4JYAO

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4jyaO00
3OTOO 3JAMN 4GKJO 2HHHO 4LF4O 3T1YO 4X64O 4OPHA 2DOSA 1N32O 4B3SO 4DV0O 1HNWO 4JV5O 1KUQA 4JI1O 4DV4O 3O65A 4DUZO 4LF8O 4X65O 4OPAA 4LF5O 3F5TA 1N36O 4LF9O 3M8AA 2UUAO 2UU9O 4B3TO 4LF6O 1AILA 2DJVA 5LMNO 4JI2O 4K0KO 5A2QN 1HNXO 2UXBO 3SDLA 4DV7O 2UUCO 2UXCO 3J7AU 5BR8O 2VQEO 1HNZO 4DV2O 1HR0O 4A5UB 4DV1O 5H5NA 4JI3O 4GKKO 1XNQO 1A32A 4KHPO 1YZBA 4NXNO 4DR3O 1N34O 2N74A 3R66A 3J81N 2AGAA 2VQFO 4B3MO 4DR6O 4DR2O 1R6TA 5LL6Y 4NXMO 4LFBO 2LW7A 2E5LO 4DR7O 4AQYO 2UUBO 4X62O 4DV5O 4JI8O 4DV3O 2FKXA 1R1BA 2UXDO 5IT9N 1I94O 1IBKO 4JI7O 4DR1O 4LFCO 2F4VO 4DR4O 5FLXN 1F7YA 1AB3A 4JI5O 2ZKOA 4OX9O 4LF7O 1D2DA 1XEQA 4YY3O 4JYAO 4DV6O 1FYJA 1G1XB 5BXZA 1N33O 3T1HO 4X66O 4LFAO 4JI0O 1XMQO 4B3RO 2Z0AA 2ZM6O 5IWAO 4YHHO 2JRIA 4DUYO 5LMUO 4DR5O 4JI6O 1DK1A 1NS1A 1FJGO 5BY1A 1FKAO 1IBMO 3RT3C 1J5EO 1X59A 4JI4O 3J80N 1XMOO 1IBLO 1XNRO
chains in the Genus database with same CATH superfamily
1F23A 1SQBH 1KP2A 3AG1B 4UFZA 2QWPB 4I7ZB 5L3DA 2DW4A 4KP4A 3ABMC 4DYLA 4U3JB 4AQYB 3N2KA 2QWOB 2WAMA 4GX1A 1FXKA 2BTQA 3OR7C 4CS3A 1Q7YW 1SC5B 4B3TO 4LF6O 4IYIA 3D8CA 3FB7C 1M9NA 4MT8A 2JGDA 3CC4V 3CSXA 2QKSA 1MZEA 3DC6A 4A5UB 2V4DA 1QU7A 1XHZA 1XNQO 2LW1A 1S72V 1SQVH 3R66A 1NTZH 3N2KB 2YEVA 3QO8A 1FXKB 3BEHA 3D3QA 2BTQB 5LYJA 4DRXA 1Y66A 4CH5A 1Y4MA 1RPOA 4MVOA 3M99B 3CJHA 1XREA 1YHQV 3WG7C 3OTOB 3RWRD 1V55B 4GUNA 3KG2A 2M6YA 1XILA 3APOA 3QF7A 1W0JG 3GWKC 4LFCO 1VIBA 2JGDB 5EK0A 2AHZA 1NTMH 3E8GA 1SA0A 2F66C 1JFFA 1QLEC 1HNWB 5CA0A 2CDYA 5LP6A 1M57B 1D2DA 4JASA 3DTUB 2YEVB 2Q69A 4DRXB 2ZNJA 2NLJC 3BFRA 3W7SA 2IJKA 1FKAO 4GKKB 1XNRO 5IJ0A 3JAMN 1SA0B 3ASNB 4G28B 1CP9A 4FFKA 5LBQA 2DYSC 4X64O 5LP6B 1HDJA 1IXBA 4WFHA 3OTFA 3JCUZ 2BSKA 3JALA 3NR7A 5KA5A 1VF7A 1Q6UA 2EULA 4UCTA 2YS8A 4Z1VA 3VQYA 5JVDA 3P3NA 1NR1A 1XNQB 3CEIA 3BCCH 4DK1A 2YXLA 1AVMA 1AI5A 1QNMA 1YEWA 4LF7B 1R3LC 4I0XA 4JYAB 4DV2O 3CMAV 4DV1O 2Q4PA 1GN6A 5CB4B 2CTPA 4KHPO 4X8AA 4DXWA 3ZMSA 2L6LA 1KC8W 3UO2A 1VEWA 2EJRA 1UJWB 2BSKB 3JALB 3ZRSA 1MSWD 4K8ZA 2GV9A 2LW7A 4DR5B 3I5DA 1JMKC 5JVDB 5C8YA 3RVYA 4JI8O 3APQA 3ZHTA 1OV9A 1H2NA 3CRMA 3CYOA 4FLWA 1TA8A 2KKWA 4OXSA 1OHHG 3E22A 5IY5B 4BW5A 4I0XB 4PV1B 1N32B 2JEUA 1MABG 2QWNB 2C2AA 3CWBH 1K34A 1VQ9V 4KFMA 1KKCA 2PZSA 4X66O 4JI0O 4TOIA 3K3WA 2WA4A 4EEQA 1WA8A 4DV7B 5B3SB 4Q20A 1L0LH 4X1KB 5C8YB 4X64B 3E89A 2LGWA 1TVKB 1V54C 4MSWC 1JQ0A 1CEZA 3E22B 1KP3A 3OEHG 2VQFB 1WB7A 4UVAA 2R9RB 2F23A 3CCMV 4JAAA 4FVMA 1KUQA 3SPJA 2XNDG 2DQ0A 1YI2V 1ZTEA 2OCCC 5ITZA 4DV2B 2FTKA 2IJHA 2Q8VA 2XAGA 3Q4HB 2UU9O 2Q6AA 1H8HG 4KHPB 3G4SV 3IJ4A 3THOA 2Q5ZA 1HNXO 4FLUA 2WLKA 2E74B 3RYCA 1H2KA 1NZ6A 2EIKC 5CA1B 4JI8B 2CAZC 3CCVV 1SQXH 4DR3O 1KQSU 3KKYA 2NR5A 3SJBC 4YHHB 3SPGA 2PI4A 5ITZB 1RPRA 3BRCA 3D36C 4X89A 4TQDA 4W4KA 1XMOB 2WLMA 3OAAG 3ZMUA 4GKJB 4LR3A 2UXDO 4O4JA 1QR8A 1AJQA 1WP7A 3BVOA 3ASOC 4RUFA 4UCOA 3RYCB 4DV0B 5LGNA 1JA8A 1S77D 3ZHSA 3FB8C 4YY3O 2IJIA 2Z5UA 2ZXWC 3K03A 3LDDA 3UCSC 2UUAB 5BXZA 4WFAV 5KMGA 1I0HA 2JDIG 1Q82W 4AI8A 3B2EE 4QPJA 1AR1B 1BZKA 2V7QG 5BZBA 2NNUA 3W7UA 1MNGA 2R9IA 3RT3C 4O4JB 5CA3A 4H44B 1XOUA 1NT2B 1S3JA 3PN1A 5DECA 3RYFA 2Q0OC 1OCZB 4MVMA 1VQNV 3JD3A 5LXTA 4BAYA 1GN4A 3K9SA 3E8BA 1GTOA 1T5EA 2P90A 5KMGB 1BMFG 5JJNB 1RP3B 4OPAA 4LF5O 3AG2B 3M8AA 2EJ7A 2DQ3A 3BA8A 3DSQA 4J7KA 1E1RG 4JI2O 2WLHA 1UFIA 4MVZA 3L72H 1Z2GA 2IU3A 2XAFA 4K3AA 1YF2A 4R50A 4D6TH 5H5NA 3RYFB 4JAUA 1N8RW 4F6RA 3SJQC 1ZL8B 5LXTB 3SJAC 4DR2O 1JCHA 2E3CA 4NXMO 2E5LO 4RQFA 3ZRXA 1OCCB 1W59A 5K1PA 3B09A 1M5IA 3OEEG 3SYAA 4QE7A 3MHSC 1BL8A 3A0HZ 3FAVB 2XUMA 3JD2A 2VRZA 2DYRC 4O4HA 4DV4B 1K7DA 4F6RB 4ZHQA 4LF9B 1PNKA 2A0LA 3HB3B 2Q7EA 4NTYA 3LSSA 4KXRA 1FXVA 2HJFC 4TQFA 3JAKA 1JOYA 3E8FA 3RYHA 2ADPA 2AXTZ 4FK5C 2XT9A 2F43G 5JQGA 1NS1A 1XQ8A 2Y4UA 2B9ZA 3GWOA 1QLNA 1KBHA 4ZKIA 3ABUA 1AJPA 3QNEA 1Q81W 3NXSA 3ZMTA 3QO7A 3CP1A 3K5OA 4O4HB 3K58A 3VBBA 2EILC 5KHHA 4JI2B 5FNVB 4ZHQB 3OMNB 2EINC 1U96A 4D7TA 3ABLC 2CE4A 1HWYA 1QCEA 2EIMC 1VQ7V 1M93A 4C7UA 1VQ6V 3AG4B 3RYHB 2PUSA 4AHCA 3OM3B 2H94A 2ZT9B 3OR6C 5IDJA 5A2QN 5KHJA 5B1AB 5CBHA 5BR8O 4DR2B 2ADQB 4NR1A 5F2VO 1Q6HA 1AI6A 2QWRB 1DLBA 4WBNA 4DUYB 1N0JA 3LSQA 1COWG 1GN3A 