4JYAF

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4jyaF00
4LF9F 1G1XA 4DR7F 2KJVA 2ZM6F 4JYAF 1XNRF 1N32F 4B3MF 1IJEB 1CQMA 4X66F 4X64F 1FKAF 4LFAF 4GKKF 2YY3A 2B7BB 4LFBF 5BR8F 4YY3F 4LFCF 4LF4F 4JI3F 2F4VF 3T1HF 2BVZA 4X62F 1VMBA 2UUBF 2RJZA 4DR2F 1XMOF 1GH8A 4JI0F 4DR3F 4DUZF 2UU9F 4AQYF 4LF8F 4DV2F 1QJHA 1IBMF 1HNXF 4K0KF 4DV1F 1IBKF 4NXMF 3ZZPA 4JI4F 1IBLF 1N36F 1LOUA 4OX9F 4DUYF 1RISA 4B3SF 4DV6F 1FJGF 5LMUF 4LF7F 5AJ3F 4JI7F 1XMQF 1IJFB 4KHPF 4JI8F 4GKJF 1B64A 4DV0F 4LF6F 4DV4F 2UXBF 4DR6F 3OTOF 2B7CB 1G7CB 4JI1F 4DV5F 4DR5F 4DR1F 4X65F 4JV5F 1F60B 2BXJA 1HNZF 3T1YF 1N33F 4B3RF 4JI6F 1I94F 4B3TF 2J5AA 1J5EF 3R3TA 4JI5F 5IWAF 2VQEF 5LMNF 2VQFF 4YHHF 1XNQF 1HR0F 2KJWA 2E5LF 4LF5F 2UXDF 2HHHF 4NXNF 2UUAF 4DR4F 2UXCF 4DV7F 2UUCF 1CQNA 4DV3F 4JI2F 1N34F 1HNWF
chains in the Genus database with same CATH superfamily
3RB3A 1GAOA 3NGRA 3LP1B 4ECVA 3DDNA 3TA1A 3D66A 2OPPB 3NOGA 4AT1B 5M2PA 3ZFVA 1U1MA 2D7SA 3VZHA 4X4RA 1UZHA 1CEZA 4C4WA 3IP0A 2OGUA 3I0SB 2ZBCA 2RVJA 2DRBA 2GZOA 3OFGA 2HVDA 5CCMA 1CPZA 1RA7A 3M1VA 3P96A 3H5XA 2RHQB 1G3OA 2H5IB 2QL9B 5J1PA 2BQ3A 4DHVA 3TANA 1SH3A 1DQ8A 1R27B 1UFLA 3QSIA 5B0FA 3SEOA 3W2WB 4UQGA 1GXTA 1OY8A 2P5VA 2HBQB 2Y1RI 4LFBF 4EK2A 2E7XA 2BW2A 2XMJA 2NXNA 4DSKA 4DBQA 3LUYA 1KFSA 3KWMA 2G1DA 3MCOA 4JI3F 3NGUA 5L1KA 2DR5A 2AYGA 4C8YA 2BDPA 2CPXA 3AQPA 4RNOA 4J9RA 2K2PA 4QIFA 4F4AA 1N34J 2NSBA 1KC8T 5CD4H 3I55S 4Y00A 5KFVA 1DY3A 4DR2F 4EU0A 3D3CJ 3LP2B 4CLYA 5J2PA 3O8WA 4NZ0A 3GB0A 1T11A 1SKWA 3I96A 2M0GB 3IBFB 3NS5A 3J7A1 1TVRA 3H5YA 2Y1IA 4WZMA 4NLQA 3BPDA 3L7OA 3W8PA 3MMBB 4CO5A 5I42B 2A3JA 2K8GA 4NL5A 5A0YB 5D77A 1QJHA 3HZEA 1JLQA 3V6HA 1VQKS 1KTQA 2HVZA 4L72B 4JI3J 3MR5A 4DV1F 3W66A 3R7BB 3H2LA 2O67A 1T9WA 2ZDPA 4IG3B 1S6PA 2M2BA 5LXYA 1RU2A 4KGVB 1IKYB 3SCKE 2L3MA 1H7XA 3PM9A 2J7KA 1YHQS 1X4GA 1N36F 3LO3A 3FVYA 1NB7A 4L6V3 1VQ7S 4B3SF 1OPZA 2AQ4A 1MLAA 3DOMB 3ILIA 2HHQA 1YJNS 4KKOA 1K44A 1UAWA 3FSYA 1LW2B 3T6JA 2L9WA 3W7BA 2FHMA 4BLGA 2IM3A 3RBDA 4DZDA 3MD3A 3HHEA 4UUWA 1WEZA 1IKVB 2DNGA 2XMMA 1KN6A 1YJRA 4B9TA 1VOMA 2WOMA 1P27B 4ZIVA 2VV5A 2V69A 3ISND 1WOSA 2DNLA 4NLTA 4RKUC 5FDLA 5G0RA 2ZBPA 3QFWA 3HVWA 2QRRA 3IS9B 1QD1A 1S1XB 2K1RA 5ETSA 3MUVP 1KVJA 1CS4A 4K8RA 2LFVA 1S9GB 1WF1A 4XPCA 2ZH3A 1NDLA 2PMZD 4CI0B 2J7UA 3UO0A 1VC5A 1LW0A 4C7QA 4DF8A 3L7PA 1JLCB 5L9XA 3CD7A 5KG5A 3KK1B 3OTDA 2EFVA 3SFUA 5B09A 1HD0A 3RBZA 4J90A 2RUGA 3PYEA 1SH0A 4PQUB 3JQJA 4ANCA 4OI1A 4N8OA 5KT4A 2GJIA 2WHOA 2VDHA 3MPYA 1J5EF 3GSDA 4HI2A 4OZ0A 1RK8A 1WHVA 4CLTA 3JSMA 1SH2A 3D0IE 2WB1D 4E8UA 1TKTB 1C1CA 2XMKA 3T9NA 1HQEA 3Q8PB 1L3UA 1XNQF 2OFGX 3OVSA 1RP5A 2IYGA 3TA2A 3O44A 3N9UC 2XGQA 3QJJA 3OW2R 1NHVA 1C0TB 1XN9A 4RW9B 2DNYA 3OTBA 2AX0A 1EARA 1S1TA 4NXNF 2PMWA 2YPYA 4KJIA 2J0WA 4OHYA 1FE4A 2OKQA 1RT6B 3OT9A 5ETVA 5T14A 1NJIT 1J5EJ 3TZZA 3NNCA 4RW6B 4B9VA 2C2KB 3HHLC 3MF5A 2DPJA 1RWPB 2FJXA 4MH8A 2JX2A 3RAQA 1FNMA 4X65J 4FS2A 2GC8A 4C2MA 5KFIA 2P9GA 2LMIA 4G1QB 4WPAA 3DRPB 4LSNA 1XMBA 2XO7A 3S7RA 2CJAA 2FY1A 4PG4A 3P49B 3LANA 3KHLA 2V34A 4FNHA 4URQU 1XK8A 3VAFA 4MYTA 3WBZA 5DG9A 1YI2S 3PO4A 3MMAA 4Q7AA 5FLXY 3G87A 3GG1A 1CQMA 2AEMA 3I0SA 3KJNB 3UQSA 4C0BA 4EBCA 3SI8A 1DAXA 4F4KA 3X3UA 2B56A 1APSA 4R8UA 4TN2A 4GKKF 4OI4A 1MW7A 4WU2A 1VS3A 1UMJA 4E98A 5LSOA 1RAGB 1X7VA 2HIYA 5KFFA 4DLEA 1ZH5A 4YY3J 3OR2A 3NBPA 4B9LA 2KRRA 1MMDA 4KFBB 4ICLA 4QR2A 1DTTB 3TP2A 3H2VE 3W62A 3VWSA 1X5PA 5EWGA 2L48A 3QZ8A 3GYXB 1C0UA 1RWVB 2AJQA 5DDOC 1WHWA 3WIUA 5KFAA 4LFCJ 2ILYA 3E01B 1RAFB 4P6QA 3D3BJ 4IFVA 2VC1A 4XTTA 4K0KF 1N8RT 5C42B 3NLCA 2C1EB 4NA3A 3N4WA 3TAPA 4Q5VA 4IO1A 3G4SS 1GH8A 1DZ5A 2QIFA 2RB7A 5IS2A 2HQFA 3NNHA 2MZTA 2CPIA 1SC4B 5F3ZA 1FXDA 2UU9F 1NHKL 4HTJA 3W2VB 1FJEB 4DQSA 3DFEA 2DH7A 2W2QP 5JXSA 3AHPA 3C6TA 1TVRB 1XEZA 5LSRA 3OSNA 4F3OA 1IR1A 2HGNA 2QA4G 3W9IA 5EGYA 1TP7A 3R6GB 3R2CJ 4NXMF 2ASYA 2VODA 2EVZA 1HFEL 3FMWA 3I0RA 2DO4A 4NCAA 3AXKA 3P3DA 3KFWX 4CYUA 5GMDA 1TK0A 4P9SA 3P8BB 2X1FA 4OYWA 2ZHAA 2R7VA 2G2ZA 2X3DA 5HVHA 1O0PA 3GIMA 3MECB 2R7XA 3B8HA 4JOUA 1U2RA 4KIAA 5G4DA 2NCKL 3VGTA 3V6KA 2QSFA 3HVTB 2W2PP 4KKOB 2WONB 5JUMA 2B9WA 5GMEA 2R9LA 4RU2A 3UD5A 3M8ZA 3FQKA 3NRBA 3W8GA 1D8ZA 3V4MA 5AXKA 3OHAA 1JXEA 1GMWD 4I6WA 4UOFA 5J1EB 1OWXA 4D3HA 3OUYB 2UXDJ 3UFCX 2ZD1B 3MAAA 3WHIA 1JLFB 4OI6A 3BQ1A 4CLPA 3DRYA 2Z56B 1ZTTA 2BV3A 3PCOB 2DGVA 2YKMB 2B7CB 4IH7A 2IRUA 4O3RA 1CS4B 1QVGR 5KT7A 1XMOJ 4LJMA 1QSYA 1VK8A 2DNRA 2XI2A 2VHGA 4AE5A 4PUOA 4KRWA 4P74A 2RRAA 1IWAA 1UVJA 3RB0A 2AEFA 3EVWA 4F04B 5A6WA 4QPXA 4MKAA 4AQYJ 4FYYB 4MFBB 1S0NA 1U45A 1D9DA 2HHUA 3GZ7A 5E0OA 5IOLA 3CCJS 2V0NA 3HZGA 2ZH6A 1S9FA 4IRKA 1BC6A 5JVHQ 3CO9A 1T9XA 2H9ZA 4C48A 1SCJB 4DL4A 3Q24A 4FF1A 3EGNA 2LA4A 2OJ3A 1FDBA 4C98A 2XLKA 3CDEA 2MZ1A 3G9CA 4WXOA 3G96A 3UVJB 3HM9A 1E6VB 2V63A 1U1PA 4AL7A 1N0UA 3HSJA 3Q86A 4ZLNA 3SYZA 3TQ1A 1LWCA 5LT5A 5EWFA 4IFYA 1IBMJ 3UDCA 2LVWA 1WKJA 3IWNC 2BBEA 3SXLA 4ED1A 1Q7YT 4DR2J 3HULA 4DLGA 1M5KC 2V2VA 3SCIE 1DTQB 3HPOA 1RHQB 2CQ0A 2D74B 4RW6A 4NLYA 4L74A 