4JYAO

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4jyaO00
4DUYO 4DR7O 4DV7O 4JI2O 3OTOO 1D2DA 1AILA 2DOSA 4JI3O 4DV3O 4X64O 4B3RO 4DV2O 3J81N 4DR1O 5BXZA 1R1BA 1X59A 2UUBO 1IBLO 5LMNO 3R66A 4GKJO 4B3TO 2F4VO 4LF7O 4X62O 3JAMN 4LF9O 4NXMO 2Z0AA 2UXBO 4OX9O 4DUZO 1AB3A 5LL6Y 1FKAO 4JI8O 4DV5O 1IBMO 1N36O 4NXNO 1N32O 5LMUO 4B3MO 4JV5O 4JI5O 5FLXN 1HNXO 2UXCO 4DR4O 4LF6O 4DV1O 4OPAA 4JI7O 4LFBO 5BY1A 1NS1A 1KUQA 2E5LO 1DK1A 4KHPO 1FJGO 4JI4O 3RT3C 2UU9O 1FYJA 2JRIA 2UUCO 5BR8O 5A2QN 4LF5O 1XNRO 5H5NA 2UUAO 2AGAA 3O65A 2UXDO 2ZKOA 4B3SO 1IBKO 4A5UB 2LW7A 2FKXA 4DV4O 4LF4O 4JI0O 1XEQA 4DV6O 4DR2O 1F7YA 4JI6O 1G1XB 1XMQO 4DR6O 3J7AU 2DJVA 1HR0O 4DV0O 3SDLA 1J5EO 2ZM6O 1N33O 1YZBA 2N74A 4YHHO 1I94O 4GKKO 5IT9N 2HHHO 4LFCO 3F5TA 4YY3O 3T1HO 1XMOO 3T1YO 4K0KO 5IWAO 4LFAO 4AQYO 4JI1O 1A32A 4X66O 4DR3O 2VQFO 4JYAO 4DR5O 4LF8O 1XNQO 3M8AA 1R6TA 4OPHA 1HNWO 1N34O 4X65O 3J80N 1HNZO 2VQEO
chains in the Genus database with same CATH superfamily
4DV1B 3CXCU 3K0GA 4O4HB 3MAQA 3ML0A 3JAWA 5IYZA 2F4VB 3OTFA 1H2LA 3DGEA 4P9PA 1UJWB 1E1RG 4IGGA 4X8AA 2OCHA 1PL4A 3QO8A 1G8MA 2C2AA 3JASA 4XDKA 5KHJA 1I08A 1SQQH 2ZXWB 1KYOF 4LH7A 4DV5O 5EZYA 1V55B 1VMGA 2P4KA 4NXNO 3L73H 2A3QA 5J2TA 3GVMA 2EZOA 1BSMA 5EIBC 2NNUA 5TISZ 5HFMA 1Y76B 4KHPO 1EN6A 3CRMA 4Z1VA 3O9OA 2AZ0A 3ZEDA 2IJJA 3EHBB 2P5OA 5B1BC 5H5NA 1WLEA 3E8BA 4DK0A 1XMQB 1SA0B 2EZPA 3K9AA 5LA6B 2ZE5A 2B1IA 4AHCA 1K8AW 3CB2A 4MVUA 3L71H 1KBHA 1HR0O 4RWUA 3SDLA 1N33O 4X1KA 3A0RA 3KKYA 4YY3O 2G38A 1MSDA 5DECA 1H2SB 2YIDA 5IYBO 4NTYA 3OAAG 4DR3O 2VQFO 3AG3B 1GH6A 3BRCA 1R6TA 4ZHQB 5CBHA 4B3RB 5C8YA 1AJPA 3SPHA 4C7UA 2VQEO 2PGGA 2XAGA 4LFBB 5E1AC 1GN3A 5CBGA 1EN4A 5B1BB 1VQKV 2L35A 4FM0A 4DV2O 2GBOA 1LUWA 4OX9B 1RPRA 1N4CA 4JF3A 4LF5B 4HNAA 3K5NA 4PDVA 1SZTA 1VQLV 4LF7O 1PP9H 1ZUQA 1YTFB 4LNUB 3UM7A 1OCCC 1GRJA 3H1IH 4MTGA 3ETDA 2E75B 1IBMO 3DXRA 1N36O 1K33A 3RWRD 1SQPH 1PNLA 2N05A 1AROP 1W2BU 5ITZB 1XREA 5JVDB 1BCCH 4E2LA 5BY1A 4JZGA 1S77D 1MMMA 3ABKB 4H13B 1YXBA 3RYFA 4FPPA 2YS8A 1IBKB 3RVZA 5BR8O 5IJ0A 1XNRO 2PUSA 1VQ9V 4LF4B 2WSSG 1SS3A 3A0BZ 3K79A 4U3JA 2CAZC 2V1DA 1IDSA 3JATB 3HKDA 1OCZC 3AK3A 4I4TB 3BFRA 1K5SA 1IVSA 1P84F 2PZSA 5A9GA 2W6IG 2O57A 3RYIB 1P4RA 3JCZA 3CCMV 4GKJB 3Q4HB 1OCCB 3CRRA 4OXSA 4K8XA 3F5TA 1JFFA 4FVMA 1GN6A 4O2BA 4I5SA 3F7YC 1TVKB 2PYJA 2KQXA 3OE7G 2QEXV 4X1YA 3FYIB 3KCXA 3SJCC 2WLMA 5LYJA 2ZNJA 4R50A 3JALA 3N2KB 4TV9B 2YXYA 4JI7B 4JI2O 5FNVB 1I0HA 3W7XA 3MD0A 4X1IB 2ETNA 3SYQA 1AI7A 2AZ2A 1GMGA 3OT7A 4FM1A 1GM7A 5LGTA 5L3FA 4K3AA 4JI5B 2YEVA 2ARHA 3C3SA 3TGUH 1YJNV 4NR1A 1FXKA 4DV4B 2Q7EA 1M56C 4J9YB 4Z2WA 1NVPD 2EILC 4MTFA 2XOKG 3S3WA 3CMAV 2PF4E 3ABMB 4I55B 3VBBA 5CA1B 3ZN0A 1JR9A 2UXDB 5LBQA 3CE2A 4PELA 5IJ9A 3GWKC 4UUJC 3WFVA 3GWOA 3HKEA 4FFKA 1B06A 3H9VA 4LF8B 1U97A 1QNMA 2ATKC 1ZX3A 3OUFA 2IH1C 1FXKC 3JYCA 5CA3A 1FS0G 4EFEA 4JI0O 1X4TA 4DR2O 2QM4A 1FFTB 1P49A 3SYOA 3J7AU 4K0KB 3CHXA 3I56V 2PY5A 5KHKA 2IM9A 3SJBC 1H8EG 1M56B 2B9ZA 2WA4A 5H6QA 1PM9A 4ZIBA 2P7TC 2EILB 4LFAO 1B3QA 3RVYA 2XNDG 3JARA 2ZINA 2OT5A 2RCVA 3CEIA 2LGQA 3P3NA 2QGNA 4X65O 2N04A 5LMNB 5EK0A 3UCSC 2JIZG 2HKOA 2XUMA 3TJTA 2JGDA 4TWKA 3CS5A 2JVDA 1X59A 1W0KG 3OMAB 2LQTA 3D3QA 2UUCB 1FXKB 3CWBH 4IIJB 2OCCC 3ZJZA 5GTIZ 4B3TO 2DWDC 4BW9A 4UCSA 1NJIW 4LWSA 5CB4B 4MW8A 2CGOA 2ZQMA 3CX5F 3UQ8A 4J80A 3VOUA 5B66Z 4PDRA 1ZWIC 2ZCEA 4JI8O 2HVKC 1FFXB 4P30A 1S3JA 1NTKH 1KKDA 4JTDB 4WBNA 1OV9A 2FTKA 1VEWA 2UUAB 2ZE8A 1XMOB 4MVMA 4F6EA 1XHZA 2CTPA 3B8NA 1VQ4V 5IWAB 2R9AA 1M4UA 3ZRWA 5LOVB 4IYHA 3WB2A 2KG7A 5HFLA 2XTAA 5D5QA 5IYCO 1J5EB 1XEQA 4O4IA 4X64B 1OZ0A 3KCYA 2OCCB 2QWNB 1Y66A 5DM6V 1WN7A 3HKBB 5K1XA 3CC7V 3H01A 4GKKO 3E22A 4WFBV 1KKCA 4YIOA 2WA3A 4KXRA 1YDXA 3K9SA 4WFAV 1QR8A 1W59A 3JD2A 4B7KA 2DE0X 4DR5O 2OTJV 3U10A 4DRXB 2CTWA 4UB8Z 4RUEA 4I0XB 1O9GA 3OTOO 3UT5B 3ZHUA 2EINC 4HYOA 3J81N 2YIBA 1QVGU 3SJAC 2UXNA 2F4VO 4X62O 2GHYA 2B5UA 2UXBO 4WF9V 2QKSA 2JK5C 5B1AB 2UXCB 1SESA 2YXHA 2F66C 5KUMA 2VWJA 1S0VA 3CSXA 1SRYA 5JH7A 1RM1C 2MK3A 4FMTA 5K1PA 4GX5A 1KP2A 4LC1A 5EYPB 2NR5A 2ITDC 2YC0A 1NS1A 3ZHTA 1ZL8A 3TK1A 4YXWG 2DN9A 4E4EA 1GN4A 1EBOA 3T1YB 1JVMA 2W6JG 4TV8A 1WP8A 4TQFA 3B2EE 3S3XA 2Q8VA 2BSKA 5EC1C 2EJ7A 