4AQYO 4TV8A 4BIUA 1IBMB 5DN6G 4IHJA 4EB6A 5L3FA 1EBOA 1M56C 4O4IA 5KUKA 1K4CC 2GHYA 5KAIZ 2GBOA 3VQWA 1PP9H 3FYIB 3HKBA 1AB3A 3ABMB 1ORQC 2KG7A 5D5QA 1Q86W 5KHGA 1W2BU 3MAQA 4I5SA 2LJ2A 3RW0A 3OMAB 2QKCA 1G1XB 4MTGA 3OGCC 2QM7A 5IYDO 4J9ZB 4WBNB 1URFA 4QE9A 2HLDG 3U10A 4MTXA 5L3CA 4TV8B 2YDEA 2UXCB 2GTAA 4IHJB 4EB6B 2VQEB 4JF3A 4O4IB 4JZ2A 3H1KH 1KU9A 4WFGA 3JSNA 3A8TA 2B1IA 3OTOO 3GVMA 4E2LA 1LUVA 1GRJA 1Q43A 2KG7B 3K5MA 1WP8A 4EKWA 1QVFU 1HNWO 1QQCA 3PJSK 1S5HC 4DV3B 4DK0A 3WG7B 4X88A 3X2QC 2AZ0A 2KSDA 1B3QA 1J95A 4U7OA 5HFMA 2PYLA 3SDLA 4I9QA 1QLEB 4RWUA 1YJWV 4LP8A 5GW7A 4DV6B 4NKGB 1SRYA 4PA9A 2PYJA 4GKKO 1N33B 3T1CA 3ZMVA 4GYCB 5IWAB 1UPGA 2WWWA 4LBEC 5JWPA 4GT1A 1F51A 3OW2U 2RN9A 1K3EA 3SYOA 3JD1A 3TK1A 1D5AA 2ILMA 2RDCA 2A3QA 3K59A 4ZBMA 1HP8A 4U7NA 5A9GA 1JPXA 1GAXA 3CRAA 4ICGA 2DYSB 4B7EA 4LF7O 3JAWA 3ML0A 4JYAO 1BE3H 1WB8A 3I55V 3K5LA 1FYJA 3ZMZA 2PTMA 4X20A 2AZ2A 4NTWA 1H2LA 2Z0AA 5E1AC 5JCOC 1N0NA 2ZE8A 4UUJC 4UB6Z 3OD4A 2CTRA 1IX9A 1HNZB 2JRIA 4DR5O 1SZXA 2ZQMA 2ZINA 2ZIOA 2X6CA 3CPWU 1S76D 5JJEB 1U97A 4FZ0A 1QBZA 2HFEC 2BCCH 3JAWB 1N32O 5LYJB 2LFRA 3BA9A 4WF9V 3ZHRA 1AI7A 1GKFA 3CCRV 4X65O 3AG3C 5B5EZ 3CJHB 1NTKH 2H3OA 2A7WA 1VQLV 4P30A 4GCZA 3SYQA 3ZRVA 4DV7O 1JFFB 2A9HA 5CA0B 4CS4A 2FMLA 3ABTA 3F7YC 5J2TA 3B4SA 3KZIZ 4JI3O 1XMQB 1KB9F 1WPBA 1DGSA 1LR1A 4B3RB 2PI5A 4H33A 3U0ZA 1TGOA 2ZM6B 3UO3A 2YXYA 1ZLZA 2VQFO 4FM1A 4N21A 5GTIZ 1US6A 2OIGA 4JI6B 4J42A 1AJNA 1V54B 1P49A 5IT9N 1PL0A 5IJ0B 2HHHB 2N04A 2PGGA 5B1BC 4AILC 3B8NA 1RSOA 1CPYA 1S0VA 4B3SB 5J2TB 1MOFA 5IE9A 2OCCB 2DWEC 2DWDC 2YIBA 2VS0A 1K4DC 3D36A 4BWAA 1YCIA 2M7WA 3H9VA 2WLLA 1L1FA 2Z3YA 2F1MA 5KHIA 2YICA 1Y74A 3ZN0A 1WLEA 4YHHO 1Y6XA 1SESA 5B66Z 1K8AW 2EIKB 2WPDG 3UQ8A 1X59A 3CRQA 4JI1O 1AROP 3HKCA 1XMOO 1NJIW 1VQ8V 3LNNA 5TISZ 4X65B 4GKJO 4CS2A 1RSOB 5KUMA 4LF4O 3W7XA 2XASA 1VQKV 1PD3A 2XAHA 4DV0O 2ZIMA 2HP8A 3O65A 2BOBC 1FFXA 3CXCU 3AK2A 2WLLB 4D7SA 2UUAO 2F95B 2ZNIA 4JI3B 2DJVA 5GTHZ 2EBOA 1NKDA 3ASOB 4EFBA 1SQPH 2K1EA 3J7AU 3HKCB 4FLZA 2WLNA 2ZXWB 4JTAB 1MG1A 4LWSA 4I9WA 1A32A 3L70H 1PPJH 1Q3EA 1KD1W 1WA8B 2VWJA 2QA4V 5KAFZ 1FFXB 2A79B 2YIBD 3OE7G 4DO2A 1EN6A 1N4CA 4KUMA 3CD6V 2CK3G 2EIJC 2IH1C 5EBLC 3VQXA 2ARHA 3A0BZ 4J11A 4PDMA 3T1YB 3QVNA 2EX3A 2ODMA 1TUBA 4X1YA 3ZIAG 1NI8A 5LHGA 3ETGA 1FD9A 5J2UA 1RM1C 4ASUG 3DGEA 4LWSB 1O9HA 4PDRA 4RO2A 4GX0A 5EBMC 2RQ6A 3CCSV 4JI1B 3MHHC 1Y67A 4F4LA 3I56V 3U11A 1YTFB 4LF4B 4XBFA 2JK5C 2Q0AA 1HR0B 3K9AA 1DK1A 2CGOA 1FJGO 5H2FZ 1TUBB 1L8DA 4FIPC 2IW5A 4P9OA 1H38A 4PDVA 1BS3A 4LFBB 1I7FA 2W6IG 2DOSA 4FMTA 2UUBB 4X62B 3LDCA 2ZDIC 3HKEA 4GX2A 4HBNA 5H6QA 5H9CA 4DV4O 3AG7A 2JJ1G 3L75H 4LF9O 3LSUA 1THZA 5EC2C 1NH2B 3N2GA 1DTOA 4DW1A 3K0GA 2JGUA 4DW0A 1QVGU 1YTFD 2DYRB 4FPPA 4MVRA 5HFLA 1P4RA 4K8XA 1HW7A 2RMKB 1WAZA 1TAEA 1H2SB 1PKXA 3T1HB 4CH3A 2GSMB 3LDEA 3HKEB 4PI0A 2YIAA 3ZHQA 2HVKC 2JS3A 3LNMB 4JYBA 4WFBV 2WLJA 1J5EB 2ITDC 2EZOA 1DF4A 3STLC 3K0DA 2OIEA 4HYOA 3CCQV 1NH2D 3ZEDA 2CTWA 1Q8IA 4DR1O 1SERA 2RCVA 3T4DA 4UXNA 1NQTA 2Y69C 4OX9O 2ZD9A 4OGQB 2EINB 4H13B 2UXXA 1OCRC 4MTFA 4UVBA 3ABLB 1D5NA 1P7GA 2EIMB 1AP6A 3ETQA 1FJGB 3TJTA 5FPRA 3L9DA 4H37A 4BIOA 2R9AA 2P4KA 3KCYA 2AW9A 2UUCB 4X1IA 3H1JH 4UVCA 4DUYO 3ZHUA 3C3SA 1CXZB 1IURA 1IBMO 3M7MX 1MZFA 1NU1H 2LFSA 1R3KC 1Z5VA 4ZI7A 1S5LZ 2QGNA 4KL1A 4PHZA 1K5QA 2ETNA 3RN4A 4DR6B 4PA7A 2Y0IA 4W4LA 1MA1A 4NYKA 3SPCA 4QJFB 2QDOA 3DXRA 2DN9A 3A0RA 1M56B 3F5TA 3ETDA 4FLVA 3H01A 4X1IB 2F4VB 4I4TA 1F4NA 4YIPA 3G6BA 4LC1A 3G6EV 5J9PC 3OMIB 2UXCO 5EYPA 3ZX6A 2VQEO 3H1LH 2QM4A 3FB5C 3ZS8C 1GM7A 4FLXA 2XTAA 1AR4A 3QTCA 4QNHB 3CCEV 3JAKB 3J81N 1G8MA 3ABKC 3DXRB 4DR1B 4NB5A 3G67A 4DR7O 1XL4A 2P22C 1YIJV 4CZZA 5JQGB 1R3JC 4OX9B 4DV3O 2FL4A 3JCZA 3B40A 2PY5A 1RFYA 4N23A 1PM9A 4ZOLA 2Q7HA 5EYPB 1V9PA 3OGIB 2R72A 1WJZA 4XDKA 1PNMA 2HVJC 4FLTA 4DV6O 4MVSA 2XOKG 5C93A 2ATKC 3X2QB 1N33O 5DM6V 2QSAA 5LMNB 1YVWA 5IWAO 3FKSG 3FYEB 4IT5A 4PDLA 1JJ2U 2UXNA 2CUGA 5E79Z 4TV9A 1K73W 3ZRWA 3IGAC 4J10A 1S5JA 4BIZA 1N34B 4UCVA 4ABMA 1G4YB 4B3MB 4UCSA 5LHHA 5AG2A 1BHBA 4J80A 5JCOA 2KB1A 4JV5O 2WLIA 5B1NA 4O2BA 1FFTB 2LO1A 1VQ4V 2Q7GA 4YJ2A 1I94B 3HR0A 4CC5A 2OTLV 2RJZA 3ZJZA 3HKBB 4TV9B 5BMVA 3CS5A 1HNZO 2QWQB 