4JYAT

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4jyaT00
4DUYT 4DV1T 4GKKT 5LMNT 4AQYT 4DV7T 4YHHT 2ZM6T 5IWAT 4DV3T 2UXDT 4NXMT 4JI6T 2VQFT 1HR0T 4JI5T 4DV2T 4JI2T 4JI0T 4LFCT 4JV5T 4DV4T 4GKJT 4DR1T 5BR8T 4B3RT 2UXCT 2F4VT 1N32T 4JYAT 2HHHT 4JI3T 4OX9T 2UUCT 4DV0T 4DR4T 2UUBT 1IBMT 1I94T 1XNQT 4JI8T 2UU9T 2UUAT 4DR3T 1N36T 4DV5T 2UXBT 4LFBT 4LF9T 4LF4T 4X62T 1N34T 4LF8T 4DV6T 4DR2T 4X65T 1HNXT 2E5LT 4KHPT 1FJGT 4NXNT 4B3TT 3OTOT 1N33T 4DUZT 5LMUT 1XMQT 3T1HT 1IBKT 4LF5T 4DR7T 4X64T 4DR6T 4DR5T 4LF6T 4X66T 1IBLT 2VQET 4JI1T 4JI4T 1XMOT 4B3ST 3T1YT 4B3MT 1J5ET 4K0KT 1XNRT 4LF7T 1HNWT 4JI7T 1HNZT 4LFAT 4YY3T
chains in the Genus database with same CATH superfamily
1YD8G 5FMNA 3EDUA 2R6GF 4Q25A 5FP3A 4WBNE 4PFPA 5L4HA 3UFGA 1FIOA 1WFDA 2CEAA 3C4WA 3JC6D 3Q5EA 2M67A 2V26A 2AE9A 3AE1A 4JI5T 5AQQB 2D0UA 5C8YE 2YU2A 5AQOB 4OK0A 4JV5T 5HWYA 3DP7A 1UK5A 2HH7A 4UR9A 2L9QA 5LJMA 2F4VT 1OEDE 5JH7E 4PJMA 4EIWA 3QUJA 1BR4A 4AI6A 2XQYA 5ABHA 2X67A 3M3ZB 3M65A 3U78A 2UUBT 3H3AA 2FUPA 3AVRA 3TLUA 2BS4A 3AEFA 1E1HB 3HL6A 4HFBA 1HG2A 2XHEB 3TLVA 3OYXA 4LF9T 4TV8E 1L0VA 1QUUA 5LA6E 1US7B 5FXVA 3P4RA 5LBQB 1MMDA 2NW8A 1N33T 2LHRA 4PK4A 4ZOLE 3N9PA 5FKYA 4DVDA 4ERRA 5CGMA 3UU3A 4IL9A 5CA0E 5CA1E 2K9AA 4B3ST 4H9QC 3OBVE 3DTOA 3CX6B 3IHRA 5ABGA 4TWHA 3ZKRA 4ILBA 1VCSA 4IDPA 3ZC1A 2VVSA 3HKCE 5EK4A 4IE6A 2LRKA 4CI1B 1WR0A 5JRCA 4DV7T 4BAYB 2VASA 3AEBA 2IC6A 3B13A 1D0ZA 3RIUC 5JRCB 4ILAA 4TNVA 4ZI7E 1QLBA 4DR1T 3T8OA 4O4LE 1IAPA 3KBTA 5JDGA 3J9X1 4UV9B 1MNDA 2UXNB 2XUEA 2BG9E 5ADXL 3VU7H 2UUAT 3RIUA 2DWGA 2VKDA 4MALA 2M6IA 4IE7A 1YXRA 3O1IA 2XAFB 2VKJA 3CWZB 3MA9A 4ZI3D 1UUSA 1LVFA 1HX8A 4U72A 3AEAA 3W15B 4EYYR 5FL0A 1JNZA 2LKHA 3LDQB 5LOVE 3WAKA 4IIJE 2W62A 4PNIA 2PJQA 4AISA 2WAUA 2E9XD 2BKPA 3FXEB 2J62A 2V8SV 3RQUA 3EHZA 3ONXA 2YDSA 3EUHA 5ABFA 4NXMT 5EK3A 4PW8A 4HWIB 3NVOA 4JI6T 4MLKA 4AIUA 4CI2B 4AKRB 5ABFB 1R8IA 2VURA 4B3RT 3EVYA 3F57A 2FJEA 4BA9A 4YSZA 4DV0T 2WU5A 3QNUA 3RQWA 2XJ7A 3BQIA 2W2UA 2CM0A 1T7SA 4KUMB 3RYCE 2UXBT 5JDFA 2SPCA 5AQUB 2WDVA 4DV6T 3ZN0B 3CIRA 3RIAA 4UELA 2XAHB 4OYJA 4U74A 1UX5A 3FZMB 2WZHA 2I0MA 4JI1T 4JI4T 2WY2A 1GQEA 1ZV4X 2JMHA 3PDYA 3BK9A 4F6RC 4B3MT 2XQ9A 3F31A 3O1HA 5LHHB 4A97A 1W0BA 4YJ2E 1KK7A 3TLSA 4U31A 5IHYA 4HWHA 2QGSA 3PUAA 1NWMX 1ZKEA 2ODUA 3K3NA 4AQYT 4CN6A 2DNXA 2YDQA 3JCFA 2XZEA 2BVMA 4QX8B 2MAWA 5ABEA 2P9BA 3QK6A 3ZSSA 3TKLB 1XDPA 2X0YA 1T98A 4TNWA 5JR9C 3RYHE 2A2FX 4QXCB 1B7TA 2VKHA 3P4SA 4IDZA 2K5BB 3CQCB 1XNQT 4ILUA 2DCFA 2CXDA 3AE9A 2ZM2A 4U7YA 2Y48B 3KV5A 5GONE 2LRLA 4NIQA 4ZI2D 3K1SA 3ABVA 5FNVE 1WRDA 5LXTE 1HS7A 2W66A 3CPZA 2EHOD 2H3RA 4TUYE 2IAKA 1XMOT 2VKOA 4I0UA 2KSRA 4JEHB 3AAEB 4GIWA 3V5UA 5J2UE 1MIVA 3CKDA 2YN6A 4ZHQE 3UQ7A 3PURA 2MBGA 4PK6A 1OEDC 2C5IT 3EAMA 3OPCA 4YFSA 3I0OA 2L3LA 3LFMA 5LNKA 4IGUA 2WBLA 4C90A 2ZM8A 5L3GB 3ZMUB 3LG7A 2JQ9A 1D0YA 4ZS3A 3CQGB 4JYAT 3RRCA 