1HNZB 2EINB 2LW7A 2QTSA 4J42A 4H37A 3CRCA 2CE4A 1GAXA 2JS3A 2HHHB 1HDJA 4DR1B 3SPIA 3PJSK 1XMQO 3CPWU 2D2CB 4AQYB 2ZM6O 3SYCA 2WLIB 4X66B 3VQWA 1ENVA 4LF9B 3K08A 1RPOA 5KA6A 4H33A 4I9QA 4J7ZA 3U0ZA 2QTOA 1RM1B 4F6RB 1OCRC 1HW7A 5LXTB 1NTZH 3STZC 4JI3B 3MHSC 1SETA 2GTAA 3IC9A 3AG1C 1YSCA 1BS3A 5CA0A 4BIOA 5L3EA 2PI5A 4DR4B 4LF6B 2EJRA 4DUYO 2GUZA 2GV9A 3T4DA 2IJHA 3SPCA 1VF5B 4Q6GA 1AILA 4D7TA 3JD1A 5KMGA 1NZ6A 1B04A 1NQTA 3K0DA 4B3RO 3WU2Z 3SR2C 4YIPA 2ZDIC 1VQ6V 3LUTB 2PI4A 4J10A 4JTCB 4R7CA 2AHZA 4B3MB 4YJ3B 2RQ6A 4DO2A 4P9OA 4OX9O 1O9HA 5L3DA 1RSOB 2YI9A 2YICA 2E5LB 5LMUO 2HJDA 1FJGB 2DWEC 4PD4F 1OJHA 5JCOA 5FLXN 4PI2A 4G2KA 3SPJA 1B6QA 2BTQA 2BTOA 2DQ0A 1HP8A 1VQOV 4ZBMA 1YIJV 1OCRB 2HJFC 3ABUA 1WA8B 2JRIA 1V9PA 3AG1B 4EB6B 2A7WA 3JSLA 4H0LB 2KSDA 1D5AA 3W7UA 1IX9A 1AR1B 1GM8A 1IBKO 3LSSA 5L3BA 3TXSA 4O2AA 1Y74B 1XL4A 2X6AA 5EIBD 4LF4O 1I94B 3OW2U 2JDIG 4DV3B 4DV6O 3ZMTA 3QO5A 4X89A 2RMKB 4WFHA 4JTAB 4MW3A 2QA4V 2P6JA 2N74A 1VQPV 1UPGA 2K1EA 2EIMC 4ZKIA 4NXMB 5BMVA 2K9PA 1M1KW 2ZIMA 3APOA 3RN4A 3OFNG 1N0NA 2F1MA 1MABG 4DV7B 3C90A 1DTOA 1Q43A 3WG7C 2WLJA 3W7WA 4JV5B 1G4YB 3FAVB 1L1FA 2ZT9B 1YTFD 5JJJB 3ZRXA 3N27A 1TUBA 2E3CA 4L8JA 4DR7O 2D3OW 1AVMA 1D2DA 3L70H 3L9DA 2QM7A 1ZAUA 1Z5VA 3B4SA 3AEIA 1PKXA 2JJ1G 2UUBO 1YF2A 3FFQA 3F7VC 1SQGA 2AXTZ 3JAWB 5IYZB 1R3IC 4X9QA 5CMUA 3LNMB 4YJ2A 2YI8A 3CCRV 4WFGA 3AK1A 4JI5O 3JASB 2HVJC 3CJHA 3OUSA 1E79G 2RNBA 4DV0B 3B77A 4X20A 5EZYB 2EIJC 1M5IA 2FB5A 3WG7B 4EEQA 5J2TB 2DMXA 3N2GA 3B8MA 3BPZA 2UXDO 2OIGA 3M7MX 3A0HZ 4GCZA 3CRAA 5GW7A 4J7JA 5JQGA 2Q73A 5B3SC 4UVBA 2FKXA 3EVKA 4GX0A 2WLLA 1F7YA 1JQ0A 2QKAA 3FX7A 5KX5A 3ICXA 2BCCH 2JGUA 1MZEA 2BE3A 2Z3YA 2Y0PA 1DGSA 1KC8W 4UB6Z 2M7WA 4IHJA 1Z2GA 1ZTEA 4KP4A 4JYAB 4EFBA 4FLYA 3MHHC 1TUBB 4K0KO 1BMFG 1K9MW 4DV5B 2F43G 4X1KB 1XNQO 4MVZA 2EIJB 1THZA 1R73A 1EN5A 3K5LA 3OMIB 1JX9A 1E1QG 1BQZA 4JYCA 2XAJA 4KHPB 4UCTA 3B40A 3RBZA 2ZR2A 5C8YB 1BZKA 4MT8A 5BXZA 3LDEA 3ABTA 3DTUB 4PA4A 5LMNO 1AR5A 4DW1A 3CRQA 2P67A 5B3SB 2YUAA 3K5OA 3JAMN 2Q68A 5H2FZ 1VQ7V 4EKWA 4HNAB 1SF9A 2Q0OC 3HPLC 3TETA 1FXVA 1S76D 4CH6A 4O4JA 1HR0B 2YXLA 5IDJA 3JAKA 3DXRB 1DK1A 1Q6IA 1OCZB 1RFYA 2EIKC 4GYCB 3CD6V 4JI6B 2QM8A 2UUAO 4ZOLA 4P2ZA 3UO2A 3H1JH 3RYFB 2VQEB 3BEHA 4CH4A 1AJNA 5IJ0B 4FJCC 3DSQA 1Q6UA 2KB1A 4F4LA 3P32A 4JAVA 1SC5B 4U3JB 4DR6O 3VQVA 1K92A 4JI1B 2XAQA 3ZMVA 3HKDB 4LBEC 1J5EO 1KMIZ 4YHHO 1I7FA 2R70A 1HNWB 1VQ5V 1WPBA 3ZIAG 2IW5A 3E8HA 5LP6A 3NXSA 4NTXA 2WPDG 1IBMB 1AI5A 2QKCA 2Q67A 1GTOA 4OPHA 1L0LH 3HKCA 3OEHG 5FL7G 1JFFB 4XDLA 3E2EA 1IBLB 4O2BB 3OD4A 4CC6A 4CS4A 2HG5C 4PHZA 2EIKB 4X1YB 2AW9A 3NR7A 5LYJB 4DUZB 4LCUC 5BR8B 3JALB 2ZE6A 4QE9A 3KG2A 1F51A 5KAIZ 1KQSU 1XOUA 4JGSA 1FXHA 1F4MA 1NI8A 3HR0A 1EM1A 5LL6Y 4D7SA 4KUMA 1D5NA 4HZ3A 4LP8A 3LDCA 4O4LA 2YEVB 5F2VO 5FPOA 3QO7A 2HFEC 2LP7A 1HNXO 2UXCO 2QWQB 1S5LZ 3X2QC 2JEUA 3JD4A 1YHQV 4I9WA 2Q7GA 3ZHSA 4WCEV 2DQ3A 1BHAA 1NR7A 1WJZA 2F23A 3UO3A 4RQFA 5D5PA 2R9IA 2OYQA 3CCVV 5J2UA 1M90W 3R65A 1CXZB 1XBLA 3E89A 2V4DA 5IJ9B 4G27B 3HKEB 1CPYA 3ABLC 2P06A 3D3IA 2GDSA 1VARA 3IGAC 2HEPA 3OMNB 2HHHO 4U7NA 1AP5A 5KUKA 4AQYO 3T4ZA 3VQXA 2ZNIA 2XT9A 1A32A 4X66O 3C3TA 5L3CA 2IU0A 2F95B 1R3JC 4J9ZB 2Q69A 4CS2A 1K73W 1JA8A 1N34O 4I50A 3OGIB 4ZI7A 4NYKA 3K5MA 3JARB 2Q9LA 3QG5A 4JI3O 4NKGB 4NTWA 1FAFA 1YITV 4GLXA 3K3WA 4UVAA 3PN1A 5KHIA 1ROPA 4N21A 1PV0A 3R66A 2XHBA 1N8RW 1NTMH 1BQ0A 2R9RB 2JGDB 4TUYA 2E74B 1H38A 3ABLB 1F23A 3JD3A 2BOBC 2MW2B 2CH7A 4BAYA 3G71V 3B09A 4B7EA 4L87A 4FFBA 4JI0B 1VP7A 4DR2B 5IYDO 3EFFK 1N32O 4B3MO 4RQEA 4LWSB 5GONA 1YJ9V 3RYCA 1M57C 2UU9B 2ITCC 1TA8A 3JSNA 3CCEV 4DV1O 5KLVH 2E5LO 1LNQA 3FB7C 1FJGO 2CTQA 1MG1A 3IC7A 2XAHA 3CCSV 4WBNB 5EC2C 4JAUA 2NLJC 1K5QA 3CC2V 3OM3B 1Q81W 4R8CA 2IU3A 1SQVH 2IH3C 3SYPA 1MNGA 3RW0A 3ZRWB 4LFCB 2KG7B 3AK2A 3T1HB 1EZVH 2YIBD 3RYHA 1YVWA 5KHHA 5J9PC 1LR1A 4K35A 1YZBA 1I94O 4B3TB 5IT9N 3ZMZA 1PD3A 4O4IB 1RP3B 1KB9F 1S72V 3BABA 1JMKC 2FMLA 2P90A 1CP9A 1AP6A 3A2FA 4JI8B 1BE3H 3QNEA 3D8CA 4O4HA 3ZRVA 1NBMG 4FZ1A 3G80A 4PA9A 3E22B 5LHIA 4QGPA 2HP8A 4DV7O 3ASNC 1Q8IA 1JCHA 3TXQA 5EBMC 3QTCA 3A8TA 3SYAA 4LR3A 2JEXA 2LO1A 4I7ZB 1H8HG 3RFRA 4JZ2A 2Z0AA 4TOIA 3G67A 3OEEG 1L0NH 1P7BA 4AILC 