1YJNV 2ZE7A 4PJ0Z 1Q90D 4G27B 4DR7B 1SQFA 3UM7A 2E75B 2QKAA 3JD4A 2BE3A 2L35A 2N74A 3BAAA 1ROPA 4JYCA 2WLIB 5IYZA 2DE0X 3MD0A 3RYIA 3E35A 1EFRG 4GLXA 3EFFK 4YJ2B 5EC1C 1GO3F 1OCOC 1AR5A 2FKXA 1MSDA 5EZYA 2LP7A 5LOVA 5BMVB 3IAYA 1SETA 2WSSG 2G38A 4HAMA 1SKVA 2IJJA 5EIBC 2OWOA 3BABA 3AG3B 5CBGA 2P6JA 1VQOV 4MVUA 1XMQO 1GN2A 2Q67A 5IYZB 4B3RO 1FAFA 4K0KB 1GMGA 3F5WC 2ZM6O 2UXBB 3AK3A 3RYIB 1XI1A 2HJDA 4X9QA 3RGBA 2X6BA 2P4VA 4JI6O 3OUFA 1Q5OA 3H1IH 5EZYB 4JV5B 1YITV 5LOVB 3CC2V 3K57A 2GUZA 4Q6GA 2HHHO 2IH3C 2WA3A 5H6RA 4OPHA 4PA6A 1WNSA 1BGYH 4MW3A 2OT5A 4B3SO 2XHBA 3FD9A 3G80A 5FL7G 1IZ3A 2YI9A 1AILA 2OTJV 4MW8A 5B1BB 3HKDA 1K92A 5FPOA 3S3WA 4JAVA 2GUZB 3P3PA 2XAQA 4LFAB 3CCUV 1ZWIC 4NXNO 3AG1C 4LCUC 4X20B 1OZ0A 3CRRA 3ICXA 1EN5A 2GDSA 5D5PA 4XDJA 3TXQA 1NVPB 4LH7A 4MTOA 3CCLV 2X0LA 3K08A 1M1KW 3UT5A 1BCCH 2ZE5A 3B77A 2LGQA 1KECA 4JI4B 4WFFA 1IBLB 2X6AA 5IYBO 3UKMA 3WU2Z 1XUQA 3HKDB 4TSFG 4P2ZA 1GK9A 3CE2A 4JI7O 1KMIZ 2PF4E 4CC6A 5EBWC 5L3BA 1BT8A 4O2AA 3ZCCA 4JI5O 1ZUQA 3N27A 4IGGA 3CCJV 3K5NA 3MDSA 1GM9A 2CH7A 2JS5A 2X7RB 5CB4A 3W7WA 4IIJA 4B3TB 4LF6B 1VF6A 1B04A 4J7JA 1K33A 5CBFA 2D2CB 3UT5B 1FXKC 3HPLC 2LQTA 1NVPD 1NR7A 4R6ZA 5KA6A 4UV8A 5B1OA 2ZCEA 1OJHA 3J80N 1V55C 1ZX3A 1Z5WA 1O9GA 3EHBB 4PELA 4HNAA 4O2AB 4CBCA 2QTSA 3T1YO 4RQEA 5IJ9A 4LNUA 3E8HA 2DMXA 3R65A 4JPRA 1SZTA 2CH7B 2Y48A 1EZVH 1M57C 4I50A 4IIJB 5KX5A 2P7TC 2YUAA 4DUZO 1BQ0A 2EIJB 1YSCA 4FZ1A 1DF5A 1MMMA 1JVMA 1K9MW 4LFCB 2Q9LA 4YIOA 1LNQA 4NXNB 4X1KA 1RM1B 1YXBA 2Q73A 3STZC 1L0NH 1HR0O 1TVKA 3BY6A 3OT7A 1VQMV 2ZDIA 4HNAB 1R3IC 3E2EA 5IJ9B 4LNUB 3ASNC 2ZE6A 3ZN1A 1E1QG 1LUWA 4JZGA 1JX9A 1VMGA 5LP6C 4FM0A 4I50B 4JI7B 1R6TA 1G6UA 5LGUA 5KX5B 4LFBO 1Y74B 1XDCA 4TT3G 2E76B 2UUBO 3B8MA 4X62O 4DV5O 4JI5B 1XNRB 1KKDA 1R1BA 2IM9A 4UB8Z 3Q4HA 2B1GA 1H2GA 4Z1MG 3WB1A 2ITCC 2CGNA 2MW2B 5FLXN 2XAJA 1VQ5V 1GH6A 2IU0A 3ETEA 3G71V 5CA1A 2HKOA 3SYPA 2JEXA 5LA6A 3T1HO 1AI4A 1VF6C 3C3TA 4LH6A 1I5YA 5IYCO 2VWKA 3WFVA 3SR2C 5L3EA 4PD4F 4DV1B 3ZHVA 3VQVA 3P30A 1J5EO 4DUZB 3KCXA 1SQQH 5IY5C 4I55A 1ENVA 3SJCC 4UV9A 4HZ3A 5LHIA 3FB6C 5LA6B 2P06A 4J9YB 4PA4A 1B6QA 1FS0G 2YXHA 1F4MA 1JJOA 4X1YB 5B3SC 3WB2A 1QHTA 1X4TA 2UUCO 2W0XA 2Y69B 5J2UB 2EZPA 1R6NA 4E4EA 1K97A 2JJ2G 1OCRB 4F6EA 4JYYA 3CB2A 4DV5B 3QO5A 4X66B 2QR4A 4JI0B 3BPZA 4I55B 1R73A 4JTCB 4NTXA 4DR6O 2V1DA 2ZR2A 3EVKA 2YSUB 2W6JG 5KHKA 3E83A 4XDLA 5DEDA 2OYQA 3GB7C 1IBKO 1WPXA 2F4VO 4DR4O 3P32A 4B08A 3DC5A 2P67A 5KLVH 1QR9A 2KQXA 1PNLA 3L74H 4QGPA 2BTOA 2H8PC 1JR9A 3JD0A 4EFEA 1ZAUA 1Q6IA 1M90W 3IC9A 3SPIA 2UU9B 1FXHA 1ZL8A 1PL4A 1I08A 3N2GB 3CHXA 5L3GA 1HNXB 1EM1A 4JGSA 4H0LB 5K1XA 3TGUH 5JH7A 2EILB 3JATA 5BY1A 1EN4A 1H8EG 4IL6Z 3BHPA 3FAVA 4DR3B 2GTSA 2HR3A 4R7CA 1VP7A 3LUTB 3QG5A 2YI8A 2R70A 1B06A 2F93B 3ABKB 3SGIA 3SYCA 1XHXA 1XL6A 4L8JA 2Y4TA 4GZRB 3CX5F 3RBZA 5GONA 2P5OA 1FPOA 3JSLA 2K9PA 4Z2WA 1IXMA 4J7ZA 1N36O 2UXDB 2JVDA 3FX7A 3EXAA 1P7BA 1M4UA 3S3XA 5LMNO 2JIZG 5JH7B 1IVSA 3JATB 3RFRA 4YY3B 3JASA 3H1HH 3SPHA 3C90A 5CN0A 3CC7V 4TUYA 2QE7G 1N34O 2Y0PA 3O9OA 3FFQA 1OCZC 4B3MO 1IBKB 4J41A 4R8CA 2HEPA 5LL6Y 5FNVA 2B5UA 3RVZA 4DR4B 5GONB 2YC0A 3AG2C 1EZJA 1YJ9V 1I94O 4ZI7B 5JJJB 2OCHA 1XBLA 1F7YA 1P84F 3JASB 1BHAA 4QPKA 2ZKOA 3D3IA 1VQPV 3F7VC 1XEQA 4MVQA 3K06A 1YDXA 4LF5B 4PA3A 4TUYB 3ZBHA 1WN7A 4UCUA 4BR6A 1KYOF 1I5XA 1SF9A 4I4TB 2NN4A 4RUEA 4WCEV 5LMUO 1SQGA 4IYHA 3CRCA 3WB0A 1OCCC 4WFEA 1H2MA 4FFBA 2QJ1A 3AK1A 4MS2A 3OFNG 3K04A 3TETA 3AEIA 1N36B 3T4ZA 2QTOA 4NVPA 2D3OW 2W0FC 4NXMB 4L87A 2E5LB 3L73H 3A2FA 4UCRA 4YXWG 2QEXV 2MK3A 2FYUH 4LF8O 1OCOB 3OUSA 3IC7A 4FJCC 4FLYA 4O4LA 3JARA 3TXSA 4YJ3A 2CTQA 3TCUA 1NBMG 4K0KO 2YIDA 4ZOLB 2UXBO 3CXHF 1BQZA 2BOCC 4FFBB 1K5SA 3K79A 3VOUA 4P9PA 1PV0A 2QM8A 3E86A 5LGTA 1VARA 1GM8A 2O57A 2AGAA 3W7TA 3T2MA 2FB5A 2ZR3A 4CH6A 4GX5A 2HG5C 3IFXA 4FM2A 4RAIA 4TWKA 1VF5B 3ZRWB 4O4LB 1Y76A 2Q68A 3JARB 4BW9A 4YJ3B 3AG4C 2IBZH 3JYCA 1SS3A 1IDSA 1AP5A 4PI2A 1BSMA 5B1AC 1W0KG 1E79G 2AHYA 4U3JA 3CMEV 5LMUB 4QIWF 5EIBD 2A06H 4B7KA 4O2BB 4CH4A 4LFAO 4K35A 2RNBA 4U3FH 4JTDB 1TUEB 5BR8B 5CMUA 3L71H 1Y76B 1IBLO 1R6KA 4ZIBA 2N05A 4JI4O 4G2KA 1YZBA 1ZSPA 4LF8B
chains in the Genus database with same CATH topology