2YX1A 4QIGA 4QIEA 5K8PA 4USHA 5EWEA 1GK8A 1LXNA 1Y11A 1NK6A 3J7YI 1VQYA 2VFRA 4YOEA 2YKOA 5FD1A 2ZH7A 3DLHA 5U47A 3BQ0A 4ZPVR 1FRIA 4ED6A 1C1BB 1U6ZA 2NPIA 4DL0C 4TLRA 4J91A 3DCAA 3W2WA 4PWDB 1X4AA 1TV6B 4PWUA 3QRQA 3BSAA 3DOLB 3SQGB 4FDFA 2XI3A 4LQ3A 4ILLA 1U24A 2I9SA 3JB9k 1FJGJ 6FDRA 1RAAB 5ETNA 2GNKA 2IM2A 1YQHA 4AL6A 5AXNA 2D3UA 3DLEA 1B7YB 1YWXA 3DGPB 3L9ZA 4K5RA 3EM1A 1LFWA 5KFZA 3K5LA 2EKYA 1K73T 1CC7A 4ICLB 2JWNA 1WEYA 2LLZA 2HG4A 2IJRA 4X84A 3T6BA 2UU9J 2XLIA 1MWZA 1HBOA 2HIQA 3F41A 4ZVRB 3UDVA 4ZITA 2LEAA 1KBRA 2EK1A 4GC7A 1WEXA 3V4IA 1ZM9A 1FJ7A 2LU1A 3JTOA 5A8RA 5I3QA 3CVKA 3QRPA 1YKWA 3A3NB 5D0GA 3OTCA 1EAYC 1Q5YA 5E7OB 1X9SA 2BKPA 3KK3A 1M5HA 3V6DB 4ZVFA 3ELHA 2FHJA 2LQ5A 4A8XA 3CJTA 2CPEA 4IG3A 4DV2F 1VGYA 4HH1A 1IKYA 2NXCA 2EPIA 3M6UA 3M9NB 1K47A 3CJ5A 4XIUA 1BQXA 1H3DA 3Q0AA 2MKIA 3A8JA 2H48B 2V68A 2PN6A 3R27A 4JI1J 1NLKL 1R3NA 3CCTA 3GYGA 2XC9A 1XNQJ 4QU7A 1G4CA 1LW2A 1FFWB 2ROPA 2PO4A 3KNGA 1FXRA 2G13A 1RWXB 5IQQA 3W5XA 4BC7A 5H9EJ 2E5HA 1CVJA 3G8QA 3CDAA 1L3VA 4LF7F 4F0HA 3DRSA 1IUJA 1HNVB 2V5HG 5DM6Q 2MXYA 5SZTA 5G0RB 3KLHA 2MB0B 1AFJA 4Q43A 4UTGA 4UT4A 4CLUA 3H90A 2YQ1A 1IKXA 1S1XA 3AXMA 4O0NA 4ZCMA 2HHXA 2E1CA 4IOBA 4Z2XA 4DL2A 1S9GA 3NWGA 1A7GE 2LP4A 3DNCA 3MFHA 2UUAJ 4QYRA 2W2NP 4KPCA 2BKNA 2R7SA 1RT2A 4OHVA 3WC2A 4JV1A 4O3NA 2R2SA 2DBBA 1MU2A 3OQ2A 2FB0A 3BGOP 1LWFA 1T03A 2AGPA 1I6JA 4CLZA 2QEXS 5F0WA 3C46A 3AB4B 2HLUA 4NLGA 4ZPBA 3CXCR 2AIRB 2DHHA 3MPDA 4BC9A 4H4MA 1VQPS 3JSMB 3M6VA 4QW9A 2C3MA 5K8OA 1C1CB 4PXDA 5HO4A 1HQEB 4NYZA 2XWXA 3DI6A 3UNGC 5DGBA 2R8JA 4YP3A 2VQEF 2MHEA 5AT1B 5IXUA 4USTA 1C0TA 1EX8A 2CG8A 4MFBA 2KJWA 4NLOA 1TFYA 4LSLA 3BB5A 1FO1A 3EDQB 3JQMA 4OZLA 4OLPA 3SSRA 1RI7A 3CF5Q 4OFZA 4M5MA 2BKOA 2ILZA 1JKHB 1IM6A 3ETOA 5K20B 4RNNA 3D1HA 3GIJA 1WG4A 4LUBA 2V4JA 4P7TA 1TELA 2QG9B 2HHWA 2CG4A 1H6KX 2NS1B 1YRUA 2CVEA 4K4UA 1GFWB 3ILOA 3LP1A 3N5BA 4NEYA 3HSZA 2IBOA 1MNEA 4UOGA 1ZM4A 1U09A 3GCWP 3WDOA 4CH1A 2W7PA 1QUVA 4CT9A 1L5UA 3OLAA 4LRCA 3BO4A 3QMQA 4MJKA 1NPPA 2N7YA 2GMHA 2F9JA 4Z7YA 1D9FA 3GTYX 3QBCA 2LECA 2IDEA 2MLXA 3KMQA 3FBCA 2XZTB 3I4PA 1IJEB 3BSCA 2FLPA 2M9KA 4PXCA 2EK6A 3PJXA 2ZH1A 1HA1A 3A3OB 5DETA 1ZTWA 2GHWA 4X66F 3FBFA 5AE1A 1UZDA 5F9LA 3A1YG 1X60A 3H5UA 1VIOA 1WHYA 2QC3A 2V8GA 1PKUA 2XHCA 1DTTA 3S01A 3TZYA 5E2QA 1VLOA 4YB5A 2QGFB 4FN5A 3UR3C 5E33A 2UUWA 1UWBA 1S4EA 1SV5B 3I4HX 5KFLA 1YVFA 1U47A 1NK5A 4LFCF 5K8MA 5BYRA 2F65A 1V3ZA 3Q8SB 2KB2A 5MAOA 4PCQA 4ENOA 3MR7A 3DLEB 1LQ9A 3W3SA 3DGPA 2UUBF 3QLHB 4YR0A 1QAIA 2Z2LA 4DS4A 1WF0A 1R8HA 1WOOA 5LXRA 2DISA 1HBOB 5I42A 5D15A 1N6QB 1KQSR 3GIKA 2HBRB 2QZ8A 4B3RJ 3A3PB 1NDPA 2GVZB 5A2QU 1T9UA 3TJ9A 5A8RB 2MKKA 3UCZP 4LF8F 1E6YB 3KLGB 3BO2A 3MMCA 4TQSA 1S72S 1RKJA 1RLDA 3HVRA 2AT1B 1EJ7L 3J7Z5 4C8NA 2LEPA 2KG0A 3KJVB 1UW9A 2LQ9A 3CIZA 3TVZA 3AODA 4J9LA 1ZAWA 4K4YA 1N5QA 4M8LA 4N7TA 2OO4A 1S97A 1CJKA 3MAQA 2MLZA 2VBWA 2WVBA 3MEDB 3MECA 5KFMA 4ECSA 2IBKA 4GKJJ 1MSWD 1RT3A 4WWSA 3NAHA 1NBEB 1SQFA 1PJ7A 2LDYA 3FMBA 5DRKA 3TR5A 1MROB 1UW4A 5HP1B 1RHKB 1X4HA 4C8KA 2WK4A 5AJ3F 3PV8A 4PPDA 1WORA 5LM7E 3FCVA 1P9YA 1CULA 1NKBA 2Y1JA 3K7RA 3W9HA 2IA6A 5HROA 1UEUA 2IDLA 1FXLA 4DR3J 2B4OA 1R43A 3GE9A 1UEVA 3AOCA 4GKJF 5KFTA 5ETLA 4HH0A 3PR4A 4Y28C 3KUEA 1BHNA 2B4VA 4F8RA 3IGNA 4EMDA 4CLFA 4DUYJ 3M32B 2I8EA 3UE2A 5EDWA 1RT2B 1WUUA 2JRSA 2PSZA 3HFKA 4X65F 3EZ5A 1QAYA 1X31C 1AUDA 4K4VA 4PQUA 4WFNQ 1H72C 3BGUA 1Q78A 2OPRA 2D1CA 1HHSA 3AH6A 2MMYA 4P7VA 1X0PA 2MHNA 4WKYA 4C97A 4DWIA 2CJYB 3GCXP 1VQ8S 1ZZFA 4ZVQB 5DM7Q 4K4XA 4YHHF 3DI6B 3E51A 1SUQA 3DXSX 1S1TB 1YBUA 3MR6A 3BDPA 4ZVEA 1JNRB 3DDKA 3TZWA 2N7CA 2KZZA 4GKKJ 4WK1A 1AW0A 1WC6A 3M9OB 4F2SA 5E41A 2ZOMA 2EG1A 2MQNA 4LVOP 4K5SA 2IM0A 1BQNA 3L7UA 2I1RA 5KG2A 2DT9A 4O3QA 3CIMA 2P2CB 1GMWA 2F7VA 1ZBTA 1KVIA 1F5AA 4MYUA 4QU6A 5DDRC 4G1QA 1N33J 2VA3A 3DRPA 2J0SD 5IV3A 2WW8A 1Q0NA 3GG0A 3CMQA 1NK9A 3HI9A 3HHLB 4ZVUB 3MCMA 4O4GB 4J9QA 1Q81T 4C9DA 3C8YA 4RWWA 3QIPB 3GV7B 1JXLA 1OQ6A 3ILLA 3QAEA 3J7AN 4B3MF 3QAUA 1DHMA 4DQRA 1D0EA 5H9EK 3QJLA 2OPSB 3EGZA 2C2EA 3SV3A 1S12A 2JOQA 4RNMA 2ASJA 2QL7B 1G6BA 4ED8A 3NMAA 1IVZA 5HN0A 5D0HA 1AZSB 1HWLA 1Q79A 1WTFA 9ATCB 1XC9A 1U25A 1C0UB 1PAEX 3T41A 5CHCB 2HMIA 3IC1A 3EICA 3GJSB 4Y2CA 2VB6A 4Q2MA 3G8TA 2R8HA 4LF6J 4IFVB 3OLBA 1N56A 1AYEA 2BACA 3V4IB 3QRRA 3LPEA 2FHKA 2RILA 1TKXB 4K59A 4B3SJ 4GVLA 1YX2A 2MQLA 3VHQA 2ZJQQ 2VU5A 2FQQB 3O1LA 2H5EA 3H59A 1WHXA 4ETXA 5LMNJ 3FUYA 1D1UA 2DH9A 5KG7A 1U6FA 2X51A 3BREA 4ECZA 3M8RA 5C25A 1Q8KA 3D6MB 3ZNJ1 4DQPA 4MT1A 2BE2B 3J81Y 3CD5A 5DJBA 2KHDA 2IJFA 2WBMA 2XSFA 3MMCB 5H1SV 1TFWA 4FBTA 4KHMA 4Y65A 4RNFA 2GIQA 2ZWOA 4PWWA 4OX9F 4LT6A 2ERRA 4FXDA 5H9FK 5BR8J 2KZMA 2A0FB 2BJ8A 1PJ6A 1S5ZA 2QMWA 2JEIA 5C2CA 4F4YA 4PYDA 2DR9A 3UDEA 1FFSB 3J81U 3OL7A 2OMOA 3EDRB 4E2FB 5HP1A 3EWGA 4DV3J 3OUYA 2ZE2A 3KG1A 1Q82T 4ILMA 5ETQA 4ZJQA 1FKOB 1Y3JA 1TUGB 2GX8A 1JLFA 3UR0A 1G1XA 2XS7A 1F0XA 4F3QA 3TUZC 4XDCA 2QA4S 4JI5J 4QPTA 1DJ0A 2C2MB 1LNQA 1R6VA 1XJWB 4AD6A 1UA1A 4OHZA 2UXBF 1FNOA 1RT7A 