3K03A 1Z5WA 1Y76A 2CUGA 4PA3A 3LDDA 4JI4B 4FLXA 1P7GA 3BA8A 3T1CA 2QR4A 4GKKB 4RAIA 4LFBO 3EXAA 1KUQA 2X7RB 5B1OA 4D6TH 2JJ2G 5JH7B 4B3SB 4RO2A 1DLBA 3P30A 5LA6A 4LF5O 4KL1A 2PTMA 3SJQC 4DR5B 1S5HC 1ZL8B 5IY5C 3ASNB 3FKSG 3WB1A 1WNSA 3CCLV 4TV8B 1GN2A 1FD9A 4UCRA 4OGQB 5KAFZ 2BSKB 3CCJV 3BA9A 1JJOA 1NR1A 1G1XB 4PA6A 1VF6A 2ZIOA 1CEZA 2YDEA 4GT1A 4X62B 1K97A 1BHBA 3GB7C 4ZHQA 2UXBB 1QBZA 3K59A 2QSAA 3IFXA 4CH5A 1VQMV 3H1KH 2DYRC 1XILA 4JYAO 5JCOC 3FB8C 3ZHVA 1QU7A 1SKVA 1YCIA 1SQFA 2ZE7A 5BZBA 1H2GA 2DOSA 1VF6C 2H3OA 5CBFA 2VWKA 3ZMUA 5IY5B 1R1BA 2WLKA 5CA0B 4LNUA 3AG3C 3IJ4A 2GUZB 1XQ8A 4GKJO 1AJQA 4TSFG 5EBLC 2XASA 4LH6A 5KMGB 1EFRG 1QCEA 1AR4A 5ITZA 1Q90D 4DXWA 2X6BA 1SERA 5JVDA 1BGYH 3ETGA 1NT2B 2Q4PA 2Y0IA 2LGWA 3T2MA 2ZM6B 2EULA 5AG2A 2BOCC 4JI7O 4GX1A 2DYRB 1GM9A 1TUEB 1PPJH 1Y67A 5JJNB 4MVRA 3SGIA 2AHYA 3JATA 1PL0A 2RN9A 2CDYA 2UXXA 2BTQB 4UV8A 4I4TA 4QIWF 3OR7C 2LFRA 5B5EZ 2EIMB 3RYIA 4DUYB 2W0FC 1AI6A 5L3GA 4DV4O 3ABKC 3Q4HA 4JI6O 4PV1B 2W0XA 1K4DC 4CH3A 2DJVA 2CTRA 5JJEB 2VRZA 3ZRSA 1TVKA 3HB3B 4O2AB 2XAFA 2NN4A 2CGNA 1U96A 2M6YA 3N2KA 4TV9A 1R3KC 1W0JG 4JI1O 5FNVA 5LMUB 1QQCA 4XDJA 1YJWV 1R6KA 2DW4A 4LF8O 1HNWO 5BMVB 4FLZA 1UFIA 4X1IA 1WAZA 1XL6A 2A9HA 1ZLZA 4QNHB 2ADQB 5IE9A 4K8ZA 3G4SV 3L74H 1VQ8V 1IBLO 3CYOA 3FB6C 4Z1MG 4JASA 3E83A 2L6LA 3UKMA 4NXNB 4UCUA 2QWPB 1XHXA 3ZX6A 4CS3A 4DK1A 3BVOA 4DUZO 1JPXA 4W4KA 4W4LA 2WAMA 2GSMB 4DV6B 4I55A 1WPXA 5CA1A 1N0JA 2WLHA 4MVOA 3FB5C 4MS2A 2A0LA 4WFEA 1T5EA 1US6A 4YJ2B 3W7TA 2VS0A 1KD1W 1S5JA 2A06H 3CJHB 1IXMA 1SQBH 1BL8A 2UUCO 3E8FA 4U7OA 4UCOA 2PYLA 2Y48A 1K4CC 4X20B 3DC5A 2AGAA 3O65A 1ORQC 1SZXA 1TGOA 4NB5A 1I5XA 3K04A 3N2GB 3ABMC 2QJ1A 4DR7B 1N33B 3QF7A 3M99B 1BT8A 4YY3B 3K57A 4AI8A 4IL6Z 1Q6HA 1I5YA 2UUBB 4X88A 5JQGB 4RUFA 5LGUA 1NH2D 3ZBHA 4DR3B 2WLLB 2VQFB 5KX5B 1XMOO 1QHTA 3DC6A 5IWAO 4JAAA 1ZSPA 2RDCA 4IHJB 1MA1A 5E79Z 4DV2B 4DW0A 1K7DA 1PNKA 1K34A 3LNNA 4IIJA 2B1GA 4J11A 1OHHG 5LHGA 4JYBA 4LF7B 3OR6C 2Y69C 4X64O 4FM2A 5CB4A 1VQNV 3BCCH 4BW5A 2Y4UA 2IJKA 2E76B 2QWRB 1FFXA 4TQDA 3BAAA 4BIUA 2EBOA 1N36B 2YIAA 3E8GA 1Q3EA 4JYYA 4XBFA 4JPRA 2A79B 2JS5A 1TAEA 2FYUH 3BY6A 4FZ0A 1NH2B 5LGNA 3L72H 4CBCA 3QVNA 1NU1H 5LHHA 1V54C 2X0LA 3G6BA 1XNRB 4OPAA 2FL4A 5LOVA 3CP1A 3H1LH 4U3FH 3CCUV 5LP6C 3STLC 2UU9O 1FYJA 4O4JB 1J95A 3TCUA 5A2QN 2Z5UA 3JAKB 4H44B 1XNQB 3KZIZ 1COWG 1MSWD 2IBZH 3D36A 2Y69B 3HKBA 1NVPB 3ZHQA 4A5UB 1Y6XA 3E35A 4MTOA 5EBWC 1WB8A 1XUQA 4HBNA 2OIEA 1M93A 1WB7A 4ICGA 1GK9A 2X6CA 4MTXA 1NKDA 4ZOLB 2Q0AA 4PA7A 4LFCO 3T1HO 4FLWA 3AG4C 3T1YO 4DRXA 1JOYA 1Q5OA 2QWOB 1V54B 1DF4A 3K06A 4I0XA 5JWPA 4JI2B 3D36C 3UT5A 4N23A 2IJIA 1IZ3A 4GX2A 3I55V 1XI1A 1QLEC 1VIBA 1G6UA 1DF5A 1WP7A 5LP6B 1R6NA 1HNZO 3ZMSA 3LSQA 2HLDG 5DN6G 3OGCC 1R3LC 3LSUA 1K3EA 3HKCB 5C93A 2QDOA 4DR1O 1YEWA 1Y4MA 4KFMA 2ILMA 3AG7A 1EZJA 2EX3A 4PI0A 1LUVA 4WFFA 3ZS8C 3SPGA 3ASOC 1H2MA 2WWWA 3H1HH 1PNMA 4LF9O 3X2QB 1Q82W 3THOA 1FKAO 3P3PA 4PJ0Z 5DEDA 4NVPA 5EYPA 5H9CA 1QLNA 2R72A 2KKWA 4DR6B 1URFA 3AG4B 2F93B 4DR4O 4LF6O 4YHHB 2WLNA 4G28B 4IYIA 1Q7YW 2P22C 5B1AC 2OWOA 2RJZA 4O4LB 4HAMA 4JI4O 1L8DA 4QE7A 2V7QG 3E86A 3JCUZ 4CC5A 1IXBA 4PDLA 3AG2C 1QLEB 4CZZA 2ODMA 3W7SA 5GTHZ 4QPKA 1QVFU 3L75H 4IT5A 4B3SO 5B1NA 1VF7A 3K58A 3CMEV 2Q7HA 4UVCA 4J41A 2WLIA 2H8PC 5KA5A 3ASOB 3APQA 5J2UB 2LFSA 5FPRA 4ASUG 4UV9A 4MVQA 4LFAB 1JJ2U 4F6RA 3I5DA 3ZCCA 2ZR3A 5LXTA 2DYSC 3ETQA 4ABMA 1HWYA 4X65B 1GKFA 3G6EV 3M8AA 1OCOC 4BWAA 1HNXB 4R6ZA 1IURA 2YSUB 1MZFA 1KU9A 3BHPA 3CC4V 4UFZA 3AG2B 4FIPC 3ETEA 4DV3O 4YJ3A 3IAYA 1M9NA 2QE7G 4I50B 1Q86W 4ZI7B 1F4NA 1M57B 1AI4A 1RSOA 3JD0A 4NXMO 1KECA 1AB3A 2CK3G 1XDCA 4DYLA 5CN0A 4JV5O 4TUYB 2ZD9A 5KHGA 2DYSB 2LJ2A 1GO3F 1H2KA 1WA8A 1KP3A 2CH7B 1QR9A 4EB6A 4FFBB 4Q20A 4FK5C 4FLUA 1YI2V 3CXHF 5GONB 3RYCB 3FYEB 3RT3C 1OCOB 4FLTA 2ADPA 1Y74A 2ZDIA 4GZRB 3WB0A 3MDSA 4QPJA 2ZKOA 4MSWC 1N34B 2GTSA 4MVSA 3ZHRA 4TT3G 4QJFB 1FPOA 2Q5ZA 4FLVA 2LW1A 3CCQV 2ZXWC 3RGBA 1SA0A 4UXNA 1V55C 4DV0O 2Q6AA 3F5WC 4UCVA 1MOFA 4B08A 1H2NA 3FAVA 2OTLV 3RYHB 3VQYA 4BR6A 2H94A 3U11A 1SQXH 2P4VA 3OTOB 4J7KA 1N32B 2HR3A 2Y4TA 4BIZA 3FD9A 4PDMA 3J80N 5H6RA 4GUNA 3ZN1A
chains in the Genus database with same CATH topology
