4JYAF

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4jyaF00
2UUCF 2BXJA 5LMUF 2ZM6F 4DR3F 1J5EF 1HNZF 4DV6F 4DR4F 1F60B 4DV7F 1IJEB 4NXMF 1N32F 5AJ3F 4JI1F 4JI5F 4LFAF 4AQYF 4LF9F 1HR0F 2E5LF 1G1XA 4KHPF 4JI6F 1G7CB 2VQEF 4JV5F 3OTOF 2UXCF 1N36F 1XNQF 2UUAF 4B3TF 4GKKF 1CQNA 4NXNF 4X62F 1N33F 3R3TA 1IBKF 1HNXF 1XMOF 1IBMF 2B7CB 2UXDF 1HNWF 4DV3F 2HHHF 2UXBF 2J5AA 4LF8F 4X66F 4DUZF 4LF5F 4JI3F 1IBLF 4DV1F 4LF6F 1XNRF 4DR7F 4DV5F 1VMBA 4DR6F 4B3SF 5IWAF 4LF7F 1XMQF 3T1HF 4YHHF 4LFBF 2YY3A 5BR8F 3ZZPA 4JI7F 4OX9F 4DV0F 4B3RF 4LF4F 2KJVA 1N34F 2B7BB 1RISA 1FJGF 1LOUA 1IJFB 4DUYF 4DV2F 4K0KF 1CQMA 4B3MF 4X65F 2KJWA 2UUBF 1I94F 1B64A 3T1YF 2UU9F 2F4VF 2RJZA 4GKJF 2BVZA 4JYAF 4JI2F 2VQFF 1GH8A 4YY3F 4JI8F 4X64F 4DV4F 1QJHA 5LMNF 4JI4F 4LFCF 4JI0F 4DR2F 1FKAF 4DR1F 4DR5F
chains in the Genus database with same CATH superfamily
2UUCF 3CDAA 2B0GA 1NJWA 2RHSB 2CG4A 2H5EA 4BDPA 4FYVB 4CO4A 3H5YA 4CO3A 4OHVA 3VTIA 1H73A 3KKFA 1EP4A 2XLIA 4XO0A 2WSCC 3M32B 4NI2B 3ZZOA 5CZVA 4EZ6A 1JXLA 3AH6A 4OV6A 4ZPVR 4PQUB 4M5MA 4CTAB 2GAGC 2VKZG 3LP0A 1V3ZA 1HHQA 3PYEA 2IC3A 3CJKB 3QLHA 2HNDA 4OX7A 2D41A 2DNQA 3SQGB 1WKLA 2XWXA 3Q24A 3GPAA 5GVQA 3ILJA 2NZ4A 2DPIA 2VFVA 3MFHA 3LP0B 1GQEA 1Q95G 3AJDA 1T9VA 4UOGA 2XO6A 3O2IA 3HHNB 3MI7X 2P9EA 2Y1LB 2HNDB 3EE3A 5KFFA 2WVEA 3I0RB 1CPZA 4A8QA 1Y0HA 1DTQA 1RT5A 1JLAB 1RAFB 1UW9A 2ZOGA 1HWJA 3FFIA 4GC7A 3N5FA 4XK8C 1UPPA 2U1AA 2RUSA 1DY3A 2I9SA 4ZJQA 1KQSR 1LW2B 3NGRA 2R8GA 1FKOB 2ZITA 2PMHA 3MFIA 2BE2A 4ZVHA 2J8SA 1QSYA 2LYVA 1NU4A 2NLWA 3F56A 1FFSB 1GMUA 4MK7A 4PPZA 2HQGA 4DPYA 1HBNB 2KVIA 3HHLB 3T1YJ 1HPZB 3DRYA 4B3SF 4FF2A 3ZTPA 1UA0A 5HMWA 2CPIA 5A8WA 5CHCB 1RISA 3IR6B 4KV8A 3C8YA 1KS2A 2BUNA 1NNDA 1F5CA 5GADI 1S77D 1AYEA 3AXMA 3LGHA 1MROA 2R7RA 3ZZYA 4ITSA 3VVTA 2FJAB 1Y3JA 3CJSA 5ETTA 4DEZA 3GG0A 2R7XA 4X2BA 2ZBQA 3DOLA 1RJJA 5IT4A 1V5IB 2CPHA 3ENVA 4RU2A 1XWLA 5HJYA 1R89A 4USUA 5DGAA 2W01A 2CQ3A 1MROB 2CPYA 4WP9A 1VC5A 2DKOB 4FPIA 1L3SA 2FHOB 4LF2A 3EX7B 3HULA 3MM5A 4X4OA 1M5HA 4DQSA 1P1TA 4KC5A 3GSDA 2HNYB 2BQRA 3G6YA 3CDUA 5D78A 2AD9A 2VONA 2NCKL 5HVGA 3NCRA 1RU1A 2OEKA 2M52A 3ILOA 1RWXB 5LSOA 2OUGA 4ZS6A 1M1HA 2G0IA 1N5VA 1ZAWA 2FHJA 3TNVA 1HNIB 4CLSA 4KIAA 4AXJA 1S1TA 2DNOA 1GAOA 1HQ2A 3D54A 4ZK7M 4QR0A 2GW8A 4V19J 3U7JA 4C3KA 3V6KA 2OI2A 3DU5A 3UN3A 2NR0A 4G6VB 3KLEB 1Y5NB 3BR8A 4BWJA 2MZQA 2QLWA 3R7SB 1G2EA 3FZBA 3ZTSA 1G1XA 4WE1A 1TP7A 1KHWA 4ZP6A 5LOQA 3OJSA 4LBPA 3F44A 3DRSA 3M8RA 2QFIA 2GVZB 4DX6A 4DV3F 2F7VA 2MKHA 2Y3YA 2ZUGA 4FF1A 4IRDA 5KG6A 4EO6A 1SB6A 4UZBA 1R31A 2I6WA 2FGCA 3V81B 1S76D 4ATNA 1RTIA 4ECWA 2MTLA 3H90A 2C2EA 1BQNB 3DU6A 3TW0A 3DRSB 4EWTA 2V5HG 3IC1A 2LQ5A 2J0QD 3PEHA 3FCVA 2XZWA 1RABB 2F8HA 4QPXA 4CCHA 4NLPA 2HK3A 1RHKB 4QWEA 1RTIB 2V2VA 3VAHA 2UUCJ 1Q82T 4DG1A 1NM2A 1N0VC 3ENAA 1U1OA 2MJUA 4ZP9A 2MLYA 3M30A 1HNZF 2RRAA 2DGQA 1IQZA 2F9DA 2ADBA 2Q79A 1NK4A 3W2WA 3ITHA 1UJ5A 1RE1B 2F8EX 3D7SB 5C5JA 4ECQA 1DFDA 2K7KA 1ZA2B 2E1AA 1AA1B 5LJ5Y 1MSWD 1FE0A 4NEZA 2POKA 1RK8A 3TP2A 1SKWA 1XNRF 3KK1A 3C14B 1S4FA 4DL4A 3AJ2A 2EFQA 2RS2A 3DM2A 5JVGQ 2W4CA 3THVA 2Z57B 2AHOB 2WTFA 1X9SA 2GS8A 4ID5A 2HHPA 3G8SA 2YWHA 1FRXA 3TUZC 3Q89A 1KQGB 2VPZB 2XSJB 1B0PA 1CS4A 3H4DA 1FRHA 2YX4A 4JP8A 1HNWJ 2AZ3A 3P45B 4TXSA 1MMDA 4X66J 1QE1A 1T03B 1Y5IB 1C2PA 2BANB 1EETA 3OTEA 3T41A 3UVJA 1LWCB 1U8WA 1RHQB 3MTJA 2VKRA 5J2NA 4N76A 3VQTA 1HI8A 3GFHA 3CSKA 3HHEA 4N56A 4E2FB 2NZCA 3KXDA 2DNLA 1YHQS 1SV5A 3W5YA 2FVSA 2E9RX 3I4HX 1HBOA 2Y8YA 4B3MJ 1LQ9A 3A3NB 1CJUA 5LSRA 3ZZ0A 5HMZA 1S9EA 3PVXA 5JJBA 3VAJA 2IJFA 3UCUP 2DHGA 3HVTB 2XMKA 4HI1A 2EFVA 2FLNA 4NWBA 4WFAQ 2QFJA 2XI3A 2EK6A 1TAUA 3KK2A 4PG6A 2WONB 4AUKA 3U27A 1SC3B 1KVIA 2EG1A 4A8FA 3DGPB 3GU0A 4FF4A 4IFVA 4CT9A 3HVRA 2BW2A 2HKEA 2C2RA 1YJTA 4X84A 2WSFC 3QJPA 3O8WA 1DRZA 1HI1A 4TQSA 2HHUA 4HKQA 3HI9A 3TA0A 3BQ2A 1KQKA 3MEEB 4NMXA 1HBUA 2R7OA 4IR1A 2M4MA 2ASYA 2RIJA 2W7OA 3CD5A 4DR5F 2OD6A 3M8WA 2YNGA 4NXMF 1PAUB 2YNFB 2ADCA 2A6MA 1SC6A 1X4GA 1L3KA 4C8OA 1H2VZ 4EYHB 3M6WA 2IRUA 3NLCA 1MWQA 4C7QA 3UI3A 5FLXY 3IO1A 1HNXF 1VRUB 2FLOA 2L9NA 2OKQA 2XMWA 3CXCR 5H9EK 4DXLA 2LFVA 2EK1A 2J5AA 1HARA 2HS4A 1IN0A 3GE9A 4ZCKA 2BX6A 3ZZZA 3TAMB 4DV5F 4JI2J 4M5IA 2IBKA 3CUNA 3TANA 5J2PB 4RW6A 1UL3A 3HFZB 3HKWA 2KKHA 2FJVA 2CQ4A 1KBRA 1S1XA 1YWXA 1FJGF 2DD8S 2YKMB 2AW0A 1LNQA 4Q45A 4DL2A 5KG2A 3FMWA 4ICLB 1FVSA 1JLEB 1XERA 3PNIA 2PA8D 2A0FB 4WFXA 2XMTA 3DXSX 3R5GA 4DSEA 5HP1A 4BCAA 2AF6A 2WCXA 2DR7A 5DG8A 4ERDA 3OSPA 3SCIE 4USWA 4OMFG 2HMIA 2FLLA 2VDHA 2NXCA 5LMUF 4DUTA 4RW9B 1KHVA 3ISZA 3OR2B 4CI0B 2E1MC 3MMJA 2EFNA 4QOTA 3H59A 3NRBA 5HAOA 3PW2A 1YTYA 4Y00A 1WC5A 3CCZA 1BQXA 4ED1A 4LF5F 4USMA 3KLIB 4DI6A 4J9QA 2Q66A 1LW0A 1FJEB 4TU8A 2YPYA 2V8PA 3AOAA 2CJBA 3UO0A 1TK5A 2XSFA 1YBAA 4OJGA 1H2UX 1RCXB 4OHWA 2WVCA 2JH3A 2ILYA 5KT4A 5AXKA 1XN9A 1IKWA 3BJYA 2MSTA 4YB1P 3K5LA 5J1NA 2XZTB 4NXNJ 1VQMS 1YK9A 4P9SA 2D7SA 1VQKS 1UEKA 3FBFA 4CNYA 4LVOP 2M8DB 3BGOP 4M8LA 2C3MA 3FVYA 4ZVOB 5A8KA 5AE1A 2DXDA 3HVWA 5G0RB 4CWBA 