2BJDA 4DL5A 4FBUA 1I5OB 4U96A 2IVFB 5GADU 1QAXA 2RIJA 3UI3A 4OZ3A 3UPFA 4DR5F 1F3VA 1OO0B 5ETOA 1T05A 4A8QA 4FP9A 4CLKA 3PRDA 4OZJA 1F60B 4JV5F 4A8KA 2D69A 4X64J 3M32A 2Z2ZA 4HHHA 2F9DA 4ZJLA 2DNHA 3KLIA 1HPZB 3VV2B 4RBVA 4A8WA 2HHSA 2FTRA 4FYVB 3RYLA 4ITSA 3OR1A 1F3FA 4LREA 2VPZB 2OPRB 3CCQS 2HYIB 1LK7A 1H98A 2VQFF 3UDLA 2DNKA 1FRJA 4ZLPA 4P75A 5KFQA 1FRMA 4PRFA 3RU0A 3CJ3A 1LWCB 2V4JB 3BBFA 3D1OA 4IFYB 1MWYA 1RTDB 1RYRA 2JSXA 2IMOA 1ULRA 5LOQA 2XSJA 2DIUA 2AGOA 1PJ5A 3ENAA 2RS8A 4ZVPB 3OL8A 2XYHB 3WX4A 3N0VA 2QLXA 2YWKA 3CJ8A 2CJ9A 3DLGB 2DGOA 4KV8B 4OHWA 4ES3A 1YJWS 2DKOB 4JI2F 1NK8A 2DB1A 5KG1A 4RO0A 1HNIB 1T9YA 2CYYA 3FBBA 1URRA 2GGPB 3FRZA 4GO5X 2H5JB 1PC4A 3D6FB 4KQZA 1HD1A 1C1BA 3KLFA 1QUPA 4BDPA 4JYAF 4NCBA 2LEBA 3V81B 1YLXA 4NCGB 3PYDA 1S7HA 4LR9A 3BSOA 3KKFA 1N54B 4A8MP 3IFEA 1ELOA 3H5SA 4DFMA 4X4NA 3RRHA 2L08A 3QQCD 1FERA 2I38A 4JI7J 2YWHA 1FDAA 1FESA 1AUSL 1YDLA 2C3YA 3FEXB 3GWCA 4RUBA 4LFAJ 1B7FA 4OHXA 1M1GA 1FA0A 2CNLB 2IM1A 2UV8A 5CYJA 2XY5A 1LWEB 2E5LJ 1RB0A 2L9DA 3W60A 4Y34A 5E5NA 5ITHA 4LF4F 1GMUA 3C66A 1TL1B 2UUBJ 3HD1A 4MTPA 5GVQA 4DR6J 1RA6A 3C2PA 3PFOA 3EPGA 2OTJS 3QWPA 3IBCB 3UN3A 4IOCQ 3J80U 3KK3B 4OYBA 1A0OB 2GVZA 3V6DA 4C8LA 3AAWB 3DU5A 1TKXA 1FVQA 3QZ7A 3OJSA 1F2GA 2QE5A 4LVNP 3KYLA 4KSEB 2VJUA 1S59A 2HRTA 2ZNYA 3ENWA 4WTOB 4Z7CA 5IT4A 2LU2A 4GRSA 2CJKA 3MEDA 1S1VA 2IAJA 2LYVA 2MQMA 1TKDA 4NXNJ 4CWBA 5C25B 4W90B 4NMLA 3DHWC 1RTIA 2BE2A 3CD0A 3IBWA 2QTWA 4IOAQ 2U2FA 1SB6A 1MROA 2CPZA 3WC0A 2CPYA 2UXCJ 4YHHJ 4HR2A 4KC5A 1HBUA 1UJ4A 3P5TL 4J5OA 1IBCB 3PYFA 3KLHB 5A8KA 2YNIA 1SI9A 3BSNA 2CJXB 4U8VA 1IKXB 4DFJA 1BQMA 2UP1A 5HQLA 1XR6A 1XERA 3UNYA 3G82A 1VBZA 4O3OA 2HFUA 2Q1LA 3W65A 3C16B 1HNWJ 3D68A 3HVAA 1W26A 3RBXA 3KHHA 5DQGA 1R0AA 2JNJA 1J5OB 1DFDA 1FEEA 5FIIA 4R25A 2MDAA 1FI4A 3VCDA 3PZPA 3KTQA 1I51B 3LAMA 3HHLD 4ECQA 4K2XA 4BCAA 3R2DJ 3R5AA 3FBEA 4NXMJ 1NZAA 4X4UA 3RB4A 2KRBA 2EXUA 3P5BP 4DDFA 2XS5A 4QIVA 1LWXA 2EFPA 1SC3B 4N56A 1RT7B 1FTCA 3GFHA 3G6YA 3QGIA 5IZHA 4ELTA 1D09B 1TL7A 1OSDA 1TZ0A 2A18A 3TEGA 3HP6A 1I1GA 1RBAA 2VUGA 2FVCA 4B3RF 4ALZA 1KLNA 3MEEB 3H98A 4OX6A 4XK8C 4F7VA 2VBYA 4DU7A 1S57A 1EETB 5K8NA 3H4BA 5KFKA 2B6AA 4J9MA 4TU9A 4ILRA 4KGKA 4PABA 5CYMA 2KYXA 3OL6A 3I82A 2YPZA 1HKAA 3PTWA 3SCLE 1JKHA 2C28A 3HX9A 3K0JA 3Q8UA 4IQXA 2UXDF 1V9OA 4V1Ak 3MMJA 3CWJA 2HWHA 1SJ1A 1Y9OA 4ATNA 2CRLA 4ZN3A 4OLOA 2VOPA 2DNNA 1Y5IB 2CDRB 2JLFA 3VVUA 4M1KA 2KN4A 2R8IA 2EFNA 5F8MA 2GHVC 1S9EA 4QWCA 4C3MA 3M8SA 1TTHB 2DNZA 2F40A 4ZPCA 3M8WA 5KFXA 2C2OB 1M5OC 4DV7F 2KFZA 4FF3A 1EP4A 2AEJA 3D67A 1QSLA 1VJQA 2ZJRQ 3W5ZA 4UOCA 3R8YA 1Q53A 3I5AA 2PMHA 3A12A 1FK9B 2KT2A 4ANEA 3BQ2A 1N5YA 2KJVA 5DS7A 4TVAB 1X4BA 4HTIA 4LSZB 3UCGA 2CQCA 4B08A 4RW8B 3PO5A 2GV1A 4PZVA 3RB6A 3H2UB 1U0HA 3TUPA 2V2QA 3R5GA 4NOHA 5JVGQ 2DY9A 3G71S 3V81A 2JHEA 3PEJA 1AZSA 1UCNA 2W2OP 3TI0A 1VQLS 3ADAC 4EEYA 1QAJA 4Y2AA 1O8BA 2BJEA 5C7PA 4X2BA 3QGPA 3GMGA 2YNHA 4HDHA 4DV2J 3T19A 1ZA1B 1S79A 3M8PA 1SV5A 2BX6A 3BO3A 2RQCA 2E1MC 3H8YA 1HWJA 3FKBA 3LOUA 3OHBA 1XBWA 1ZETA 1K8AT 2B7BB 3D0HE 2V8HA 3E8OA 4H54A 1SIWB 3AD7C 1B0VA 3MI7X 1BXNA 4I69A 2RKIA 3RUBL 1N4LA 4MKYA 4EUVA 3TAMA 1KOHA 2CWXA 2HRUA 4XPEA 2KTQA 4ERDA 3ZZ0A 4GVBA 5KT3A 4B9NA 3SDEA 5KAKA 1TL1A 2F8MA 1ACMB 4HEA9 3PKYA 2YBVA 3BGRB 4DR3F 3P6YC 3NG8A 3HHDA 4M5HA 3BPSP 2YWWA 2GS8A 3H42A 5IM0B 5I3UA 3KJVA 1H7WA 3PHTA 3HJVA 2AP6A 3QT6A 3N79A 4CT8A 1N5TA 2F4VJ 2ZH4A 3OD2A 4UOHA 5KFDA 3IRWP 4Q8FA 5F8JA 3KDOA 2YKAA 1RT3B 4CO3A 3S8SA 1D9AA 2B4UA 5A6PA 4NEZA 1OMSA 5D4OA 3KUHA 4URSA 2HQGA 1SL2A 1ZAXA 3I31A 1JJHA 3NCQA 1LEOA 3J80Y 2VG6B 2KT5A 2XYPB 1HBNB 3TRGA 1NPRA 5EX3A 1F9FA 2QLJB 2YNIB 2GHPA 1XNRJ 2RSQA 4YB1P 1RDRA 2K1RB 1RAJA 3KUGA 3V5RA 4ED4A 2EKNA 4CLSA 1DARA 2FC8A 2P9CA 4OX8A 2AZ1A 2KM8C 4DV0F 1N5SA 1LW0B 1R8CA 4WP8A 2VASA 2FLNA 3CDBA 5I3PA 2NYIA 2PDAA 2XNQA 1NO8A 2YX7A 3D1QA 5DQHA 3T5JA 3R7SB 3EJMA 2IY5B 1U2FA 5EN1A 4NYOA 4WU3A 1EB0A 3CCZA 1HQ2A 1GEHA 1HPZA 2IRYA 4DX8H 1RSCA 2HZCA 2QA1A 1FDDA 3D6TB 3OR1B 3Q8YA 4OJ3A 2W9BB 4ZP7A 4BBYA 3MUMP 4DV1J 4DSEA 3V6JA 4H4KC 1UTAA 4J9NA 1Q8BA 2IPOB 1UVMA 2O5DA 2ZC4A 2Q6CA 1SUQB 3GONA 3CJ2A 5CQGA 4ZVSB 1T7PA 4ZCKA 5KOWA 2BOPA 4HT7A 2PI4A 1RWKB 4FXWA 4J37A 4WFAQ 1B3TA 2E5LF 2R8KA 2HFZA 1Q4RA 2CUYA 1VBKA 3IR6B 4YMEA 1BWEA 2BQRA 2JEJA 3HK2A 2BANA 3OPKA 4JV2A 1Q16B 2K3IA 2RS2A 1UFKA 2O1PA 4KYZA 5L46A 3Q2TC 4L3NA 4X4PA 2R3VA 2MY8A 4DFPA 3HHLA 1C4CA 1NMEB 4O4GA 4WK3A 5KT2A 4DV3F 4EO6A 1PGZA 1W7WA 1U2CA 2YKPA 2HRYA 2BABA 2BM1A 2KU7A 3PRVA 3R5DA 4ZVTB 2MGZB 3KLFB 1YZ7A 4ER8A 4ED2A 1SL0A 4OZ1A 4C3KA 2NPFA 2OPSA 1ICEB 4W4MA 2R2TA 4QCLA 3MOJB 1M0SA 1SIZA 2DHAA 2E29A 2M88A 3IRXA 3LAKA 1U0SA 2YWFA 4NPOA 1HNZJ 2W7OA 4M5DB 4DR5J 2AW0A 3AT1B 1FCAA 2MKYA 1IR2A 3R7NB 2C3OA 1SVDA 3DYAA 1RT5B 4UZCA 4LFAF 1JLGB 4AYBD 1T95A 3C6UB 2FGOA 4USJC 2NQPA 4ID5B 1S6QB 4HLBA 2YNHB 2XZDB 5BR8F 3CSKA 3OV7A 1MG7A 2VFTA 2IRXA 3ITHA 5L1JA 1SJFA 3FEYB 1WC3A 4EZ6A 4LIWA 4YFUA 2J9DE 4ECWA 3RAMA 3PY8A 4KT0C 1DLOB 3CNQP 3ZZZA 3AA9A 1HYSB 1T0TV 