4DUYO 4DR7O 4DV7O 4JI2O 3OTOO 1D2DA 1AILA 2DOSA 4JI3O 4DV3O 4X64O 4B3RO 4DV2O 3J81N 4DR1O 5BXZA 1R1BA 1X59A 2UUBO 1IBLO 5LMNO 3R66A 4GKJO 4B3TO 2F4VO 4LF7O 4X62O 3JAMN 4LF9O 4NXMO 2Z0AA 2UXBO 4OX9O 4DUZO 1AB3A 5LL6Y 1FKAO 4JI8O 4DV5O 1IBMO 1N36O 4NXNO 1N32O 5LMUO 4B3MO 4JV5O 4JI5O 5FLXN 1HNXO 2UXCO 4DR4O 4LF6O 4DV1O 4OPAA 4JI7O 4LFBO 5BY1A 1NS1A 1KUQA 2E5LO 1DK1A 4KHPO 1FJGO 4JI4O 3RT3C 2UU9O 1FYJA 2JRIA 2UUCO 5BR8O 5A2QN 4LF5O 1XNRO 5H5NA 2UUAO 2AGAA 3O65A 2UXDO 2ZKOA 4B3SO 1IBKO 4A5UB 2LW7A 2FKXA 4DV4O 4LF4O 4JI0O 1XEQA 4DV6O 4DR2O 1F7YA 4JI6O 1G1XB 1XMQO 4DR6O 3J7AU 2DJVA 1HR0O 4DV0O 3SDLA 1J5EO 2ZM6O 1N33O 1YZBA 2N74A 4YHHO 1I94O 4GKKO 5IT9N 2HHHO 4LFCO 3F5TA 4YY3O 3T1HO 1XMOO 3T1YO 4K0KO 5IWAO 4LFAO 4AQYO 4JI1O 1A32A 4X66O 4DR3O 2VQFO 4JYAO 4DR5O 4LF8O 1XNQO 3M8AA 1R6TA 4OPHA 1HNWO 1N34O 4X65O 3J80N 1HNZO 2VQEO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY O;  4DR7 O;  4DV7 O;  4JI2 O;  3OTO O;  1D2D A;  1AIL A;  2DOS A;  4JI3 O;  4DV3 O;  4X64 O;  4B3R O;  4DV2 O;  3J81 N;  4DR1 O;  5BXZ A;  1R1B A;  1X59 A;  2UUB O;  1IBL O;  5LMN O;  3R66 A;  4GKJ O;  4B3T O;  2F4V O;  4LF7 O;  4X62 O;  3JAM N;  4LF9 O;  4NXM O;  2Z0A A;  2UXB O;  4OX9 O;  4DUZ O;  1AB3 A;  5LL6 Y;  1FKA O;  4JI8 O;  4DV5 O;  1IBM O;  1N36 O;  4NXN O;  1N32 O;  5LMU O;  4B3M O;  4JV5 O;  4JI5 O;  5FLX N;  1HNX O;  2UXC O;  4DR4 O;  4LF6 O;  4DV1 O;  4OPA A;  4JI7 O;  4LFB O;  5BY1 A;  1NS1 A;  1KUQ A;  2E5L O;  1DK1 A;  4KHP O;  1FJG O;  4JI4 O;  3RT3 C;  2UU9 O;  1FYJ A;  2JRI A;  2UUC O;  5BR8 O;  5A2Q N;  4LF5 O;  1XNR O;  5H5N A;  2UUA O;  2AGA A;  3O65 A;  2UXD O;  2ZKO A;  4B3S O;  1IBK O;  4A5U B;  2LW7 A;  2FKX A;  4DV4 O;  4LF4 O;  4JI0 O;  1XEQ A;  4DV6 O;  4DR2 O;  1F7Y A;  4JI6 O;  1G1X B;  1XMQ O;  4DR6 O;  3J7A U;  2DJV A;  1HR0 O;  4DV0 O;  3SDL A;  1J5E O;  2ZM6 O;  1N33 O;  1YZB A;  2N74 A;  4YHH O;  1I94 O;  4GKK O;  5IT9 N;  2HHH O;  4LFC O;  3F5T A;  4YY3 O;  3T1H O;  1XMO O;  3T1Y O;  4K0K O;  5IWA O;  4LFA O;  4AQY O;  4JI1 O;  1A32 A;  4X66 O;  4DR3 O;  2VQF O;  4JYA O;  4DR5 O;  4LF8 O;  1XNQ O;  3M8A A;  1R6T A;  4OPH A;  1HNW O;  1N34 O;  4X65 O;  3J80 N;  1HNZ O;  2VQE O; 
#chains in the Genus database with same CATH topology
 4DV1 B;  3CXC U;  3K0G A;  4O4H B;  3MAQ A;  3ML0 A;  3JAW A;  5IYZ A;  2F4V B;  3OTF A;  1H2L A;  3DGE A;  4P9P A;  1UJW B;  1E1R G;  4IGG A;  4X8A A;  2OCH A;  1PL4 A;  3QO8 A;  1G8M A;  2C2A A;  3JAS A;  4XDK A;  5KHJ A;  1I08 A;  1SQQ H;  2ZXW B;  1KYO F;  4LH7 A;  4DV5 O;  5EZY A;  1V55 B;  1VMG A;  2P4K A;  4NXN O;  3L73 H;  2A3Q A;  5J2T A;  3GVM A;  2EZO A;  1BSM A;  5EIB C;  2NNU A;  5TIS Z;  5HFM A;  1Y76 B;  4KHP O;  1EN6 A;  3CRM A;  4Z1V A;  3O9O A;  2AZ0 A;  3ZED A;  2IJJ A;  3EHB B;  2P5O A;  5B1B C;  5H5N A;  1WLE A;  3E8B A;  4DK0 A;  1XMQ B;  1SA0 B;  2EZP A;  3K9A A;  5LA6 B;  2ZE5 A;  2B1I A;  4AHC A;  1K8A W;  3CB2 A;  4MVU A;  3L71 H;  1KBH A;  1HR0 O;  4RWU A;  3SDL A;  1N33 O;  4X1K A;  3A0R A;  3KKY A;  4YY3 O;  2G38 A;  1MSD A;  5DEC A;  1H2S B;  2YID A;  5IYB O;  4NTY A;  3OAA G;  4DR3 O;  2VQF O;  3AG3 B;  1GH6 A;  3BRC A;  1R6T A;  4ZHQ B;  5CBH A;  4B3R B;  5C8Y A;  1AJP A;  3SPH A;  4C7U A;  2VQE O;  2PGG A;  2XAG A;  4LFB B;  5E1A C;  1GN3 A;  5CBG A;  1EN4 A;  5B1B B;  1VQK V;  2L35 A;  4FM0 A;  4DV2 O;  2GBO A;  1LUW A;  4OX9 B;  1RPR A;  1N4C A;  4JF3 A;  4LF5 B;  4HNA A;  3K5N A;  4PDV A;  1SZT A;  1VQL V;  4LF7 O;  1PP9 H;  1ZUQ A;  1YTF B;  4LNU B;  3UM7 A;  1OCC C;  1GRJ A;  3H1I H;  4MTG A;  3ETD A;  2E75 B;  1IBM O;  3DXR A;  1N36 O;  1K33 A;  3RWR D;  1SQP H;  1PNL A;  2N05 A;  1ARO P;  1W2B U;  5ITZ B;  1XRE A;  5JVD B;  1BCC H;  4E2L A;  5BY1 A;  4JZG A;  1S77 D;  1MMM A;  3ABK B;  4H13 B;  1YXB A;  3RYF A;  4FPP A;  2YS8 A;  1IBK B;  3RVZ A;  5BR8 O;  5IJ0 A;  1XNR O;  2PUS A;  1VQ9 V;  4LF4 B;  2WSS G;  1SS3 A;  3A0B Z;  3K79 A;  4U3J A;  2CAZ C;  2V1D A;  1IDS A;  3JAT B;  3HKD A;  1OCZ C;  3AK3 A;  4I4T B;  3BFR A;  1K5S A;  1IVS A;  1P84 F;  2PZS A;  5A9G A;  2W6I G;  2O57 A;  3RYI B;  1P4R A;  3JCZ A;  3CCM V;  4GKJ B;  3Q4H B;  1OCC B;  3CRR A;  4OXS A;  4K8X