1OEDA 4OFZA 3JC6C 1HFAA 5J1GA 2XQ8A 4DMWA 2KLQA 5BMVE 5HXSA 3Q9DA 4XZCA 4O4IE 1OEDB 2XAJB 3ZCIA 2NTYA 2RA1A 4FI5A 4HFIA 2N9DA 3KV6A 1SA0E 1SE7A 2X0LB 2IMLA 2ZLYA 2CXFA 3RLFF 1X79A 4QX7B 2LEHA 5F5WA 2Q9QD 3OKQA 4CN4A 2A3DA 1KFYA 2YINA 3VHLA 2I59A 4X66T 1UURA 1MNEA 3MJXA 2VB6A 3E22E 1ZEEA 2LE8A 2C5KT 4MHCA 1CUNA 1KNRA 3CK6A 2XSAA 2WP9A 1IZNB 4P1NA 1H7CA 5L3DB 5F3JA 3UUBA 4HFDA 4UIGA 1IJ5A 4LMLA 2HPJA 2V1DB 2FJAA 3N2OA 4JI0T 5HAXA 4H9NC 2J47A 2Y8DA 1HTJF 3QB5A 5AQLB 3NKZA 2PG8A 5JDNA 4JEUB 2WDQA 3FZHB 2DL1A 3QB5K 4OX9T 4ISTA 4IT4A 3AEDA 1ZP0A 2QVAA 2WZIA 3F2EA 2BDEA 1Z0PA 4IL4A 3A5XA 2BG9A 4HFEA 3SFEA 4G2AA 3ZN1B 4AKHA 4QHOA 1D1AA 4DV5T 4LF4T 4A5XA 3EABA 2CPTA 5KX5E 2M6BA 2BG9B 3IA3A 1FJGT 3N9OA 4YHJA 4PJLA 2VVNA 4WNKA 4YT0A 5LMUT 2LT3A 2WSSV 3ZSTA 2K3WA 5AFUL 4FJOA 2W00A 1IBLT 5AQIB 4U3CA 4YXDA 3T1YT 4MFRA 2XQ7A 4ZI3C 3PJAA 2OV9A 5E0OA 2NW9A 2XQ5A 3RYFE 3K3QC 3AE3A 4LFAT 3OJAA 5HEOA 3ZYKA 1D1CA 3RH3A 3RIFA 4DO0A 3MK7C 3V5SA 2E9XC 3C51A 2VK9A 4ZXLA 4HWCA 3KVBA 5AQFB 4YTPA 4H9SE 3ZT6A 3CMLA 5AQPB 1SHZC 2G0UA 5L3CB 4CQIA 2E9XA 2VL8A 1FEWA 2WMNA 4OHFA 1J1JA 1LVKA 5CB4E 3CX8B 3R84B 2MYSA 3PUWF 1UCUA 2E9XB 3ANWA 2MTQA 2YKSA 1HNXT 2KMFA 4X1KE 4E7SA 3X1DA 4KHPT 4JLEA 3OTOT 3FXDB 2XAGB 3ANWB 2N1GA 1LKXA 4I4TE 1G8XA 5EK2A 5CJ5A 5J2TE 5DQWA 1D1BA 5AQJB 4H9RC 3PUZF 2IDOB 2K24A 2CBIA 2CWYA 3OYZA 3RF1A 2GK9A 5HYAA 1W0AA 1IJ6A 4K0UA 5HCJA 2D2SA 2PTFA 1W09A 3J7Yq 2A72A 2NW7A 4YHHT 2LJLA 3Q5WA 3ZMZB 2FBWA 4TWDA 4U33A 3UTKA 2WB5A 4QKNA 2ZMAA 2X51A 3SFDA 3MZKB 2CHNA 4EAHA 3RI5A 4N78D 1HX1B 1Y64B 4A56A 3G06A 3BQKA 2VL0A 5FVKA 2VWAA 4YSXA 1XDOA 2D9DA 3VRAA 1MMAA 1EZ3A 2LHNA 3GN5A 4JI8T 3IEEA 2DI4A 2X0HA 2KWHA 1T72A 4UVAB 5AQRB 3GN5B 3LJCA 2E5LT 2NWBA 2L8KA 5LHIB 4JUYA 3NWIA 1XMQT 3UU6A 4X64T 5DQVA 4I50E 4WBOA 5AQHB 4LF6T 2PFVA 2VQET 3ZLIA 3C64A 4ZI2C 3AE7A 4UF0A 3RC8A 2LSJA 4JBWF 5JDLA 3PJAJ 2EHOC 4UF0B 4HGAA 1Y01A 4AQFA 3ZYMA 2XQAA 4HKAA 5L4EA 2YOEA 3UU5A 3VRBA 1G73A 3Q5XA 2WCAA 2XM2A 4ZEYA 2JRKA 3RKOA 2NP9A 3O9XA 5A1LA 3A8YC 1E2AA 4GKJT 2EHOA 4ZZCA 3JAEA 3AE6A 3S4UA 3HI2A 2LM2A 3ZJ2A 3FBZA 2BZBA 2WWVA 2V7MA 4ZS2A 2EHOB 2OA5A 5ETWA 1NENA 2HN1A 2CE7A 3P4WA 3ZEFB 4M1PA 1M62A 3B5MA 3PE0A 1HG5A 2WWUA 4O2BE 4LFBT 1MIYA 4PAGA 4HWFA 4X65T 2JQKA 5KXJA 3ZC0A 2MOZA 4QH5A 4AKIA 2ES0A 3VR9A 2CCQA 5HEUA 1IBKT 5L47A 1BR2A 5M4YA 2IUBA 1XWMA 4DR6T 4Z90A 1QSDA 4Z91A 5FVLA 4U2ZA 4AKLA 5LGTB 3LK2B 1YKEB 5HXHA 3K3OA 1T8BA 4P09A 2E5VA 4JI7T 3AA6B 2LSKA 3LK42 3GWHA 2ODVA 4BJNA 2Q9QC 4YY3T 2K48A 2H88A 4GYSA 4X5TA 4X1IE 4DUYT 3FZKB 4X20E 4GKKT 2V7KA 2V6YA 4G63A 4DV3T 4TN7B 2XPKA 5LB7B 4CZZB 2V6YB 3MKDA 3H37A 2H89A 3HKDE 4EB6E 2AXDS 2PBIA 4EEDA 3HA4A 2X9HA 2ZM0A 5LYJE 4HN9A 1J5WA 2Q9QA 1S94A 2X66A 2IC9A 5LHGB 3N9NA 5HEJA 4DIDB 2H7OA 2V6XA 2Q9QB 3FZFB 4YSYA 2B1EA 4DNDA 3ZPOA 2XTLA 1ZOYA 5AQSB 5JDMA 3B57A 5FL1A 2LOSA 3CX7B 4YLHA 4DMVA 2BS2A 2H7VC 2DLRA 3N2KE 4DBRA 3C4XA 