3OTOO 3JAMN 4GKJO 2HHHO 4LF4O 3T1YO 4X64O 4OPHA 2DOSA 1N32O 4B3SO 4DV0O 1HNWO 4JV5O 1KUQA 4JI1O 4DV4O 3O65A 4DUZO 4LF8O 4X65O 4OPAA 4LF5O 3F5TA 1N36O 4LF9O 3M8AA 2UUAO 2UU9O 4B3TO 4LF6O 1AILA 2DJVA 5LMNO 4JI2O 4K0KO 5A2QN 1HNXO 2UXBO 3SDLA 4DV7O 2UUCO 2UXCO 3J7AU 5BR8O 2VQEO 1HNZO 4DV2O 1HR0O 4A5UB 4DV1O 5H5NA 4JI3O 4GKKO 1XNQO 1A32A 4KHPO 1YZBA 4NXNO 4DR3O 1N34O 2N74A 3R66A 3J81N 2AGAA 2VQFO 4B3MO 4DR6O 4DR2O 1R6TA 5LL6Y 4NXMO 4LFBO 2LW7A 2E5LO 4DR7O 4AQYO 2UUBO 4X62O 4DV5O 4JI8O 4DV3O 2FKXA 1R1BA 2UXDO 5IT9N 1I94O 1IBKO 4JI7O 4DR1O 4LFCO 2F4VO 4DR4O 5FLXN 1F7YA 1AB3A 4JI5O 2ZKOA 4OX9O 4LF7O 1D2DA 1XEQA 4YY3O 4JYAO 4DV6O 1FYJA 1G1XB 5BXZA 1N33O 3T1HO 4X66O 4LFAO 4JI0O 1XMQO 4B3RO 2Z0AA 2ZM6O 5IWAO 4YHHO 2JRIA 4DUYO 5LMUO 4DR5O 4JI6O 1DK1A 1NS1A 1FJGO 5BY1A 1FKAO 1IBMO 3RT3C 1J5EO 1X59A 4JI4O 3J80N 1XMOO 1IBLO 1XNRO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO O;  3JAM N;  4GKJ O;  2HHH O;  4LF4 O;  3T1Y O;  4X64 O;  4OPH A;  2DOS A;  1N32 O;  4B3S O;  4DV0 O;  1HNW O;  4JV5 O;  1KUQ A;  4JI1 O;  4DV4 O;  3O65 A;  4DUZ O;  4LF8 O;  4X65 O;  4OPA A;  4LF5 O;  3F5T A;  1N36 O;  4LF9 O;  3M8A A;  2UUA O;  2UU9 O;  4B3T O;  4LF6 O;  1AIL A;  2DJV A;  5LMN O;  4JI2 O;  4K0K O;  5A2Q N;  1HNX O;  2UXB O;  3SDL A;  4DV7 O;  2UUC O;  2UXC O;  3J7A U;  5BR8 O;  2VQE O;  1HNZ O;  4DV2 O;  1HR0 O;  4A5U B;  4DV1 O;  5H5N A;  4JI3 O;  4GKK O;  1XNQ O;  1A32 A;  4KHP O;  1YZB A;  4NXN O;  4DR3 O;  1N34 O;  2N74 A;  3R66 A;  3J81 N;  2AGA A;  2VQF O;  4B3M O;  4DR6 O;  4DR2 O;  1R6T A;  5LL6 Y;  4NXM O;  4LFB O;  2LW7 A;  2E5L O;  4DR7 O;  4AQY O;  2UUB O;  4X62 O;  4DV5 O;  4JI8 O;  4DV3 O;  2FKX A;  1R1B A;  2UXD O;  5IT9 N;  1I94 O;  1IBK O;  4JI7 O;  4DR1 O;  4LFC O;  2F4V O;  4DR4 O;  5FLX N;  1F7Y A;  1AB3 A;  4JI5 O;  2ZKO A;  4OX9 O;  4LF7 O;  1D2D A;  1XEQ A;  4YY3 O;  4JYA O;  4DV6 O;  1FYJ A;  1G1X B;  5BXZ A;  1N33 O;  3T1H O;  4X66 O;  4LFA O;  4JI0 O;  1XMQ O;  4B3R O;  2Z0A A;  2ZM6 O;  5IWA O;  4YHH O;  2JRI A;  4DUY O;  5LMU O;  4DR5 O;  4JI6 O;  1DK1 A;  1NS1 A;  1FJG O;  5BY1 A;  1FKA O;  1IBM O;  3RT3 C;  1J5E O;  1X59 A;  4JI4 O;  3J80 N;  1XMO O;  1IBL O;  1XNR O; 
#chains in the Genus database with same CATH topology
 1F23 A;  1SQB H;  1KP2 A;  3AG1 B;  4UFZ A;  2QWP B;  4I7Z B;  5L3D A;  2DW4 A;  4KP4 A;  3ABM C;  4DYL A;  4U3J B;  4AQY B;  3N2K A;  2QWO B;  2WAM A;  4GX1 A;  1FXK A;  2BTQ A;  3OR7 C;  4CS3 A;  1Q7Y W;  1SC5 B;  4B3T O;  4LF6 O;  4IYI A;  3D8C A;  3FB7 C;  1M9N A;  4MT8 A;  2JGD A;  3CC4 V;  3CSX A;  2QKS A;  1MZE A;  3DC6 A;  4A5U B;  2V4D A;  1QU7 A;  1XHZ A;  1XNQ O;  2LW1 A;  1S72 V;  1SQV H;  3R66 A;  1NTZ H;  3N2K B;  2YEV A;  3QO8 A;  1FXK B;  3BEH A;  3D3Q A;  2BTQ B;  5LYJ A;  4DRX A;  1Y66 A;  4CH5 A;  1Y4M A;  1RPO A;  4MVO A;  3M99 B;  3CJH A;  1XRE A;  1YHQ V;  3WG7 C;  3OTO B;  3RWR D;  1V55 B;  4GUN A;  3KG2 A;  2M6Y A;  1XIL A;  3APO A;  3QF7 A;  1W0J G;  3GWK C;  4LFC O;  1VIB A;  2JGD B;  5EK0 A;  2AHZ A;  1NTM H;  3E8G A;  1SA0 A;  2F66 C;  1JFF A;  1QLE C;  1HNW B;  5CA0 A;  2CDY A;  5LP6 A;  1M57 B;  1D2D A;  4JAS A;  3DTU B;  2YEV B;  2Q69 A;  4DRX B;  2ZNJ A;  2NLJ C;  3BFR A;  3W7S A;  2IJK A;  1FKA O;  4GKK B;  1XNR O;  5IJ0 A;  3JAM N;  1SA0 B;  3ASN B;  4G28 B;  1CP9 A;  4FFK A;  5LBQ A;  2DYS C;  4X64 O;  5LP6 B;  1HDJ A;  1IXB A;  4WFH A;  3OTF A;  3JCU Z;  2BSK A;  3JAL A;  3NR7 A;  5KA5 A;  1VF7 A;  1Q6U A;  2EUL A;  4UCT A;  2YS8 A;  4Z1V A;  3VQY A;  5JVD A;  3P3N A;  1NR1 A;  1XNQ B;  3CEI A;  3BCC H;  4DK1 A;  2YXL A;  1AVM A;  1AI5 A;  1QNM A;  1YEW A;  4LF7 B;  1R3L C;  4I0X A;  4JYA B;  4DV2 O;  3CMA V;  4DV1 O;  2Q4P A;  1GN6 A;  5CB4 B;  2CTP A;  4KHP O;  4X8A A;  4DXW A;  3ZMS A;  2L6L A;  1KC8 W;  3UO2 A;  1VEW A;  2EJR A;  1UJW B;  2BSK B;  3JAL B;  3ZRS A;  1MSW D;  4K8Z A;  2GV9 A;  2LW7 A;  4DR5 B;  3I5D A;  1JMK C;  5JVD B;  5C8Y A;  3RVY A;  4JI8 O;  3APQ A;  3ZHT A;  1OV9 A;  1H2N A;  3CRM A;  3CYO A;  4FLW A;  1TA8 A;  2KKW A;  4OXS A;  1OHH G;  3E22 A;  5IY5 B;  4BW5 A;  4I0X B;  4PV1 B;  1N32 B;  2JEU A;  1MAB G;  2QWN B;  2C2A A;  3CWB H;  1K34 A;  1VQ9 