4ELUA 1U8SA 1EAYC 3IRXA 2G2ZA 1T02A 1LV5A 2CAJA 3Q23A 3SDEA 5CCLA 1RHJB 3WC0A 1CVJA 3BGLA 4L6V3 2D3UA 3B82A 3EVMA 3HMJG 3C6UB 1XNRJ 1T05B 4ZIVA 2CPZA 2X1BA 4AXIA 3BDPA 3VHQA 1UFLA 3J7A1 1J5OB 3SXLA 2HGNA 3OT9A 2B3TB 2LKZA 1SUQB 1RT4A 1TV6A 4TKTA 2VOPA 4KHRA 4F25A 4RNHA 4DQPA 4QIEA 4KHPJ 3BB5A 2J0XA 2ZH6A 3QIPB 4OYOA 2UXCJ 4C8LA 1JNRB 2OSRA 1WWHA 4MFBA 4JYAF 4R0JA 2L41A 5HLFA 2G9OA 4IR9A 2QSFA 4P2MA 2I38A 1U47A 2VG6A 3MD1A 2P9CA 4LF8J 4OHZA 2BXJA 2JC0A 5A2QY 3TR5A 2IFXA 2KHDA 2XCAA 2LEPA 2J7KA 2OO4A 1U1KA 3M2UA 1VC6A 1JKHA 3K0JA 3KDOA 5I42B 3DN9A 3MAAB 5KFAA 3CMES 5F3TA 5J2MA 1N0UA 3H2UB 4ED0A 3FJ2A 1Q0NA 2R7VA 5I3UB 4CLZA 4FYXB 2DITA 2R3VA 3CO0P 4AL6A 4TQRA 2DTJA 1ZAXA 5A0YB 1HNVA 1H2TZ 5HMXA 1JKHB 5EX3A 4JI4J 1RTZA 3OUYA 2X1AA 1ZM4A 1UVJA 4NLDA 1Q7YT 4GVBA 1N5YA 3HM9A 4PYDA 3ETMA 1VHIA 2VB6A 3I82A 4P73A 2BVZA 4DR5J 4XPCA 2VF3A 3KLHB 1JLFA 2FJXA 4NXMJ 4NLWA 3DOMA 4DUZJ 4ZLNA 2FDNA 3MTKA 3QGPA 3TJ8A 5ETNA 5E2QA 1RXOB 2R8JA 2H9ZA 1R7IA 4PCQA 2BDPA 4PZVA 1OY8A 5C7PA 2PO4A 4F2RA 1OYDA 3TOQA 1SJ1A 5E3PA 3KHRA 5B0BA 4UUWA 2J0SD 3MPDA 3MMAB 2BEFA 1Q79A 3ZTRA 3UR0A 1IBLF 1DBDA 3LPYA 4G3IA 3RG6A 5IC6B 3H25A 3HCXA 2DVIA 1B0VA 1RYSA 4OJ3A 2HVZA 2BACA 3O44A 2NS1B 3OPKA 2UP1A 1Q86T 2KXNB 2HVHA 1QAXA 2AJQA 3BM7A 1EHWA 2X1GA 2AGPA 3LW5C 3CULA 2R7TA 4HVZA 4CNZA 1GNKA 4Y65A 2XMMA 2WVFA 2QL7B 3DLBA 3G8TA 2RILA 2L9WA 2UUAJ 3M4XA 1RWNB 4TYBA 2UVVA 5U47A 3DOKA 2MMYA 4CH7A 1PIEA 2VHGA 1MLAA 4K4ZA 2NUUG 4OI4A 3MPWA 4ECZA 4HHUA 3K58A 4UY85 2CZ9A 4DR6J 4ZVEA 1T9YA 3LTOA 4UY8T 3I9ZA 1FK9A 4JV5F 1CC8A 3W2VA 1CG2A 4DCOB 4UOHA 2NPFA 4U8VA 1EX8A 1IBMF 3B54A 3AT1B 1NDLA 5IT9Y 2KYXA 3GCWP 2IAJB 4F0MA 3B78A 3NOCA 1IM4A 3P3DA 1FESA 1BQMA 4TYAA 2EC2A 2GIFA 3ETOA 2OGUA 1FK9B 2M9KA 4B9TA 3DLGA 1EZZB 2IM2A 3K5PA 2BKPA 2DNKA 3I0SA 3W8GA 3NS6A 3P49B 1WSRA 2DY1A 2XCPA 3CC7S 4WCEQ 4FPRA 1VYAA 3BBBA 1XJWB 4PABA 1GXTA 3PZPA 3J81Y 4ES1A 4WFNQ 4MMOA 2YWEA 4JI0F 4LR8A 1V3SA 4IFYA 4LRAA 3GFYA 2QC3A 2J9DA 1PKUA 2PMZD 4U95A 1OY9A 1RT6B 2E1PA 1NK0A 4E98A 4W4MA 1U24A 1L3TA 4C11A 4ED5A 3M2RA 4B3TF 4A8KA 1GMWA 4DSKA 2YNIA 2KT2A 3E3XA 4M5NA 1MU2A 4UOCA 1T3NA 4YR3A 2MHNA 2KT3A 3JSRA 1KLMB 2WVBA 4J9OA 1D9AA 5FLXU 2DNHA 3D68A 3M2RB 2ZKUA 2HFVA 2FHKA 1JMTA 4ZCLA 4EO8A 4C98A 5D0GA 3DMJA 1X5OA 4N47A 2GHVC 1TUVA 4R8UA 4Q8FA 5CD4H 1Y7PA 3AODA 3SBMA 1AFIA 3BN4A 5GAEU 4ZN1A 1S1UA 3I96A 2NSBA 4TY8A 4QIFA 4DPWA 4DR2F 4BLGA 2LXUA 4QWDA 5DG9A 1RA7A 1X8DA 3FEZA 2W9AA 3HLUA 2DGOA 2IVMA 4IYQA 5KOWA 2E1CA 1UAWA 2QRRA 2OPRB 3VGVA 2FIUA 3OTOF 4R8UB 3FEYB 5L1KA 2C28A 2GJFA 4OZ5A 1TFYA 4O0IA 1SH2A 2UXDF 3G82A 2AWZA 2OFGX 4BHQA 1TL3B 1RP5A 5RUBA 4A48A 2QA1A 2WRMA 5F3ZA 5CYMB 3MM8B 4K4VA 1H74A 3EUNA 3TQEA 2BJDA 4WJBA 1Y9OA 1L3UA 4DS5A 2H4WB 2BM0A 3RW7A 2UUWA 5C42B 1NJZA 4OZ0A 3PRBA 3UCZP 5IC4B 1OYEA 3E01B 4OYMA 1SKSA 2IPOB 2J9EA 2DEJA 1VQLS 1R8CA 2IRXA 2CQBA 3GIMA 3M8QA 2EBGA 1KKHA 1NZ8A 4NLUA 2E7XA 5F8JA 1QD1A 3MCSA 2OPPA 3POTA 3GV5B 2EXUA 1N5SA 2BJ1A 4KB7A 4TN2A 3CCJS 4YS2A 4JI3J 1S6UA 3RR7A 3B4MA 1Q8LA 4ZPDA 2WVDA 1M5KC 4RW7B 1R8PA 4ZVTB 2FZKB 2DR5A 2FVRA 2W1BA 4DU8A 1KEKA 2NYIA 1N36F 4KAIA 4DV0J 2LXFA 4HH1A 1RDRA 3IG1B 4RX6A 2CYYA 2HS3A 3NGTA 2D9OA 1SIZA 5KG1A 2DGXA 4PWDB 2MGZB 2EPIA 4ZLJA 1QUVA 4WYWA 1PYTA 2VFSA 1FRJA 4A8OA 3PACA 2DYAA 3MM7B 3ZZUA 4B9UA 1JLGB 1NB7A 1S0OA 1N34F 4U7UD 1HA1A 1IWAA 3WDOA 5F9NA 3ZC4A 2HHQA 1RKJA 1CQMA 2QA2A 3CJ3A 2FTRA 4PRFA 2PC6A 1S79A 3FBEA 2B4UA 3QFWA 1FFWB 3AAWB 2VODA 2KRRA 2K3KA 2ACMA 1T3OA 3PRDA 4Q0BB 3PG9A 3CCQS 1T9TA 3DLKB 2HEKA 1VLYA 3NXZA 2YWFA 1Y5LB 1MN7A 2IY5B 4JV5J 1RWKB 1S1VA 3W1YC 3EVOA 3SI8A 1HFEL 3QWUA 1QVGR 4JUZA 4A8SA 3VAFA 5C25B 3JQKA 4MIBA 3RU0A 2A1BA 3TA2A 2HLTA 3J80U 3BPSP 1W7WA 4HH0A 1TKZA 3A8JA 4O3RA 5F0WA 5F8MA 5A2QU 1MWZA 1UCNA 4O4GB 3MMCB 3MMBB 2ROEA 3CT9A 3CO9A 1K44A 2HQDA 2K2PA 4KGZB 7AT1B 2NQPA 4QWCA 2UVRA 4FN5A 2MZTA 4WFYA 2VZ9A 3MR7A 4HACA 4DSJA 1QTNB 2H5IB 2IA0A 5CCMA 3NGUA 2IYIA 2B9YA 4OZLA 4L3KA 1O6XA 1Q16B 1M0SA 4P2SA 3T6JA 2XB2D 1CJTA 1JLQB 5J1EA 3TVZA 1FERA 2CPEA 1NDPA 3UDVA 4OL8A 2VA3A 5IXUA 3VAIA 2YX7A 4JI1F 2RQ4A 3UQSA 1FTRA 2NPIA 4B3TJ 3NEKA 2KYZA 2ZJPQ 4NZ6A 1UEVA 5LSLA 4C0BA 1A0OB 1WTFA 3HDSA 1N54B 4DHVA 4KBIA 5KFDA 5GAEI 2VFTA 2AQ4A 3DHXA 2MZ1A 1PJ6A 4IH7A 1AT1B 1IR0A 5F0UA 2ZH4A 1NKEA 1S6QA 5HJXA 4I6WA 4YHHF 3M05A 5L1JA 4JI7F 2HVDA 2DGWA 4LF4F 4P7VA 1T95A 4QW9A 4EMDA 2L9DA 2GX8A 3PKYA 3QWPA 3MPVA 1I94F 3MPYA 4ZP7A 3IBFB 1YGYA 3HJFA 1R8HA 4KKOA 5FD1A 4C3MA 2DNMA 3TX0A 3C66A 2XY5A 1F0XA 5EX0A 5T14A 2GJIA 4ECTA 4M5DA 3D5MA 3NGKA 5L8RC 2UXDJ 1Q8IA 3OR1A 4ZVFA 2XY6A 4KKOB 3ZFVA 1FDAA 2LECA 2E66A 1M5VC 3PV8A 4B9NA 2GIQA 3VALA 2YWWA 3R7NB 3M8PB 2HBRB 2IDEA 1YJRA 4PYAA 3CJ8A 3IA0A 3OHAA 4UT4A 2VOOA 5L9XA 5IT9U 2UV8G 2XS7A 1U26A 1UZHA 1I51B 1P27B 2V63A 4DQRA 3NOGA 1ZETA 3P96A 3J7YU 3H5UA 2A10A 2YNHB 2KN4A 1F9FA 2IM3A 2BJ9A 2M70A 3IN5A 1NAQA 2XGPA 3OL6A 3AQOA 1LWEA 4G1IA 2ZE2A 4WIQA 4LSLB 1E6YA 2HHVA 2B43A 2RS8A 4C8ZA 4F36A 5GAGI 2ZZTA 3GFXA 4RUAA 4YQWA 3C6TB 1U1RA 5HSPA 4DSIA 3CCTA 4KGMA 