A;  3F5T A;  1JFF A;  4FVM A;  1GN6 A;  4O2B A;  4I5S A;  3F7Y C;  1TVK B;  2PYJ A;  2KQX A;  3OE7 G;  2QEX V;  4X1Y A;  3FYI B;  3KCX A;  3SJC C;  2WLM A;  5LYJ A;  2ZNJ A;  4R50 A;  3JAL A;  3N2K B;  4TV9 B;  2YXY A;  4JI7 B;  4JI2 O;  5FNV B;  1I0H A;  3W7X A;  3MD0 A;  4X1I B;  2ETN A;  3SYQ A;  1AI7 A;  2AZ2 A;  1GMG A;  3OT7 A;  4FM1 A;  1GM7 A;  5LGT A;  5L3F A;  4K3A A;  4JI5 B;  2YEV A;  2ARH A;  3C3S A;  3TGU H;  1YJN V;  4NR1 A;  1FXK A;  4DV4 B;  2Q7E A;  1M56 C;  4J9Y B;  4Z2W A;  1NVP D;  2EIL C;  4MTF A;  2XOK G;  3S3W A;  3CMA V;  2PF4 E;  3ABM B;  4I55 B;  3VBB A;  5CA1 B;  3ZN0 A;  1JR9 A;  2UXD B;  5LBQ A;  3CE2 A;  4PEL A;  5IJ9 A;  3GWK C;  4UUJ C;  3WFV A;  3GWO A;  3HKE A;  4FFK A;  1B06 A;  3H9V A;  4LF8 B;  1U97 A;  1QNM A;  2ATK C;  1ZX3 A;  3OUF A;  2IH1 C;  1FXK C;  3JYC A;  5CA3 A;  1FS0 G;  4EFE A;  4JI0 O;  1X4T A;  4DR2 O;  2QM4 A;  1FFT B;  1P49 A;  3SYO A;  3J7A U;  4K0K B;  3CHX A;  3I56 V;  2PY5 A;  5KHK A;  2IM9 A;  3SJB C;  1H8E G;  1M56 B;  2B9Z A;  2WA4 A;  5H6Q A;  1PM9 A;  4ZIB A;  2P7T C;  2EIL B;  4LFA O;  1B3Q A;  3RVY A;  2XND G;  3JAR A;  2ZIN A;  2OT5 A;  2RCV A;  3CEI A;  2LGQ A;  3P3N A;  2QGN A;  4X65 O;  2N04 A;  5LMN B;  5EK0 A;  3UCS C;  2JIZ G;  2HKO A;  2XUM A;  3TJT A;  2JGD A;  4TWK A;  3CS5 A;  2JVD A;  1X59 A;  1W0K G;  3OMA B;  2LQT A;  3D3Q A;  2UUC B;  1FXK B;  3CWB H;  4IIJ B;  2OCC C;  3ZJZ A;  5GTI Z;  4B3T O;  2DWD C;  4BW9 A;  4UCS A;  1NJI W;  4LWS A;  5CB4 B;  4MW8 A;  2CGO A;  2ZQM A;  3CX5 F;  3UQ8 A;  4J80 A;  3VOU A;  5B66 Z;  4PDR A;  1ZWI C;  2ZCE A;  4JI8 O;  2HVK C;  1FFX B;  4P30 A;  1S3J A;  1NTK H;  1KKD A;  4JTD B;  4WBN A;  1OV9 A;  2FTK A;  1VEW A;  2UUA B;  2ZE8 A;  1XMO B;  4MVM A;  4F6E A;  1XHZ A;  2CTP A;  3B8N A;  1VQ4 V;  5IWA B;  2R9A A;  1M4U A;  3ZRW A;  5LOV B;  4IYH A;  3WB2 A;  2KG7 A;  5HFL A;  2XTA A;  5D5Q A;  5IYC O;  1J5E B;  1XEQ A;  4O4I A;  4X64 B;  1OZ0 A;  3KCY A;  2OCC B;  2QWN B;  1Y66 A;  5DM6 V;  1WN7 A;  3HKB B;  5K1X A;  3CC7 V;  3H01 A;  4GKK O;  3E22 A;  4WFB V;  1KKC A;  4YIO A;  2WA3 A;  4KXR A;  1YDX A;  3K9S A;  4WFA V;  1QR8 A;  1W59 A;  3JD2 A;  4B7K A;  2DE0 X;  4DR5 O;  2OTJ V;  3U10 A;  4DRX B;  2CTW A;  4UB8 Z;  4RUE A;  4I0X B;  1O9G A;  3OTO O;  3UT5 B;  3ZHU A;  2EIN C;  4HYO A;  3J81 N;  2YIB A;  1QVG U;  3SJA C;  2UXN A;  2F4V O;  4X62 O;  2GHY A;  2B5U A;  2UXB O;  4WF9 V;  2QKS A;  2JK5 C;  5B1A B;  2UXC B;  1SES A;  2YXH A;  2F66 C;  5KUM A;  2VWJ A;  1S0V A;  3CSX A;  1SRY A;  5JH7 A;  1RM1 C;  2MK3 A;  4FMT A;  5K1P A;  4GX5 A;  1KP2 A;  4LC1 A;  5EYP B;  2NR5 A;  2ITD C;  2YC0 A;  1NS1 A;  3ZHT A;  1ZL8 A;  3TK1 A;  4YXW G;  2DN9 A;  4E4E A;  1GN4 A;  1EBO A;  3T1Y B;  1JVM A;  2W6J G;  4TV8 A;  1WP8 A;  4TQF A;  3B2E E;  3S3X A;  2Q8V A;  2BSK A;  5EC1 C;  2EJ7 A;  1HNZ B;  2EIN B;  2LW7 A;  2QTS A;  4J42 A;  4H37 A;  3CRC A;  2CE4 A;  1GAX A;  2JS3 A;  2HHH B;  1HDJ A;  4DR1 B;  3SPI A;  3PJS K;  1XMQ O;  3CPW U;  2D2C B;  4AQY B;  2ZM6 O;  3SYC A;  2WLI B;  4X66 B;  3VQW A;  1ENV A;  4LF9 B;  3K08 A;  1RPO A;  5KA6 A;  4H33 A;  4I9Q A;  4J7Z A;  3U0Z A;  2QTO A;  1RM1 B;  4F6R B;  1OCR C;  1HW7 A;  5LXT B;  1NTZ H;  3STZ C;  4JI3 B;  3MHS C;  1SET A;  2GTA A;  3IC9 A;  3AG1 C;  1YSC A;  1BS3 A;  5CA0 A;  4BIO A;  5L3E A;  2PI5 A;  4DR4 B;  4LF6 B;  2EJR A;  4DUY O;  2GUZ A;  2GV9 A;  3T4D A;  2IJH A;  3SPC A;  1VF5 B;  4Q6G A;  1AIL A;  4D7T A;  3JD1 A;  5KMG A;  1NZ6 A;  1B04 A;  1NQT A;  3K0D A;  4B3R O;  3WU2 Z;  3SR2 C;  4YIP A;  2ZDI C;  1VQ6 V;  3LUT B;  2PI4 A;  4J10 A;  4JTC B;  4R7C A;  2AHZ A;  4B3M B;  4YJ3 B;  2RQ6 A;  4DO2 A;  4P9O A;  4OX9 O;  1O9H A;  5L3D A;  1RSO B;  2YI9 A;  2YIC A;  2E5L B;  5LMU O;  2HJD A;  1FJG B;  2DWE C;  4PD4 F;  1OJH A;  5JCO A;  5FLX N;  4PI2 A;  4G2K A;  3SPJ A;  1B6Q A;  2BTQ A;  2BTO A;  2DQ0 A;  1HP8 A;  1VQO V;  4ZBM A;  1YIJ V;  1OCR B;  2HJF C;  3ABU A;  1WA8 B;  2JRI A;  1V9P A;  3AG1 B;  4EB6 B;  2A7W A;  3JSL A;  4H0L B;  2KSD A;  1D5A A;  3W7U A;  1IX9 A;  1AR1 B;  1GM8 A;  1IBK O;  3LSS A;  5L3B A;  3TXS A;  4O2A A;  1Y74 B;  1XL4 A;  2X6A A;  5EIB