4CI3B 4YTNA 4IDNA 1JNRA 1MIWA 2JPFA 3RKGA 3IF8B 4K0KT 1XNRT 3UUMA 2KXPB 3N2GE 4TX5A 3HR0A 1M7KA 4HE8A 4IE4A 4WW0A 4PJJA 2YK0A 4LMJA 3JAFA 3ZMVB 2DHRA 4P0BA 3RHWA 5L2LA 3RC3A 4DBQA 4TWFA 2WM9A 5JREA 3PUGA 4WYVA 2KT9A 4H63H 1KNZA 2RP4A 3N5LA 1CHUA 4X1YE 1S35A 3P4PA 2JIWA 3SRZA 4KBMB 2BG9C 4IE0A 2LSGA 4DR4T 4XAXB 2B76A 5HEHA 3JADA 4HFCA 3PV0F 4DR3T 1N36T 4H9PC 4EEBA 4X62T 2WDRA 4HWDA 3D0TA 4DR2T 3P7IA 2V5CA 1FMVA 1DU2A 4GK5E 2YDRA 1Z8UA 2X9YA 1BR0A 4MBQA 5FY1A 4IHJE 3AAIA 2ACXA 4HFVA 2C5JA 3U3IA 4NPPA 3AEGA 3UUXB 4EV6A 2XASB 3R6NA 5LGUB 5FY7A 3ZMSB 1HNWT 1HCIA 2QA7A 2XM1A 1YW0A 3SS1A 2YU1A 5AQGB 3I1AA 3N9MA 4HTEA 2UXXB 1HF8A 3KV9A 4BJMA 4XBFB 5LBMA 2OLTA 5HXRA 2X9XA 3A7MA 4JI2T 4OYKA 2E2AA 4O4JE 4DV4T 2XY8B 3L8RA 3N9QA 4ISSA 4P0AA 4NUVA 5AQVB 2HHHT 3AECA 2UUCT 1LRZA 3PU3A 3FZLB 3SWHA 2X68A 1I94T 3ZYLA 2BKNA 3PUVF 3PUSA 2UU9T 3MXZA 4EXTA 4B6XA 3KV4A 2KINB 5JTGA 3AE2A 2D5UA 5AQTB 3N9LA 3AB3B 3UULA 3AAAB 3HKEE 2QYWA 4DR5T 3KINB 3NZQA 1OXZA 3H3MA 5LJNA 3UU8A 4CXWA 2CXLA 5IUXA 3TLWA 1J5ET 4PK5A 2JQHA 4LF7T 4QWNB 1MMNA 5FXXA 3KDSE 2IHR1 1O3XA 5HEGA 5H6QB 2LLYA 4DV1T 4I43B 1SUMB 5JVDE 2LKGA 2V7LA 4GYRA 3C4ZA 1E7PA 3ZCJA 5DJQC 5JQGE 1I6ZA 4DV2T 2WMOA 3PUXF 3UU4A 4WZXA 3AA1B 1D0XA 4CXYA 2X9WA 3WI3A 4A98A 5F8PA 5IYZE 2W4XA 4J2CA 2IIUA 5L3FB 3LK3B 3PTRB 1OWAA 2W61A 5EZYE 1U5PA 4H63V 1UX4A 4ILCA 4AQGA 3UUNA 1N34T 2W67A 3EDVA 4LMKA 3RX6A 4U7IA 5L3EB 1YQ3A 4F8HA 3ONJA 4DUZT 4O8SA 2LOPA 2YEVC 2FJDA 3L39A 1X9BA 2CMRA 3VKHA 4AQFC 3Q5DA 4O2AE 4U2YA 1AJ3A 2HPLA 4L9IA 3PU8A 5AQKB 3GMIA 3I9YA 2HN2A 5LMNT 2LM9A 3VR8A 3WAJA 4KHZF 3ZT5A 2ZM6T 3ESLA 3E08A 2UXDT 2CBJA 4PFOA 3I0QA 2WS3A 5C3JA 2V7JA 3AE8A 4IREA 3AE5A 2IW5B 4HFHA 3C98B 4LFCT 5FY0A 1UGOA 4CN1A 3AE4A 4ASKA 5LP6E 3RPUA 3EI0A 1WCRA 4YJ3E 5TAOA 1N32T 5CFBA 3NBXX 1FMWA 3IBPA 4JI3T 3AXJA 2BS3A 2A9UA 1WR6A 3C50A 5FXZA 3RGLA 1IBMT 2KWIB 3AXJB 2LSIA 4EYUA 4ZZBA 2BBHA 3DJBA 5KDMC 3LBXA 5LCYA 1WYCA 3L09A 3ONLC 2Y6XA 4NXNT 3MACA 3HKBE 2QRXA 3ZT7A 3FBLA 3LBXB 1WYBA 5LGNB 3ETVA 1NEKA 3CQXC 4NUUA 2BVLA 5HXEA 4COFA 2CRBA 2Z6EA 1YQ4A 4ANJA 4UV8B 4EZHA 5KMGP 3LSVA 3K8PC 4E7ZA 5H6RB 4Z8XA 3PUYF 4GOUA 4AXPA 5IWAT 3RRWA 3ZMTB 3Q2MA 2FJBA 4EGWA 4QH4A 1HR0T 3VKGA 4HEAA 3QOFA 2ACZA 1KEYA 5JDHA 5FXWA 4PJNA 5BR8T 2WQYA 2UXCT 5L3BB 2XAQB 5LG4A 2CWOA 2XSBA 2RPAA 4KI0F 2JJ9A 2CLYC 4QXBB 2XQ3A 3I9WA 3NZPA 5JR9A 2DWKA 3FHNA 3NRYA 4C91A 2JMKA 5HXCA 3ETUA 5JR9B 1U4QA 5AQNB 3AA7B 4LF8T 3P8CD 3UT5E 1KNPA 3E0ZA 2XQ6A 4EZ4A 1VCTA 4KMCA 3AVSA 2I6HA 4IE5A 3AEEA 3T1HT 4O4HE 4DR7T 4UVBB 3P50A 2C0SA 2XQ4A 2J4GA 5HCMA 1W9RA 4QH1A 2CLYB 4UVCB 2E8IA 4I55E 4ADZA 3KBUA 2V5DA 4UXNB 1XZYA 3O4XE 2CA5A 3QC9A 1BR1A 4H9OC 3ZJ1A 2LSYA 5DABA 3FB2A 4KX6A 2JQQA 3KFWX 4L0RA 3SOLA 2V7IA 2J1DG 5JDQA 2W0GA 2VQFT 5HWXA 2BBJA 3KVAA 4YTMA 2KNDA 3UFEA 4UEMA 3GA8A 2W63A 3P4QA 1YKHB 4IDOA 4EOZB 3PUQA 3UQ4A 4TV9E 4CXXA 1VRBA 2BKOA 4AKGA 2NR4A 5AQMB 1MMGA 4TZ4C 4GK0E 2KZ7B 3TLTA 2NOXA 3BQLA 2NTXA 1V9DA 1WLXA 5C2TA 3CVRA 2D0TA 3O1JA 4B3TT 2N2NA 1VOMA 4LF5T 3L3PA 4V1Av 5LG3A 3RYIE 3NRXA 1NAFA 3AA0B 3OVUA 5FYMA 2MPKA 4QXHB 4KP3C 2WU2A 2CHOA 1ZHCA 1KF6A 5J0ZA 4IDQA 1HNZT 4L5GA