2CDQA 1WI6A 2VG5B 3D1HA 3GYGA 4DV1F 1VQ9S 1TL4A 3BEGB 2PI5A 1FD8A 1Y11A 2RKIB 4DLEA 1SC1B 1N34J 4QIVA 2O1PA 3ONQA 5E3AA 3ZZPA 3JYTA 3LF0A 1H98A 3CCUS 2V94A 4QR1A 2CVEA 2ZEJA 3PIPQ 3UR3C 2DNNA 2AJ2A 4PXEA 5B09A 2OJ3A 2OH2A 4G65A 2E5LJ 3SCKE 4DL5A 2AP6A 3G9CA 3PX4A 2BKOA 2DISA 2LCWA 3AY0A 4X4PA 2V6AA 1R27B 1VRTB 2IVFB 1ACMB 2R42A 3T3FA 1WOPA 3MXHP 2O67A 1FKAF 4UQGA 2DJWA 4USIA 1B0TA 1N5QA 2QA4G 1N32F 2HNZA 3GJTB 2J0WA 2VQEF 4RPFA 3LAMA 3BSAA 4WTOB 2I8EA 1OQ6A 3ZZRA 4M95A 3MR3A 3F0NA 3KJVA 3KFWX 1TAQA 1F9HA 5HMYA 4ZCIA 5HROB 2MY7A 3ZO7A 1C1BB 2GIRA 4NCGA 2JSXA 5IZHA 3C46A 4IDKA 1YX2A 3U1LA 2JJ4D 2W4DA 3QZ8A 4LSNA 3G96A 5CYQB 4P7TA 1QM9A 3D28A 5EHHA 5DETA 3KLFB 1GMVA 2GHWA 2UU9F 2J7UA 2V4RA 3M8ZA 1Z2LA 1KFDA 4Y2MA 5KFGA 5H9EJ 1HQUB 1N48A 2WW8A 4X62J 5IV4A 1FHTA 2HGMA 4ED6A 3UDEA 2QG9B 4ZJLA 4CM2A 2Z2MA 3U1MA 1G6BA 3I32A 3HSJA 4DR1F 3KYLA 2V8DA 1F60B 4I7FA 1DARA 4RNOA 4CZCA 1S9GB 2HBQB 4IG0B 1IXKA 1UWBA 4AT1B 2DY9A 2YKNB 5F41A 1VBXA 3QBCA 3G87A 1MW7A 4EK2A 3HF5A 3HVAA 1RLDA 1NSQA 1C4CA 3JXOA 3NS7B 1Y3KA 4OX9F 4F50A 4KYZA 2YWGA 8AT1B 3CCLS 1I94J 5ETRA 3K8VA 3BV8A 2YX1A 2V8VA 2R8HA 3CCES 1C0UB 4YDDB 1B3TA 3FRYA 3GYNA 3V6DB 3FBCA 1X4AA 3HKZD 2GMHA 1XR6A 1HD1A 2GMLA 2DNGA 5K8OA 4DDFA 2VPYB 3ILIA 2VASA 1URRA 5H9FK 2QSWA 1U6ZA 4NE9C 4DOZA 3J7YI 1ZYQA 3IGNA 5DQGA 5D4NA 2KI2A 4NYPA 1FI4A 1WI8A 3R3TA 1IBKF 2UVUA 3EXCX 2P6TA 1R0CB 2E44A 3Q8RB 1PC4A 3BF4A 1Q8BA 4N8OA 1SCJB 1KQFB 4ANEA 4LF7F 2HZCA 1NKBA 4DBQA 4DV2F 3V4IB 1T9UA 2EBEA 2WBMA 4CQ1A 5IQQA 3JQJA 2FJWA 3NY0A 4OYIA 4DF4A 3V4MA 5AXNA 4OIXA 1RBLA 2ZH2A 3N9UC 4LFCF 1HMVA 1WD6A 1B4SA 2AJ4A 4DR3F 3EM1A 1KP6A 1QAIA 3DRRA 4P6QA 2U2FA 3T5LA 3IWLA 4N77A 5B0FA 2CQCA 3BZQA 2NYHA 1HL6A 1VQ5S 4HYKA 4GKKF 2OD4A 2UZAA 3QO9B 4OYZA 4OLPA 3QATA 1CEZA 1IKYB 2HAFA 3L7PA 2PFFB 4IRCA 4J9KA 4CLLA 3D0GE 5HQLA 4QR2A 5BR8F 4ZVGA 4PUOA 1SC4B 1JXVA 5A76A 3ET6B 3MWBA 4DN9A 2CQDA 2V50A 2X3GA 3S01A 2X51A 3N28A 3NGSA 4J9VA 3PW0A 4I6YA 1YDLA 3N6LA 4ZHRB 2PSZA 4RW4A 2J9DE 5ETOA 2R2TA 5CQGA 5D77A 4GKJF 2H48B 1CSJA 4PXBA 3DRPB 3P5BP 3MEDB 2VC0A 4WBFA 2W9CA 5KFZA 2CPDA 3ENWA 5J2QB 3R1LA 3DLJA 5F9LA 1VC0A 2CQHA 3VGUA 4HL9A 2M0GB 2P5VA 4ILMA 3R8YA 1IVZA 1IKXA 4KQZA 2HAIA 3ISNC 4DU7A 3PFEA 2R2SA 4HDGA 1SJRA 2HZVA 5LT5A 2OHDA 3RRGA 3GJRB 2E1RA 2BJ7A 2B4VA 1R8BA 3T1HF 1XMQF 2VL1A 9ATCB 3KG0A 2ROGA 2ZUAA 3CVKA 4ZVUB 4NLQA 1HKAA 5IOLA 4M5KA 4LBHA 2DGUA 4OYAA 3LOUA 3CCRS 4DPOA 3CC2S 1TL7A 4ETZA 2GZOA 4LFAJ 1TZ0A 4PR6A 3NS5A 5HQ8A 4K5SA 2UUBF 4Q2MA 1S48A 2G1DA 1EIYB 3X1LB 3LUYA 3LALA 4H4KA 1NDKA 2YKQA 5E3RA 1V5VA 3NGDA 1UW4A 1FRMA 2DRBA 4BBYA 2J8AA 3BGRA 2B6AB 2GVDA 5T7LB 3WQPA 3G71S 5HO4A 2FZCB 3K2YA 4V1Ak 1ZH5A 3OHBA 3DI6A 3MR2A 3I4PA 2KG0A 3W3SA 3EZ5A 2V4JB 1M90T 2K1RB 4H4MA 3FRZA 2YXLA 4U9RA 3HP6A 3CD0A 2E7VA 4UOFA 5IM0A 4IG3B 2LVWA 3GYXB 4OX9J 5EWGA 1Y4ZB 4B9MA 1RT1A 5DLGA 1TL5A 3H5SA 1F3VA 4I2PA 2MLXA 1SKUB 2A3JA 2L48A 1CJKB 1H6KX 1D9DA 4K0KF 4C9DA 5HVFA 3Q22A 2GHPA 2D3ZA 2X3DA 3FUYA 3SIPB 2KXFA 5K8MA 1AB8A 1AUSL 4CLYA 2BW7A 1SVDA 3IAS9 3JTNA 1M5OC 2AEFA 5A8RB 1D8YA 1SQEA 3HFVA 2D74B 2RH3A 1S1WA 3SSSA 4L72B 3Q86A 1TKXA 5K14B 3D1OA 2O01C 2C1EB 1YVFA 2QL5B 1OS5A 4HEA9 1IBKJ 2KFZA 2Q1LA 3I9V9 3KNAA 1TVRB 1CLFA 3KJNB 4LREA 3G86A 1XR7A 4KO0A 4DZDA 3PEJA 3PX6A 4CT8A 3KWMA 2VBWA 3GQCA 3CB4A 3TUPA 3AXKA 3QT7A 1EQMA 3HD1A 1WC6A 4G1PA 4GRSA 3VGSA 2YY3A 2DIUA 1U0SA 1ZM3A 2ATLA 3I5BA 4QIGA 3PM9A 1QSLA 3R1HA 1Q1KA 4USVA 4IO1A 2Y1RI 3WC2A 5HN0A 4X4SA 4ELVA 1CJVB 1FKPB 4G1QA 3G6XA 2DNRA 1VQSA 1NDCA 3PYFA 1VQ7S 2JVOA 4PG7A 1SJQA 1VBZA 1H7XA 2IM0A 4ZVRB 1RGVA 2Z56B 1RB0A 4PG8A 3VGTA 1IJEB 2RF2A 3KJFB 1BHNA 5BXIA 4OJ1A 3T9ZA 4GKKJ 3BKTA 2C3PA 2LQJA 3I5AA 1WNEA 3Q0AA 4G1QB 5A6WA 3NBPA 2RDDA 2VICA 3LP2A 2MXYA 1YJVA 3I6PA 4DZ6A 2W9BA 1BE4A 4LIRA 3I5CA 4V19X 3ZNJ1 4ZPAA 2E29A 2W2OP 1ITPA 3CWJA 3I87A 5IV3A 3PCOB 3PDNA 1KTQA 1VQOS 4B3RF 2F5GA 2H5JB 2HK2A 1UFWA 1R0AB 2D9PA 3CMQA 1S59A 4L74A 4RW8B 2W9BB 3FCHA 2MKJA 2WHOA 4NI2A 1NB2A 3B4DA 3F41A 4Y2CA 1RAAB 4PQUA 2P8IA 4CTAA 4DJBA 1SXLA 1LFWA 2JHEA 1ZAVA 1WORA 1U49A 2LU2A 4OI0A 4YUDA 3EYZA 3EDQB 2D3O1 3CJKA 1CULB 3GSIA 1HI0P 3SQGA 9RUBA 4DCPB 2KO1A 3I55S 1NHVA 2Z8QA 2HHSA 2CQ0A 2XY7A 1KDNA 1UVMA 2ZWPA 2CZ4A 1HLWA 5HK4A 1QUPA 4QYZJ 1KONA 2HPUA 2ZVSA 1FWKA 3NNAA 3I0RA 4X65J 3MGJA 4QU7A 3T1HJ 1GEHA 1JLAA 2FZGB 1RTHB 5E33A 4OHXA 2AU0A 3DLEB 1TTHB 3MEGA 3N01A 2GO9A 1LW2A 2E5HA 1FKOA 1R6YA 3R97A 4WZQA 4YY3J 1P6TA 2UUBJ 1S49A 4F3MA 3MDFA 2PGCA 1FNXH 1HBNA 3FKBA 1RI7A 3HHLA 4Q7AA 3RBZA 2QMUB 1HPZA 1XNQJ 4DFMA 1B7FA 3MEGB 3KMQA 2V0NA 3FNNA 4RBVA 5BYSA 1WJ9A 5GMKa 3KHLA 1SL0A 1J5EF 1IKVA 3BGUA 4M5GA 1RHMB 4JI5F 2HS0A 2K8GA 1NLKL 3DDKA 3L09A 2O66A 3H5XA 4EU0A 4F04B 1EKRA 1FX2A 4DPXA 1KWMA 4I0WA 4M5HA 4NRUA 1RAOA 4NMLA 2HSEB 2IJRA 2MZRA 2AYGA 4DUYJ 2EVZA 2HHHF 2CJKA 5KFSA 1H0HB 1RAEB 1FTCA 1IKVB 2Y0SD 4PG5A 1ICEB 2BA9A 2NXEA 1Q53A 5KFJA 2VQFJ 4KR0B 3PW4A 5KFYA 1U0HA 3M2VB 4F8RA 4CRJA 2N4CA 2YQ0A 2M88A 1X5TA 3QT6A 3ZNUA 1AZSB 1N56A 4J9SA 1YSJA 1SJFA 1OIAA 2YH0A 3LP1B 