA 3NKYA 3J7YI 3PX4A 5DJBA 4J9UE 2G2ZA 2DHGA 1N33J 3BH7B 2UXDJ 5DGBA 4F4AA 4E2FB 1WC5A 1YIJS 5E41A 4FYXB 3R3TA 5ETSA 3X1LB 4C8ZA 3GWCA 4FVCA 1BQMB 4EFAC 5IT9U 3P4UB 2BE2B 3QSYB 1U1MA 2GIFA 5AXLA 4C0HA 2W25A 1WC3A 2B4VA 1CLFA 2EFQA 4H4MB 2KB2A 3CIZA 4XDDA 2DT9A 3R5GA 2UZAA 2WBMA 2RIJA 2ZOFA 2V8DA 1S7HA 4LT6A 3DU6A 4N7TA 1I94F 3BKUA 2DGXA 2CZ9A 3D4JA 1HNXF 5KG5A 2DNHA 4KPYA 1QD1A 3CD5A 2AWZA 4AXIA 4Y28C 3HHEA 1TKXA 5J2QB 3OXGA 1T05B 2BACA 2XULA 4F4ZA 5KFWA 2V2ZA 3OV7A 1HNIB 3OTBA 5C7PA 1RA7A 3IG1A 3KJQB 1QY7A 4MYUA 1SL1A 4OYAA 1I51B 4URSA 5HATA 2FGOA 5DZ6A 3QAEA 1VLOA 2XGQA 1CC7A 1X4BA 4FS2A 1IR2A 2K7KA 3BJYA 1Q53A 4Z7YA 1CULA 1B7YB 2FHJA 4LR9A 4C11A 2OH2A 3MM5A 4WFNQ 1CS4A 1R6YA 2XGPA 3PKMA 4DV2F 3MR2A 3LAKA 2JH3A 3WC0A 2CWXA 2HIQA 3CJRA 1RWWB 3NGRA 1KFDA 1X5PA 4ECRA 3C15B 5A2QU 4ZJLA 3Q8SB 4RPFA 1M5PC 3RUBL 2DNOA 2YNFB 2IJNA 4B08A 4OZ0A 4QU7A 1TVRA 3DGPA 4NLSA 1TZ0A 4RKUC 3ETOA 3PX0A 1WUUA 4QYZJ 1TAUA 1HKAA 3H2LA 3MEDA 2ZD1B 2F7VA 1EARA 1EZZB 2GC8A 4ECWA 1CBKA 4ED0A 4MMOA 1NUEA 3G82A 3DLKA 2NYIA 2PSZA 2DNGA 2X51A 3I96A 4YY3F 4NZ0A 1RTDA 3R5BA 1BQNB 3S1TA 2M2BA 1AUSL 2ASYA 2UXBJ 4AL6A 5E3CA 4X62F 2HHUA 3WX4A 4R0EA 1SJ4P 2ZZMA 2E9TA 2R7TA 4DPWA 1VDHA 4RBVA 4X4PA 2MLYA 3TAMB 2JHEA 2DNPA 2C2KB 1YG0A 2IYIA 4E0DA 3NS6A 1CPZA 2R8HA 3H2VE 1YJTA 3CULA 3V81B 3TANA 1Y9OA 1W26A 2ZE2B 3A4TA 3C3LA 5ETTA 1OWXA 2NXJA 2W1BA 5DG9A 1GMUA 3GTYX 3M32B 3LGNA 2FZGB 4G1IA 2ACYA 1WG5A 2R2TA 2Q79A 4LRAA 2AYMA 1C0UB 1TKTA 2WSCC 2CQ0A 3IXQA 3BB5A 2UU9J 1JJ2R 1HR0J 1C4CA 3DHWC 2IVYA 1KR4A 1RTHA 2ADBA 1KBRA 2F65A 1P9QC 1Z4UA 4KTQA 4DSEA 3ZTRA 1N32F 2YKNB 3K0JA 1FDNA 3GJQB 3EM1A 3K7RA 5ETRA 