chains in the Genus database with same CATH topology
4DUYT 4DV1T 4GKKT 5LMNT 4AQYT 4DV7T 4YHHT 2ZM6T 5IWAT 4DV3T 2UXDT 4NXMT 4JI6T 2VQFT 1HR0T 4JI5T 4DV2T 4JI2T 4JI0T 4LFCT 4JV5T 4DV4T 4GKJT 4DR1T 5BR8T 4B3RT 2UXCT 2F4VT 1N32T 4JYAT 2HHHT 4JI3T 4OX9T 2UUCT 4DV0T 4DR4T 2UUBT 1IBMT 1I94T 1XNQT 4JI8T 2UU9T 2UUAT 4DR3T 1N36T 4DV5T 2UXBT 4LFBT 4LF9T 4LF4T 4X62T 1N34T 4LF8T 4DV6T 4DR2T 4X65T 1HNXT 2E5LT 4KHPT 1FJGT 4NXNT 4B3TT 3OTOT 1N33T 4DUZT 5LMUT 1XMQT 3T1HT 1IBKT 4LF5T 4DR7T 4X64T 4DR6T 4DR5T 4LF6T 4X66T 1IBLT 2VQET 4JI1T 4JI4T 1XMOT 4B3ST 3T1YT 4B3MT 1J5ET 4K0KT 1XNRT 4LF7T 1HNWT 4JI7T 1HNZT 4LFAT 4YY3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY T;  4DV1 T;  4GKK T;  5LMN T;  4AQY T;  4DV7 T;  4YHH T;  2ZM6 T;  5IWA T;  4DV3 T;  2UXD T;  4NXM T;  4JI6 T;  2VQF T;  1HR0 T;  4JI5 T;  4DV2 T;  4JI2 T;  4JI0 T;  4LFC T;  4JV5 T;  4DV4 T;  4GKJ T;  4DR1 T;  5BR8 T;  4B3R T;  2UXC T;  2F4V T;  1N32 T;  4JYA T;  2HHH T;  4JI3 T;  4OX9 T;  2UUC T;  4DV0 T;  4DR4 T;  2UUB T;  1IBM T;  1I94 T;  1XNQ T;  4JI8 T;  2UU9 T;  2UUA T;  4DR3 T;  1N36 T;  4DV5 T;  2UXB T;  4LFB T;  4LF9 T;  4LF4 T;  4X62 T;  1N34 T;  4LF8 T;  4DV6 T;  4DR2 T;  4X65 T;  1HNX T;  2E5L T;  4KHP T;  1FJG T;  4NXN T;  4B3T T;  3OTO T;  1N33 T;  4DUZ T;  5LMU T;  1XMQ T;  3T1H T;  1IBK T;  4LF5 T;  4DR7 T;  4X64 T;  4DR6 T;  4DR5 T;  4LF6 T;  4X66 T;  1IBL T;  2VQE T;  4JI1 T;  4JI4 T;  1XMO T;  4B3S T;  3T1Y T;  4B3M T;  1J5E T;  4K0K T;  1XNR T;  4LF7 T;  1HNW T;  4JI7 T;  1HNZ T;  4LFA T;  4YY3 T; 
#chains in the Genus database with same CATH topology
 1YD8 G;  5FMN A;  3EDU A;  2R6G F;  4Q25 A;  5FP3 A;  4WBN E;  4PFP A;  5L4H A;  3UFG A;  1FIO A;  1WFD A;  2CEA A;  3C4W A;  3JC6 D;  3Q5E A;  2M67 A;  2V26 A;  2AE9 A;  3AE1 A;  4JI5 T;  5AQQ B;  2D0U A;  5C8Y E;  2YU2 A;  5AQO B;  4OK0 A;  4JV5 T;  5HWY A;  3DP7 A;  1UK5 A;  2HH7 A;  4UR9 A;  2L9Q A;  5LJM A;  2F4V T;  1OED E;  5JH7 E;  4PJM A;  4EIW A;  3QUJ A;  1BR4 A;  4AI6 A;  2XQY A;  5ABH A;  2X67 A;  3M3Z B;  3M65 A;  3U78 A;  2UUB T;  3H3A A;  2FUP A;  3AVR A;  3TLU A;  2BS4 A;  3AEF A;  1E1H B;  3HL6 A;  4HFB A;  1HG2 A;  2XHE B;  3TLV A;  3OYX A;  4LF9 T;  4TV8 E;  1L0V A;  1QUU A;  5LA6 E;  1US7 B;  5FXV A;  3P4R A;  5LBQ B;  1MMD A;  2NW8 A;  1N33 T;  2LHR A;  4PK4 A;  4ZOL E;  3N9P A;  5FKY A;  4DVD A;  4ERR A;  5CGM A;  3UU3 A;  4IL9 A;  5CA0 E;  5CA1 E;  2K9A A;  4B3S T;  4H9Q C;  3OBV E;  3DTO A;  3CX6 B;  3IHR A;  5ABG A;  4TWH A;  3ZKR A;  4ILB A;  1VCS A;  4IDP A;  3ZC1 A;  2VVS A;  3HKC E;  5EK4 A;  4IE6 A;  2LRK A;  4CI1 B;  1WR0 A;  5JRC A;  4DV7 