V;  4KFM A;  1KKC A;  2PZS A;  4X66 O;  4JI0 O;  4TOI A;  3K3W A;  2WA4 A;  4EEQ A;  1WA8 A;  4DV7 B;  5B3S B;  4Q20 A;  1L0L H;  4X1K B;  5C8Y B;  4X64 B;  3E89 A;  2LGW A;  1TVK B;  1V54 C;  4MSW C;  1JQ0 A;  1CEZ A;  3E22 B;  1KP3 A;  3OEH G;  2VQF B;  1WB7 A;  4UVA A;  2R9R B;  2F23 A;  3CCM V;  4JAA A;  4FVM A;  1KUQ A;  3SPJ A;  2XND G;  2DQ0 A;  1YI2 V;  1ZTE A;  2OCC C;  5ITZ A;  4DV2 B;  2FTK A;  2IJH A;  2Q8V A;  2XAG A;  3Q4H B;  2UU9 O;  2Q6A A;  1H8H G;  4KHP B;  3G4S V;  3IJ4 A;  3THO A;  2Q5Z A;  1HNX O;  4FLU A;  2WLK A;  2E74 B;  3RYC A;  1H2K A;  1NZ6 A;  2EIK C;  5CA1 B;  4JI8 B;  2CAZ C;  3CCV V;  1SQX H;  4DR3 O;  1KQS U;  3KKY A;  2NR5 A;  3SJB C;  4YHH B;  3SPG A;  2PI4 A;  5ITZ B;  1RPR A;  3BRC A;  3D36 C;  4X89 A;  4TQD A;  4W4K A;  1XMO B;  2WLM A;  3OAA G;  3ZMU A;  4GKJ B;  4LR3 A;  2UXD O;  4O4J A;  1QR8 A;  1AJQ A;  1WP7 A;  3BVO A;  3ASO C;  4RUF A;  4UCO A;  3RYC B;  4DV0 B;  5LGN A;  1JA8 A;  1S77 D;  3ZHS A;  3FB8 C;  4YY3 O;  2IJI A;  2Z5U A;  2ZXW C;  3K03 A;  3LDD A;  3UCS C;  2UUA B;  5BXZ A;  4WFA V;  5KMG A;  1I0H A;  2JDI G;  1Q82 W;  4AI8 A;  3B2E E;  4QPJ A;  1AR1 B;  1BZK A;  2V7Q G;  5BZB A;  2NNU A;  3W7U A;  1MNG A;  2R9I A;  3RT3 C;  4O4J B;  5CA3 A;  4H44 B;  1XOU A;  1NT2 B;  1S3J A;  3PN1 A;  5DEC A;  3RYF A;  2Q0O C;  1OCZ B;  4MVM A;  1VQN V;  3JD3 A;  5LXT A;  4BAY A;  1GN4 A;  3K9S A;  3E8B A;  1GTO A;  1T5E A;  2P90 A;  5KMG B;  1BMF G;  5JJN B;  1RP3 B;  4OPA A;  4LF5 O;  3AG2 B;  3M8A A;  2EJ7 A;  2DQ3 A;  3BA8 A;  3DSQ A;  4J7K A;  1E1R G;  4JI2 O;  2WLH A;  1UFI A;  4MVZ A;  3L72 H;  1Z2G A;  2IU3 A;  2XAF A;  4K3A A;  1YF2 A;  4R50 A;  4D6T H;  5H5N A;  3RYF B;  4JAU A;  1N8R W;  4F6R A;  3SJQ C;  1ZL8 B;  5LXT B;  3SJA C;  4DR2 O;  1JCH A;  2E3C A;  4NXM O;  2E5L O;  4RQF A;  3ZRX A;  1OCC B;  1W59 A;  5K1P A;  3B09 A;  1M5I A;  3OEE G;  3SYA A;  4QE7 A;  3MHS C;  1BL8 A;  3A0H Z;  3FAV B;  2XUM A;  3JD2 A;  2VRZ A;  2DYR C;  4O4H A;  4DV4 B;  1K7D A;  4F6R B;  4ZHQ A;  4LF9 B;  1PNK A;  2A0L A;  3HB3 B;  2Q7E A;  4NTY A;  3LSS A;  4KXR A;  1FXV A;  2HJF C;  4TQF A;  3JAK A;  1JOY A;  3E8F A;  3RYH A;  2ADP A;  2AXT Z;  4FK5 C;  2XT9 A;  2F43 G;  5JQG A;  1NS1 A;  1XQ8 A;  2Y4U A;  2B9Z A;  3GWO A;  1QLN A;  1KBH A;  4ZKI A;  3ABU A;  1AJP A;  3QNE A;  1Q81 W;  3NXS A;  3ZMT A;  3QO7 A;  3CP1 A;  3K5O A;  4O4H B;  3K58 A;  3VBB A;  2EIL C;  5KHH A;  4JI2 B;  5FNV B;  4ZHQ B;  3OMN B;  2EIN C;  1U96 A;  4D7T A;  3ABL C;  2CE4 A;  1HWY A;  1QCE A;  2EIM C;  1VQ7 V;  1M93 A;  4C7U A;  1VQ6 V;  3AG4 B;  3RYH B;  2PUS A;  4AHC A;  3OM3 B;  2H94 A;  2ZT9 B;  3OR6 C;  5IDJ A;  5A2Q N;  5KHJ A;  5B1A B;  5CBH A;  5BR8 O;  4DR2 B;  2ADQ B;  4NR1 A;  5F2V O;  1Q6H A;  1AI6 A;  2QWR B;  1DLB A;  4WBN A;  4DUY B;  1N0J A;  3LSQ A;  1COW G;  1GN3 A;  4AQY O;  4TV8 A;  4BIU A;  1IBM B;  5DN6 G;  4IHJ A;  4EB6 A;  5L3F A;  1EBO A;  1M56 C;  4O4I A;  5KUK A;  1K4C C;  2GHY A;  5KAI Z;  2GBO A;  3VQW A;  1PP9 H;  3FYI B;  3HKB A;  1AB3 A;  3ABM B;  1ORQ C;  2KG7 A;  5D5Q A;  1Q86 W;  5KHG A;  1W2B U;  3MAQ A;  4I5S A;  2LJ2 A;  3RW0 A;  3OMA B;  2QKC A;  1G1X B;  4MTG A;  3OGC C;  2QM7 A;  5IYD O;  4J9Z B;  4WBN B;  1URF A;  4QE9 A;  2HLD G;  3U10 A;  4MTX A;  5L3C A;  4TV8 B;  2YDE A;  2UXC B;  2GTA A;  4IHJ B;  4EB6 B;  2VQE B;  4JF3 A;  4O4I B;  4JZ2 A;  3H1K H;  1KU9 A;  4WFG A;  3JSN A;  3A8T A;  2B1I A;  3OTO O;  3GVM A;  4E2L A;  1LUV A;  1GRJ A;  1Q43 A;  2KG7 B;  3K5M A;  1WP8 A;  4EKW A;  1QVF U;  1HNW O;  1QQC A;  3PJS K;  1S5H C;  4DV3 B;  4DK0 A;  3WG7 B;  4X88 A;  3X2Q C;  2AZ0 A;  2KSD A;  1B3Q A;  1J95 A;  4U7O A;  5HFM A;  2PYL A;  3SDL A;  4I9Q A;  1QLE B;  4RWU A;  1YJW V;  4LP8 A;  5GW7 A;  4DV6 B;  4NKG B;  1SRY A;  4PA9 A;  2PYJ A;  4GKK O;  1N33 B;  3T1C A;  3ZMV A;  4GYC B;  5IWA B;  1UPG A;  2WWW A;  4LBE C;  5JWP A;  4GT1 A;  1F51 A;  3OW2 U;  2RN9 A;  1K3E A;  3SYO A;  3JD1 A;  3TK1 A;  1D5A A;  2ILM A;  2RDC A;  2A3Q A;  3K59 A;  4ZBM A;  1HP8 A;  4U7N A;  5A9G A;  1JPX A;  1GAX A;  3CRA A;  4ICG A;  2DYS B;  4B7E A;  4LF7 O;  3JAW A;  3ML0 A;  4JYA O;  1BE3 H;  1WB8 