3AOCA 2HNYA 1U2RA 1VQ4S 5D3GB 5IQ6A 3J7Z5 1U0HB 3J7ZT 3EZOA 3KJQB 3QSIA 2FYXA 2G4BA 3H4BA 3TO8A 1IUJA 1FVQA 3KG4A 1HNIA 3DKDA 3US5A 1TUWA 1K9MT 4DL7A 4MIAA 4RZRA 2VD3A 1XMBA 3KLEA 3RGIA 1WEZA 2HFUA 2FY1A 5EN1A 1TL1B 4ILRA 2CQ2A 1SL2A 3B6BA 2ASLA 1YBTA 4WP8A 3CPWR 5LMNJ 4XDDA 1U2CA 2GVZA 2RU9A 3WBZA 3LWLA 2VDIA 4NLXA 2JEJA 4LF9J 5ETSA 1PSDA 3RAMA 2ATCB 3H98A 3LWMA 4B3OB 5GMDA 4WU2A 3V81A 1U45A 1KLNA 2NXJA 3LPEA 1N33J 5I4MA 4MAKA 3CIZA 4FNHA 1DLOB 4M63A 1X4FA 4WK3A 1BQNA 3THPA 1EJ7L 5DRKA 2ZM6F 4MTPA 4DFPA 2JOQA 5AJ3F 1TMJA 3UNGC 3MHYA 1FNOA 1SBRA 3N5BA 1FWLA 2HWIA 4KTQA 2IMWP 1GXUA 1C4AA 2ZH9A 2PI4A 3DGVA 2PN6A 1RHUB 1UJ4A 2QYCA 1NPKA 1GK8A 2ALZA 4FYDA 1GTEA 4ZVSB 2EFOA 3KK3B 4B3RJ 1X4CA 1ZM2A 5SUHA 2XYPB 5FDLB 1WACA 2LMIA 3MUVP 1RACB 4MYTA 5BYRA 3NKYA 3FEXB 3LA0A 4F0KA 3K17A 2F4VF 1VGYA 5MAOA 4F4ZA 2WW4A 2JWNA 4EBCA 3C14A 2DT9A 2X7IA 4K4XA 4NCBA 1DQAA 4Z7CA 2WOMB 2ALYB 1RADB 1TR0A 3H8YA 2Z2LA 2ZH3A 4DR4F 2AGOA 4C97A 1NXIA 4N8NA 4L76A 3UD5A 3JAMU 4X4TA 1HHSA 3O1LA 2G13A 1TMMA 2XSJA 2JLGA 2D69A 4EEYA 1HBMB 4YMEA 3BDEA 3D4JA 1PJ5A 1F2GA 4DQIA 2BKNA 3KG1A 2C2OB 3DXBA 2B5JB 3RRKA 1RT2B 2FY8A 4C8NA 1T03A 2BANA 4LF6F 4UW2A 1LWCA 3QSYB 3JSMA 4NRTA 2AJ0A 4BC7A 2IIHA 4ECXA 1I5OB 4LQ3A 4ZA1A 3ADAC 4C4WA 2Z4PA 4ED8A 3TARA 3OBIA 5KFWA 1VIOA 3FMBA 3BH7B 2B9WA 4KJIA 3JSMB 2YKOA 2ZOFA 4ZLPA 4PPDA 5HI7A 2GGPB 2YWKA 4CH1A 1S6PB 2V67A 4X64F 4RNNA 1UWAA 3HVTA 2W25A 2I5JB 3TUJC 4QJVA 3H2LA 1H38A 1K1QA 2JX2A 2WONA 2APOA 3DGPA 5KFQA 4B3SJ 4JI6F 1SIWB 1RBAA 3BS9A 4L75A 1WEXA 4HT7A 4KGKA 5E41A 4MK9A 3HZEA 2MSSA 3PFOA 3E8OA 3RB3A 2ZHAA 3FZ2A 2ZBRA 3MEEA 4B9SA 3T5HA 4P71A 2DH8A 1SH0A 3AD8C 3NP5A 4YFUA 1QVFR 2EW9A 4PXCA 4ZVQB 1T0TV 3UWTA 2YNFA 2HLUA 1LWXA 2R7WA 4DX8H 3BN7A 4FP9A 4ZPBA 3KHHA 4LRCA 1S97A 1NMEB 2LEBA 1PCAA 3FSYA 1VRUA 4Z7YA 2EC0A 5MLCV 3C15B 4P10A 4ES3A 4KSEB 4CO5A 5GAHU 1B7YB 3BQ0A 4XIUA 2RJZA 3MCMA 3TAMA 2AMCB 4XAKA 4CLUA 2DB1A 4QWBA 4TVAB 1AFJA 1VR6A 5J2PA 2ZFHA 4DV4F 2ZHOA 1Z4UA 5D6GA 3NMAA 1APSA 4DSFA 2YKMA 1PGZA 4Q5VA 5IT0A 3OFFA 2OSQA 2Y1IA 2F3JA 1GTHA 4ICLA 2N3OA 5FJ4A 1JLEA 3N4WA 1EARA 2OPSB 5DDPC 5EDWA 4U67Q 2RD5C 3SZ2A 2PA3A 2J9CA 4RWWA 3K89A 2V9WA 2UXBF 3T6BA 4URQU 1X5PA 3D9BA 4NYZA 3C16B 4Q43A 2H1YA 1KOHA 4RW9A 3GV8B 3W5ZA 4XDCA 2BYCA 3OR2A 5K20B 3MR6A 4NZ0A 2XYGB 3L95X 1FEHA 3BGFA 5G4DA 1W25A 1Q7LB 3HD2A 3Q8QB 4C0HA 3THTA 3RB0A 3KLIA 4P74A 2BMBA 2VBZA 1VOMA 4OYBA 2GNKA 1C1CB 2C22A 4NA1A 1XIQA 2ZM6J 3MECB 4DV3J 1KOOA 5AJ3J 2NUHA 1FRKA 3CC4S 5KG5A 2BE9B 3TZYA 3W64A 1GMWD 5L46A 3MM6B 3I31A 5J1PA 2VJUA 4FYWB 3VF0B 2MQPA 4WKYA 1LKZA 1Z2ZA 3W9JA 1L5UA 2MHEA 3CJRA 3HFKA 3EMTA 1S7IA 1JLCB 1NPPA 4KGXB 3HO1A 1HYSB 5G0RA 1JNZB 3TZWA 2CNKB 2FVPA 3AHPA 5H9FJ 1HNZJ 1RA6A 3PYGA 3GR0A 1Y00A 3C6UA 4QWAA 4NLRA 2KFYA 3WZ0A 1T05A 3WX4A 4J90A 1RTDB 2RUGA 4ELTA 3T1YF 2XHCA 2OPQB 2HBZB 2DR8A 1J5OA 2QTWA 3Q8PB 3CJ2A 2WB4A 2YPZA 1ZS6A 4UQTA 1SUQA 4AYBD 3HHDA 4ZMMA 4O44B 2AT1B 4ILLA 1F5AA 4K50A 4CLTA 4NCAA 4DV6F 4CH0S 1K47A 1OPIA 2V2QA 3GG1A 4OX8A 3QIPA 4J91A 2VUGA 2VJVA 4D3GA 3FSIA 1ROFA 4LF6J 1NHUA 4RU9A 1E6VB 4MYUA 3AB4B 4XPEA 2AGQA 2XLKA 1VBKA 2DPJA 3PW7A 4DR7F 5D15A 1P9QC 2MY8A 1XTZA 3HSGA 1M1GA 3OLBA 5GADU 4IH6A 1OSCA 5F8NA 5THWA 4R5PB 5I42A 1JIHA 1T9WA 2KB2A 5D4OA 3MAAA 3CEDA 3S1TA 2WK4A 3Q8SB 1KVJA 4X64J 5I3UA 2DK2A 2CQPA 4RBTA 1WC1A 5ITHA 4ID8A 5A0YA 4OV1A 5B0EA 3QZ7A 3L3CA 4K4TA 4MKBA 4JV0A 3C2PA 4DPTA 2XS5A 3RW6A 2J6SA 1O0PA 2I1RA 2W2QP 2CG8A 2ZZNA 1BGXT 3Q8YA 5GAHI 2ZC3A 2OP5A 3M9MB 2LEAA 2C2DA 5E0OA 2DH9A 1Q5VA 3KLHA 1NK6A 5DJBA 3A8IA 3OV7A 1KD1T 1NBEB 3FBBA 2KG1A 3J81j 5K5MA 5IWAF 4ALZA 3L9ZA 3A13A 3IM8A 4L73A 3W8PA 4CYUB 3IP0A 3R6GB 2B4OA 3PR5B 4Y2KA 5KT5A 3MMAA 3S6EA 2ZJQQ 4HI2A 1QY7A 2VU5A 2Y9HA 3K57A 5CXTA 3MM9B 1HNXJ 3WHIA 2PMWA 2Z2YB 2N82B 4OQJA 3PX0A 1RT7B 3IS9B 3GIRA 1ZPWX 2RRNA 4O3SA 1RT3B 3KTQA 4MIWA 2AEMA 4P75A 2CJYB 3V6JA 2ZD1B 4DV5J 2RAQA 5KFNA 3G2XA 5LJ3Y 2GQ2A 4ZLLA 1WHYA 2FD2A 1FJGJ 4CO1A 2FC9A 1JLBB 3NWGA 2VG7B 3TVYA 2AX1A 4ZP8A 3M1VB 4J5OA 3AOBA 4LUBA 4ZCMA 3EGZA 2LQ9A 1G3OA 4KHMA 1OY6A 1S9FA 5C2GA 3LGNA 3D0IE 4HR2A 4I56A 2DNPA 5LMUJ 1FEEA 3K5MA 2J76E 1KC8T 5AE3A 2IAJA 2XMJA 4NEYA 2CFXA 5KFBA 1L3VA 4Q2LA 3Q8VA 4BC9A 2AYEA 1EP4B 2QYGA 4I64A 3QRRA 2W4PA 3PJXA 4O3QA 5AXMA 2E7WA 3R5JB 4LF5J 5H1SV 5M2RA 3GIKA 4I4BA 4AD6A 2FQQB 1G7CB 1U7LA 1SQFA 2CIMA 2Y1JA 3K5OA 2MQ8A 2V8GA 2IC3B 2D1CA 1O5JA 3QLHB 3HPOA 2Q43A 4J9LA 4UF4A 3BYPA 2LU1A 1HNWF 5EUHA 4F4KA 4X66F 4WXOA 1FXLA 1TK8A 4WPAA 2V68A 4IO9Q 1WEYA 1U4BA 4LF1A 3BO3A 4KRWA 3VAKA 1RT6A 3MR5A 1SQGA 2O5DA 3OXLA 3OVBA 1DTQB 4O3OA 1RT5B 1FCAA 3CJ0A 4F4AA 4ED4A 2AJ1A 3FFIB 4OFZA 2R7UA 4B3MF 2DGSA 3QIDA 1KLMA 3W62A 3GIIA 1S0VA 2DXFA 4F7VA 4YN3B 2BE2B 4ZDNA 4CM0A 2DRAA 5F8LA 5HBMA 2M2BA 4DV6J 4EBDA 1VS3A 4NL5A 4P52A 1RWOB 2KT5A 3R2DJ 4F2SA 3OVAA 3D6TB 2RDJA 3U02A 1RHRB 2Q6BA 2B51A 1U48A 4K7QA 5DDOC 5A8WB 2FGOA 2E5JA 3AFGA 4KV8B 5HBMB 3H7HB 4F3OA 3JSYA 2ZWOA 4NLOA 4DR7J 1PYOB 2CADA 3Q83A 2CRLA 4YR0A 3BO4A 1RZMA 2J7WA 2CWKA 4I1TA 1P8GA 