T;  4BAY B;  2VAS A;  3AEB A;  2IC6 A;  3B13 A;  1D0Z A;  3RIU C;  5JRC B;  4ILA A;  4TNV A;  4ZI7 E;  1QLB A;  4DR1 T;  3T8O A;  4O4L E;  1IAP A;  3KBT A;  5JDG A;  3J9X 1;  4UV9 B;  1MND A;  2UXN B;  2XUE A;  2BG9 E;  5ADX L;  3VU7 H;  2UUA T;  3RIU A;  2DWG A;  2VKD A;  4MAL A;  2M6I A;  4IE7 A;  1YXR A;  3O1I A;  2XAF B;  2VKJ A;  3CWZ B;  3MA9 A;  4ZI3 D;  1UUS A;  1LVF A;  1HX8 A;  4U72 A;  3AEA A;  3W15 B;  4EYY R;  5FL0 A;  1JNZ A;  2LKH A;  3LDQ B;  5LOV E;  3WAK A;  4IIJ E;  2W62 A;  4PNI A;  2PJQ A;  4AIS A;  2WAU A;  2E9X D;  2BKP A;  3FXE B;  2J62 A;  2V8S V;  3RQU A;  3EHZ A;  3ONX A;  2YDS A;  3EUH A;  5ABF A;  4NXM T;  5EK3 A;  4PW8 A;  4HWI B;  3NVO A;  4JI6 T;  4MLK A;  4AIU A;  4CI2 B;  4AKR B;  5ABF B;  1R8I A;  2VUR A;  4B3R T;  3EVY A;  3F57 A;  2FJE A;  4BA9 A;  4YSZ A;  4DV0 T;  2WU5 A;  3QNU A;  3RQW A;  2XJ7 A;  3BQI A;  2W2U A;  2CM0 A;  1T7S A;  4KUM B;  3RYC E;  2UXB T;  5JDF A;  2SPC A;  5AQU B;  2WDV A;  4DV6 T;  3ZN0 B;  3CIR A;  3RIA A;  4UEL A;  2XAH B;  4OYJ A;  4U74 A;  1UX5 A;  3FZM B;  2WZH A;  2I0M A;  4JI1 T;  4JI4 T;  2WY2 A;  1GQE A;  1ZV4 X;  2JMH A;  3PDY A;  3BK9 A;  4F6R C;  4B3M T;  2XQ9 A;  3F31 A;  3O1H A;  5LHH B;  4A97 A;  1W0B A;  4YJ2 E;  1KK7 A;  3TLS A;  4U31 A;  5IHY A;  4HWH A;  2QGS A;  3PUA A;  1NWM X;  1ZKE A;  2ODU A;  3K3N A;  4AQY T;  4CN6 A;  2DNX A;  2YDQ A;  3JCF A;  2XZE A;  2BVM A;  4QX8 B;  2MAW A;  5ABE A;  2P9B A;  3QK6 A;  3ZSS A;  3TKL B;  1XDP A;  2X0Y A;  1T98 A;  4TNW A;  5JR9 C;  3RYH E;  2A2F X;  4QXC B;  1B7T A;  2VKH A;  3P4S A;  4IDZ A;  2K5B B;  3CQC B;  1XNQ T;  4ILU A;  2DCF A;  2CXD A;  3AE9 A;  2ZM2 A;  4U7Y A;  2Y48 B;  3KV5 A;  5GON E;  2LRL A;  4NIQ A;  4ZI2 D;  3K1S A;  3ABV A;  5FNV E;  1WRD A;  5LXT E;  1HS7 A;  2W66 A;  3CPZ A;  2EHO D;  2H3R A;  4TUY E;  2IAK A;  1XMO T;  2VKO A;  4I0U A;  2KSR A;  4JEH B;  3AAE B;  4GIW A;  3V5U A;  5J2U E;  1MIV A;  3CKD A;  2YN6 A;  4ZHQ E;  3UQ7 A;  3PUR A;  2MBG A;  4PK6 A;  1OED C;  2C5I T;  3EAM A;  3OPC A;  4YFS A;  3I0O A;  2L3L A;  3LFM A;  5LNK A;  4IGU A;  2WBL A;  4C90 A;  2ZM8 A;  5L3G B;  3ZMU B;  3LG7 A;  2JQ9 A;  1D0Y A;  4ZS3 A;  3CQG B;  4JYA T;  3RRC A;  1OED A;  4OFZ A;  3JC6 C;  1HFA A;  5J1G A;  2XQ8 A;  4DMW A;  2KLQ A;  5BMV E;  5HXS A;  3Q9D A;  4XZC A;  4O4I E;  1OED B;  2XAJ B;  3ZCI A;  2NTY A;  2RA1 A;  4FI5 A;  4HFI A;  2N9D A;  3KV6 A;  1SA0 E;  1SE7 A;  2X0L B;  2IML A;  2ZLY A;  2CXF A;  3RLF F;  1X79 A;  4QX7 B;  2LEH A;  5F5W A;  2Q9Q D;  3OKQ A;  4CN4 A;  2A3D A;  1KFY A;  2YIN A;  3VHL A;  2I59 A;  4X66 T;  1UUR A;  1MNE A;  3MJX A;  2VB6 A;  3E22 E;  1ZEE A;  2LE8 A;  2C5K T;  4MHC A;  1CUN A;  1KNR A;  3CK6 A;  2XSA A;  2WP9 A;  1IZN B;  4P1N A;  1H7C A;  5L3D B;  5F3J A;  3UUB A;  4HFD A;  4UIG A;  1IJ5 A;  4LML A;  2HPJ A;  2V1D B;  2FJA A;  3N2O A;  