1H7XA 1IKYA 2MTLA 4NI2A 4DSLA 1KLNA 1AXQA 4OZ1A 2CQCA 3CB4A 5J2MB 4DMZA 3H5UA 3D3CJ 5KFYA 2XM3A 4J9MA 2ZJPQ 4DQIA 3V2UC 1U49A 5KTQA 2GNKA 1ZTTA 1WTBA 3VQTA 2NXEA 3MECB 2Y8WA 1BXNA 2YNIA 3FZBA 1X4EA 2ZH8A 3HD1A 1SPBP 1H2VZ 3EZ5A 3OBIA 5FJ4A 1SV5B 4OJ3A 4ED1A 3FFIB 4FBUA 4P7TA 4XK8C 3KLIB 2QGFB 3WQPA 3KLFA 4DX8H 2YQ3A 3QYYA 2C2DA 3EICA 4ZCKA 3CVKA 1TL5A 2V68A 3R6LB 1X60A 4ZVRB 4M5KA 3JQKA 1UJ5A 1RBOB 1HL6A 4ILRA 1X9SA 2YWKA 4RW6B 2VICA 1VQPS 3W5YA 1E6YB 2DHAA 2EKYA 3MOZA 1KWMA 3MD1A 1KQKA 1X4HA 3MPYA 1KNZA 1RWKB 3NMAA 3P3DA 4HT5A 1SQGA 3C8YA 2N82B 2CAJA 2QLBB 4ZP6A 1JLQA 4NA1A 5DM6Q 3VGUA 4M5GA 4DPYA 4KHPJ 1S48A 5HVGA 3CDWA 3DFEA 5HQMA 3I32A 3HT0A 2XBPA 3CCRS 2C3PA 3BPSP 2D3OR 4FS1A 3ENWA 4WIQA 3NGTA 4I4BA 4JI2F 4ZHRB 4IO1A 4R8UB 2ZDPA 2YH0A 4RBTA 4LF4F 5LSRA 4NCAA 1UPPA 4K2XA 2HK3A 2Q6CA 5IFMA 4I2PA 2VJUA 4LMZA 1XN9A 3ETMA 1FERA 4W92B 3VGVA 3W9HA 1XR7A 4CLKA 2UXCJ 1UFWA 4X4RA 4K4YA 5CCMA 3DRPA 5DDOC 1V5IB 4WFYA 3BN4A 1EETB 1S10A 1N0UA 2ATLA 2WVEA 2RRAA 4LUBA 2HGNA 1R31A 1S1TB 2Q6BA 3SQOP 4FXVA 3W60A 2CPIA 4D3GA 2XCPA 3W5XA 2DNMA 2QT7A 1RXOB 4DS5A 4I6YA 3HZGA 4ZPCA 3QATA 3HFVA 4DQSA 5DLGA 5HROA 2IMOA 4RNNA 5CH7B 1AROP 5FDLA 4ZMMA 2PC6A 2A10A 2MQOA 1X9WA 2GQ2A 1XEZA 1TUVA 2PMHA 2N3OA 4MIWA 4EZ9A 1NNDA 3AT1B 1WWHA 3H5SA 4OFZA 3LP2A 5IWAJ 3BQ0A 2QFJA 2FJXA 3D5MA 5B0EA 1GMWD 4OZ2A 2MKCA 3DYAA 2HNZB 5F9LA 2M5YA 4LQ3A 1IWGA 2Y1RI 1HQEA 4FF4A 2GQCA 2QX0A 1S7IA 1HFEL 1RHJB 2IDLA 4RNOA 1Z1ZA 2DB1A 1YGYA 3MR7A 2DITA 4NYPA 4FVMA 1WJ9A 3GJSB 3BZQA 4N5SA 3BGRA 3MTKA 1S4EA 4HHHA 5D3GB 2IJFA 3BDPA 3AHPA 1VJQA 1Q0NA 2RRBA 1R8CA 3MM6B 1F9HA 3FUYA 3B6BA 3V4IB 1BE4A 2RDJA 3DI6A 3NNAA 