A;  3I55 V;  3K5L A;  1FYJ A;  3ZMZ A;  2PTM A;  4X20 A;  2AZ2 A;  4NTW A;  1H2L A;  2Z0A A;  5E1A C;  5JCO C;  1N0N A;  2ZE8 A;  4UUJ C;  4UB6 Z;  3OD4 A;  2CTR A;  1IX9 A;  1HNZ B;  2JRI A;  4DR5 O;  1SZX A;  2ZQM A;  2ZIN A;  2ZIO A;  2X6C A;  3CPW U;  1S76 D;  5JJE B;  1U97 A;  4FZ0 A;  1QBZ A;  2HFE C;  2BCC H;  3JAW B;  1N32 O;  5LYJ B;  2LFR A;  3BA9 A;  4WF9 V;  3ZHR A;  1AI7 A;  1GKF A;  3CCR V;  4X65 O;  3AG3 C;  5B5E Z;  3CJH B;  1NTK H;  2H3O A;  2A7W A;  1VQL V;  4P30 A;  4GCZ A;  3SYQ A;  3ZRV A;  4DV7 O;  1JFF B;  2A9H A;  5CA0 B;  4CS4 A;  2FML A;  3ABT A;  3F7Y C;  5J2T A;  3B4S A;  3KZI Z;  4JI3 O;  1XMQ B;  1KB9 F;  1WPB A;  1DGS A;  1LR1 A;  4B3R B;  2PI5 A;  4H33 A;  3U0Z A;  1TGO A;  2ZM6 B;  3UO3 A;  2YXY A;  1ZLZ A;  2VQF O;  4FM1 A;  4N21 A;  5GTI Z;  1US6 A;  2OIG A;  4JI6 B;  4J42 A;  1AJN A;  1V54 B;  1P49 A;  5IT9 N;  1PL0 A;  5IJ0 B;  2HHH B;  2N04 A;  2PGG A;  5B1B C;  4AIL C;  3B8N A;  1RSO A;  1CPY A;  1S0V A;  4B3S B;  5J2T B;  1MOF A;  5IE9 A;  2OCC B;  2DWE C;  2DWD C;  2YIB A;  2VS0 A;  1K4D C;  3D36 A;  4BWA A;  1YCI A;  2M7W A;  3H9V A;  2WLL A;  1L1F A;  2Z3Y A;  2F1M A;  5KHI A;  2YIC A;  1Y74 A;  3ZN0 A;  1WLE A;  4YHH O;  1Y6X A;  1SES A;  5B66 Z;  1K8A W;  2EIK B;  2WPD G;  3UQ8 A;  1X59 A;  3CRQ A;  4JI1 O;  1ARO P;  3HKC A;  1XMO O;  1NJI W;  1VQ8 V;  3LNN A;  5TIS Z;  4X65 B;  4GKJ O;  4CS2 A;  1RSO B;  5KUM A;  4LF4 O;  3W7X A;  2XAS A;  1VQK V;  1PD3 A;  2XAH A;  4DV0 O;  2ZIM A;  2HP8 A;  3O65 A;  2BOB C;  1FFX A;  3CXC U;  3AK2 A;  2WLL B;  4D7S A;  2UUA O;  2F95 B;  2ZNI A;  4JI3 B;  2DJV A;  5GTH Z;  2EBO A;  1NKD A;  3ASO B;  4EFB A;  1SQP H;  2K1E A;  3J7A U;  3HKC B;  4FLZ A;  2WLN A;  2ZXW B;  4JTA B;  1MG1 A;  4LWS A;  4I9W A;  1A32 A;  3L70 H;  1PPJ H;  1Q3E A;  1KD1 W;  1WA8 B;  2VWJ A;  2QA4 V;  5KAF Z;  1FFX B;  2A79 B;  2YIB D;  3OE7 G;  4DO2 A;  1EN6 A;  1N4C A;  4KUM A;  3CD6 V;  2CK3 G;  2EIJ C;  2IH1 C;  5EBL C;  3VQX A;  2ARH A;  3A0B Z;  4J11 A;  4PDM A;  3T1Y B;  3QVN A;  2EX3 A;  2ODM A;  1TUB A;  4X1Y A;  3ZIA G;  1NI8 A;  5LHG A;  3ETG A;  1FD9 A;  5J2U A;  1RM1 C;  4ASU G;  3DGE A;  4LWS B;  1O9H A;  4PDR A;  4RO2 A;  4GX0 A;  5EBM C;  2RQ6 A;  3CCS V;  4JI1 B;  3MHH C;  1Y67 A;  4F4L A;  3I56 V;  3U11 A;  1YTF B;  4LF4 B;  4XBF A;  2JK5 C;  2Q0A A;  1HR0 B;  3K9A A;  1DK1 A;  2CGO A;  1FJG O;  5H2F Z;  1TUB B;  1L8D A;  4FIP C;  2IW5 A;  4P9O A;  1H38 A;  4PDV A;  1BS3 A;  4LFB B;  1I7F A;  2W6I G;  2DOS A;  4FMT A;  2UUB B;  4X62 B;  3LDC A;  2ZDI C;  3HKE A;  4GX2 A;  4HBN A;  5H6Q A;  5H9C A;  4DV4 O;  3AG7 A;  2JJ1 G;  3L75 H;  4LF9 O;  3LSU A;  1THZ A;  5EC2 C;  1NH2 B;  3N2G A;  1DTO A;  4DW1 A;  3K0G A;  2JGU A;  4DW0 A;  1QVG U;  1YTF D;  2DYR B;  4FPP A;  4MVR A;  5HFL A;  1P4R A;  4K8X A;  1HW7 A;  2RMK B;  1WAZ A;  1TAE A;  1H2S B;  1PKX A;  3T1H B;  4CH3 A;  2GSM B;  3LDE A;  3HKE B;  4PI0 A;  2YIA A;  3ZHQ A;  2HVK C;  2JS3 A;  3LNM B;  4JYB A;  4WFB V;  2WLJ A;  1J5E B;  2ITD C;  2EZO A;  1DF4 A;  3STL C;  3K0D A;  2OIE A;  4HYO A;  3CCQ V;  1NH2 D;  3ZED A;  2CTW A;  1Q8I A;  4DR1 O;  1SER A;  2RCV A;  3T4D A;  4UXN A;  1NQT A;  2Y69 C;  4OX9 O;  2ZD9 A;  4OGQ B;  2EIN B;  4H13 B;  2UXX A;  1OCR C;  4MTF A;  4UVB A;  3ABL B;  1D5N A;  1P7G A;  2EIM B;  1AP6 A;  3ETQ A;  1FJG B;  3TJT A;  5FPR A;  3L9D A;  4H37 A;  4BIO A;  2R9A A;  2P4K A;  3KCY A;  2AW9 A;  2UUC B;  4X1I A;  3H1J H;  4UVC A;  4DUY O;  3ZHU A;  3C3S A;  1CXZ B;  1IUR A;  1IBM O;  3M7M X;  1MZF A;  1NU1 H;  2LFS A;  1R3K C;  1Z5V A;  4ZI7 A;  1S5L Z;  2QGN A;  4KL1 A;  4PHZ A;  1K5Q A;  2ETN A;  3RN4 A;  4DR6 B;  4PA7 A;  2Y0I A;  4W4L A;  1MA1 A;  4NYK A;  3SPC A;  4QJF B;  2QDO A;  3DXR A;  2DN9 A;  3A0R A;  1M56 B;  3F5T A;  3ETD A;  4FLV A;  3H01 A;  4X1I B;  2F4V B;  4I4T A;  1F4N A;  4YIP A;  3G6B A;  4LC1 A;  3G6E V;  5J9P C;  3OMI B;  2UXC O;  5EYP A;  3ZX6 A;  2VQE O;  3H1L H;  2QM4 A;  3FB5 C;  3ZS8 C;  1GM7 A;  4FLX A;  2XTA A;  1AR4 A;  3QTC A;  4QNH B;  3CCE V;  3JAK B;  3J81 N;  1G8M A;  3ABK C;  3DXR B;  4DR1 B;  4NB5 A;  3G67 A;  4DR7 O;  1XL4 A;  2P22 C;  1YIJ V;  4CZZ A;  5JQG B;  1R3J C;  4OX9 B;  4DV3 O;  2FL4 A;  3JCZ A;  3B40 A;  2PY5 A;  1RFY A;  4N23 A;  1PM9 A;  4ZOL A;  2Q7H A;  5EYP B;  1V9P A;  3OGI B;  2R72 A;  1WJZ A;  4XDK A;  1PNM A;  2HVJ C;  4FLT A;  4DV6 O;  4MVS A;  2XOK G;  5C93 A;  2ATK C;  3X2Q B;  1N33 O;  5DM6 V;  2QSA A;  5LMN B;  1YVW A;  5IWA O;  3FKS G;  3FYE B;  4IT5 A;  4PDL A;  1JJ2 U;  2UXN A;  2CUG A;  5E79 Z;  4TV9 A;  1K73 W;  3ZRW A;  3IGA C;  4J10 A;  1S5J A;  4BIZ A;  1N34 B;  4UCV A;  4ABM A;  1G4Y B;  4B3M B;  4UCS A;  5LHH A;  5AG2 A;  1BHB A;  4J80 A;  5JCO A;  2KB1 A;  4JV5 O;  2WLI A;  5B1N A;  4O2B A;  1FFT B;  2LO1 A;  1VQ4 V;  2Q7G A;  4YJ2 A;  1I94 B;  3HR0 A;  4CC5 A;  2OTL V;  2RJZ A;  3ZJZ A;  3HKB B;  4TV9 B;  5BMV A;  3CS5 A;  1HNZ O;  2QWQ B;  1YJN V;  2ZE7 A;  4PJ0 Z;  1Q90 D;  4G27 B;  4DR7 B;  1SQF A;  3UM7 A;  2E75 B;  2QKA A;  3JD4 A;  2BE3 A;  2L35 A;  2N74 A;  3BAA A;  1ROP A;  4JYC A;  2WLI B;  5IYZ A;  2DE0 X;  3MD0 A;  3RYI A;  3E35 A;  1EFR G;  4GLX A;  3EFF K;  4YJ2 B;  5EC1 C;  1GO3 F;  1OCO C;  1AR5 A;  2FKX A;  1MSD A;  5EZY A;  2LP7 A;  5LOV A;  5BMV B;  3IAY A;  1SET A;  2WSS G;  2G38 A;  4HAM A;  1SKV A;  2IJJ A;  5EIB C;  2OWO A;  3BAB A;  3AG3 B;  5CBG A;  2P6J A;  1VQO V;  4MVU A;  1XMQ O;  1GN2 A;  2Q67 A;  5IYZ B;  4B3R O;  1FAF A;  4K0K B;  1GMG A;  3F5W C;  2ZM6 O;  2UXB B;  3AK3 A;  3RYI B;  1XI1 A;  2HJD A;  4X9Q A;  3RGB A;  2X6B A;  2P4V A;  4JI6 O;  3OUF A;  1Q5O A;  3H1I H;  5EZY B;  4JV5 B;  1YIT V;  5LOV B;  3CC2 V;  3K57 A;  2GUZ A;  4Q6G A;  2HHH O;  2IH3 C;  2WA3 A;  5H6R A;  4OPH A;  4PA6 A;  1WNS A;  1BGY H;  4MW3 A;  2OT5 A;  4B3S O;  2XHB A;  3FD9 A;  3G80 A;  5FL7 G;  1IZ3 A;  2YI9 A;  1AIL A;  2OTJ V;  4MW8 A;  5B1B B;  3HKD A;  1K92 A;  5FPO A;  3S3W A;  4JAV A;  2GUZ B;  3P3P A;  2XAQ A;  4LFA B;  3CCU V;  1ZWI C;  4NXN O;  3AG1 C;  4LCU C;  4X20 B;  1OZ0 A;  3CRR A;  3ICX A;  1EN5 A;  2GDS A;  5D5P A;  4XDJ A;  3TXQ A;  1NVP B;  4LH7 A;  4MTO A;  3CCL V;  2X0L A;  3K08 A;  1M1K W;  3UT5 A;  1BCC H;  2ZE5 A;  3B77 A;  2LGQ A;  1KEC A;  4JI4 B;  4WFF A;  1IBL B;  2X6A A;  5IYB O;  3UKM A;  3WU2 Z;  1XUQ A;  3HKD B;  4TSF G;  4P2Z A;  1GK9 A;  3CE2 A;  4JI7 O;  1KMI Z;  2PF4 E;  4CC6 A;  5EBW C;  5L3B A;  1BT8 A;  4O2A A;  3ZCC A;  4JI5 O;  1ZUQ A;  3N27 A;  4IGG A;  3CCJ V;  3K5N A;  3MDS A;  1GM9 A;  2CH7 A;  2JS5 A;  2X7R B;  5CB4 A;  3W7W A;  4IIJ A;  4B3T B;  4LF6 B;  1VF6 A;  1B04 A;  4J7J A;  1K33 A;  5CBF A;  2D2C B;  3UT5 B;  1FXK C;  3HPL C;  2LQT A;  1NVP D;  1NR7 A;  4R6Z A;  5KA6 A;  4UV8 A;  5B1O A;  2ZCE A;  1OJH A;  3J80 N;  1V55 C;  1ZX3 A;  1Z5W A;  1O9G A;  3EHB B;  4PEL A;  4HNA A;  4O2A B;  4CBC A;  2QTS A;  3T1Y O;  4RQE A;  5IJ9 A;  4LNU A;  3E8H A;  2DMX A;  3R65 A;  4JPR A;  1SZT A;  2CH7 B;  2Y48 A;  1EZV H;  1M57 C;  4I50 A;  4IIJ B;  5KX5 A;  2P7T C;  2YUA A;  4DUZ O;  1BQ0 A;  2EIJ B;  1YSC A;  4FZ1 A;  1DF5 A;  1MMM A;  1JVM A;  1K9M W;  4LFC B;  2Q9L A;  4YIO A;  1LNQ A;  4NXN B;  4X1K A;  1RM1 B;  1YXB A;  2Q73 A;  3STZ C;  1L0N H;  1HR0 O;  1TVK A;  3BY6 A;  3OT7 A;  1VQM V;  2ZDI A;  4HNA B;  1R3I C;  3E2E A;  5IJ9 B;  4LNU B;  3ASN C;  2ZE6 A;  3ZN1 A;  1E1Q G;  1LUW A;  4JZG A;  1JX9 A;  1VMG A;  5LP6 C;  4FM0 A;  4I50 B;  4JI7 B;  1R6T A;  1G6U A;  5LGU A;  5KX5 B;  4LFB O;  1Y74 B;  1XDC A;  4TT3 G;  2E76 B;  2UUB O;  3B8M A;  4X62 O;  4DV5 O;  4JI5 B;  1XNR B;  1KKD A;  1R1B A;  2IM9 A;  4UB8 Z;  3Q4H A;  2B1G A;  1H2G A;  4Z1M G;  3WB1 A;  2ITC C;  2CGN A;  2MW2 B;  5FLX N;  2XAJ A;  1VQ5 V;  1GH6 A;  2IU0 A;  3ETE A;  3G71 V;  5CA1 A;  2HKO A;  3SYP A;  2JEX A;  5LA6 A;  3T1H O;  1AI4 A;  1VF6 C;  3C3T A;  4LH6 A;  1I5Y A;  5IYC O;  2VWK A;  3WFV A;  3SR2 C;  5L3E A;  4PD4 F;  4DV1 B;  3ZHV A;  3VQV A;  3P30 A;  1J5E O;  4DUZ B;  3KCX A;  1SQQ H;  5IY5 C;  4I55 A;  1ENV A;  3SJC C;  4UV9 A;  4HZ3 A;  5LHI A;  3FB6 C;  5LA6 B;  2P06 A;  4J9Y B;  4PA4 A;  1B6Q A;  1FS0 G;  2YXH A;  1F4M A;  1JJO A;  4X1Y B;  5B3S C;  3WB2 A;  1QHT A;  1X4T A;  2UUC O;  2W0X A;  2Y69 B;  5J2U B;  2EZP A;  1R6N A;  4E4E A;  1K97 A;  2JJ2 G;  1OCR B;  4F6E A;  4JYY A;  3CB2 A;  4DV5 B;  