4JI0 T;  5HAX A;  4H9N C;  2J47 A;  2Y8D A;  1HTJ F;  3QB5 A;  5AQL B;  3NKZ A;  2PG8 A;  5JDN A;  4JEU B;  2WDQ A;  3FZH B;  2DL1 A;  3QB5 K;  4OX9 T;  4IST A;  4IT4 A;  3AED A;  1ZP0 A;  2QVA A;  2WZI A;  3F2E A;  2BDE A;  1Z0P A;  4IL4 A;  3A5X A;  2BG9 A;  4HFE A;  3SFE A;  4G2A A;  3ZN1 B;  4AKH A;  4QHO A;  1D1A A;  4DV5 T;  4LF4 T;  4A5X A;  3EAB A;  2CPT A;  5KX5 E;  2M6B A;  2BG9 B;  3IA3 A;  1FJG T;  3N9O A;  4YHJ A;  4PJL A;  2VVN A;  4WNK A;  4YT0 A;  5LMU T;  2LT3 A;  2WSS V;  3ZST A;  2K3W A;  5AFU L;  4FJO A;  2W00 A;  1IBL T;  5AQI B;  4U3C A;  4YXD A;  3T1Y T;  4MFR A;  2XQ7 A;  4ZI3 C;  3PJA A;  2OV9 A;  5E0O A;  2NW9 A;  2XQ5 A;  3RYF E;  3K3Q C;  3AE3 A;  4LFA T;  3OJA A;  5HEO A;  3ZYK A;  1D1C A;  3RH3 A;  3RIF A;  4DO0 A;  3MK7 C;  3V5S A;  2E9X C;  3C51 A;  2VK9 A;  4ZXL A;  4HWC A;  3KVB A;  5AQF B;  4YTP A;  4H9S E;  3ZT6 A;  3CML A;  5AQP B;  1SHZ C;  2G0U A;  5L3C B;  4CQI A;  2E9X A;  2VL8 A;  1FEW A;  2WMN A;  4OHF A;  1J1J A;  1LVK A;  5CB4 E;  3CX8 B;  3R84 B;  2MYS A;  3PUW F;  1UCU A;  2E9X B;  3ANW A;  2MTQ A;  2YKS A;  1HNX T;  2KMF A;  4X1K E;  4E7S A;  3X1D A;  4KHP T;  4JLE A;  3OTO T;  3FXD B;  2XAG B;  3ANW B;  2N1G A;  1LKX A;  4I4T E;  1G8X A;  5EK2 A;  5CJ5 A;  5J2T E;  5DQW A;  1D1B A;  5AQJ B;  4H9R C;  3PUZ F;  2IDO B;  2K24 A;  2CBI A;  2CWY A;  3OYZ A;  3RF1 A;  2GK9 A;  5HYA A;  1W0A A;  1IJ6 A;  4K0U A;  5HCJ A;  2D2S A;  2PTF A;  1W09 A;  3J7Y q;  2A72 A;  2NW7 A;  4YHH T;  2LJL A;  3Q5W A;  3ZMZ B;  2FBW A;  4TWD A;  4U33 A;  3UTK A;  2WB5 A;  4QKN A;  2ZMA A;  2X51 A;  3SFD A;  3MZK B;  2CHN A;  4EAH A;  3RI5 A;  4N78 D;  1HX1 B;  1Y64 B;  4A56 A;  3G06 A;  3BQK A;  2VL0 A;  5FVK A;  2VWA A;  4YSX A;  1XDO A;  2D9D A;  3VRA A;  1MMA A;  1EZ3 A;  2LHN A;  3GN5 A;  4JI8 T;  3IEE A;  2DI4 A;  2X0H A;  2KWH A;  1T72 A;  4UVA B;  5AQR B;  3GN5 B;  3LJC A;  2E5L T;  2NWB A;  2L8K A;  5LHI B;  4JUY A;  3NWI A;  1XMQ T;  3UU6 A;  4X64 T;  5DQV A;  4I50 E;  4WBO A;  5AQH B;  4LF6 T;  2PFV A;  2VQE T;  3ZLI A;  3C64 A;  4ZI2 C;  3AE7 A;  4UF0 A;  3RC8 A;  2LSJ A;  4JBW F;  5JDL A;  3PJA J;  2EHO C;  4UF0 B;  4HGA A;  1Y01 A;  4AQF A;  3ZYM A;  2XQA A;  4HKA A;  5L4E A;  2YOE A;  3UU5 A;  3VRB A;  1G73 A;  3Q5X A;  2WCA A;  2XM2 A;  4ZEY A;  2JRK A;  3RKO A;  2NP9 A;  3O9X A;  5A1L A;  3A8Y C;  1E2A A;  4GKJ T;  2EHO A;  4ZZC A;  3JAE A;  3AE6 A;  3S4U A;  3HI2 A;  2LM2 A;  3ZJ2 A;  3FBZ A;  2BZB A;  2WWV A;  2V7M A;  4ZS2 A;  2EHO B;  2OA5 A;  5ETW A;  1NEN A;  2HN1 A;  2CE7 A;  3P4W A;  3ZEF B;  4M1P A;  1M62 A;  3B5M A;  3PE0 A;  1HG5 A;  2WWU A;  4O2B E;  4LFB T;  1MIY A;  4PAG A;  4HWF A;  4X65 T;  2JQK A;  5KXJ A;  3ZC0 A;  2MOZ A;  4QH5 A;  4AKI A;  2ES0 A;  3VR9 A;  2CCQ A;  5HEU A;  1IBK T;  5L47 A;  1BR2 A;  5M4Y A;  2IUB A;  1XWM A;  4DR6 T;  4Z90 A;  1QSD A;  4Z91 