1S72S 1FRIA 1IM6A 2MQMA 3BQ1A 4JYAJ 3QRQA 1XBWA 3EPGA 2OPRA 1U02A 1ZPVA 4AL5A 3MEKA 5KFPA 3DOLB 3UE2A 2XMVA 1HD0A 1YJ9S 1NSAA 2W8LA 3E51A 4F4WA 1TL3A 2VIHA 2EFPA 1MG7A 2ZNZA 2QLJB 5B7WA 2J6TA 3IAM9 5CYMA 3MM8A 4JI2F 3MM5B 3SCLE 1KRPA 2HQ3A 2XNRA 3H0PA 4FVCA 4HTIA 2DGVA 1XEZA 5C42A 1O8BA 5KFIA 4ED7A 3IBWA 2DRDA 3E01A 2AJFE 2MQOA 3L7UA 6FDRA 2JVRA 1RYRA 1LWFA 4O3NA 3OXGA 2DIVA 4RO0A 1REGX 2DGTA 1WTBA 4YB5A 3S8SA 2B7CB 3AQPA 1X4HA 3CMAS 4JV1A 1VLOA 1S1TB 3OTCA 5IWAJ 2K3IA 1PBUA 4NX9A 2BQUA 4RW7A 4NOHA 2OEMA 3L7OA 1D1UA 3EICA 1LWFB 3OL8A 4KPCA 5AE2A 3AD9C 3QQCD 3MPUB 3GZ7A 4F4XA 3PR4A 3IG1A 5KFTA 3VV2B 4PWDA 2GA7A 2JLEA 5F8HA 2MGZA 4WE1B 3O3LA 3QAUA 1G4CA 3BH6B 5AT1B 8RUCA 1XK8A 3RUBL 2KM8C 3MOZA 4OHYA 3MM7A 2NXUA 4JV2A 2HG4A 3O6QA 1JLGA 1FFGB 1IBLJ 3RAXA 5E5NA 3GWCA 3MZIA 3IBCB 3PJ9A 5E7OB 3RJMB 4OZ1A 3EGNA 4U7UK 3G4SS 4NXNF 4Q0BA 5B0AA 3DLKA 3D6FB 1S12A 3P5TL 4DX5A 2BJ3A 3GJSB 4OZ3A 3CJ4A 2AZ1A 2HRTA 2DCLA 3OL9A 5FIIA 2HRUA 3SFGA 1FX4A 1UP1A 2DNYA 1RAIB 2YKAA 5C25A 2OTJS 1MMLA 4DG1B 5KFCA 3DYAA 5DQHA 5E3CA 3M30B 3VZHA 1GFWB 4O4GA 3MMCA 2X1FA 3MMBA 1WF1A 3AJ1A 3N79A 2QT7A 4XTTA 3W2WB 1YRUA 2XEXA 3ITHB 5B0DA 4LRFA 4QU6A 1U1QA 1MWYA 2IDLA 4JI8F 1IBMJ 2HHWA 3DYAB 2KXHA 3ULHA 2OELA 4KT0C 5KOXA 3KK1B 1RSCA 4KHPF 3GMGA 4R0EA 2UXCF 2QIFA 5CD4A 3DM2B 2XGQA 3KUHA 1TKDA 4OZ2A 1FNMA 3PXGa 3H42A 5E3QA 3BYRA 3T1AA 2HVIA 1JLQA 2AV5A 1T11A 4LF8F 1OJ4A 2XO7A 4Q8EA 4ID5B 5KFRA 1WHXA 5KG7A 2B4PA 3GIJA 1KN6A 3EJMA 2QGFB 1LEOA 3K59A 1CS4B 2YH1A 1JJHA 4LFBF 3TJAA 4D3HA 3PO4A 3RZAA 4JI0J 1QE1B 2V9KA 1Q78A 1EETB 3KDNA 3UVJB 4HHHA 2ZH7A 3W60A 1HQEA 5J2NB 2RU3A 1U1PA 2IM1A 2NXNA 4URGA 3HXMA 2F63A 1YRTA 1F6TA 3RRHA 1SV5B 2CPFA 2RVJA 5C2CA 1HBOB 4JI4F 3L4BC 1CJUB 1FRLA 1HQEB 2R4FA 4DPUA 1S9EB 2MKKA 4ZJOA 1HR0F 3HJVA 4BWMA 1F3FA 5IFMA 4I2QA 3H40A 5KT6A 2V8HA 4ES2A 2C2ZB 5EGYA 3KK2B 4J37A 5B0CA 4EGLA 4B9VA 4FBUA 4DUZF 4CDIA 3ENQA 4IFVB 5ETKA 3TVKA 1BMQB 2ZC4A 4LMZA 3GTYX 2OLWA 3CGIA 3TZZA 2N7CA 4LR7A 4I2QB 1A7GE 4RL1A 3HX9A 1HBUB 2QE5A 1NUEA 1U6BA 4DR2J 3QT5A 3RB4A 4M1KA 1LOUA 2A18A 4NYOA 2HQIA 2YNGB 2LQBA 2JNJA 2VBYA 2E5GA 3AD7C 1FD2A 3M8PA 1WSVA 2RB7A 3RBXA 4A8YA 2HQCA 3OTOJ 4FYYB 2FPHX 2R2UA 4B02A 3DRXA 1OSDA 2YKPA 2BQ3A 2YBVA 1FDNA 2G0CA 1I1GA 3MUTP 1WHVA 1JK9B 4U7CA 2PIIA 2R7SA 1GX6A 2HGLA 2DCUB 1FXDA 2MKIA 2HWTA 3MCNA 4RW6B 2I2YA 2YNHA 1WOOA 4DQQA 2XZDB 2UUAF 1S1XB 1H3DA 2C2KB 2PFDA 3NCPA 2VFRA 4A46A 1YITS 1ZA1B 4OI1A 3BKFA 1QAJA 3Q2TC 3W65A 1BWVA 1PILA 1WF0A 4LSLA 2F65A 3HHKA 1X7VA 4NLVA 3VQSA 4DR6F 1N88A 5HP1B 1K0VA 6AT1B 2XQCA 3SV4A 4N41A 2HMIB 2H54B 3C6TA 4CP5A 3CJ5A 3A3OB 1NO8A 1N52B 2W8KA 1TU0B 2R9LA 3ZXWA 2A6OA 2VG5A 4NLGA 3NCQA 4KH0B 4MK8A 3A1YG 2HVEA 2BZ2A 1N36J 5CH7B 2RKIA 3J81U 4J9NA 2H51B 4DMZA 4USJC 4DS4A 3P8BB 3AB2B 2JEFA 3TZXA 1WC0A 3CCSS 2R8KA 3TUIC 1WC3A 3PHTA 1LW0B 4RNFA 4RUHA 1RWVB 3W9IA 1RAJA 5KFVA 3BSNA 1QAYA 1PC5A 1VI7A 2M8HA 3PJWA 3TRGA 4IH5A 1J27A 5M2UA 3C3LA 1T94A 1VRTA 4RJVA 2A2CA 4GO5X 1JQGA 3N6NA 2MEWA 4GC6A 1X9WA 1IKWB 4OI3A 4RNMA 2IVYA 5DLFA 1HW9A 4PG4A 1AUDA 5DDRC 1LXJA 1VK3A 1FO1A 1K1SA 4U6PA 3ZZTA 5A8KB 1QLNA 4USHA 4JI8J 2CJXB 5HROA 2KHCA 3MURP 2MKCA 3IRXB 4J7CA 3Q8UA 2IYGA 1C1BA 4DFJA 3SDEB 2DHSA 3HT3A 1JJ2R 1YJNS 2C3UA 3J7AN 2FB0A 2W7AA 2VFUA 1FJ7A 1NJYA 3GFZA 3PTWA 3PY8A 1JJCB 5CYQA 5LXRA 1VDHA 5D4PA 4FXWA 4WP3A 4F02A 3KLFA 1UVKA 3J80Y 1RT4B 1NZAA 3G8QA 3DNCA 1HQUA 2XBPA 4IKAA 1TV6B 3UDLA 3WIUA 1UPMB 1LK5A 4C0OC 4KPYA 3R5BA 1H72C 2AEJA 4LFBJ 5DO2A 2H65B 3LGMA 1WDDA 4MFBB 5L39A 4KH1B 1RWUA 2GJ2A 1S9GA 1WC4A 4IG0A 5HLFB 3CJQA 4CLFA 1VFJA 2CKWA 2HFSA 4FXVA 2VG6B 1UTAA 3IFEA 4ETXA 1RCOB 3IM9A 1RUSA 2YKNA 4C3LA 3P4UB 4JI1J 4KFBA 4ZOSA 3EDRB 1YI2S 3M2UB 3D0HE 2Q6CA 4FNIA 1JB0C 4H4KC 3OFEA 1GH8A 1U1MA 2CNNB 4B08A 2RNEA 3NG8A 5J2MB 2VPWB 1BD6A 1AXQA 3FGVA 4QW8A 1SL1A 1HR0J 2Z30B 4EUVA 2RRBA 3TX8A 2JEGA 3VZIA 5ETPA 4KFBB 4ZPTR 4RKUC 2GMJA 4YHHJ 3AA8A 1HNVB 5DZ7A 4DWIA 1C0UA 4JI7J 3V6DA 3T5JA 2YQ3A 3A4TA 1XC9A 4LF4J 3OUYB 2ILZA 1U6FA 1AROP 4Q44A 1IR2A 4GVBB 3C19A 1N5YB 1D9FA 4JI3F 4GMKA 4X4RA 3VVUA 4ZPWR 1OWXA 4PQAA 1DZ5A 1I3OB 2B8QA 3QGIA 3M6VA 2M5YA 3R2CJ 1JLFB 3MAHA 4DV0F 1MMNA 3DOMB 1HW8A 3A3PB 1DQ9A 2Z2ZA 3FQKA 1F5BA 2HFZA 1HWIA 1YLXA 2ZDOA 3G6VA 2C42A 2E9TA 4YEAA 1M5SA 5ETLA 5DDQC 4X4VA 3UN2A 3PO5A 3AA9A 3V4IA 4TU9A 2Q3PA 4OZNA 1TELA 1WOSA 4USKA 1NKCA 1ZBTA 5KTQA 2OIHA 3CTRA 4GO7X 3OJUA 4IOCQ 2CQGA 4QQBA 3RBDA 5D4LA 5DM7Q 2C3OA 2DBBA 1BXNA 5KT7A 1X4DA 4DL0C 2LXIA 3E2EA 2CNOB 3OTDA 4IQXA 4M5LA 4IOBA 3DOKB 2HWHA 3IXQA 4ZPCA 3VWSA 3W63A 4N7TA 1X4BA 3MOJB 1LXNA 2HIYA 2EI5A 5L9NA 2GV1A 4U96A 3QO9A 8ATCB 3UPFA 1IKYA 4WFBQ 3W2VB 2RQKA 3IRWP 4WK1A 5KFEA 4WKRA 7FD1A 3IMQJ 3OW2R 2W2NP 2ZVIA 4URSA 3UD4P 3ET6A 4BS2A 1RTJA 4DV1J 3V2UC 1BQMB 2MKYA 3JS9A 1HHTP 1Q8KA 1WUUA 4WU3A 4ZHRA 3DLGB 5M2PA 3FCWA 3S7RA 1RQ0A 2LA6A 3LAKA 3I0SB 3NAHA 5DM6Q 3DRPA 1X31C 2V69A 3PW5A 3M9OB 4UUXA 1RTJB 3MEDA 3UCGA 1JX4A 1T8EA 4OYWA 1ELOA 1LK7A 5J2QA 2HZAA 2K7JA 5D0EA 2E9ZA 4A8XA 2F9JA 2DHHA 4MT1A 2CJAA 2ZBPA 1REVA 3JSBA 5K8NA 3IWXA 3SQOP 3HHLD 4IFYB 4PAAA 3HSZA 4FBTA 2HURA 4E8UA 4OLOA 3W5XA 1R8AA 3F73A 1N32J 3BO2A 1UVIA 2FJDB 1NRKA 1NK9A 1ZTTA 2VQEJ 3RAQA 4C11B 3HT0A 1FE4A 2YNIB 1REVB 3PHEA 2KFNA 1MU2B 1VQ8S 1RWPB 1QDUB 5KFKA 4YR2A 4W92B 2UV8A 1NSKL 1X0FA 2JC1A 2EWHA 4ENOA 2CPXA 5EWEA 1UA1A 2ABYA 1QTMA 2H4YB 2B8PA 3RR8A 2XLJA 2QN6B 2W2PP 3DMJB 5BJRA 2RE1A 1NHKL 4LIWA 3MAQA 2UU9J 3FDSA 3KMSA 1TUGB 2B6AA 5T7LA 4C8KA 3QNWB 3K8WA 3RB6A 1D8ZA 3KLVA 1S1UB 3M8SA 2XTJP 2KL8A 4TY8B 3W7BA 1RBOB 2MQQA 4FF3A 2MYFA 4DR1J 2BOPA 2MQNA 1OPZA 2V4JA 2K1RA 4W98A 2KVQE 2OEJA 2HRYA 5KT2A 3VAGA 3HHLC 2WZ1A 4IG3A 3OLAA 4DX7A 3M6UA 1S4EA 3G82B 1WKJA 1QJHA 1CJKA 4QYZK 1UFKA 5D0RA 1X9MA 3D3CJ 2G2YA 1WG1A 3UDCA 1U09A 3ILLA 5T41A 2PEHA 2OMOA 1HIYA 5HANA 5A8RA 4OYXA 1XR5A 3A8EA 2H3EB 5L1IA 3D67A 4ECYA 5KG3A 1NCLA 3GLJA 3KUGA 4JB8B 1TKTA 5K14A 3KNGA 4FKXA 3M8QB 3DDIA 2FLPA 2XNQA 2JL9A 5JUMA 1DAXA 2OPPB 3SSQA 3POTB 1TVRA 3PYDA 2KJVA 1HWKA 3H2VE 4B9LA 3TAPA 3BSOA 2CDRB 1NPRA 2EFGA 1WELA 4RR5A 1KNZA 1TKTB 4QIWD 5ADZA 2I0XA 4YB6A 1R3NA 3R9LA 1NJIT 2AKWB 4RUCA 3GILA 1S6OA 4HHJA 3M9NB 1XQIA 3W9HA 3EPIA 2VA2A 1VHFA 3CCVS 5L38A 3D2WA 1UJ6A 2R7QA 2CQ1A 5GAGU 2V2ZA 4TNOA 1KTVA 4DV7F 2P2CB 2E5LF 3M7VA 5L1LA 4LF7J 3D6MB 2GQCA 1CJVA 5KFLA 1FKPA 2CZVC 1U1NA 2HIQA 4DV2J 1NK7A 1NK5A 4Y28C 3QMQA 4K4UA 1LFPA 1S0NA 1VK8A 1NSPA 2P9GA 5ETVA 4Y2AA 3GCXP 2EEYA 2CVIA 2MZSA 4LFCJ 1WG5A 4YOEA 3IGVA 3NMRA 1RAGB 1WG4A 1N4LA 3IWNC 2DXEA 1FXRA 4X4NA 4DR3J 1S1VB 4QPTA 2IA6A 1NH7A 1O51A 3KLGA 4J9RA 1RWMB 5HVHA 3LO3A 3SYZA 4PEOA 2CJ9A 2PE8A 3FQLA 1TKZB 2PD1A 4C6AA 1R43A 4ZN3A 2MQLA 4NLTA 1MNEA 2YVSA 7FDRA 4HT5A 2FVCA 3CDBA 3OSNA 3KOAA 1R0AA 4ED3A 2XM3A 4RW8A 3DLLQ 4ANCA 3RYLA 3KLGB 2AYMA 2HW3A 4PWWA 3T19A 5BR8J 4IOAQ 2OAUA 1H7WA 3CNQP 5ETMA 1F9EB 4X62F 4HACB 3NL0A 4OZJA 1JWWA 2EKNA 3DHWC 1CULA 2L3MA 2MLZA 1DURA 3A8KA 4GKJJ 3G6ES 4CO0A 3DCAA 3MCOA 2XMUA 1CJTB 2DHAA 5LL6d 3GONA 2QLBB 5J1EB 2IMOA 2OFHX 3UN5A 3CF5Q 4WXWA 3GR1A 1YIJS 5F8GA 1N6QA 1WF2A 2DH7A 1NK8A 2COLA 1RTHA 2UUTA 5C24A 5JMNA 2F4FA 3DLEA 1X4EA 1DTTA 2GCFA 4RBUA 4DSLA 4HLBA 2LLZA 1S6QB 2VH7A 1HWUA 4AQYF 1VQNS 4Y34A 1N6QB 5KG4A 1XMQJ 1OMSA 4K4SA 4AL7A 2ACYA 2LA4A 3R27A 5KFHA 5C24B 1PO6A 2KU7A 1DTTB 3SEOA 2V34A 1YZ6A 3JTOA 2R8IA 2XYHB 5B08A 5I3QA 1VMBA 1TFWA 1VQPS 4FKYA 1BUXA 2HYIB 4FZVA 4ECRA 1Q81T 1M1KT 1YJWS 2B9EA 4U8YA 4WYLA 4WFZA 3HZGA 4Y0FA 3FSXA 2JFKA 1K73T 4M5DB 3FK4A 3OR1B 1S7HA 2RT3A 3LH2S 1IWGA 2Y0BB 2JLFA 3M2VA 1KR4A 3NNHA 1EB0A 3TI0A 1J2VA 5BYQA 2ZH1A 4GVLA 3EZUA 2RQCA 3M8YA 3KUEA 1AZSA 2KTQA 2L08A 4CLKA 2WAQD 1QSSA 1YG0A 3DDNA 5CABA 1VRQC 1YKWA 1U25A 1K0TA 4NPOA 3WIVA 3LP1A 1B99A 2QA4S 1AW0A 3QYYA 5D3GA 1CQNA 2CQIA 3OTBA 2MZJA 2XULA 1XMOF 2BJEA 1UMJA 4X4UA 3N0VA 1N5TA 4K0KJ 3LQVA 1KVKA 2D3OR 2KDOA 1BC6A 3DLHA 2N4DA 2G2OA 3QAEA 2W2MP 4JBCA 1FA0A 2KM8B 2XHWA 3R7BB 1Q5YA 2QX0A 5IS2A 2HQFA 1A6LA 2W24A 1LWEB 4ANDA 2ZE2B 1W26A 2CNLB 2RQMA 1S10A 2WSEC 1E6YB 5CA5A 1TL1A 4HTJA 3CD6S 3SV3A 4FXDA 2BOAA 1UVNA 3BR9A 4CIOA 4I68A 3UNYA 4MH8A 3W66A 4DV7J 4P2FA 1BLUA 3UFCX 3CDEA 4RUBA 3K5NA 3OFHA 1OO0B 4B3OA 1KFSA 3NWRA 3QT8A 4CLPA 3JYTB 4LR9A 4HDHA 2LP4A 3NAIA 1W2IA 1DLOA 3T5KA 5F8IA 1F2HA 1VQ6S 1YBUA 3NNCA 2FHMA 1ZM9A 1P1LA 4B17A 4WZMA 4TY9A 3KHGA 2PT0A 4E0DA 3EGVA 4ZIWA 4Y2IA 4QCLA 1PG5B 3VCDA 4X4QA 4IRKA 5CAAA 3U1NA 4R25A 2HNZB 1A9NB 2ROPA 5LXYA 4MKVA 2GAHC 2ZOMA 4Z37A 5KG0A 3KK3A 4YP3A 3KJVB 5FDLA 2G1HA 2V2KA 4FS1A 4QYRA 4ER8A 4LFAF 4A4JA 4NCGB 2RHQB 2DNZA 5K9FA 4IDKB 2RSQA 4TLQA 2BR0A 1V6HA 1U1LA 1EQ0A 4TLRA 4PXDA 1PAEX 1I6JA 4LSNB 3BPDA 2NREA 1PBAA 3QJJA 1B70B 1Y10A 2MKSA 4IUFA 4LVNP 3OXFA 2WOMA 1EKSA 5AXLA 2A2DA 2KZZA 4I67A 4KE5A 2C2NA 2ZZMA 4FDFA 3OL7A 1GT8A 3R5DA 3TA1A 5KFUA 1FDBA 1YZ7A 4L3NA 2F1FA 2O3DA 4M5JA 4AFFA 2NSCA 2B7BB 3R5AA 4DCJB 1HBMA 5D8HB 2ZNYA 4I7FB 3O5TB 4A47A 2B5JA 2DR9A 1RT2A 5LM7E 1B64A 1UWBB 2LDYA 4S0MA 1IQTA 2ERRA 3QFHA 5HL7Q 2AX0A 4K5RA 3ELHA 1OQ3A 2CA9A 4AQYJ 4W90B 1VQYA 1SKRA 1TQLA 1SH3A 4YB7A 2CWXA 1X60A 4K2XA 4J9UE 4IQMA 3D66A 4UZCA 1VIXA 2DO0A 2GGPA 1RU2A 1S6PA 2JFDA 5KT3A 2JDJA 4RLEA 3PIOQ 2I5JA 1RLCL 1VBYA 4OI6A 4TU7A 2FVQA 2HHTA 2ZKTA 2DEIA 3ZTOA 4CLWA 1UVLA 1VJQA 2BJ8A 3R5CA 3IR7B 3EGWB 1W2BR 1D0EA 2CXEA 1P9YA 4MJKA 1IJFB 2KZMA 4AE5A 3V5RA 3HSDA 1J5EJ 2YQ1A 2XC9A 4JI5J 2N7YA 3OD2A 3HK2A 4ECVA 2CJQA 4F0HA 4KY3A 3A12A 4FS2A 4ECSA 1WHWA 2HHHJ 5DS7A 2JEIA 1DJ0A 3H20A 4DLGA 1ZZNA 5JVHQ 2F8MA 2KRBA 4LRDA 1BWEA 2QJ3A 4O4RA 2GFFA 1Q4RA 3C15A 3TJ9A 4H54A 1NEEA 5KFMA 2FJEB 3JTPA 4K59A 2J6UA 4A8MP 2JRSA 1XMOJ 3BBCA 4EFAC 2DO4A 2C3YA 1SJ3P 1UEUA 2ZHBA 4DL3A 4Z2XA 2MJNA 5CYJA 4LBIA 3P6YC 4O23A 2PDAA 2WBRA 3ISND 1VISA 3CW2C 1WDTA 2M7SA 4F3QA 4UTGA 3BREA 2ZH8A 2HHXA 4OX6A 3UD3P 1UETA 5GMEA 4ECUA 1U2FA 1HMVB 3GJQB 1D09B 2OPSA 3UW1A 3X3UA 2WB1D 2IRYA 3DRRB 4EI2A 1CBKA 1YJUA 2EKYA 3BKUA 4JOUA 3M6XA 1F1BB 3C16A 1YRXA 2GQQA 2LQ8A 3CIMA 2SXLA 4WIIA 1URNA 3BSCA 4K8RA 1SI9A 2EG2A 4Y3CA 1S5ZA 5B0GA 1SJ4P 2QMXA 3GP9A 1YJ7A 5K8PA 4EBEA 4LJMA 1X5SA 3QJLA 1JXEA 4PUOB 2HFOA 1C1CA 