3ZTQA 4KKOB 1IUJA 4DL5A 1GFWB 4DX5A 4RNMA 2GJ2A 4MFBB 5MLCV 2PFFB 3MAAA 4WWSA 2BANA 3Q2TC 4UTGA 2AMCB 2V94A 3AD8C 3FDSA 2HQIA 2RB7A 3K5LA 2B7BB 3DNCA 1RZMA 1N5SA 1U45A 3FSXA 2PA8D 2DRAA 3GFZA 2BJ7A 5CD4H 3EVMA 1IBLJ 4Y2CA 1QTNB 3JSMA 5BR8J 2HQGA 2AJ4A 3P8BB 4RWXA 4CO3A 2CWKA 1VIXA 3C16B 3T1YJ 2WCXA 5D4LA 3W66A 2QJ3A
chains in the Genus database with same CATH topology
3I0RB 4L72B 4HTIA 5BYSA 3GIJA 1BQMA 4ZPWR 3T5KA 4PQUB 2JZ5A 3DXBA 2XS5A 2VODA 1N6QB 5J1EA 1Y4ZB 4NRUA 4OZLA 2C22A 2VA2A 2BBEA 3D0GE 4X4QA 2K1RA 4NOHA 3AA9A 4DHVA 2IC3B 1VQMS 5I42A 3KMQA 3LP1A 4PPZA 5C24A 1O5JA 5KFVA 2BQRA 4ZOSA 3RW7A 1CQNA 3S7RA 4IR9A 1TK5A 4DN9A 4YR0A 3GG1A 3G8TA 2I5JB 1JLQB 1B64A 5A8RB 3FMWA 4QW8A 1F9FA 2RQKA 3M2VB 3J81Y 3D0IE 4TQRA 2VFTA 3TARA 3M8RA 1NEEA 2R8KA 3SFUA 3MMAA 1X5SA 2DGUA 5HMZA 2YTCA 4ECYA 4K4XA 4RNHA 2E5HA 1SJFA 2JFKA 2D3ZA 3CMAS 1PGZA 2YKQA 3IWXA 1EP4B 3JTPA 5DO2A 5EWGA 1NK6A 2K3KA 2MZJA 3N79A 3LANA 3VAHA 3PW4A 1URNA 1NJIT 2AQ4A 1YBAA 5M2PA 5EWFA 3ZZUA 4Z37A 1RISA 2A1BA 1M0SA 2G13A 3GYNA 3POTB 2KG1A 4EYHB 1C4AA 4HH0A 1REVB 1HPZB 2XSJA 3NNHA 2MZTA 2WSEC 4F26A 3UPFA 4LF9F 2DNQA 3DLEB 4C3KA 2JFDA 3UR3C 1RT6B 1R7IA 2JVRA 2OPQA 4PXEA 3QO9B 2LA6A 2ERRA 1LOUA 3RRKA 4USJC 3D1OA 3MMJA 3MFIA 1TFWA 2IM1A 4ES2A 4DQPA 3PJWA 5JUMA 3T5JA 1FE4A 3T1HF 1KQSR 3HP6A 3GR1A 2FTRA 3MUMP 3I55S 3GMGA 1KFSA 1TR0A 4NL5A 3CC2S 1NHUA 5JVHQ 1G7CB 1UW4A 3KLHB 3TW0A 1S1UB 3LWLA 1M1KT 1TFYA 2HZCA 3OW2R 1NK0A 4MAKA 2CQ1A 2EG1A 3BSOA 2C3OA 4F4WA 1GT8A 3LO3A 1Q86T 5BJRA 2R7RA 2B3TB 4ZPBA 2P5VA 1QM9A 3KOAA 2F4VF 1HWIA 3G8QA 2CRLA 1S1VB 4XDCA 1JNZB 5EDWA 2MY7A 3QJPA 4K4TA 2XY7A 1GNKA 2WHOA 4Q2MA 