A;  5FVL A;  4U2Z A;  4AKL A;  5LGT B;  3LK2 B;  1YKE B;  5HXH A;  3K3O A;  1T8B A;  4P09 A;  2E5V A;  4JI7 T;  3AA6 B;  2LSK A;  3LK4 2;  3GWH A;  2ODV A;  4BJN A;  2Q9Q C;  4YY3 T;  2K48 A;  2H88 A;  4GYS A;  4X5T A;  4X1I E;  4DUY T;  3FZK B;  4X20 E;  4GKK T;  2V7K A;  2V6Y A;  4G63 A;  4DV3 T;  4TN7 B;  2XPK A;  5LB7 B;  4CZZ B;  2V6Y B;  3MKD A;  3H37 A;  2H89 A;  3HKD E;  4EB6 E;  2AXD S;  2PBI A;  4EED A;  3HA4 A;  2X9H A;  2ZM0 A;  5LYJ E;  4HN9 A;  1J5W A;  2Q9Q A;  1S94 A;  2X66 A;  2IC9 A;  5LHG B;  3N9N A;  5HEJ A;  4DID B;  2H7O A;  2V6X A;  2Q9Q B;  3FZF B;  4YSY A;  2B1E A;  4DND A;  3ZPO A;  2XTL A;  1ZOY A;  5AQS B;  5JDM A;  3B57 A;  5FL1 A;  2LOS A;  3CX7 B;  4YLH A;  4DMV A;  2BS2 A;  2H7V C;  2DLR A;  3N2K E;  4DBR A;  3C4X A;  4CI3 B;  4YTN A;  4IDN A;  1JNR A;  1MIW A;  2JPF A;  3RKG A;  3IF8 B;  4K0K T;  1XNR T;  3UUM A;  2KXP B;  3N2G E;  4TX5 A;  3HR0 A;  1M7K A;  4HE8 A;  4IE4 A;  4WW0 A;  4PJJ A;  2YK0 A;  4LMJ A;  3JAF A;  3ZMV B;  2DHR A;  4P0B A;  3RHW A;  5L2L A;  3RC3 A;  4DBQ A;  4TWF A;  2WM9 A;  5JRE A;  3PUG A;  4WYV A;  2KT9 A;  4H63 H;  1KNZ A;  2RP4 A;  3N5L A;  1CHU A;  4X1Y E;  1S35 A;  3P4P A;  2JIW A;  3SRZ A;  4KBM B;  2BG9 C;  4IE0 A;  2LSG A;  4DR4 T;  4XAX B;  2B76 A;  5HEH A;  3JAD A;  4HFC A;  3PV0 F;  4DR3 T;  1N36 T;  4H9P C;  4EEB A;  4X62 T;  2WDR A;  4HWD A;  3D0T A;  4DR2 T;  3P7I A;  2V5C A;  1FMV A;  1DU2 A;  4GK5 E;  2YDR A;  1Z8U A;  2X9Y A;  1BR0 A;  4MBQ A;  5FY1 A;  4IHJ E;  3AAI A;  2ACX A;  4HFV A;  2C5J A;  3U3I A;  4NPP A;  3AEG A;  3UUX B;  4EV6 A;  2XAS B;  3R6N A;  5LGU B;  5FY7 A;  3ZMS B;  1HNW T;  1HCI A;  2QA7 A;  2XM1 A;  1YW0 A;  3SS1 A;  2YU1 A;  5AQG B;  3I1A A;  3N9M A;  4HTE A;  2UXX B;  1HF8 A;  3KV9 A;  4BJM A;  4XBF B;  5LBM A;  2OLT A;  5HXR A;  2X9X A;  3A7M A;  4JI2 T;  4OYK A;  2E2A A;  4O4J E;  4DV4 T;  2XY8 B;  3L8R A;  3N9Q A;  4ISS A;  4P0A A;  4NUV A;  5AQV B;  2HHH T;  3AEC A;  2UUC T;  1LRZ A;  3PU3 A;  3FZL B;  3SWH A;  2X68 A;  1I94 T;  3ZYL A;  2BKN A;  3PUV F;  3PUS A;  2UU9 T;  3MXZ A;  4EXT A;  4B6X A;  3KV4 A;  2KIN B;  5JTG A;  3AE2 A;  2D5U A;  5AQT B;  3N9L A;  3AB3 B;  3UUL A;  3AAA B;  3HKE E;  2QYW A;  4DR5 T;  3KIN B;  3NZQ A;  1OXZ A;  3H3M A;  5LJN A;  3UU8 A;  4CXW A;  2CXL A;  5IUX A;  3TLW A;  1J5E T;  4PK5 A;  2JQH A;  4LF7 T;  4QWN B;  1MMN A;  5FXX A;  3KDS E;  2IHR 1;  1O3X A;  5HEG A;  5H6Q B;  2LLY A;  4DV1 T;  4I43 B;  1SUM B;  5JVD E;  2LKG A;  2V7L A;  4GYR A;  3C4Z A;  1E7P A;  3ZCJ A;  5DJQ C;  5JQG E;  1I6Z A;  4DV2 T;  2WMO A;  3PUX F;  3UU4 A;  4WZX A;  3AA1 B;  1D0X A;  4CXY A;  2X9W A;  3WI3 A;  4A98 A;  5F8P A;  5IYZ E;  2W4X A;  4J2C A;  2IIU A;  5L3F B;  3LK3 B;  3PTR B;  1OWA A;  2W61 A;  5EZY E;  1U5P A;  4H63 V;  1UX4 A;  4ILC A;  4AQG A;  3UUN A;  1N34 T;  2W67 A;  3EDV A;  4LMK A;  