3MF5A 5KAKA 2HBYB 3WX8A 1NH8A 2CUYA 5D0HA 5DGBA 2AYBA 2P6SA 2BRKA 3MECA 4O3PA 4NLYA 3SMZA 1IR1A 2B56A 2FUG9 3JB9k 4M94A 4RW4B 1T9XA 2BM1A 1V3RA 3V6HA 3EVWA 5SZTA 2VPXB 3MM6A 2BABA 6FD1A 4LQ9A 5ETQA 3D3BJ 4NLSA 4F67A 2HFNA 5KFXA 1ULRA 2QLXA 3CE8A 2W9CB 1FWPA 1ZTWA 4F4YA 4MKAA 1GXLA 5EWFA 3D1QA 4X65F 1Z1ZA 1IBCB 2PEBA 1BY9A 3D6HB 4NASA 4OYPA 4OI2A 2B9XA 1JLCA 2RMLA 2YTCA 4ZKAA 1FDDA 4WF9Q 2Y8WA 3MUMP 4EZ9A 2BE7D 4DF8A 1HYSA 2ASDA 4NZ7A 1IKXB 3TAQA 2W7PA 4OJHA 2QO3A 5DZ6A 1GX5A 4YY3F 1SPBP 1RAHB 1FF2A 3ZTQA 3RBEA 2CPJA 1C0TA 1T7PA 2BV3A 2M3DA 1RTDA 3TEGA 4J9MA 1S57A 2OPQA 4K2JA 1XNQF 3DFEA 3RTVA 4I69A 1ZZFA 5A6PA 2QL9B 1S99A 1PYSB 2JZ5A 1TL7B 2F40A 2K06A 4O44A 3CCWA 1KSPA 2F4VJ 1C0TB 3TEHB 1N8RT 4C8MA 2GO8A 2OTLS 1S0MA 3R6LB 1D3WA 4YDXA 2QEXS 3JQMA 5HQMA 4ZVPB 2ZJRQ 4DUYF 4FVMA 3B8HA 4DR4J 3BGRB 1E6VA 2GVDB 1WKKA 2QZ8A 2FHJD 1CC7A 2KJWA 4NA2A 3SSRA 1PJ7A 3W61A 2VQFF 2LDIA 4J9PA 4ZITA 1VJWA 3DI6B 2Z0GA 2QV6A 4O0NA 3N6MA 4H4MB 3CJTA 3TYTA 3VR1A 2KH9A 1UZDA 4R5PA 2XS2A 5HATA 4Y6IA 1RWWB 5IM0B 2N3LA 3GB0A 2MDAA 1RT1B 3OVSA 1UKUA 3PKMA 4I2PB 2VC1A 3JAMY 1RKIA 1K8AT 3TWZA 3FC9A 3QGGA 4CO2A 4USTA 4A8WA 4RWXA 4P2XA 1M5PC 4NA3A 2VV5A 2RDIA 1R6VA 1MN9A 2QMWA 4C2MA 4K4YA 3CD7A 2GC8A 4WWSA 4ED2A 1S1WB 4KGVB 2IHR1 5CZXA 4DFKA 4LRBA 1TKXB 2XI2A 2BBEA 4F26A 2E5IA 1TK0A 3SFUA 4JI6J 3I56S 1FJCA 3EXYA 3CDWA 4QBUA 2XWYA 2DR6A 3VAMA 4DL6A 1JJ4A 2MB0B 4C48A 3BBFA 1DQ8A 4LSZB 4KO0B 4PWUA 5LMNF 2ZH5A 3ICLA 2R2RA 3K7RA 4K4WA 4CYUA 1V9OA 4MKYA 3CCMS 4LF9F 2BRLA 4DN0A 2ASJA 4EYIB 4QZVB 4P72A 2OMLA 1N33F 3MM9A 1NJXA 2FC8A 4PKDB 1RT7A 3QPIA 3DC2A 3IS9A 4C8YA 4N5SA 2Z58B 3MD3A 1RT3A 2G0JA 2UVWA 2XG8A 5JXSA 1VCTA 4H4OA 4LT6A 2VBXA 2ZD1A 1FT8A 3QRPA 1R0BG 2MPUA 5DQIA 2C2MB 4DV4J 2ZBCA 1DHMA 3OQ2A 1ZOTA 2DHXA 2AIRB 3T9NA 2ZBIA 5I3PA 4WTYA 2V4QA 1YQHA 1JLBA 3PRVA 2RF2B 5DG7A 3TQ1A 2VG7A 3QGHA 2ZDPA 1HWLA 3LANA 1X0PA 3EWGA 3M1VA 2IJNA 3GV7B 4H4OB 2IBOA 3NBPB 4I6AA 3IR5B 3Q2SC 2FJBB 3OFGA 3LP2B 5KFOA 3SCJE 3M32A 2UXBJ 2QLFB 2XMAA
chains in the Genus database with same CATH topology
2CPEA 2UUCF 3PO5A 3AA9A 3V4IA 2VA3A 1K1QA 2JX2A 4OL8A 5IXUA 3CDAA 3VAIA 2WONA 2YX7A 2APOA 2B0GA 4JI1F 2RQ4A 4TU9A 2Q3PA 3DGPA 3UQSA 4OZNA 5KFQA 1NJWA 1FTRA 2CG4A 2NPIA 4JI6F 1SIWB 3BS9A 2H5EA 4BDPA 1WEXA 4CO4A 2KYZA 2ZJPQ 4NZ6A 3H5YA 1UEVA 4HT7A 5LSLA 4C0BA 4CO3A 4KGKA 4OHVA 3VTIA 1NKCA 5E41A 4MK9A 1ZBTA 1WTFA 3HDSA 5KTQA 3HZEA 1N54B 2MSSA 3CTRA 4GO7X 4DHVA 3OJUA 2OIHA 4IOCQ 2CQGA 3PFOA 3KKFA 3E8OA 1EP4A 2XLIA 3RB3A 4XO0A 2ZHAA 4KBIA 5KFDA 2WSCC 5GAEI 3M32B 4QQBA 3RBDA 2VFTA 3FZ2A 5D4LA 3ZZOA 5DM7Q 3MEEA 4B9SA 2C3OA 5CZVA 2DBBA 2AQ4A 3DHXA 2MZ1A 1JXLA 4EZ6A 4IH7A 3AH6A 5KT7A 1X4DA 3T5HA 1IR0A 5F0UA 2ZH4A 4DL0C 4ZPVR 4PQUB 2DH8A 1SH0A 3NP5A 2LXIA 4YFUA 1QVFR 4CTAB 3E2EA 2EW9A 1NKEA 1S6QA 4PXCA 3OTDA 2VKZG 4IQXA 3LP0A 3UWTA 2YNFA 2HLUA 4IOBA 4I6WA 4YHHF 3DOKB 2R7WA 4DX8H 3BN7A 2HWHA 3IXQA 3M05A 4ZPCA 3VWSA 4FP9A 5L1JA 1V3ZA 1X4BA 4JI7F 4ZPBA 2IC3A 3MOJB 3CJKB 3KHHA 1LXNA 2DGWA 3QLHA 4LF4F 2HNDA 4OX7A 1S97A 2LEBA 3FSYA 2D41A 2DNQA 2EI5A 4P7VA 3SQGB 1T95A 2XWXA 5L9NA 1VRUA 4QW9A 3Q24A 2EC0A 5MLCV 2GV1A 2L9DA 4ES3A 2GX8A 3QO9A 5GVQA 4KSEB 4CO5A 3PKYA 3QWPA 3UPFA 2NZ4A 5GAHU 3BQ0A 3MPVA 1IKYA 4WFBQ 3W2VB 1I94F 3MPYA 2RQKA 2DPIA 4XIUA 3IRWP 4ZP7A 2VFVA 4WK1A 3MFHA 3LP0B 2RJZA 3TAMA 5KFEA 1GQEA 4WKRA 4XAKA 1YGYA 2DB1A 4QWBA 3HJFA 1R8HA 7FD1A 1AFJA 4KKOA 3OW2R 5J2PA 3O2IA 3HHNB 3MI7X 2P9EA 5FD1A 2ZFHA 4DV4F 2ZHOA 4C3MA 2DNMA 1Z4UA 4URSA 5D6GA 2HNDB 3UD4P 5KFFA 3NMAA 4BS2A 1RTJA 3I0RB 1APSA 1CPZA 4A8QA 1Y0HA 1DTQA 4DSFA 1RT5A 3C66A 2YKMA 1JLAB 1F0XA 3V2UC 1BQMB 2XY5A 2ZOGA 1HWJA 1PGZA 4Q5VA 3FFIA 4GC7A 5EX0A 3N5FA 4XK8C 5IT0A 1HHTP 3OFFA 5T14A 2U1AA 2GJIA 4ECTA 2OSQA 2Y1IA 2F3JA 4WU3A 1GTHA 2I9SA 4ZHRA 3DLGB 4ICLA 4M5DA 2N3OA 5FJ4A 1KQSR 3D5MA 3NGKA 5M2PA 1JLEA 1LW2B 5L8RC 2R8GA 1Q8IA 3OR1A 1FKOB 2ZITA 2PMHA 4ZVFA 3MFIA 3N4WA 3S7RA 2BE2A 4ZVHA 2XY6A 1RQ0A 4KKOB 2LA6A 3ZFVA 3LAKA 3I0SB 1FDAA 1QSYA 3NAHA 2OPSB 2LECA 2LYVA 2E66A 1NU4A 2NLWA 5DDPC 5EDWA 3F56A 5DM6Q 3DRPA 4U67Q 3PV8A 1M5VC 2RD5C 2GIQA 2PA3A 4MK7A 3SZ2A 4PPZA 4B9NA 3VALA 2J9CA 4RWWA 3PW5A 3M9OB 2V9WA 4UUXA 2UXBF 3T6BA 3M8PB 1RTJB 1HBNB 1YJRA 3MEDA 4URQU 3UCGA 1X5PA 1JX4A 2KVIA 3HHLB 4NYZA 1T8EA 1ELOA 1LK7A 1HPZB 4Q43A 5J2QA 2K7JA 3DRYA 1KOHA 4RW9A 3GV8B 4B3SF 4FF2A 2E9ZA 4A8XA 3IA0A 4XDCA 2F9JA 1UA0A 3OHAA 2BYCA 2CJAA 3OR2A 5HMWA 3MR6A 1REVA 2CPIA 2VOOA 3JSBA 5K8NA 5L9XA 3IWXA 2UV8G 4NZ0A 2XS7A 5A8WA 5CHCB 3L95X 1U26A 1FEHA 3HHLD 1RISA 3IR6B 3BGFA 4IFYB 5G4DA 4KV8A 3C8YA 1KS2A 4FBTA 2BUNA 1P27B 1W25A 1NNDA 4E8UA 1Q7LB 1F5CA 4OLOA 5GADI 4DQRA 1ZETA 1R8AA 3P96A 3F73A 3J7YU 1S77D 3BO2A 3H5UA 1UVIA 2FJDB 3Q8QB 4C0HA 2A10A 3THTA 3RB0A 1NRKA 3KLIA 1MROA 2R7RA 1ZTTA 1NK9A 3ZZYA 2VBZA 1VOMA 2YNHB 2KN4A 3RAQA 1F9FA 4ITSA 4C11B 2GNKA 2FJAB 1C1CB 1Y3JA 1FE4A 2IM3A 2C22A 4NA1A 2YNIB 4DEZA 1REVB 3GG0A 2M70A 3PHEA 3MECB 3IN5A 1NAQA 2KFNA 1MU2B 2XGPA 3OL6A 2R7XA 4X2BA 1VQ8S 1KOOA 3DOLA 3AQOA 1LWEA 1RJJA 