1S79A 4MK7A 4NYZA 1P27B 1QVGR 4ED5A 4WTYA 2RF2B 1KONA 5L39A 3J7A1 4X84A 2XNRA 2DGOA 4H4OA 4N47A 1UEUA 4KHPF 3CTRA 3X3UA 3G96A 3IR6B 4B9LA 3OJUA 1RYRA 4ED7A 2FGCA 2L9NA 2PD1A 3BEGB 1S72S 3C66A 3SXLA 2H9ZA 5KT5A 5AE1A 1Z2LA 3QWPA 5ADZA 1L3TA 1VIOA 2H5EA 1R8PA 3HHDA 1QLNA 2K8GA 2CKWA 4Q0BB 4NCGA 5DS7A 2JWNA 2C42A 4N76A 1JJHA 3FEYB 3GIKA 5HBMA 1RT3A 1NJWA 5JVGQ 3V6JA 4A46A 1TV6B 4DV7F 1D0EA 2FHJD 3DRPB 1RI7A 1A7GE 2Q1LA 1VFJA 2EFVA 3M8QA 1U26A 5F8NA 3UCUP 2MQPA 4DV3F 4DV1F 3OFGA 3GFHA 4Q5VA 1HBOB 1JB0C 4C8YA 5IT9Y 1CSJA 3V5RA 3EGWB 2YWEA 3UD4P 4J9KA 3KJVB 1SUQB 1Y5IB 5F8GA 3IWNC 3MOJB 2RJZA 3KHRA 3HVTB 3IRXA 4QWEA 4G1PA 3I31A 4QR1A 4EO8A 3RB4A 1XMOF 2EFNA 1FA0A 3K8WA 3O3LA 1F60B 1VQLS 1LK7A 2P9EA 4HTJA 4F2SA 1S6PB 2BQUA 1FJGF 2OMOA 2EK6A 2RVJA 1VQSA 4EGLA 3BM7A 2X1AA 2DGTA 2J9CA 4FP9A 3JTNA 3OHBA 3D28A 1R0AB 2J9DA 1P6TA 2LKZA 1HARA 2GA7A 1L3SA 2IA6A 1N54B 2DPIA 1FNMA 3PKYA 4N77A 3G9CA 3OFHA 1U6FA 2CQBA 1NK5A 2ZD1A 2QEXS 3M1VB 1DTQA 5H9FJ 5LXYA 2FLOA 3EPGA 2HHSA 4RW7B 3QWUA 2RRNA 1YJWS 2J0SD 2ZZNA 4JI4F 5A0YA 3DRXA 3I9V9 5FDLB 2I2YA 4CI0B 2GCFA 1HHTP 1QSYA 2UXCF 1QE1B 1X5TA 3M2RA 4CZCA 4CNZA 1FO1A 2IM2A 5K14A 1X4AA 5LJ3Y 3VAIA 4ED6A 2R7VA 2A2DA 3TNVA 3ZZZA 1B0TA 2NZ4A 1JLAA 4BC7A 1HWLA 1Q7LB 3GIMA 2YVSA 4RW4A 5B0DA 2E1MC 4ZVEA 4EWTA 2W9BB 4UY85 4XIUA 4I67A 3TUIC 3HHKA 4LFAF 2BV3A 2XEXA 2HYIB 7FDRA 4OHZA 4MK9A 2F3JA 2GX8A 3MTJA 1FRXA 2ZBCA 3BO3A 4CCHA 4GMKA 3CCLS 2MZQA 2DNRA 3RR7A 4WFAQ 1HBMA 4DV0F 2VOPA 2DGVA 3IG1B 4EUVA 4RW8B 1GQEA 1MNEA 4O3SA 1F0XA 5BYQA 2KZMA 1D9DA 5HL7Q 4DR6F 2GFFA 4O44B 1HBUB 2KI2A 1IN0A 1FKPB 3RAMA 3MR6A 2W9AA 1RT2B 2HLTA 2VFRA 2DNKA 5C42B 1FXLA 