2FIUA 3TAMB 1CLFA 2XM3A 1XMOF 2GAGC 4UY8T 3PW0A 2EBEA 4GVBB 3LALA 2GAHC 6AT1B 2MSSA 2BJ3A 3LW5C 1VC6A 1M5PC 3L3CA 1IBKJ 3DLLQ 4WKRA 3CCES 4N77A 5IT9U 2MTLA 3FSXA 7FD1A 1ZYQA 3MXHP 1SKSA 1S6UA 2VPWB 4KB7A 4CQ1A 4DG1B 1PAUB 2DXEA 3MM7B 2DO0A 4WTYA 5IM0A 2R7QA 3MOZA 5I3UB 3IA0A 4CYUB 1VLYA 1T9TA 4IQMA 4ZHRB 3K5OA 4RZRA 1S76D 1VQ4S 1K0TA 4IO9Q 1NJYA 1UWAA 3I6PA 3THPA 1HBUB 1FD8A 3VAKA 3EX7B 3G8SA 3I32A 1RACB 5ETRA 1NPKA 3MWBA 1WNEA 3EGWB 3CGIA 1ZPWX 3DLJA 2V9KA 1T3OA 1CJUA 1X5SA 3MM5A 5A8WB 2QLFB 5J2MA 3Q89A 3WX8A 2ZE2B 2P6SA 4A8OA 2QN6B 1RHUB 3ENQA 3JXOA 1PILA 5KFOA 4OYOA 2VOOA 2POKA 3HT0A 2BE9B 1KHWA 4UQTA 2HS3A 4OI3A 2ZD1A 3MAAB 3K5NA 3Q8VA 2RE1A 4DXLA 1VRUA 3OVAA 1ZA2B 1RE1B 1CBKA 2XY6A 5D78A 1S48A 1RBOB 2DYAA 5C24A 1X5TA 1VISA 2A6MA 3D2WA 4DCPB 1V5VA 4NX9A 2V2ZA 3OTOF 2XMWA 2EFOA 3M7VA 5KG3A 1SJQA 4F4WA 2ZZMA 2OD4A 2PA3A 3KLIB 2QMUB 2HNDA 2BMBA 3OBIA 3CCMS 4XAKA 1EETA 2DR6A 5HANA 4WZQA 2DTJA 3RZAA 1N33F 4U9RA 1W25A 4IUFA 2J5AA 2ATLA 4OZ5A 4OYPA 1YBAA 3VQTA 3PW7A 5HQ8A 3GIRA 5IWAF 4JP8A 4F26A 2FD2A 2G0CA 5DLGA 5HMYA 4QWAA 1XQIA 3JTNA 1RTDA 1KONA 3K59A 4HACB 3HT3A 1YZ6A 3AA8A 2H54B 3MHYA 4IYQA 3BYRA 4NLWA 5FLXU 3U1LA 1S9EB 3ENVA 4LQ9A 1S1UB 3CW2C 4C8MA 2VPYB 2VKRA 4NZ7A 2E9TA 3D0GE 3TEHB 3N6NA 3FFIA 3O3LA 5F8HA 1B99A 2PI5A 2M5YA 3HFVA 5E3PA 1RCXB 1U26A 2V8PA 3VAGA 5M2RA 2UVVA 3MPWA 4LR8A 1HNIA 1RJJA 5K14A 1N5YB 4DSJA 4TKTA 1NXIA 2OSRA 1WC1A 1HNWF 3IMQJ 1S10A 3Q8QB 4ZDNA 1S0MA 3H4DA 2J0XA 4NCGA 2H4YB 1U0HB 4ZS6A 4ED3A 2FLLA 1RWUA 2ZM6F 4DR7F 2HVHA 2MZJA 4NLXA 5KFGA 2OEMA 2RQMA 3MGJA 4CM0A 1FRLA 2IA0A 3AD8C 4I6YA 4ZPTR 4JV0A 3TWZA 4ZOSA 1AFIA 3HD2A 4O23A 1TV6A 4C3LA 5IT9Y 2F63A 2W9CA 1UPMB 3D6HB 5F8IA 2BW7A 4N41A 1GQEA 1JLBA 4BWJA 4OI2A 1HMVB 1HARA 4QR0A 2R2UA 3EXCX 3T1HJ 3PX6A 1URNA 1OS5A 4PKDB 1S7IA 2XWYA 3DYAB 1GNKA 2RKIB 3MEGA 1RAIB 1VRTA 2C2NA 4QZVB 2V2KA 1VHFA 1XTZA 1S6QA 1Z2ZA 2ACYA 2CQIA 4A46A 5C2GA 3KOAA 3VZIA 4WF9Q 2J9DA 1JK9B 1KLMB 3BGRA 2C3PA 5IQ6A 3R5CA 4CLWA 5CCLA 2HFSA 5AXLA 1JJCB 3TUIC 5F9NA 3QJPA 1NNDA 1HYSA 2ZKTA 1X4DA 3M4XA 1HQUA 4WP3A 2JEGA 1N88A 4G6VB 1R89A 5E3CA 5LJ3Y 4LRDA 1RWMB 5KFRA 1HI0P 1S1VB 2IAJB 1ZM2A 2NYHA 3AB2B 2UUTA 1WKLA 4USIA 2BJ7A 3TVKA 4AUKA 2IYIA 1HNXF 1RAHB 3HDSA 3PR5B 4DSLA 1RTIB 1Y3KA 3CTRA 2AYBA 3U1MA 2HKEA 5A76A 4LRAA 3DHXA 4M5JA 4U6PA 4V19X 2UXBJ 3MUTP 2DEJA 2HQCA 1H2TZ 1H74A 3MM7A 2EFQA 1RU1A 4F36A 2ROEA 2DH8A 3PACA 1BE4A 1S77D 4BWMA 3ZZUA 2M7SA 2VG6A 1RQ0A 4RJVA 3VF0B 3OTEA 4JBCA 3GR1A 4IG0A 1WG5A 3M2RA 3G82B 3CPWR 2Q66A 4JYAJ 1FJGF 5M2UA 1WD6A 4HI1A 1JNZB 2B9XA 2WW4A 3MM5B 5A8WA 4TY8A 5J2MB 3AD9C 3TARA 2FVQA 3Q23A 4ECUA 4WCEQ 4PG5A 2G9OA 3FDSA 2BJ1A 3MEKA 3PG9A 1MU2B 1TK5A 2E5JA 3KDNA 1SQGA 2JVRA 4NASA 2ALZA 2I0XA 2RQ4A 2YX4A 4LIRA 1PG5B 3QT5A 1QTMA 2HS4A 2W4DA 2J6TA 3DLBA 2HK3A 1SC1B 2ZH2A 2W9BA 1WC5A 3GPAA 2BM0A 2LQBA 2H3EB 2DHGA 4P2MA 2YQ3A 5KFUA 3PFEA 2R7WA 1J2VA 5F0UA 1HNZF 2HNZB 4V19J 5EHHA 4Y2MA 1N52B 3CJQA 2JJ4D 3TX8A 2ASDA 2FPHX 3NGDA 4C11B 2FUG9 4I0WA 5CYMB 5DZ7A 1ZOTA 2XZWA 2J0QD 2JFDA 2MKCA 4DR4J 2H51B 2O3DA 4ZIWA 3FQLA 1U7LA 3MPVA 3NGTA 1GXLA 1H73A 1Q5VA 3NY0A 4MKBA 2ZOGA 3ET6A 2HHHJ 2BANB 4P2XA 3CCSS 3GP9A 4J9SA 2D3OR 4PYAA 1RXOB 2QYCA 3VAJA 4LF7J 4HACA 1OIAA 3N5FA 3DXBA 2FJEB 3HMJG 2XMVA 1TQLA 2QFIA 1IWGA 3ETMA 2IJNA 4EYIB 4DR4F 1S1UA 3K5PA 4HT5A 3TNVA 4MKVA 2UUCF 2UXCF 2R8GA 4M5IA 2CQBA 3MM8A 1FT8A 2NREA 3RJMB 2ASLA 2YNGA 2HWIA 2AWZA 3CCVS 4Q45A 1WI6A 4RW4B 4WIQA 4C6AA 4LF9F 4LF4J 3MM6A 2KI2A 4GC6A 3J7ZT 2HWTA 3DRXA 1PC5A 4ZCIA 2B3TB 2EC2A 5H9FJ 1GXUA 3ZZOA 2Z8QA 4ZVOB 3CUNA 4WJBA 4U7UK 2LKZA 2NUUG 2GIFA 1AXQA 3KHGA 1JLGA 3JS9A 4JI4J 2IVYA 1KRPA 4LMZA 5D4LA 4LFBJ 2NZ4A 4OIXA 1MN7A 2DGSA 3POTB 3LPYA 4ID5A 4URGA 2FZKB 2QT7A 2GFFA 2ZEJA 3DMJA 2YY3A 2HGLA 2OEJA 1FEHA 2XY7A 2B8QA 3ITHB 2VG5B 2HFOA 4ZLJA 4Q0BA 5L1LA 2LA6A 4KY3A 4JI2J 1HMVA 2ACMA 1B4SA 4A4JA 4ZK7M 5HVGA 2NSCA 4X4TA 1FJCA 2BZ2A 4U95A 1FD2A 2DHXA 2Q79A 5AE2A 4I6AA 3QLHA 3PNIA 1KP6A 3BGLA 3M6WA 3LWLA 3BS9A 2A1BA 1R8AA 5HATA 1N6QA 3JYTA 2WSFC 1LXJA 1KFDA 2KL8A 3JSYA 2U1AA 3KJFB 1KLMA 2Y1LB 4M94A 1CJTA 3W9JA 2K7KA 3BH6B 2X1BA 4I7FA 1QM9A 4PG6A 4DG1A 2NR0A 2UVWA 2CDQA 2VQFJ 2V8VA 2E9RX 4NLPA 3L09A 4R0EA 2RT3A 2OD6A 1HHTP 4ZPAA 4M5NA 1GX5A 2JVOA 1CJKB 2HQ3A 2DJWA 3BN7A 4RUCA 4K4SA 2HHTA 3KHRA 1S0OA 2DR8A 2E44A 2ZHOA 3FSIA 1KWMA 2MQQA 3LQVA 3IG1A 3IGVA 5DO2A 2MKSA 5IV4A 1CULB 1A6LA 1NCLA 2DXDA 3CEDA 5LMUF 4DFKA 2E9ZA 2X7IA 1REVA 1JLAA 3C19A 2UV8G 3NCRA 2CQ3A 4MK7A 1IJFB 1TMMA 2Z4PA 4NLUA 2C22A 3S1TA 2EBGA 5C24B 4ANDA 4HVZA 4ED0A 4DV4J 3EVMA 3I9ZA 4TY8B 5KOXA 2N3LA 4QWEA 2RAQA 4QYZJ 2X1AA 4A8YA 1FRXA 5HK4A 2ZHBA 1OY6A 3HF5A 4U7UD 2C3UA 4MMOA 1TK8A 3ZTQA 3MM9B 2A10A 5L8RC 1L3SA 1IKWA 2MLYA 3PIOQ 1M1KT 2N3OA 1G7CB 1UL3A 2HNYB 2GA7A 1NJXA 1DQ9A 3TO8A 3B54A 4U7CA 1UVLA 4TYAA 1K0VA 3PXGa 4CH0S 2LDIA 1X8DA 1KKHA 1VK3A 2I5JA 2MKJA 3M30B 1Y0HA 3OJUA 4JI6F 5HJXA 2P9EA 2J8SA 1IQZA 2JC1A 2W25A 2GMLA 1VQMS 1OSCA 1Q86T 4NYPA 4Y3CA 5HAOA 2FJDB 2KT3A 1NEEA 3LGHA 5KG6A 1I94J 5AXMA 2D3O1 