D;  4LF4 O;  1I94 B;  3OW2 U;  2JDI G;  4DV3 B;  4DV6 O;  3ZMT A;  3QO5 A;  4X89 A;  2RMK B;  4WFH A;  4JTA B;  4MW3 A;  2QA4 V;  2P6J A;  2N74 A;  1VQP V;  1UPG A;  2K1E A;  2EIM C;  4ZKI A;  4NXM B;  5BMV A;  2K9P A;  1M1K W;  2ZIM A;  3APO A;  3RN4 A;  3OFN G;  1N0N A;  2F1M A;  1MAB G;  4DV7 B;  3C90 A;  1DTO A;  1Q43 A;  3WG7 C;  2WLJ A;  3W7W A;  4JV5 B;  1G4Y B;  3FAV B;  1L1F A;  2ZT9 B;  1YTF D;  5JJJ B;  3ZRX A;  3N27 A;  1TUB A;  2E3C A;  4L8J A;  4DR7 O;  2D3O W;  1AVM A;  1D2D A;  3L70 H;  3L9D A;  2QM7 A;  1ZAU A;  1Z5V A;  3B4S A;  3AEI A;  1PKX A;  2JJ1 G;  2UUB O;  1YF2 A;  3FFQ A;  3F7V C;  1SQG A;  2AXT Z;  3JAW B;  5IYZ B;  1R3I C;  4X9Q A;  5CMU A;  3LNM B;  4YJ2 A;  2YI8 A;  3CCR V;  4WFG A;  3AK1 A;  4JI5 O;  3JAS B;  2HVJ C;  3CJH A;  3OUS A;  1E79 G;  2RNB A;  4DV0 B;  3B77 A;  4X20 A;  5EZY B;  2EIJ C;  1M5I A;  2FB5 A;  3WG7 B;  4EEQ A;  5J2T B;  2DMX A;  3N2G A;  3B8M A;  3BPZ A;  2UXD O;  2OIG A;  3M7M X;  3A0H Z;  4GCZ A;  3CRA A;  5GW7 A;  4J7J A;  5JQG A;  2Q73 A;  5B3S C;  4UVB A;  2FKX A;  3EVK A;  4GX0 A;  2WLL A;  1F7Y A;  1JQ0 A;  2QKA A;  3FX7 A;  5KX5 A;  3ICX A;  2BCC H;  2JGU A;  1MZE A;  2BE3 A;  2Z3Y A;  2Y0P A;  1DGS A;  1KC8 W;  4UB6 Z;  2M7W A;  4IHJ A;  1Z2G A;  1ZTE A;  4KP4 A;  4JYA B;  4EFB A;  4FLY A;  3MHH C;  1TUB B;  4K0K O;  1BMF G;  1K9M W;  4DV5 B;  2F43 G;  4X1K B;  1XNQ O;  4MVZ A;  2EIJ B;  1THZ A;  1R73 A;  1EN5 A;  3K5L A;  3OMI B;  1JX9 A;  1E1Q G;  1BQZ A;  4JYC A;  2XAJ A;  4KHP B;  4UCT A;  3B40 A;  3RBZ A;  2ZR2 A;  5C8Y B;  1BZK A;  4MT8 A;  5BXZ A;  3LDE A;  3ABT A;  3DTU B;  4PA4 A;  5LMN O;  1AR5 A;  4DW1 A;  3CRQ A;  2P67 A;  5B3S B;  2YUA A;  3K5O A;  3JAM N;  2Q68 A;  5H2F Z;  1VQ7 V;  4EKW A;  4HNA B;  1SF9 A;  2Q0O C;  3HPL C;  3TET A;  1FXV A;  1S76 D;  4CH6 A;  4O4J A;  1HR0 B;  2YXL A;  5IDJ A;  3JAK A;  3DXR B;  1DK1 A;  1Q6I A;  1OCZ B;  1RFY A;  2EIK C;  4GYC B;  3CD6 V;  4JI6 B;  2QM8 A;  2UUA O;  4ZOL A;  4P2Z A;  3UO2 A;  3H1J H;  3RYF B;  2VQE B;  3BEH A;  4CH4 A;  1AJN A;  5IJ0 B;  4FJC C;  3DSQ A;  1Q6U A;  2KB1 A;  4F4L A;  3P32 A;  4JAV A;  1SC5 B;  4U3J B;  4DR6 O;  3VQV A;  1K92 A;  4JI1 B;  2XAQ A;  3ZMV A;  3HKD B;  4LBE C;  1J5E O;  1KMI Z;  4YHH O;  1I7F A;  2R70 A;  1HNW B;  1VQ5 V;  1WPB A;  3ZIA G;  2IW5 A;  3E8H A;  5LP6 A;  3NXS A;  4NTX A;  2WPD G;  1IBM B;  1AI5 A;  2QKC A;  2Q67 A;  1GTO A;  4OPH A;  1L0L H;  3HKC A;  3OEH G;  5FL7 G;  1JFF B;  4XDL A;  3E2E A;  1IBL B;  4O2B B;  3OD4 A;  4CC6 A;  4CS4 A;  2HG5 C;  4PHZ A;  2EIK B;  4X1Y B;  2AW9 A;  3NR7 A;  5LYJ B;  4DUZ B;  4LCU C;  5BR8 B;  3JAL B;  2ZE6 A;  4QE9 A;  3KG2 A;  1F51 A;  5KAI Z;  1KQS U;  1XOU A;  4JGS A;  1FXH A;  1F4M A;  1NI8 A;  3HR0 A;  1EM1 A;  5LL6 Y;  4D7S A;  4KUM A;  1D5N A;  4HZ3 A;  4LP8 A;  3LDC A;  4O4L A;  2YEV B;  5F2V O;  5FPO A;  3QO7 A;  2HFE C;  2LP7 A;  1HNX O;  2UXC O;  2QWQ B;  1S5L Z;  3X2Q C;  2JEU A;  3JD4 A;  1YHQ V;  4I9W A;  2Q7G A;  3ZHS A;  4WCE V;  2DQ3 A;  1BHA A;  1NR7 A;  1WJZ A;  2F23 A;  3UO3 A;  4RQF A;  5D5P A;  2R9I A;  2OYQ A;  3CCV V;  5J2U A;  1M90 W;  3R65 A;  1CXZ B;  1XBL A;  3E89 A;  2V4D A;  5IJ9 B;  4G27 B;  3HKE B;  1CPY A;  3ABL C;  2P06 A;  3D3I A;  2GDS A;  1VAR A;  3IGA C;  2HEP A;  3OMN B;  2HHH O;  4U7N A;  1AP5 A;  5KUK A;  4AQY O;  3T4Z A;  3VQX A;  2ZNI A;  2XT9 A;  1A32 A;  4X66 O;  3C3T A;  5L3C A;  2IU0 A;  2F95 B;  1R3J C;  4J9Z B;  2Q69 A;  4CS2 A;  1K73 W;  1JA8 A;  1N34 O;  4I50 A;  3OGI B;  4ZI7 A;  4NYK A;  3K5M A;  3JAR B;  2Q9L A;  3QG5 A;  4JI3 O;  4NKG B;  4NTW A;  1FAF A;  1YIT V;  4GLX A;  3K3W A;  4UVA A;  3PN1 A;  5KHI A;  1ROP A;  4N21 A;  1PV0 A;  3R66 A;  2XHB A;  1N8R W;  1NTM H;  1BQ0 A;  2R9R B;  2JGD B;  4TUY A;  2E74 B;  1H38 A;  3ABL B;  1F23 A;  3JD3 A;  2BOB C;  2MW2 B;  2CH7 A;  4BAY A;  3G71 V;  3B09 A;  4B7E A;  4L87 A;  4FFB A;  4JI0 B;  1VP7 A;  4DR2 B;  5IYD O;  3EFF K;  1N32 O;  4B3M O;  4RQE A;  4LWS B;  5GON A;  1YJ9 V;  3RYC A;  1M57 C;  2UU9 B;  2ITC C;  1TA8 A;  3JSN A;  3CCE V;  4DV1 O;  5KLV H;  2E5L O;  1LNQ A;  3FB7 C;  1FJG O;  2CTQ A;  1MG1 A;  3IC7 A;  2XAH A;  3CCS