2L3MA 3DYAB 2AD9A 2RH3A 2DVIA 1KOOA 4BWJA 1NJXA 2KZZA 4Q7AA 1C0TA 5KFXA 3ZZ0A 4ZPDA 1RT4A 2CQGA 3O6QA 4Q43A 2DBBA 2GW8A 1HW8A 4K4VA 2AX0A 2I9SA 5B0BA 2HMIB 2DTJA 4HYKA 1KHWA 4IH5A 5D6GA 4TYAA 2E9ZA 3I82A 2W4CA 3V6KA 5LT5A 4YMEA 2GMJA 2NUUG 1RT1B 3MM7A 3OTCA 5DQGA 4WJBA 2UV8G 1HQEB 5B7WA 1ZTWA 4PWDB 2KT5A 3MMBB 3KLEA 3CDAA 4X4OA 1Q16B 2J0XA 2ZH9A 3PRBA 4QIFA 2J7UA 5L8RC 3LGMA 1NAQA 1FCAA 5A6PA 2AGPA 1WNEA 3DDNA 4Q8EA 2JC0A 2IRXA 2GHVC 2ILZA 2DH7A 2W9CB 2RS8A 2YX7A 5CYQB 3CDBA 1IR0A 3GE9A 5KG2A 1VMBA 2HVIA 5E2QA 3MD3A 4C0OC 1NH7A 2NUHA 3PX6A 1IQTA 2L48A 4J37A 3QIPA 4PCQA 4IFYA 2HVZA 4A8WA 1UA0A 2GV1A 2GMLA 3Q22A 2AYBA 2HWIA 2KJVA 1JLCB 1UWBA 4PPDA 5IT4A 3JYTA 3BGRB 5IWAF 5A2QY 4DSJA 2XMJA 2W4DA 3PHEA 1N5YA 1DQ8A 1E6VB 3M32A 1M90T 4F67A 3FQLA 2M8HA 5KFUA 2HFNA 2F40A 2O3DA 3Q2SC 3NGKA 3MEDB 1VQ7S 4IRDA 3NS5A 5J2NB 3VAFA 1LXJA 1RT5A 2CZVC 3ZFVA 2QA2A 4Q8FA 2CPDA 1ELOA 3OL6A 3PW5A 1V3ZA 2IVMA 4M5DB 3DI6B 2VZ9A 4ID5B 4QWAA 3KLVA 2LMIA 4G3IA 1NK7A 5DQHA 4J9OA 3GB0A 1U1LA 1DTTA 5T7LA 3AH6A 4PXDA 3GV7B 1RT7A 1SL0A 4L3NA 3B82A 2NS1B 2MGZB 1Q78A 2XB2D 4LVOP 3TYTA 1SKRA 1KLMB 5K9FA 4EZ6A 2K2PA 5CQGA 1OPZA 4K5SA 1V6HA 2EBEA 1RK8A 5B09A 5B08A 3VF0B 5HP1B 2XMKA 4QWBA 3J7YU 1JIHA 3V6DA 3IA0A 5KFZA 3ZZYA 1RQ0A 4QIVA 4CT8A 3MEGB 4ZPVR 2MKHA 3DOKB 3SCIE 5T41A 1ZM4A 3AA8A 3KWMA 2G0CA 5KOXA 1QAXA 2ZFHA 2OD6A 4LFBF 1F5CA 4B3SF 2BOPA 2NQPA 3TAPA 2GIQA 2LDIA 4KV8B 5L1LA 2UP1A 1SC6A 2WRMA 3S6EA 5D78A 3KNGA 4EEYA 1IQZA 2ZC4A 4P6QA 1RDRA 2RQMA 1F2GA 1QAJA 2J0WA 4KQZA 2VFVA 4X4SA 4C8OA 1LWFA 5L38A 1XMQF 2WSFC 3JSMB 1ZPVA 2BR0A 3OL8A 1IKWA 4JBCA 4C98A 4F3QA 4DV4F 3IR5B 2B56A 2PI4A 4IDKA 