2Y3YA 4L76A 3ICLA 4DCOB 2V50A 3CCWA 1YRTA 1B0TA 3KG0A 4B9UA 4M63A 1RWOB 1HWUA 3DGVA 4RBUA 2B43A 3ZZRA 1X4FA 3DU6A 4ZPDA 3BH7B 1T94A 2FHOB 2X1GA 3FFIB 4N47A 2GVDB 5L38A 4YDDB 2W9CB 4FYDA 3VR1A 2AJFE 4OYZA 2DNPA 2HK2A 2Q43A 5K14B 2XO6A 3ILJA 5ADZA 2YVSA 2XMAA 3MR3A 1GTHA 2MGZA 1YSJA 1VC0A 2DR7A 3NGSA 4UW2A 1REGX 5A2QY 4IRDA 3IN5A 1O5JA 2M8DB 1NSAA 2PEHA 4KHPJ 3HXMA 2F4FA 1NSQA 3FC9A 5RUBA 3O5TB 3LF0A 3QGGA 4LF2A 5I4MA 4M5DA 1ZM3A 1XNRF 1RBLA 2QSWA 1RABB 3CJRA 1CG2A 1RTJB 3CD6S 1TL5A 1HWKA 1TR0A 2HFNA 1WELA 2NXEA 3MM6B 2CVIA 4CO4A 2I2YA 3RW6A 1O51A 2F5GA 1JLBB 4ECTA 3HCXA 2BUNA 1RHJB 1VDHA 2GQQA 4B3MJ 4LRFA 3G6VA 2LXIA 5F8GA 3W5YA 5GAHU 4P2SA 2QA2A 5KFWA 4PPZA 1ZS6A 2AJ1A 3MEGB 1RKIA 3M8QB 1I94F 2HMIB 5KFJA 2XLJA 2CQ1A 3M1VB 4NA1A 4EBEA 3D4JA 1UPPA 4YR2A 3MD1A 3PDNA 1VRQC 2OMLA 2OUGA 2ZC3A 4PAAA 4QIWD 1DLOA 2FC9A 3SIPB 1FDNA 4EFAC 3EZOA 2ZBIA 3AOAA 5IC4B 7AT1B 3PJ9A 1M5VC 2VKZG 2B5JB 3PYGA 1VIXA 4DI6A 1S1WB 1LFPA 1Q1KA 2HQIA 4ZPWR 3R97A 1VMBA 4DV6J 2MY7A 2RJZA 4I4BA 1MN9A 1KOOA 2YNFA 5KFNA 5DG8A 2WVEA 3UW1A 4JV5J 2WBRA 2VZ9A 2QFJA 3I5CA 5B7WA 4DUZF 4DPTA 3SMZA 3FJ2A 4DEZA 2M8HA 3IXQA 2MKHA 3PHEA 1ZZNA 5BYSA 4ZHRA 1HNXJ 2MQPA 1U48A 2CZ4A 2MQOA 1JX4A 2Q3PA 3E3XA 5EX0A 3WZ0A 2CZVC 1RAOA 4X4SA 4NRUA 4R5PA 2DCUB 4EYHB 2XHWA 2V4QA 5A0YA 3U27A 3UCUP 2W7AA 1GTEA 1LK5A 4K7QA 3SFGA 3HKZD 4PEOA 2VICA 1VQ5S 4IG0B 4OJHA 1CJUB 3MFIA 5CYQA 3CJKB 1AROP 2VC0A 4DPOA 2KG1A 3SQOP 1R31A 1KDNA 4B02A 2A2DA 1N32J 2CPJA 1EZZB 3F44A 1IN0A 4RW7A 1KNZA 1S0VA 3IG1B 4J9VA 3J81j 2W24A 1WWHA 8AT1B 1SKUB 3IO1A 4PXEA 3K8VA 3LA0A 3D7SB 3K8WA 2QMXA 1HHQA 4Y2IA 3CC7S 1B0PA 2RRBA 2EWHA 2W4CA 4OJGA 5K9FA 1JJ2R 3A8IA 4ZJOA 3RR7A 2VONA 2PFFB 3D28A 4IR1A 2PE8A 1TL3A 2Y0SD 4USKA 5HMZA 2HNDB 2RH3A 5F8LA 1T05B 2ZKUA 4J9KA 4JI6J 2AV5A 3BBCA 4IDKA 3H0PA 4G3IA 1CJVA 4DZ6A 4DN9A 2HGMA 4DF4A 2B8PA 1NK7A 3T1YF 2C42A 3B78A 5B0EA 4WFZA 4ZP9A 4MIAA 1NJWA 2ZM6J 4B3TF 1VQSA 3G86A 1EQ0A 1V6HA 2EI5A 2ADBA 2WVDA 4NLDA 4OJ1A 5L39A 3UD3P 2P6TA 2XCAA 4EGLA 3H40A 1WTBA 1F9HA 3F0NA 4FPRA 1SXLA 1VQ6S 1CC8A 1RTZA 2C2ZB 2HAFA 4CZCA 2FVSA 4DPWA 2HSEB 2HVEA 2MJUA 3C14A 2IC3B 3NGKA 4NLSA 5D4NA 2VIHA 1NK0A 4K4ZA 2CQGA 2F1FA 3QFHA 4QYZK 1BUXA 2DNMA 2LXUA 4K50A 2G0JA 3IR5B 4KV8A 4B9MA 1P6TA 2ZH5A 4FPIA 2MZRA 4P71A 1YG0A 2YXLA 1JIHA 2J7WA 4WP9A 3H7HB 1QE1A 1KQKA 5KFYA 2KXNB 4A8SA 3OXGA 2MZQA 1N34F 1RADB 3M2UB 3MCNA 2GMJA 4WFXA 4JUZA 2ZVSA 3PEHA 1EKSA 3N6LA 4NMXA 3TJ8A 2D41A 2WAQD 2CA9A 1FWPA 5B0BA 1YITS 1RWNB 5ETMA 5EUHA 1Y5NB 5CD4A 4ECYA 4CCHA 4ELUA 1ITPA 2R4FA 7FDRA 4JB8B 5T7LA 2YWEA 2P8IA 4J9OA 5DLFA 5KFEA 2RHSB 3BKFA 4MK8A 3WIVA 4TXSA 1RT4B 3Q2SC 3BDEA 1VRTB 3BM7A 2VF3A 2AZ3A 3FGVA 4UF4A 5GAGI 3S6EA 4YQWA 4O4RA 5ETPA 1QTNB 1YJUA 3NBPB 1GT8A 3NL0A 1S49A 1QDUB 3BBBA 2WCXA 4FVMA 4KFBA 3T3FA 1R6YA 2B9YA 2V8DA 3CE8A 3NP5A 2CNOB 4A47A 1F6TA 3OL9A 2LQ8A 3PW2A 4I7FB 5B0AA 2FVPA 1HQUB 2JFKA 1FNXH 2RUSA 3C15B 3GILA 5J1NA 3D9BA 4EO8A 1RHRB 3JTPA 3AQOA 1L3KA 3IAM9 1FX2A 1HBMB 1FKPB 1U1NA 1SBRA 1EQMA 1D8YA 5E3AA 2ZH8A 1QLNA 1I3OB 4CRJA 3PX0A 3AFGA 1VQ9S 4M5LA 1Q8LA 2OEKA 3VGVA 4FS1A 1CSJA 4FYXB 4WBFA 3Q8RB 2DCLA 4WXWA 3HFZB 3DRRB 1TL4A 3EVOA 3GR0A 4NLRA 5E3RA 2DRDA 1HLWA 4MK9A 3US5A 1H38A 4OL8A 4FF4A 4ZCLA 1LOUA 1X5OA 3FNNA 5GAEI 1DBDA 1WSVA 1REVB 1BQMB 3QO9A 4G65A 4IKAA 3PIPQ 4EBDA 2DGXA 1P8GA 3R5JB 3CJKA 4HHUA 2XULA 1TAUA 4ES1A 4DMZA 1R0AB 3K89A 4CIOA 1J5OA 4QW8A 2AYMA 1V5IB 2BOAA 4RW7B 1Y5LB 3CC2S 3PRBA 3ISZA 1T3NA 3MM9A 3IM8A 3RRKA 5ETTA 1KD1T 2CQ4A 2E5IA 2WONA 3A4TA 1JLEB 5HLFA 2HNYA 1O6XA 2VBZA 1S4FA 1EHWA 3NS6A 2WVCA 2FGCA 1BWVA 1TUVA 4DX5A 2PFDA 5DGAA 2W9AA 4J9PA 5KT5A 1Z4UA 2V6AA 2BXJA 1WF2A 2VD3A 2LCWA 4IDKB 1SJ3P 3DC2A 4DL6A 4C8OA 2G2YA 2J9CA 2WSEC 3I5BA 5D0EA 3T5HA 1Y00A 1C4AA 3PJWA 1BD6A 3M6XA 1HI1A 5J2NB 3MAHA 3VALA 5CXTA 1XIQA 3ET6B 1XWLA 4I2PA 1IBLJ 3BKTA 3N6MA 4AL5A 3FZBA 4KH1B 4AFFA 4B9SA 2ADCA 1DURA 6FD1A 2L41A 2DGQA 3M05A 2J6SA 1BY9A 2Z2YB 4WIIA 4USMA 4WFBQ 2Y8YA 3GJTB 2Z0GA 2EG2A 2AF6A 2RDDA 3OTOJ 3W64A 1EP4B 1KTVA 2DGUA 3C14B 3QWUA 2IC3A 2KKHA 5HVFA 4DV0J 3NNAA 4YEAA 1SL1A 2YNGB 2IIHA 5C5JA 4JI8J 4I2QA 4M5GA 1RTHA 1WJ9A 4RW4A 1FK9A 3HHKA 4KE5A 3GJQB 4DN0A 3O6QA 3THVA 1T02A 3M8YA 2L9NA 2MZSA 2XTJP 4K2JA 5BYQA 1W2IA 3RGIA 1VBYA 2IMWP 4RW8A 4BS2A 3OFEA 3E2EA 4GMKA 1RTJA 2RU9A 2ZZTA 3GYNA 2NLWA 1DTQA 3B6BA 2CQDA 3T1AA 1BMQB 2E1PA 1ZPVA 2DHSA 2M4MA 4C0HA 1HWIA 5KFBA 1Q8IA 1YJ7A 4DL7A 1UFWA 4TNOA 1TKZB 1M90T 4ELVA 2CPDA 1IQTA 2YH0A 4F3MA 1GX6A 3DMJB 1NH8A 2DITA 1IR0A 2ZBQA 4I67A 3M8PB 2KH9A 2G0IA 2AHOB 3ZXWA 1FKAF 4YN3B 5T7LB 2RF2A 3WQPA 4YS2A 1YJ9S 2VDIA 2O01C 4HHJA 1HR0J 4PWDA 3NAIA 2KO1A 2FJAB 2A6OA 3DOLA 2NXUA 4B17A 1K1SA 1QSSA 3GFYA 3EPIA 4USWA 3QATA 4B3OA 1S6OA 4XO0A 2Q6BA 2IHR1 3SDEB 5LMUJ 2XMUA 1X4EA 1PCAA 1OY9A 2EEYA 4LBPA 3W1YC 3VAMA 1QY7A 3VQSA 4ECXA 3IM9A 4KBIA 3CC4S 4A8FA 4W92B 3CJ0A 2E66A 3CJSA 3EYZA 4KGXB 1F9EB 4DUZJ 3V2UC 3QSYB 4OV6A 4DL3A 4ED7A 3RRGA 4JI0F 2WB4A 3AJDA 5J2QA 1AB8A 1NUEA 5HMXA 3GLJA 4AXJA 2HW3A 2DXFA 2RDJA 1YJVA 2CPFA 