V;  4WBN B;  5EC2 C;  4JAU A;  2NLJ C;  1K5Q A;  3CC2 V;  3OM3 B;  1Q81 W;  4R8C A;  2IU3 A;  1SQV H;  2IH3 C;  3SYP A;  1MNG A;  3RW0 A;  3ZRW B;  4LFC B;  2KG7 B;  3AK2 A;  3T1H B;  1EZV H;  2YIB D;  3RYH A;  1YVW A;  5KHH A;  5J9P C;  1LR1 A;  4K35 A;  1YZB A;  1I94 O;  4B3T B;  5IT9 N;  3ZMZ A;  1PD3 A;  4O4I B;  1RP3 B;  1KB9 F;  1S72 V;  3BAB A;  1JMK C;  2FML A;  2P90 A;  1CP9 A;  1AP6 A;  3A2F A;  4JI8 B;  1BE3 H;  3QNE A;  3D8C A;  4O4H A;  3ZRV A;  1NBM G;  4FZ1 A;  3G80 A;  4PA9 A;  3E22 B;  5LHI A;  4QGP A;  2HP8 A;  4DV7 O;  3ASN C;  1Q8I A;  1JCH A;  3TXQ A;  5EBM C;  3QTC A;  3A8T A;  3SYA A;  4LR3 A;  2JEX A;  2LO1 A;  4I7Z B;  1H8H G;  3RFR A;  4JZ2 A;  2Z0A A;  4TOI A;  3G67 A;  3OEE G;  1L0N H;  1P7B A;  4AIL C;  3K03 A;  1Z5W A;  1Y76 A;  2CUG A;  4PA3 A;  3LDD A;  4JI4 B;  4FLX A;  1P7G A;  3BA8 A;  3T1C A;  2QR4 A;  4GKK B;  4RAI A;  4LFB O;  3EXA A;  1KUQ A;  2X7R B;  5B1O A;  4D6T H;  2JJ2 G;  5JH7 B;  4B3S B;  4RO2 A;  1DLB A;  3P30 A;  5LA6 A;  4LF5 O;  4KL1 A;  2PTM A;  3SJQ C;  4DR5 B;  1S5H C;  1ZL8 B;  5IY5 C;  3ASN B;  3FKS G;  3WB1 A;  1WNS A;  3CCL V;  4TV8 B;  1GN2 A;  1FD9 A;  4UCR A;  4OGQ B;  5KAF Z;  2BSK B;  3CCJ V;  3BA9 A;  1JJO A;  1NR1 A;  1G1X B;  4PA6 A;  1VF6 A;  2ZIO A;  1CEZ A;  2YDE A;  4GT1 A;  4X62 B;  1K97 A;  1BHB A;  3GB7 C;  4ZHQ A;  2UXB B;  1QBZ A;  3K59 A;  2QSA A;  3IFX A;  4CH5 A;  1VQM V;  3H1K H;  2DYR C;  1XIL A;  4JYA O;  5JCO C;  3FB8 C;  3ZHV A;  1QU7 A;  1SKV A;  1YCI A;  1SQF A;  2ZE7 A;  5BZB A;  1H2G A;  2DOS A;  1VF6 C;  2H3O A;  5CBF A;  2VWK A;  3ZMU A;  5IY5 B;  1R1B A;  2WLK A;  5CA0 B;  4LNU A;  3AG3 C;  3IJ4 A;  2GUZ B;  1XQ8 A;  4GKJ O;  1AJQ A;  4TSF G;  5EBL C;  2XAS A;  4LH6 A;  5KMG B;  1EFR G;  1QCE A;  1AR4 A;  5ITZ A;  1Q90 D;  4DXW A;  2X6B A;  1SER A;  5JVD A;  1BGY H;  3ETG A;  1NT2 B;  2Q4P A;  2Y0I A;  2LGW A;  3T2M A;  2ZM6 B;  2EUL A;  5AG2 A;  2BOC C;  4JI7 O;  4GX1 A;  2DYR B;  1GM9 A;  1TUE B;  1PPJ H;  1Y67 A;  5JJN B;  4MVR A;  3SGI A;  2AHY A;  3JAT A;  1PL0 A;  2RN9 A;  2CDY A;  2UXX A;  2BTQ B;  4UV8 A;  4I4T A;  4QIW F;  3OR7 C;  2LFR A;  5B5E Z;  2EIM B;  3RYI A;  4DUY B;  2W0F C;  1AI6 A;  5L3G A;  4DV4 O;  3ABK C;  3Q4H A;  4JI6 O;  4PV1 B;  2W0X A;  1K4D C;  4CH3 A;  2DJV A;  2CTR A;  5JJE B;  2VRZ A;  3ZRS A;  1TVK A;  3HB3 B;  4O2A B;  2XAF A;  2NN4 A;  2CGN A;  1U96 A;  2M6Y A;  3N2K A;  4TV9 A;  1R3K C;  1W0J G;  4JI1 O;  5FNV A;  5LMU B;  1QQC A;  4XDJ A;  1YJW V;  1R6K A;  2DW4 A;  4LF8 O;  1HNW O;  5BMV B;  4FLZ A;  1UFI A;  4X1I A;  1WAZ A;  1XL6 A;  2A9H A;  1ZLZ A;  4QNH B;  2ADQ B;  5IE9 A;  4K8Z A;  3G4S V;  3L74 H;  1VQ8 V;  1IBL O;  3CYO A;  3FB6 C;  4Z1M G;  4JAS A;  3E83 A;  2L6L A;  3UKM A;  4NXN B;  4UCU A;  2QWP B;  1XHX A;  3ZX6 A;  4CS3 A;  4DK1 A;  3BVO A;  4DUZ O;  1JPX A;  4W4K A;  4W4L A;  2WAM A;  2GSM B;  4DV6 B;  4I55 A;  1WPX A;  5CA1 A;  1N0J A;  2WLH A;  4MVO A;  3FB5 C;  4MS2 A;  2A0L A;  4WFE A;  1T5E A;  1US6 A;  4YJ2 B;  3W7T A;  2VS0 A;  1KD1 W;  1S5J A;  2A06 H;  3CJH B;  1IXM A;  1SQB H;  1BL8 A;  2UUC O;  3E8F A;  4U7O A;  4UCO A;  2PYL A;  2Y48 A;  1K4C C;  4X20 B;  3DC5 A;  2AGA A;  3O65 A;  1ORQ C;  1SZX A;  1TGO A;  4NB5 A;  1I5X A;  3K04 A;  3N2G B;  3ABM C;  2QJ1 A;  4DR7 B;  1N33 B;  3QF7 A;  3M99 B;  1BT8 A;  4YY3 B;  3K57 A;  4AI8 A;  4IL6 Z;  1Q6H A;  1I5Y A;  2UUB B;  4X88 A;  5JQG B;  4RUF A;  5LGU A;  1NH2 D;  3ZBH A;  4DR3 B;  2WLL B;  2VQF B;  5KX5 B;  1XMO O;  1QHT A;  3DC6 A;  5IWA O;  4JAA A;  1ZSP A;  2RDC A;  4IHJ B;  1MA1 A;  5E79 Z;  4DV2 B;  4DW0 A;  1K7D A;  1PNK A;  1K34 A;  3LNN A;  4IIJ A;  2B1G A;  4J11 A;  1OHH G;  5LHG A;  4JYB A;  4LF7 B;  3OR6 C;  2Y69 C;  4X64 O;  4FM2 A;  5CB4 A;  1VQN V;  3BCC H;  4BW5 A;  2Y4U A;  2IJK A;  2E76 B;  2QWR B;  1FFX A;  4TQD A;  3BAA A;  4BIU A;  2EBO A;  1N36 B;  2YIA A;  3E8G A;  1Q3E A;  4JYY A;  4XBF A;  4JPR A;  2A79 B;  2JS5 A;  1TAE A;  2FYU H;  3BY6 A;  4FZ0 A;  1NH2 B;  5LGN A;  3L72 H;  4CBC A;  3QVN A;  1NU1 H;  5LHH A;  1V54 C;  2X0L A;  3G6B A;  1XNR B;  4OPA A;  2FL4 A;  5LOV A;  3CP1 A;  3H1L H;  4U3F H;  3CCU V;  