2NUHA 1FRKA 5IT4A 4G1IA 5KFKA 2ZE2A 2CPHA 3ENVA 5KG5A 4YR2A 4RU2A 3CC4S 4W92B 2UV8A 1XWLA 1R89A 4LSLB 1E6YA 5DGAA 1X0FA 2HHVA 2B43A 2CQ3A 3MM6B 3I31A 1MROB 2CPYA 2JC1A 5J1PA 2RS8A 4C8ZA 1VC5A 2EWHA 1L3SA 2FHOB 5GAGI 2CPXA 5EWEA 1UA1A 2ABYA 3EX7B 4RUAA 3GFXA 1QTMA 3MM5A 3VF0B 4YQWA 2MQPA 3RR8A 4WKYA 3C6TB 4X4OA 2XLJA 1U1RA 1LKZA 1M5HA 1Z2ZA 4DSIA 3CCTA 4DQSA 1L5UA 1P1TA 4KGMA 2CDQA 3DMJB 5BJRA 1WI6A 2RE1A 2MHEA 4KC5A 2VG5B 3D1HA 4DV1F 3HFKA 3GSDA 4LIWA 1VQ9S 1TL4A 2HNYB 3MAQA 3FDSA 3BEGB 1JLCB 2BQRA 2PI5A 3KMSA 1FD8A 2RKIB 3G6YA 2B6AA 3CDUA 5D78A 5T7LA 4DLEA 2AD9A 2VONA 4C8KA 3K8WA 3HO1A 3RB6A 3NCRA 1D8ZA 1HYSB 3KLVA 2M52A 1S1UB 4QIVA 1JNZB 2O1PA 5G0RA 3M8SA 3ONQA 4TY8B 5E3AA 3ZZPA 3JYTA 5LSOA 3W7BA 2FVPA 3LF0A 1H98A 4ZS6A 2MQQA 3CCUS 2V94A 3AHPA 4QR1A 4FF3A 2CVEA 2MYFA 3PIPQ 1N5VA 2MQNA 2BOPA 1OPZA 1ZAWA 2FHJA 2DNNA 5H9FJ 3UR3C 1RA6A 2V4JA 4PXEA 3GR0A 2K1RA 1Y00A 3TNVA 5B09A 1HNIB 3C6UA 4QWAA 4NLRA 2KFYA 2OJ3A 3WZ0A 2OH2A 2HRYA 5KT2A 4KIAA 3WX4A 3VAGA 4AXJA 1T05A 1S1TA 1RTDB 2DNOA 3SCKE 3HHLC 2RUGA 4DL5A 4ELTA 3T1YF 1GAOA 2AP6A 3D54A 3G9CA 4IG3A 4ZK7M 4QR0A 2GW8A 2OPQB 3PX4A 2DISA 4V19J 3U7JA 2LCWA 4C3KA 3AY0A 3OLAA 3V6KA 2DR8A 1J5OA 3DU5A 2NR0A 3Q8PB 4X4PA 3CJ2A 2WB4A 4G6VB 3KLEB 1Y5NB 3BR8A 3M6UA 1R27B 1VRTB 4UQTA 2IVFB 1QJHA 4BWJA 1SUQA 4AYBD 3HHDA 3T3FA 4FF4A 3MXHP 2MZQA 4ZMMA 2O67A 4O44B 2QLWA 1FKAF 4ILLA 1F5AA 4K50A 4UQGA 2DJWA 4USIA 1B0TA 4NCAA 1G2EA 4DV6F 1N5QA 4CH0S 2QA4G 3FZBA 1N32F 1X9MA 2HNZA 1OPIA 1G1XA 3GG1A 1WG1A 3UDCA 1U09A 4WE1A 2J0WA 5T41A 2VQEF 1TP7A 1KHWA 2PEHA 2OMOA 4OX8A 3QIPA 4ZP6A 3LAMA 2VUGA 3OJSA 3BSAA 3F44A 2I8EA 5A8RA 4D3GA 3DRSA 1OQ6A 3ZZRA 3M8RA 3FSIA 4M95A 3MR3A 1XR5A 1ROFA 3A8EA 3KJVA 3KFWX 4DV3F 2F7VA 5L1IA 1TAQA 2MKHA 1NHUA 2ZUGA 1E6VB 4RU9A 5HMYA 4MYUA 4ECYA 4FF1A 3AB4B 4XPEA 4IRDA 5KG3A 5KG6A 4EO6A 2AGQA 1SB6A 2XLKA 1R31A 4ZCIA 2FGCA 5HROB 1TKTA 2DPJA 2MY7A 3V81B 5K14A 3PW7A 4DR7F 3KNGA 1P9QC 2MY8A 1C1BB 2GIRA 3M8QB 1S76D 1XTZA 4NCGA 4ATNA 2JSXA 5IZHA 3C46A 1RTIA 3OLBA 2XNQA 5GADU 4IDKA 4ECWA 2FLPA 2JL9A 4IH6A 5JUMA 1DAXA 1OSCA 5F8NA 2OPPB 3SSQA 3POTB 2C2EA 1BQNB 3DU6A 3TW0A 3U1LA 1TVRA 2JJ4D 5THWA 3DRSB 4EWTA 2V5HG 2KJVA 3IC1A 4R5PB 1HWKA 3H2VE 2LQ5A 4B9LA 2J0QD 3PEHA 3BSOA 3TAPA 2W4DA 5I42A 3QZ8A 1JIHA 2KB2A 5D4OA 2EFGA 4LSNA 3G96A 5CYQB 2XZWA 1WELA 3CEDA 4P7TA 1QM9A 3S1TA 1KNZA 3D28A 2WK4A 5EHHA 5DETA 2F8HA 4QPXA 3KLFB 3Q8SB 4CCHA 1TKTB 1KVJA 4NLPA 2GHWA 4QIWD 5ADZA 2UU9F 2J7UA 2V4RA 2I0XA 5I3UA 2DK2A 1Z2LA 1KFDA 4Y2MA 2CQPA 5KFGA 5H9EJ 4YB6A 4RBTA 1HQUB 5ITHA 1N48A 1R3NA 4ID8A 1RTIB 2WW8A 4QWEA 1NJIT 1FHTA 2HGMA 4RUCA 4ED6A 5A0YA 3VAHA 3GILA 1S6OA 4HHJA 1Q82T 2Z2MA 4OV1A 3U1MA 3M9NB 4DG1A 3EPIA 1N0VC 2VA2A 1VHFA 5B0EA 3QZ7A 3L3CA 5L38A 3CCVS 4K4TA 1G6BA 3I32A 3D2WA 1U1OA 2MJUA 4MKBA 1UJ6A 4JV0A 2R7QA 4ZP9A 4DR1F 3C2PA 3M30A 2XS5A 3KYLA 3RW6A 1HNZF 2CQ1A 2V8DA 5GAGU 2RRAA 2J6SA 2DGQA 1IQZA 1O0PA 1F60B 4TNOA 1KTVA 2I1RA 4DV7F 2F9DA 4I7FA 1DARA 1BGXT 4RNOA 4CZCA 2E5LF 2ZZNA 5L1LA 2ADBA 1S9GB 2Q79A 4IG0B 1NK4A 2GQCA 3W2WA 3ITHA 5GAHI 1UJ5A 1IXKA 1UWBA 2F8EX 2ZC3A 1FKPA 5KFLA 2CZVC 2OP5A 5C5JA 3M9MB 4ECQA 1DFDA 2K7KA 2LEAA 2C2DA 5E0OA 1U1NA 2HIQA 2E1AA 2DH9A 1NK7A 1NK5A 2YKNB 3KLHA 4Y28C 5F41A 3QMQA 4K4UA 5LJ5Y 1MSWD 1NK6A 1FE0A 1VBXA 5DJBA 2POKA 1LFPA 1S0NA 1RK8A 1VK8A 1MW7A 3TP2A 3OV7A 1SKWA 1KD1T 3HF5A 1XNRF 3HVAA 2P9GA 3KK1A 2KG1A 4Y2AA 5K5MA 5IWAF 4ALZA 1C4CA 1S4FA 4DL4A 3AJ2A 2EFQA 2CVIA 2RS2A 3DM2A 1Y3KA 4OX9F 5JVGQ 4F50A 2MZSA 2W4CA 1WG5A 4YOEA 3IGVA 3NMRA 1WG4A 1N4LA 3IWNC 1FXRA 4X4NA 3THVA 2YWGA 1S1VB 2B4OA 4QPTA 3PR5B 3CCLS 2IA6A 4Y2KA 1NH7A 5KT5A 3MMAA 1O51A 3S6EA 3KLGA 4J9RA 2WTFA 2ZJQQ 3K8VA 1X9SA 4HI2A 4ID5A 3LO3A 2YX1A 2V8VA 1QY7A 2R8HA 3SYZA 3CCES 1C0UB 2CJ9A 2PE8A 3FQLA 2HHPA 4YDDB 3G8SA 3FRYA 2YWHA 1FRXA 3GYNA 3TUZC 3V6DB 1TKZB 2PD1A 1X4AA 3HKZD 3K57A 1R43A 1KQGB 2GMHA 2VPZB 2XSJB 5CXTA 1B0PA 3MM9B 1XR6A 1HD1A 3H4DA 1FRHA 2MQLA 4NLTA 1MNEA 2YX4A 2N82B 2YVSA 7FDRA 2GMLA 4OQJA 2DNGA 3PX0A 4TXSA 1RT7B 3IS9B 4HT5A 1MMDA 2FVCA 1ZPWX 2RRNA 3CDBA 5K8OA 1QE1A 4DDFA 1T03B 1Y5IB 3OSNA 1C2PA 4O3SA 3KOAA 1RT3B 2BANB 1EETA 1R0AA 3OTEA 4ED3A 3KTQA 2VPYB 4MIWA 1LWCB 4RW8A 3DLLQ 3V6JA 3RYLA 2VASA 3KLGB 3MTJA 1URRA 2ZD1B 2VKRA 2AYMA 5KFNA 5J2NA 4N76A 2QSWA 1U6ZA 1HI8A 3VQTA 3GFHA 4DOZA 3J7YI 3CSKA 1ZYQA 3HHEA 2HW3A 4N56A 3IGNA 5LJ3Y 2GQ2A 5DQGA 5D4NA 3T19A 1WHYA 2KI2A 4NYPA 4IOAQ 2OAUA 1H7WA 2FD2A 4X62F 1WI8A 3R3TA 1IBKF 2UVUA 4CO1A 2FC9A 2DNLA 3EXCX 1JLBB 3NWGA 1SV5A 1YHQS 3NL0A 2FVSA 2E9RX 2VG7B 4OZJA 1JWWA 3I4HX 2P6TA 1HBOA 3TVYA 2AX1A 2E44A 3DHWC 4ZP8A 3M1VB 3Q8RB 1PC4A 3BF4A 1LQ9A 2L3MA 1Q8BA 4N8OA 1DURA 4J5OA 5LSRA 3G6ES 4LUBA 3ZZ0A 4CO0A 5HMZA 1S9EA 4ZCMA 3EGZA 1KQFB 3PVXA 2LQ9A 5JJBA 1G3OA 4LF7F 3DCAA 2XMUA 4KHMA 3VAJA 2IJFA 2DHAA 5LL6d 3UCUP 2HZCA 2DHGA 1S9FA 1NKBA 3HVTB 2XMKA 4HI1A 5J1EB 2IMOA 3LGNA 2EFVA 2FLNA 2OFHX 3D0IE 4NWBA 4DBQA 4I56A 4WFAQ 2QFJA 2DNPA 2XI3A 4DV2F 2EK6A 3CF5Q 3V4IB 1TAUA 1FEEA 3KK2A 4PG6A 2EBEA 2WONB 4WXWA 4AUKA