3DKDA 2AKWB 4R5PB 2OH2A 3MR2A 4YB6A 1WSRA 2FJVA 2OTLS 3CDWA 1NB2A 3U7JA 1FKPA 1LV5A 4X4OA 2J9EA 3BYPA 3VGSA 5CYQB 1FRHA 2FZCB 3B4DA 5HJYA 4PR6A 1FFGB 4KH0B 4Y6IA 4OMFG 2RU3A 3KNAA 3DOKB 2W2MP 1AT1B 3DRRA 3VTIA 5KT6A 5LSLA 4CM2A 1MWQA 1HBNA 2A2CA 3HSDA 5LL6d 2OHDA 5DZ6A 2LXFA 3MURP 4EWTA 4KHRA 4C0OC 1N0VC 2Y8WA 4DR1J 4OZ2A 3T5LA 1U49A 2G2OA 3GQCA 1VBXA 5D3GA 1FVSA 3HHNB 4DJBA 4DX6A 1AA1B 5IT0A 2FDNA 4O0IA 1IXKA 3DDIA 2VJVA 1HNVA 2OSQA 2G1HA 3BJYA 2FYXA 2H1YA 2MJNA 2YWGA 3A13A 2GIRA 3CT9A 3RW7A 3KK2A 4F4ZA 4MIWA 2DPIA 2KFNA 4M95A 3JQKA 2W8KA 1CJVB 4QWBA 3DLKB 1KS2A 2ROGA 4KO0A 4N5SA 4USVA 1HL6A 2DK2A 2JH3A 2WVFA 5GMKa 5HLFB 4TQRA 1N36J 2I5JB 4DV5F 4CNZA 1NKCA 1JWWA 4DR1F 3MTJA 4ZP8A 2KXHA 4LR7A 2JL9A 4FXVA 2JLEA 3CMES 1LWFB 2D9OA 4J9UE 4NA2A 2DNQA 4HDGA 5HBMB 4WE1A 2D9PA 2VQEJ 4JI5F 4WFYA 4LF9J 4HL9A 4H4MB 5CAAA 5F8NA 2G4BA 5HL7Q 1YTYA 2XS2A 1WACA 1HR0F 4DX7A 2RRNA 4DV5J 4N76A 1SQEA 1NRKA 2PGCA 3VAIA 4CH7A 3N28A 2GQ2A 4OI0A 1EIYB 2ZUGA 4LSLB 4HYKA 2E5GA 3QPIA 5HQMA 4KR0B 3G6ES 3ZTRA 5JJBA 1UEKA 4O44A 3JAMY 3NEKA 1Y4ZB 2VH7A 3MZIA 2W01A 3M2UA 4FYWB 2DIVA 2D3ZA 3BR9A 2XEXA 3HJFA 1H0HB 2QJ3A 2VG7A 2XYGB 4YUDA 2AGQA 2OFHX 1GMVA 2HZAA 5KFHA 3IRXB 3OFHA 5GADI 2XCPA 3TVYA 5GAHI 1R8PA 3GFZA 3O2IA 1J27A 1VYAA 2R42A 3HO1A 5GAEU 4RX6A 2R7OA 4DOZA 1RT5A 3R9LA 4CO0A 3CJ4A 2KXFA 2QLWA 3A8EA 1RT4A 2GO9A 4Y0FA 3M8QA 3UN2A 4RU9A 3I9V9 3DM2B 2OELA 2GQCA 3C6UA 3BR8A 3DN9A 2BEFA 1YK9A 2ZNZA 5HMWA 3CULA 1OQ3A 3PKMA 2CJQA 5B0DA 1VR6A 1Z1ZA 3B82A 4B3TJ 4LF5J 1KQFB 1PBUA 2RF2B 4F25A 2B5JA 3TAQA 2N4DA 3ZZTA 1VJWA 3MCSA 1S1WA 3GJRB 4KGZB 5CZVA 2ALYB 8ATCB 4JI0J 3TZXA 4F67A 2OIHA 2YNFB 5B0CA 1UWBB 4I56A 4CLLA 1U1OA 2VA2A 5E3QA 1HW9A 2XBPA 3KMSA 4DS5A 1XR7A 3ONQA 2E7WA 4ZVHA 4X62J 2W4PA 3THTA 4F50A 1HBMA 4Q44A 3D5MA 2KDOA 1RCOB 1P1LA 3ZZYA 5BXIA 1OPIA 4DSIA 4CTAA 5J2QB 5HSPA 3ISNC 1F5CA 5IWAJ 3VGUA 1PO6A 1IBMF 3G6XA 4DPXA 2M52A 4E0DA 4FKXA 4DCJB 4HKQA 1L3TA 3MMBA 4D3GA 1F5BA 4ZA1A 1E6YA 4NLVA 5KTQA 3KLGA 1OYEA 4KTQA 2HURA 4P72A 2UZAA 3T1YJ 1IBLF 1NSKL 3A8KA 3BF4A 2CNKB 3KLVA 5D8HB 2BJ9A 3F73A 2PEBA 4LBIA 3SZ2A 1FX4A 3R5BA 4QR1A 1UVNA 4RNHA 5F41A 4A48A 4LRBA 1F1BB 4WYLA 2V4RA 5GAGU 1N5VA 3NKYA 2YH1A 1VRUB 4P73A 5HI7A 4MIBA 4Q2LA 1SC6A 4TYBA 1Y10A 1LKZA 4DQIA 3NOCA 1XMQJ 2BRLA 3CO0P 1TL3B 4JI8F 2I6WA 3J7YU 4RLEA 3BGFA 2R2RA 2BRKA 1IKVA 3BZQA 4OX7A 1BLUA 5HROB 1VCTA 4FKYA 3AY0A 3B4MA 1JQGA 2VL1A 3IWLA 2B9EA 1U6BA 4L73A 4KPYA 4W98A 2PT0A 3IR7B 3IS9A 2ZJPQ 4K0KJ 3IAS9 2K7JA 4F0MA 3G2XA 4KO0B 2ZUAA 2J6UA 4U67Q 1P9QC 4KAIA 3BV8A 4I2PB 1ZAVA 4ID8A 3KK1A 2VFUA 2AU0A 4WYWA 1M5SA 2PA8D 1RHMB 4RBTA 4FNIA 1NZ8A 1WOPA 1JXVA 2CZ9A 4OYIA 4P10A 3OVBA 2ZH9A 3P45B 2M3DA 1RUSA 1UVKA 3TQEA 2FZGB 1TKTA 1HIYA 1BGXT 2KVQE 3MPUB 2CAJA 5ETKA 2KFYA 1KEKA 1RTHB 2QL5B 1QE1B 3SV4A 1D3WA 3M2VA 4H4OB 1FE0A 2CQHA 2XG8A 2YKNA 3LGNA 5F3TA 1BQNB 1RT1A 2JZ5A 2DEIA 3JAMU 1CQNA 3KLEB 2YKQA 2ZWPA 3ZO7A 3OSPA 2AD9A 3L95X 1X9MA 4X4VA 4ECRA 4RUAA 2AJ4A 2V94A 3GV5B 9RUBA 2MEWA 3N01A 4IH5A 4NRTA 2JLGA 3CCUS 1UVIA 1A9NB 3HKWA 3H20A 1WC0A 1Q95G 3QNWB 2VG7B 3CMAS 3TX0A 1RZMA 1OYDA 1R0CB 4L3KA 2OPPA 3QIPA 3SSQA 1PYTA 3GSIA 3T5KA 4LF8J 3OXFA 4YB7A 3RR8A 3TOQA 3K2YA 1FWKA 2BYCA 2B51A 3AOBA 1FWLA 4U8YA 3JSRA 3LGMA 5CABA 3RAXA 4CDIA 2HZVA 5FJ4A 1K9MT 4B3OB 1U4BA 3W61A 2CNNB 2XQCA 2QX0A 2GJFA 4KGMA 4R8UB 4GO7X 1X4CA 2QV6A 2AX1A 3BKUA 1KSPA 1NK4A 1SKRA 5JMNA 4S0MA 2RD5C 1VI7A 2BA9A 2J76E 2CQPA 3SBMA 3R6LB 2HQDA 3ULHA 1UA0A 2F4VF 3OXLA 2BVZA 3L4BC 3TYTA 1R8BA 2PC6A 3R1HA 2COLA 3C15A 4QJVA 5D0RA 2HS0A 1V3SA 1G2EA 3E01A 4L75A 4TU8A 3R1LA 1B70B 1W2BR 1PSDA 4R0JA 1TAQA 4QBUA 2DGTA 2SXLA 5C42A 4X4QA 3LP2A 2KM8B 4DQQA 5D4PA 4F2RA 2E1RA 1U02A 5CA5A 3RBEA 1M1HA 5AE3A 4Z37A 1WI8A 2CWKA 3T9ZA 4BHQA 8RUCA 5IFMA 3PW4A 1X0FA 4F4XA 1U1KA 3TA0A 2CJBA 3CDUA 3DOKA 3W2VA 4CTAB 2XB2D 2UVRA 3UWTA 3CCLS 3LP0B 1IBKF 1JLQB 1JMTA 3QO9B 3EZUA 4PQAA 1YGYA 2F3JA 3M2RB 2C2DA 1KQGB 1DRZA 1KHVA 1RISA 3D54A 4PG8A 4DV6F 1U1QA 3FZ2A 4I1TA 1RGVA 4CNYA 2H65B 3QT8A 5CZXA 1R0BG 3TUJC 4K4TA 2E1AA 2HEKA 4EZ9A 2IVMA 2VBXA 3DOMA 3KK2B 2HVIA 1NDCA 1NHUA 4UY85 2F8HA 3NWRA 3UD4P 4CP5A 1JLEA 3FCWA 4OV1A 3K57A 4MAKA 2O66A 1SJ4P 5KFCA 4NI2A 1RYSA 2CKWA 3DLKA 3P4UB 3X1LB 2OP5A 1OJ4A 1B64A 4LF6F 1FKOA 3TJAA 2AJ2A 2JC0A 5FDLB 1X9WA 2KHCA 1RAEB 3GU0A 2MPUA 2FHJD 2HNZA 1YJTA 4ETZA 4QWDA 4JI1F 4Q8EA 3EUNA 1H2VZ 1UJ6A 2V67A 2RNEA 5D6GA 4WE1B 3PVXA 5J2NA 1NH7A 2HAIA 4C11A 3RTVA 2YKMA 3SSSA 1N48A 1VFJA 4LF1A 4CO1A 3H25A 4C8ZA 3NS7B 3UN5A 3EXYA 3OFFA 3NMRA 1TMJA 3R3TA 5LJ5Y 4M5KA 4ZP6A 4PUOB 2DNOA 2HFVA 2BQUA 4NZ6A 4DU8A 1WDDA 2XNRA 3M9MB 2GJ2A 4PXBA 2QO3A 2OLWA 4ZVGA 2LQJA 2RQKA 2F8EX 3AJ2A 4FVCA 3C3LA 4LF5F 2H4WB 3W63A 2M70A 2HHHF 3EGVA 3MTKA 3GFXA 1P1TA 2OPQB 2AYEA 2IFXA 2EW9A 3LH2S 3NXZA 4NE9C 4O44B 5L1IA 2ABYA 1T8EA 2DGWA 2MYFA 4H4KA 4X66J 4I2QB 5DDPC 5T41A 4K4WA 4OYAA 1SPBP 1YRXA 2CIMA 3BN4A 1E6VA 3MM8B 4OYMA 4QQBA 1NAQA 1PYOB 3UVJA 2J8AA 2X3GA 2XSJB 2NUHA 1NJZA 4TY9A 3F56A 2MSTA 3AJ1A 3I87A 1EKRA 3PX4A 2UUCJ 2WRMA 