5LP6 C;  3STL C;  2UU9 O;  1FYJ A;  4O4J B;  1J95 A;  3TCU A;  5A2Q N;  2Z5U A;  3JAK B;  4H44 B;  1XNQ B;  3KZI Z;  1COW G;  1MSW D;  2IBZ H;  3D36 A;  2Y69 B;  3HKB A;  1NVP B;  3ZHQ A;  4A5U B;  1Y6X A;  3E35 A;  4MTO A;  5EBW C;  1WB8 A;  1XUQ A;  4HBN A;  2OIE A;  1M93 A;  1WB7 A;  4ICG A;  1GK9 A;  2X6C A;  4MTX A;  1NKD A;  4ZOL B;  2Q0A A;  4PA7 A;  4LFC O;  3T1H O;  4FLW A;  3AG4 C;  3T1Y O;  4DRX A;  1JOY A;  1Q5O A;  2QWO B;  1V54 B;  1DF4 A;  3K06 A;  4I0X A;  5JWP A;  4JI2 B;  3D36 C;  3UT5 A;  4N23 A;  2IJI A;  1IZ3 A;  4GX2 A;  3I55 V;  1XI1 A;  1QLE C;  1VIB A;  1G6U A;  1DF5 A;  1WP7 A;  5LP6 B;  1R6N A;  1HNZ O;  3ZMS A;  3LSQ A;  2HLD G;  5DN6 G;  3OGC C;  1R3L C;  3LSU A;  1K3E A;  3HKC B;  5C93 A;  2QDO A;  4DR1 O;  1YEW A;  1Y4M A;  4KFM A;  2ILM A;  3AG7 A;  1EZJ A;  2EX3 A;  4PI0 A;  1LUV A;  4WFF A;  3ZS8 C;  3SPG A;  3ASO C;  1H2M A;  2WWW A;  3H1H H;  1PNM A;  4LF9 O;  3X2Q B;  1Q82 W;  3THO A;  1FKA O;  3P3P A;  4PJ0 Z;  5DED A;  4NVP A;  5EYP A;  5H9C A;  1QLN A;  2R72 A;  2KKW A;  4DR6 B;  1URF A;  3AG4 B;  2F93 B;  4DR4 O;  4LF6 O;  4YHH B;  2WLN A;  4G28 B;  4IYI A;  1Q7Y W;  2P22 C;  5B1A C;  2OWO A;  2RJZ A;  4O4L B;  4HAM A;  4JI4 O;  1L8D A;  4QE7 A;  2V7Q G;  3E86 A;  3JCU Z;  4CC5 A;  1IXB A;  4PDL A;  3AG2 C;  1QLE B;  4CZZ A;  2ODM A;  3W7S A;  5GTH Z;  4QPK A;  1QVF U;  3L75 H;  4IT5 A;  4B3S O;  5B1N A;  1VF7 A;  3K58 A;  3CME V;  2Q7H A;  4UVC A;  4J41 A;  2WLI A;  2H8P C;  5KA5 A;  3ASO B;  3APQ A;  5J2U B;  2LFS A;  5FPR A;  4ASU G;  4UV9 A;  4MVQ A;  4LFA B;  1JJ2 U;  4F6R A;  3I5D A;  3ZCC A;  2ZR3 A;  5LXT A;  2DYS C;  3ETQ A;  4ABM A;  1HWY A;  4X65 B;  1GKF A;  3G6E V;  3M8A A;  1OCO C;  4BWA A;  1HNX B;  4R6Z A;  1IUR A;  2YSU B;  1MZF A;  1KU9 A;  3BHP A;  3CC4 V;  4UFZ A;  3AG2 B;  4FIP C;  3ETE A;  4DV3 O;  4YJ3 A;  3IAY A;  1M9N A;  2QE7 G;  4I50 B;  1Q86 W;  4ZI7 B;  1F4N A;  1M57 B;  1AI4 A;  1RSO A;  3JD0 A;  4NXM O;  1KEC A;  1AB3 A;  2CK3 G;  1XDC A;  4DYL A;  5CN0 A;  4JV5 O;  4TUY B;  2ZD9 A;  5KHG A;  2DYS B;  2LJ2 A;  1GO3 F;  1H2K A;  1WA8 A;  1KP3 A;  2CH7 B;  1QR9 A;  4EB6 A;  4FFB B;  4Q20 A;  4FK5 C;  4FLU A;  1YI2 V;  3CXH F;  5GON B;  3RYC B;  3FYE B;  3RT3 C;  1OCO B;  4FLT A;  2ADP A;  1Y74 A;  2ZDI A;  4GZR B;  3WB0 A;  3MDS A;  4QPJ A;  2ZKO A;  4MSW C;  1N34 B;  2GTS A;  4MVS A;  3ZHR A;  4TT3 G;  4QJF B;  1FPO A;  2Q5Z A;  4FLV A;  2LW1 A;  3CCQ V;  2ZXW C;  3RGB A;  1SA0 A;  4UXN A;  1V55 C;  4DV0 O;  2Q6A A;  3F5W C;  4UCV A;  1MOF A;  4B08 A;  1H2N A;  3FAV A;  2OTL V;  3RYH B;  3VQY A;  4BR6 A;  2H94 A;  3U11 A;  1SQX H;  2P4V A;  3OTO B;  4J7K A;  1N32 B;  2HR3 A;  2Y4T A;  4BIZ A;  3FD9 A;  4PDM A;  3J80 N;  5H6R A;  4GUN A;  3ZN1 A; 
#chains in the Genus database with same CATH homology
 4DUY O;  4DR7 O;  4DV7 O;  4JI2 O;  3OTO O;  1D2D A;  1AIL A;  2DOS A;  4JI3 O;  4DV3 O;  4X64 O;  4B3R O;  4DV2 O;  3J81 N;  4DR1 O;  5BXZ A;  1R1B A;  1X59 A;  2UUB O;  1IBL O;  5LMN O;  3R66 A;  4GKJ O;  4B3T O;  2F4V O;  4LF7 O;  4X62 O;  3JAM N;  4LF9 O;  4NXM O;  2Z0A A;  2UXB O;  4OX9 O;  4DUZ O;  1AB3 A;  5LL6 Y;  1FKA O;  4JI8 O;  4DV5 O;  1IBM O;  1N36 O;  4NXN O;  1N32 O;  5LMU O;  4B3M O;  4JV5 O;  4JI5 O;  5FLX N;  1HNX O;  2UXC O;  4DR4 O;  4LF6 O;  4DV1 O;  4OPA A;  4JI7 O;  4LFB O;  5BY1 A;  1NS1 A;  1KUQ A;  2E5L O;  1DK1 A;  4KHP O;  1FJG O;  4JI4 O;  3RT3 C;  2UU9 O;  1FYJ A;  2JRI A;  2UUC O;  5BR8 O;  5A2Q N;  4LF5 O;  1XNR O;  5H5N A;  2UUA O;  2AGA A;  3O65 A;  2UXD O;  2ZKO A;  4B3S O;  1IBK O;  4A5U B;  2LW7 A;  2FKX A;  4DV4 O;  4LF4 O;  4JI0 O;  1XEQ A;  4DV6 O;  4DR2 O;  1F7Y A;  4JI6 O;  1G1X B;  1XMQ O;  4DR6 O;  3J7A U;  2DJV A;  1HR0 O;  4DV0 O;  3SDL A;  1J5E O;  2ZM6 O;  1N33 O;  1YZB A;  2N74 A;  4YHH O;  1I94 O;  4GKK O;  5IT9 N;  2HHH O;  4LFC O;  3F5T A;  4YY3 O;  3T1H O;  1XMO O;  3T1Y O;  4K0K O;  5IWA O;  4LFA O;  4AQY O;  4JI1 O;  1A32 A;  4X66 O;  4DR3 O;  2VQF O;  4JYA O;  4DR5 O;  4LF8 O;  1XNQ O;  3M8A A;  1R6T A;  4OPH A;  1HNW O;  1N34 O;  4X65 O;  3J80 N;  1HNZ O;  2VQE O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...