1U8SA 4MTPA 3R5AA 4ZK7M 2BRLA 1L5UA 4ICLA 1I6JA 5KOWA 2UVWA 2OD4A 5J1PA 3SSQA 3JSYA 3Q8PB 1Z2ZA 4O4GB 4TYBA 2FLNA 4KT0C 1TK0A 3OLBA 5J1NA 4DL4A 3OHAA 1L3UA 2JJ4D 3M6WA 1S9EA 1SJ1A 4I1TA 5K8OA 1S9FA 5F8IA 2BRKA 4DSFA 2M70A 3HO1A 2K1RB 1ZM2A 4NXNF 5I42B 3LP1B 4OL8A 5C24B 1Q8LA 3ZZOA 2W24A 2BZ2A 1IXKA 3DRSA 4TXSA 1U48A 1T94A 3PW0A 5CA5A 1RP5A 3HVAA 3HVRA 3W3SA 5SUHA 2EC0A 1FNXH 1RWUA 3PXGa 2ZJQQ 1T7PA 2PI5A 1OPIA 3O1LA 3CD6S 3MEEA 2P6TA 2FVPA 3MMAB 4KSEB 4G6VB 1FRHA 2DCLA 3NCPA 1S49A 1VQ9S 3G6XA 2YWFA 4K5RA 2DO4A 2WOMA 2OPPB 2OJ3A 1VRUA 4CQ1A 7FD1A 3CPWR 1YHQS 1NKBA 2KFZA 4DL0C 1KC8T 1RJJA 3C6TA 3RBDA 5K8MA 2B6AA 2XSJB 4JI1F 1KRPA 5CYJA 2ZBIA 2VBXA 2KN4A 3FFIA 3VR1A 3SQGA 4CH7A 3LWMA 2OPQB 4O3RA 4WZMA 2CDQA 1IBLF 4KB7A 4J9RA 3M30A 3N9UC 1TKTB 4CO4A 2KYZA 4YB6A 4PR6A 5BR8F 2YH1A 3C6UA 4F8RA 4GKJF 2LXFA 1LV5A 3HLUA 2GGPA 1K1SA 2VKRA 4OX8A 1FNOA 3H20A 3T1YF 5HLFA 2MZSA 4FYDA 2J9DE 2KXHA 4DR3F 5KFQA 1RTHB 2HGMA 2CPEA 4OLPA 3O8WA 4AUKA 5LJ5Y 3SI8A 4LQ9A 3VCDA 4K4ZA 4AFFA 2ZDOA 4F3OA 4DR2F 2PDAA 2ZJRQ 3HX9A 2V0NA 3DLGA 3NCQA 4IQMA 4KO0A 5AXKA 3CCQS 1LFWA 4KE5A 2VOOA 3FNNA 1CQMA 2E7WA 1Q4RA 2ZVSA 3H4BA 1NK9A 1D3WA 4ZS6A 2JLFA 4H4OB 4DV5F 3PO5A 4YDXA 4FZVA 3US5A 2D7SA 4I2QA 5F3ZA 4K4WA 2KT3A 2HHHF 3OVAA 1MROA 3ISZA 2IM3A 1LFPA 4IKAA 1X7VA 1IM4A 3KG1A 1IBKF 1LK5A 1ZPWX 2V8HA 5HMXA 4A8MP 2R8JA 4CO2A 2MKSA 4PKDB 4DLEA 2AJ1A 3NAIA 4ZDNA 4DDFA 5E3PA 4X4VA 3T5LA 4L6V3 1KVJA 2VBZA 2AP6A 2YY3A 4NCGB 1Y0HA 4RUHA 3OVBA 4MH8A 5K5MA 1UVMA 2VG7A 2VD3A 1Q8BA 2HW3A 5HBMB 1RT3B 3O2IA 4NLUA 2XY6A 4WFBQ 3SSSA 2RKIA 5IQQA 3TA0A 1S77D 1R8AA 2HGLA 2W4PA 1WEXA 5FLXY 2QA4G 4G1QA 3WZ0A 1JLGB 