3QO5 A;  4X66 B;  2QR4 A;  4JI0 B;  3BPZ A;  4I55 B;  1R73 A;  4JTC B;  4NTX A;  4DR6 O;  2V1D A;  2ZR2 A;  3EVK A;  2YSU B;  2W6J G;  5KHK A;  3E83 A;  4XDL A;  5DED A;  2OYQ A;  3GB7 C;  1IBK O;  1WPX A;  2F4V O;  4DR4 O;  3P32 A;  4B08 A;  3DC5 A;  2P67 A;  5KLV H;  1QR9 A;  2KQX A;  1PNL A;  3L74 H;  4QGP A;  2BTO A;  2H8P C;  1JR9 A;  3JD0 A;  4EFE A;  1ZAU A;  1Q6I A;  1M90 W;  3IC9 A;  3SPI A;  2UU9 B;  1FXH A;  1ZL8 A;  1PL4 A;  1I08 A;  3N2G B;  3CHX A;  5L3G A;  1HNX B;  1EM1 A;  4JGS A;  4H0L B;  5K1X A;  3TGU H;  5JH7 A;  2EIL B;  3JAT A;  5BY1 A;  1EN4 A;  1H8E G;  4IL6 Z;  3BHP A;  3FAV A;  4DR3 B;  2GTS A;  2HR3 A;  4R7C A;  1VP7 A;  3LUT B;  3QG5 A;  2YI8 A;  2R70 A;  1B06 A;  2F93 B;  3ABK B;  3SGI A;  3SYC A;  1XHX A;  1XL6 A;  4L8J A;  2Y4T A;  4GZR B;  3CX5 F;  3RBZ A;  5GON A;  2P5O A;  1FPO A;  3JSL A;  2K9P A;  4Z2W A;  1IXM A;  4J7Z A;  1N36 O;  2UXD B;  2JVD A;  3FX7 A;  3EXA A;  1P7B A;  1M4U A;  3S3X A;  5LMN O;  2JIZ G;  5JH7 B;  1IVS A;  3JAT B;  3RFR A;  4YY3 B;  3JAS A;  3H1H H;  3SPH A;  3C90 A;  5CN0 A;  3CC7 V;  4TUY A;  2QE7 G;  1N34 O;  2Y0P A;  3O9O A;  3FFQ A;  1OCZ C;  4B3M O;  1IBK B;  4J41 A;  4R8C A;  2HEP A;  5LL6 Y;  5FNV A;  2B5U A;  3RVZ A;  4DR4 B;  5GON B;  2YC0 A;  3AG2 C;  1EZJ A;  1YJ9 V;  1I94 O;  4ZI7 B;  5JJJ B;  2OCH A;  1XBL A;  1F7Y A;  1P84 F;  3JAS B;  1BHA A;  4QPK A;  2ZKO A;  3D3I A;  1VQP V;  3F7V C;  1XEQ A;  4MVQ A;  3K06 A;  1YDX A;  4LF5 B;  4PA3 A;  4TUY B;  3ZBH A;  1WN7 A;  4UCU A;  4BR6 A;  1KYO F;  1I5X A;  1SF9 A;  4I4T B;  2NN4 A;  4RUE A;  4WCE V;  5LMU O;  1SQG A;  4IYH A;  3CRC A;  3WB0 A;  1OCC C;  4WFE A;  1H2M A;  4FFB A;  2QJ1 A;  3AK1 A;  4MS2 A;  3OFN G;  3K04 A;  3TET A;  3AEI A;  1N36 B;  3T4Z A;  2QTO A;  4NVP A;  2D3O W;  2W0F C;  4NXM B;  4L87 A;  2E5L B;  3L73 H;  3A2F A;  4UCR A;  4YXW G;  2QEX V;  2MK3 A;  2FYU H;  4LF8 O;  1OCO B;  3OUS A;  3IC7 A;  4FJC C;  4FLY A;  4O4L A;  3JAR A;  3TXS A;  4YJ3 A;  2CTQ A;  3TCU A;  1NBM G;  4K0K O;  2YID A;  4ZOL B;  2UXB O;  3CXH F;  1BQZ A;  2BOC C;  4FFB B;  1K5S A;  3K79 A;  3VOU A;  4P9P A;  1PV0 A;  2QM8 A;  3E86 A;  5LGT A;  1VAR A;  1GM8 A;  2O57 A;  2AGA A;  3W7T A;  3T2M A;  2FB5 A;  2ZR3 A;  4CH6 A;  4GX5 A;  2HG5 C;  3IFX A;  4FM2 A;  4RAI A;  4TWK A;  1VF5 B;  3ZRW B;  4O4L B;  1Y76 A;  2Q68 A;  3JAR B;  4BW9 A;  4YJ3 B;  3AG4 C;  2IBZ H;  3JYC A;  1SS3 A;  1IDS A;  1AP5 A;  4PI2 A;  1BSM A;  5B1A C;  1W0K G;  1E79 G;  2AHY A;  4U3J A;  3CME V;  5LMU B;  4QIW F;  5EIB D;  2A06 H;  4B7K A;  4O2B B;  4CH4 A;  4LFA O;  4K35 A;  2RNB A;  4U3F H;  4JTD B;  1TUE B;  5BR8 B;  5CMU A;  3L71 H;  1Y76 B;  1IBL O;  1R6K A;  4ZIB A;  2N05 A;  4JI4 O;  4G2K A;  1YZB A;  1ZSP A;  4LF8 B; 
#chains in the Genus database with same CATH homology
 3OTO O;  3JAM N;  4GKJ O;  2HHH O;  4LF4 O;  3T1Y O;  4X64 O;  4OPH A;  2DOS A;  1N32 O;  4B3S O;  4DV0 O;  1HNW O;  4JV5 O;  1KUQ A;  4JI1 O;  4DV4 O;  3O65 A;  4DUZ O;  4LF8 O;  4X65 O;  4OPA A;  4LF5 O;  3F5T A;  1N36 O;  4LF9 O;  3M8A A;  2UUA O;  2UU9 O;  4B3T O;  4LF6 O;  1AIL A;  2DJV A;  5LMN O;  4JI2 O;  4K0K O;  5A2Q N;  1HNX O;  2UXB O;  3SDL A;  4DV7 O;  2UUC O;  2UXC O;  3J7A U;  5BR8 O;  2VQE O;  1HNZ O;  4DV2 O;  1HR0 O;  4A5U B;  4DV1 O;  5H5N A;  4JI3 O;  4GKK O;  1XNQ O;  1A32 A;  4KHP O;  1YZB A;  4NXN O;  4DR3 O;  1N34 O;  2N74 A;  3R66 A;  3J81 N;  2AGA A;  2VQF O;  4B3M O;  4DR6 O;  4DR2 O;  1R6T A;  5LL6 Y;  4NXM O;  4LFB O;  2LW7 A;  2E5L O;  4DR7 O;  4AQY O;  2UUB O;  4X62 O;  4DV5 O;  4JI8 O;  4DV3 O;  2FKX A;  1R1B A;  2UXD O;  5IT9 N;  1I94 O;  1IBK O;  4JI7 O;  4DR1 O;  4LFC O;  2F4V O;  4DR4 O;  5FLX N;  1F7Y A;  1AB3 A;  4JI5 O;  2ZKO A;  4OX9 O;  4LF7 O;  1D2D A;  1XEQ A;  4YY3 O;  4JYA O;  4DV6 O;  1FYJ A;  1G1X B;  5BXZ A;  1N33 O;  3T1H O;  4X66 O;  4LFA O;  4JI0 O;  1XMQ O;  4B3R O;  2Z0A A;  2ZM6 O;  5IWA O;  4YHH O;  2JRI A;  4DUY O;  5LMU O;  4DR5 O;  4JI6 O;  1DK1 A;  1NS1 A;  1FJG O;  5BY1 A;  1FKA O;  1IBM O;  3RT3 C;  1J5E O;  1X59 A;  4JI4 O;  3J80 N;  1XMO O;  1IBL O;  1XNR O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...