3M2VB 3LTOA 4FZVA 4H4OA 2QLBB 5THWA 1RT1B 1PYSB 4TLQA 3DLGA 5AJ3J 1UJ5A 4RWXA 1C2PA 4F02A 2FLOA 4G1IA 2RMLA 4UZBA 1TKZA 2YQ0A 4G1PA 4RUHA 2CFXA 2DRAA 1N32F 3K58A 4LSNB 2KYZA 2XMTA 3DM2A 4TU7A 3I56S 1V3RA 2GGPA 3K17A 1F2HA 1UP1A 4J7CA 2YTCA 3POTA 1H2UX 4UUXA 5KG4A 3ZTPA 4ZLLA 2MQ8A 1DQAA 2R7TA 1RWWB 4RL1A 4DR7J 2ZBRA 3MMAB 2VG5A 3CB4A 4X64F 4EI2A 3VAHA 4IRCA 4Q0BB 1K1QA 4Y2KA 1KR4A 1R7IA 4N8NA 3BEGB 4IR9A 2DVIA 3ZTSA 1UETA 2BR0A 3ZNUA 1MMLA 2AMCB 2EFGA 2ZITA 3SQGA 2RDIA 2DD8S 2K06A 2CQ2A 2ZDOA 4PG7A 3TW0A 3ZC4A 4F0KA 4YY3F 3RG6A 2HHVA 3OR2B 1LWEA 4CO2A 3JYTB 3Q83A 1HW8A 3HSGA 4P2FA 3GV8B 3T1HF 2CXEA 5J2PB 4X62F 1CJTB 1T9VA 5DG7A 2Z30B 1VHIA 5IC6B 5DQIA 4DSFA 5B08A 4QOTA 2VFVA 3U1NA 2E7VA 4FF2A 2KVIA 3KXDA 3VVTA 4OZNA 1JB0C 1NKEA 3QIDA 2NZCA 4YR3A 2V9WA 3EE3A 4RR5A 2GO8A 2FVRA 4AQYF 1S6PB 1Q7LB 2R7RA 2N82B 4OQJA 5K5MA 4USUA 2BE7D 2VPXB 2VFSA 3C6TB 5KG0A 1NM2A 3ZZPA 4JI4F 1U8WA 1MMNA 1NSPA 1PBAA 2ZVIA 4DUYF 1Y7PA 3HLUA 3LP0A 2GCFA 2UVUA 1WG1A 3ZTOA 3JSBA 5KFPA 1JLAB 1NDKA 3I0RB 5D3GB 4DPUA 4P52A 1U1RA 2C2RA 1VQNS 1RLCL 1IM4A 2PD1A 3QT7A 4I64A 1XR5A 2DY1A 2WOMB 4JI7F 5B0GA 4ZMMA 2OI2A 1XMQF 2NXJA 5A8KB 1FF2A 2ZFHA 4IH6A 4KHPF 5BJRA 2Y9HA 1SJRA 3DRSB 2N4CA 2Z2MA 4AXIA 4DV7J 2CADA 1YIJS 1Z2LA 1U1LA 2R7UA 5L9NA 3HVTA 2EC0A 3FRYA 3FCHA 3C16A 1IKWB 3PW5A 1S99A 1TUWA 2FY8A 4DV4F 3EMTA 4ES2A 4ED5A 4NI2B 3GIIA 1JLCA 5CH7B 3CCRS 2WSCC 3MDFA 1JJ4A 2HBZB 3IWXA 2HBYB 2GW8A 5J1EA 4DR6F 3M30A 5SUHA 1HI8A 1FHTA 4I68A 5HBMA 3K5MA 4XDDA 2JDJA 1T03B 1WKKA 2ATCB 2HPUA 2FJBB 3KJQB 4O3SA 3SCJE 2ZZNA 2K3KA 1TL7B 4O3PA 3QGHA 1PIEA 5KFSA 2WTFA 2PIIA 1ROFA 3MEEA 2QYGA 2AJ0A 2XGPA 5LMNF 2APOA 3KG4A 2B6AB 4ZN1A 2HHPA 1WC4A 4RW9A 3LWMA 2B0GA 2GVDA 3FK4A 1WDTA 2WZ1A 2Y0BB 2Z58B 4DUTA 2ZOFA 4OYXA 2CPHA 2W1BA 2FJWA 1RT6A 3FEZA 1NU4A 5MLCV 1FRKA 2YKNB 1UKUA 3Q22A 2HLTA 3KLEA 3NCPA 2UUAF 1U8SA 2OPQA 4DPYA 2W8LA 1VQOS 4OX9J 1QVFR 2Z57B 4NWBA 1TU0B 2OAUA 3U02A 5DDQC 1KVKA 4YDXA 1YBTA 2JEFA 4LBHA 1FTRA 4ZKAA 3QYYA 2B4PA 4RPFA
chains in the Genus database with same CATH topology
3RB3A 1GAOA 3LP1B 4ECVA 3DDNA 3TA1A 2OPPB 5M2PA 3ZFVA 1U1MA 2D7SA 3VZHA 4X4RA 1CEZA 4C4WA 3I0SB 2ZBCA 2RVJA 2DRBA 3OFGA 5CCMA 1RA7A 3M1VA 3P96A 3H5XA 1G3OA 5J1PA 2BQ3A 4DHVA 3TANA 1SH3A 1DQ8A 1R27B 1UFLA 3SEOA 5B0FA 3W2WB 4UQGA 1GXTA 2P5VA 2Y1RI 4LFBF 4DSKA 2E7XA 2BW2A 2XMJA 4DBQA 3LUYA 1KFSA 3KWMA 2G1DA 4C8YA 4JI3F 5L1KA 2DR5A 2AYGA 2BDPA 2CPXA 3AQPA 4RNOA 4J9RA 2K2PA 4QIFA 2NSBA 1KC8T 5CD4H 3I55S 4Y00A 5KFVA 4DR2F 4EU0A 3LP2B 5J2PA 3O8WA 4NZ0A 3GB0A 3I96A 2M0GB 3NS5A 3J7A1 1TVRA 3H5YA 2Y1IA 4WZMA 4NLQA 3L7OA 4CO5A 3HM9A 3MMBB 1NK0A 5I42B 2A3JA 2K8GA 4NL5A 5A0YB 5D77A 1QJHA 3HZEA 1JLQA 3V6HA 1VQKS 1KTQA 2HVZA 4L72B 3MR5A 4DV1F 3H2LA 2O67A 2ZDPA 4IG3B 1S6PA 2M2BA 5LXYA 1IKYB 3SCKE 2L3MA 1H7XA 3PM9A 2J7KA 1YHQS 1X4GA 1N36F 3LO3A 3FVYA 1NB7A 4L6V3 1VQ7S 4B3SF 1OPZA 2AQ4A 2HHQA 1YJNS 4KKOA 1UAWA 3FSYA 1LW2B 3T6JA 2L9WA 3W7BA 2FHMA 3RBDA 2IM3A 3MD3A 3HHEA 4UUWA 1WEZA 1IKVB 2DNGA 2XMMA 1KN6A 1YJRA 4B9TA 1VOMA 2WOMA 1P27B 2VV5A 4NLTA 3ISND 4RKUC 2DNLA 5FDLA 5G0RA 3HVWA 2QRRA 3IS9B 1S1XB 2K1RA 3MUVP 1KVJA 1S9GB 1WF1A 4XPCA 2ZH3A 2PMZD 4CI0B 2J7UA 1VC5A 1LW0A 4C7QA 4DF8A 3L7PA 1JLCB 5L9XA 3CD7A 5KG5A 3KK1B 3OTDA 2EFVA 3SFUA 5B09A 1HD0A 2RUGA 1SH0A 4PQUB 4OI1A 4N8OA 5KT4A 2GJIA 2WHOA 3MPYA 1J5EF 3GSDA 4HI2A 4OZ0A 1RK8A 1WHVA 3JSMA 1SH2A 3D0IE 2WB1D 4E8UA 1TKTB 1C1CA 2XMKA 3T9NA 1HQEA 3Q8PB 1L3UA 1XNQF 2OFGX 3OVSA 1RP5A 2IYGA 3TA2A 3O44A 3N9UC 2XGQA 3QJJA 3OW2R 1NHVA 1C0TB 1XN9A 4RW9B 2DNYA 3OTBA 2AX0A 1S1TA 4NXNF 4KJIA 2J0WA 4OHYA 1FE4A 2OKQA 1RT6B 5T14A 1NJIT 3NNCA 4RW6B 4B9VA 3HHLC 3MF5A 2DPJA 2FJXA 4MH8A 2JX2A 3RAQA 1FNMA 4FS2A 2GC8A 4C2MA 5KFIA 2P9GA 2LMIA 4G1QB 3DRPB 4LSNA 1XMBA 2XO7A 3S7RA 2CJAA 2FY1A 4PG4A 3P49B 3LANA 3KHLA 4FNHA 4URQU 1XK8A 3VAFA 4MYTA 3WBZA 5DG9A 1YI2S 3PO4A 3MMAA 4Q7AA 5FLXY 3GG1A 3UQSA 1CQMA 3I0SA 4C0BA 4EBCA 3SI8A 1APSA 4F4KA 1DAXA 3X3UA 2B56A 4R8UA 4TN2A 4GKKF 4OI4A 1MW7A 4WU2A 1VS3A 1UMJA 4E98A 5LSOA 1X7VA 5KFFA 4DLEA 1ZH5A 3OR2A 3NBPA 4B9LA 2KRRA 1MMDA 4KFBB 4ICLA 4QR2A 1DTTB 3TP2A 3H2VE 4Q43A 3VWSA 1X5PA 5EWGA 2L48A 3QZ8A 3GYXB 1C0UA 2AJQA 5DDOC 1WHWA 5KFAA 2ILYA 3E01B 4P6QA 4IFVA 2VC1A 1N8RT 5C42B 3NLCA 4NA3A 3N4WA 3TAPA 4Q5VA 4IO1A 3G4SS 1GH8A 1DZ5A 2QIFA 2RB7A 5IS2A 3NNHA 2MZTA 2CPIA 5F3ZA 1FXDA 2UU9F 4HTJA 3W2VB 1FJEB 4DQSA 3DFEA 2DH7A 5JXSA 3AHPA 3C6TA 1TVRB 1XEZA 5LSRA 3OSNA 4F3OA 2HGNA 2QA4G 5EGYA 1TP7A 4NXMF 2ASYA 2VODA 2EVZA 1HFEL 3FMWA 3I0RA 2DO4A 4NCAA 3P3DA 3KFWX 1TK0A 2X1FA 2R7VA 2ZHAA 1O0PA 3GIMA 3MECB 2R7XA 3B8HA 4JOUA 1U2RA 4KIAA 5G4DA 3V6KA 2QSFA 3HVTB 4KKOB 2WONB 5JUMA 2B9WA 2R9LA 4RU2A 3FQKA 3NRBA 1D8ZA 3V4MA 5AXKA 3OHAA 1JXEA 4I6WA 3OUYB 5J1EB 1OWXA 4D3HA 3UFCX 2ZD1B 3BQ1A 1JLFB 4OI6A 3DRYA 1ZTTA 2BV3A 2DGVA 2YKMB 2B7CB 4IH7A 2IRUA 4O3RA 1QVGR 5KT7A 4LJMA 1QSYA 1VK8A 2DNRA 2XI2A 4AE5A 4PUOA 4KRWA 2RRAA 1UVJA 3RB0A 5A6WA 4QPXA 4MKAA 1S0NA 2HHUA 4MFBB 1U45A 1D9DA 3GZ7A 5E0OA 3CCJS 1S9FA 2V0NA 3HZGA 2ZH6A 