2FVCA 2XWXA 3TUZC 1YVFA 4XAKA 3ZC4A 5U47A 1N34F 3DRYA 3M8QB 2D74B 2M52A 2VG5A 3K5MA 3MM9A 1U1RA 2HFOA 1DAXA 4NZ7A 3HK2A 3PR5B 2OPSA 3HVWA 2KTQA 4HDHA 2LQ9A 4KAIA 4O3OA 2C2EA 1WG4A 3MMCA 3MZIA 4JUZA 3CJKB 1SQEA 3CF5Q 4NLVA 1VS3A 1OSDA 2QE5A 2CQ2A 2LQBA 4B9VA 3OR2A 1FRKA 4NMLA 3SDEB 1H2UX 3IRXB 3E3XA 3H5XA 5D4OA 2DPJA 3DHXA 4NX9A 5HI7A 1LWEA 1ZBTA 4ECZA 3RB3A 3TA1A 2ZH4A 1BY9A 1U2RA 2ABYA 3VAMA 1SH2A 4WKRA 4F3MA 2XO7A 1VK8A 4DG1A 3EXYA 1FJEB 4X66F 4LSNA 2CQDA 2PEHA 2IHR1 1JLBA 1U24A 2WW8A 3J7Z5 1HI8A 4ZHRA 4URQU 1X0FA 2G4BA 4Y0FA 3M2UA 5HQ8A 3WDOA 3D54A 1VLYA 5F41A 2HG4A 1MU2A 1DTQB 2RU9A 3KLGA 2E5GA 4OMFG 4N8NA 1XTZA 2KT2A 1S1WA 5A0YB 4DBQA 1ZZNA 3I5CA 4B9TA 4U9RA 3P6YC 4QIEA 2YKMA 3M2RB 1VI7A 4ID8A 5KG7A 5K14B 3B8HA 4X4TA 4O23A 3T6JA 3V4MA 3PNIA 2MQMA 3LPYA 2COLA 4HI2A 4RW4B 4FN5A 1VQOS 1OQ6A 1UMJA 4ZCIA 3OTEA 5AXMA 1R8HA 1U7LA 4DSKA 3OR1A 3DDKA 3K5PA 4OI2A 4ATNA 3KHGA 1WF0A 1Q82T 4KFBA 2VONA 3OQ2A 5DGAA 3BQ2A 4F4YA 4CNYA 1N88A 4DUZF 3HMJG 3RB6A 1FD2A 1H0HB 1W2IA 4P7VA 1HWKA 3GV8B 1HBMB 4Y00A 2SXLA 5F8MA 1A6LA 3CGIA 2CG4A 5GAGU 4QQBA 2EFPA 5KG0A 1RTIA 5DDRC 2R7WA 2UUWA 2KFYA 1YITS 2CYYA 3BSCA 1YJRA 2QYCA 2YNGA 3LALA 3UDCA 2XSFA 1C2PA 2OSRA 5G0RA 3EX7B 2FVQA 3Q24A 3CT9A 1TL4A 1GAOA 3OSPA 1F5AA 1KEKA 1HW9A 1C0TB 2BE2A 4ZPAA 3U1MA 1RT4B 4JI3F 1EETA 3QPIA 2VB6A 4B02A 3VAJA 5E7OB 5EX0A 5CHCB 1TKZA 3KNAA 4B3RF 3GSDA 3H4DA 2VPYB 3MM7B 4H4MA 2LU2A 3G8SA 4JV2A 4A48A 2HFZA 3KLEB 1D9AA 2E29A 3RBEA 1HD1A 2JOQA 3VZHA 4E8UA 1PO6A 2DHSA 3LUYA 4JOUA 5D4NA 2VG6A 2PGCA 1MMDA 4QBUA 5KFFA 3IRWP 4KRWA 5KG1A 5KG3A 4IRCA 4CH1A 2R7UA 3FEXB 3W7BA 1NU4A 4F2RA 1DQ9A 2VH7A 4NLWA 3W2WA 2CJBA