4IRKA 1BC6A 5JVHQ 3CO9A 2H9ZA 4DL4A 4FF1A 3Q24A 3EGNA 2LA4A 2OJ3A 1FDBA 4C98A 2XLKA 3CDEA 2MZ1A 3G9CA 4WXOA 3G96A 1E6VB 1U1PA 4AL7A 1N0UA 3TQ1A 3SYZA 1LWCA 5LT5A 5EWFA 4IFYA 3UDCA 2LVWA 3IWNC 2BBEA 3SXLA 4ED1A 1Q7YT 4DLGA 1M5KC 3SCIE 1DTQB 3HPOA 2CQ0A 2D74B 4RW6A 4NLYA 2YX1A 4QIGA 4QIEA 5K8PA 4USHA 5EWEA 1LXNA 1NK6A 3J7YI 1VQYA 2VFRA 4YOEA 2YKOA 5FD1A 2ZH7A 3DLHA 5U47A 3BQ0A 4ZPVR 1FRIA 4ED6A 1C1BB 1U6ZA 2NPIA 4DL0C 4TLRA 3DCAA 3W2WA 4PWDB 1X4AA 1TV6B 4PWUA 3BSAA 3DOLB 3SQGB 4ILLA 2XI3A 4LQ3A 1U24A 2I9SA 3JB9k 6FDRA 2GNKA 2IM2A 1YQHA 4AL6A 5AXNA 2D3UA 3DLEA 1YWXA 5KFZA 4K5RA 3K5LA 1LFWA 2EKYA 1K73T 1CC7A 4ICLB 2JWNA 1WEYA 2LLZA 2HG4A 4X84A 3T6BA 2XLIA 1MWZA 1HBOA 2HIQA 3F41A 2LEAA 4GC7A 2EK1A 3V4IA 1WEXA 1FJ7A 1ZM9A 2LU1A 3JTOA 5A8RA 5I3QA 3CVKA 3OTCA 5E7OB 1X9SA 3KK3A 3V6DB 1M5HA 4ZVFA 2FHJA 2LQ5A 4A8XA 2CPEA 4IG3A 4DV2F 1VGYA 4HH1A 1IKYA 2EPIA 3M6UA 3M9NB 3CJ5A 4XIUA 1BQXA 1H3DA 3Q0AA 2MKIA 2PN6A 3R27A 1R3NA 3CCTA 2XC9A 4QU7A 1LW2A 2ROPA 2PO4A 3KNGA 2VONA 1FXRA 2G13A 4BC7A 5IQQA 1CVJA 5H9EJ 2E5HA 3G8QA 3CDAA 1L3VA 4LF7F 3DRSA 1IUJA 1HNVB 2V5HG 5DM6Q 2MXYA 5SZTA 5G0RB 3KLHA 2MB0B 1AFJA 1IKXA 1S1XA 4ZCMA 2HHXA 2E1CA 4IOBA 4Z2XA 4DL2A 1S9GA 3NWGA 1A7GE 3MFHA 3DNCA 4QYRA 2R7SA 1RT2A 4OHVA 3WC2A 4JV1A 4O3NA 2R2SA 2DBBA 1MU2A 3OQ2A 2FB0A 1T03A 1LWFA 1I6JA 2AGPA 2QEXS 3C46A 5F0WA 3AB4B 2HLUA 4ZPBA 3CXCR 4BC9A 4H4MA 1VQPS 3JSMB 3M6VA 4QW9A 2C3MA 5K8OA 1C1CB 4PXDA 5HO4A 1HQEB 4NYZA 2XWXA 3DI6A 3UNGC 5DGBA 2R8JA 4YP3A 2VQEF 2MHEA 5IXUA 1C0TA 4MFBA 2KJWA 4NLOA 1TFYA 4LSLA 3BB5A 1FO1A 4OZLA 3SSRA 4OLPA 3CF5Q 1RI7A 4OFZA 2ILZA 1JKHB 3ETOA 4RNNA 3D1HA 3GIJA 1WG4A 4LUBA 2V4JA 4P7TA 2HHWA 2CG4A 1H6KX 2NS1B 1YRUA 2CVEA 4K4UA 3LP1A 3N5BA 2IBOA 1MNEA 2W7PA 1ZM4A 1U09A 3WDOA 4CH1A 1L5UA 1QUVA 4CT9A 3OLAA 3BO4A 3QMQA 4MJKA 2N7YA 1G2EA 2GMHA 2F9JA 1D9FA 2LECA 3KMQA 3I4PA 1IJEB 3BSCA 2FLPA 2M9KA 4PXCA 2EK6A 3PJXA 2ZH1A 1HA1A 5DETA 1ZTWA 2GHWA 4X66F 5AE1A 5F9LA 3A1YG 3H5UA 1VIOA 1WHYA 2V8GA 1DTTA 3S01A 5E2QA 4YB5A 3UR3C 4FN5A 5E33A 2UUWA 1UWBA 1SV5B 3I4HX 5KFLA 1NK5A 1YVFA 1U47A 4LFCF 5K8MA 5BYRA 1V3ZA 3Q8SB 2KB2A 5MAOA 4PCQA 3DLEB 1LQ9A 3W3SA 3DGPA 2UUBF 3QLHB 4YR0A 1QAIA 2Z2LA 4DS4A 1WF0A 1R8HA 5LXRA 2DISA 1HBOB 5I42A 1KQSR 1N6QB 3GIKA 2QZ8A 5A8RB 2MKKA 3UCZP 4LF8F 1E6YB 3KLGB 3BO2A 3MMCA 4TQSA 1S72S 1RKJA 3HVRA 3J7Z5 4FBUA 4C8NA 2LEPA 2KG0A 3KJVB 2LQ9A 3TVZA 3CIZA 4J9LA 4K4YA 1S97A 1ZAWA 1N5QA 4M8LA 2OO4A 3MAQA 3MECA 2VBWA 3MEDB 5KFMA 4ECSA 2IBKA 1MSWD 1RT3A 3NAHA 2LDYA 3FMBA 5DRKA 3TR5A 1MROB 1UW4A 5HP1B 1X4HA 4C8KA 2WK4A 5AJ3F 3PV8A 4PPDA 1NKBA 2Y1JA 3K7RA 2IA6A 5HROA 1UEUA 1FXLA 2B4OA 1R43A 3GE9A 1UEVA 4GKJF 5KFTA 4HH0A 3PR4A 4Y28C 2B4VA 4F8RA 3IGNA 3M32B 2I8EA 3UE2A 5EDWA 1RT2B 3EZ5A 2JRSA 2PSZA 3HFKA 4X65F 4PQUA 1QAYA 1AUDA 4K4VA 4WFNQ 3BGUA 1Q78A 2OPRA 2D1CA 1HHSA 3AH6A 2MMYA 4P7VA 1X0PA 2MHNA 4WKYA 4C97A 4DWIA 1VQ8S 1ZZFA 5DM7Q 4K4XA 4YHHF 3DI6B 3E51A 1SUQA 3DXSX 1S1TB 3MR6A 3BDPA 4ZVEA 1JNRB 3DDKA 2N7CA 2KZZA 1AW0A 4WK1A 3M9OB 4F2SA 5E41A 2ZOMA 2EG1A 2MQNA 4LVOP 4K5SA 2IM0A 1BQNA 5KG2A 2I1RA 2DT9A 4O3QA 3CIMA 1KVIA 2F7VA 1ZBTA 1F5AA 4MYUA 4QU6A 5DDRC 4G1QA 2VA3A 3DRPA 2J0SD 2WW8A 3GG0A 1NK9A 3HI9A 3HHLB 1Q81T 4C9DA 4O4GB 4J9QA 3C8YA 4RWWA 3QIPB 3GV7B 1JXLA 1OQ6A 3QAEA 4B3MF 3QAUA 1DHMA 4DQRA 1D0EA 3QJLA 2OPSB 3EGZA 2C2EA 3SV3A 2JOQA 4RNMA 1G6BA 4ED8A 3NMAA 5HN0A 1HWLA 1Q79A 1WTFA 1XC9A 1U25A 1C0UB 5CHCB 2HMIA 3IC1A 4Y2CA 2VB6A 4Q2MA 3G8TA 2R8HA 4IFVB 3OLBA 1N56A 2BACA 3V4IB 4K59A 2FHKA 2RILA 1TKXB 2MQLA 2ZJQQ 3O1LA 2H5EA 3H59A 1WHXA 4ETXA 1D1UA 2DH9A 5KG7A 1U6FA 2X51A 3BREA 4ECZA 3M8RA 5C25A 4DQPA 2BE2B 3J81Y 3CD5A 5DJBA 2KHDA 2IJFA 2WBMA 2XSFA 3MMCB 5H1SV 1TFWA 4FBTA 4KHMA 4Y65A 4RNFA 2GIQA 4OX9F 4LT6A 2ERRA 4FXDA 2KZMA 2QMWA 2JEIA 4F4YA 2DR9A 3OL7A 2OMOA 5HP1A 3OUYA 2ZE2A 3KG1A 1Q82T 4ILMA 1FKOB 1Y3JA 2GX8A 1G1XA 1JLFA 3UR0A 2XS7A 1F0XA 4F3QA 3TUZC 4XDCA 2QA4S 4QPTA 1DJ0A 2UXBF 1UA1A 4OHZA 1FNOA 1RT7A 2BJDA 4DL5A 2IVFB 5GADU 1QAXA 2RIJA 3UI3A 3UPFA 4DR5F 1OO0B 1T05A 4A8QA 4FP9A 4JV5F 3PRDA 4OZJA 1F60B 4A8KA 3M32A 2F9DA 2DNHA 3KLIA 1HPZB 2HHSA 4RBVA 4A8WA 2FTRA 3RYLA 4ITSA 3OR1A 2VPZB 2OPRB 3CCQS 2HYIB 1LK7A 1H98A 2VQFF 3UDLA 2DNKA 1FRJA 4ZLPA 5KFQA 1FRMA 4PRFA 3RU0A 3CJ3A 1LWCB 2V4JB 1RTDB 3D1OA 4IFYB 1MWYA 1RYRA 2JSXA 2IMOA 1ULRA 2XSJA 2DIUA 2AGOA 2RS8A 3OL8A 3WX4A 3N0VA 2QLXA 2YWKA 3DLGB 2CJ9A 4KV8B 2DGOA 4OHWA 4ES3A 1NK8A 1YJWS 4JI2F 2DB1A 5KG1A 1HNIB 2CYYA 1URRA 2GGPB 3FRZA 4GO5X 1HD1A 1PC4A 4KQZA 1C1BA 3KLFA 1QUPA 4BDPA 4JYAF 4NCBA 2LEBA 3V81B 4NCGB 1S7HA 3BSOA 3KKFA 1N54B 4A8MP 3IFEA 1ELOA 3H5SA 4DFMA 4X4NA 3RRHA 2L08A 1FERA 2I38A 2YWHA 1FDAA 1FESA 3FEXB 3GWCA 2C3YA 1B7FA 4WKRA 4OHXA 1FA0A 2IM1A 2UV8A 5CYJA 1LWEB 2L9DA 4Y34A 5E5NA 5ITHA 4LF4F 3C66A 1TL1B 4MTPA 5GVQA 1RA6A 3C2PA 3PFOA 3EPGA 2OTJS 3QWPA 4IOCQ 3KK3B 3V6DA 4C8LA 3AAWB 3DU5A 1TKXA 1FVQA 3QZ7A 3OJSA 1F2GA 2QE5A 4LVNP 3KYLA 4KSEB 2ZNYA 3ENWA 5IT4A 2LU2A 2CJKA 3MEDA 1S1VA 2IAJA 2LYVA 2MQMA 1TKDA 4W90B 5C25B 4NMLA 3DHWC 1RTIA