3RX6 A;  4U7I A;  5L3E B;  1YQ3 A;  4F8H A;  3ONJ A;  4DUZ T;  4O8S A;  2LOP A;  2YEV C;  2FJD A;  3L39 A;  1X9B A;  2CMR A;  3VKH A;  4AQF C;  3Q5D A;  4O2A E;  4U2Y A;  1AJ3 A;  2HPL A;  4L9I A;  3PU8 A;  5AQK B;  3GMI A;  3I9Y A;  2HN2 A;  5LMN T;  2LM9 A;  3VR8 A;  3WAJ A;  4KHZ F;  3ZT5 A;  2ZM6 T;  3ESL A;  3E08 A;  2UXD T;  2CBJ A;  4PFO A;  3I0Q A;  2WS3 A;  5C3J A;  2V7J A;  3AE8 A;  4IRE A;  3AE5 A;  2IW5 B;  4HFH A;  3C98 B;  4LFC T;  5FY0 A;  1UGO A;  4CN1 A;  3AE4 A;  4ASK A;  5LP6 E;  3RPU A;  3EI0 A;  1WCR A;  4YJ3 E;  5TAO A;  1N32 T;  5CFB A;  3NBX X;  1FMW A;  3IBP A;  4JI3 T;  3AXJ A;  2BS3 A;  2A9U A;  1WR6 A;  3C50 A;  5FXZ A;  3RGL A;  1IBM T;  2KWI B;  3AXJ B;  2LSI A;  4EYU A;  4ZZB A;  2BBH A;  3DJB A;  5KDM C;  3LBX A;  5LCY A;  1WYC A;  3L09 A;  3ONL C;  2Y6X A;  4NXN T;  3MAC A;  3HKB E;  2QRX A;  3ZT7 A;  3FBL A;  3LBX B;  1WYB A;  5LGN B;  3ETV A;  1NEK A;  3CQX C;  4NUU A;  2BVL A;  5HXE A;  4COF A;  2CRB A;  2Z6E A;  1YQ4 A;  4ANJ A;  4UV8 B;  4EZH A;  5KMG P;  3LSV A;  3K8P C;  4E7Z A;  5H6R B;  4Z8X A;  3PUY F;  4GOU A;  4AXP A;  5IWA T;  3RRW A;  3ZMT B;  3Q2M A;  2FJB A;  4EGW A;  4QH4 A;  1HR0 T;  3VKG A;  4HEA A;  3QOF A;  2ACZ A;  1KEY A;  5JDH A;  5FXW A;  4PJN A;  5BR8 T;  2WQY A;  2UXC T;  5L3B B;  2XAQ B;  5LG4 A;  2CWO A;  2XSB A;  2RPA A;  4KI0 F;  2JJ9 A;  2CLY C;  4QXB B;  2XQ3 A;  3I9W A;  3NZP A;  5JR9 A;  2DWK A;  3FHN A;  3NRY A;  4C91 A;  2JMK A;  5HXC A;  3ETU A;  5JR9 B;  1U4Q A;  5AQN B;  3AA7 B;  4LF8 T;  3P8C D;  3UT5 E;  1KNP A;  3E0Z A;  2XQ6 A;  4EZ4 A;  1VCT A;  4KMC A;  3AVS A;  2I6H A;  4IE5 A;  3AEE A;  3T1H T;  4O4H E;  4DR7 T;  4UVB B;  3P50 A;  2C0S A;  2XQ4 A;  2J4G A;  5HCM A;  1W9R A;  4QH1 A;  2CLY B;  4UVC B;  2E8I A;  4I55 E;  4ADZ A;  3KBU A;  2V5D A;  4UXN B;  1XZY A;  3O4X E;  2CA5 A;  3QC9 A;  1BR1 A;  4H9O C;  3ZJ1 A;  2LSY A;  5DAB A;  3FB2 A;  4KX6 A;  2JQQ A;  3KFW X;  4L0R A;  3SOL A;  2V7I A;  2J1D G;  5JDQ A;  2W0G A;  2VQF T;  5HWX A;  2BBJ A;  3KVA A;  4YTM A;  2KND A;  3UFE A;  4UEM A;  3GA8 A;  2W63 A;  3P4Q A;  1YKH B;  4IDO A;  4EOZ B;  3PUQ A;  3UQ4 A;  4TV9 E;  4CXX A;  1VRB A;  2BKO A;  4AKG A;  2NR4 A;  5AQM B;  1MMG A;  4TZ4 C;  4GK0 E;  2KZ7 B;  3TLT A;  2NOX A;  3BQL A;  2NTX A;  1V9D A;  1WLX A;  5C2T A;  3CVR A;  2D0T A;  3O1J A;  4B3T T;  2N2N A;  1VOM A;  4LF5 T;  3L3P A;  4V1A v;  5LG3 A;  3RYI E;  3NRX A;  1NAF A;  3AA0 B;  3OVU A;  5FYM A;  2MPK A;  4QXH B;  4KP3 C;  2WU2 A;  2CHO A;  1ZHC A;  1KF6 A;  5J0Z A;  4IDQ A;  1HNZ T;  4L5G A; 
#chains in the Genus database with same CATH homology
 4DUY T;  4DV1 T;  4GKK T;  5LMN T;  4AQY T;  4DV7 T;  4YHH T;  2ZM6 T;  5IWA T;  4DV3 T;  2UXD T;  4NXM T;  4JI6 T;  2VQF T;  1HR0 T;  4JI5 T;  4DV2 T;  4JI2 T;  4JI0 T;  4LFC T;  4JV5 T;  4DV4 T;  4GKJ T;  4DR1 T;  5BR8 T;  4B3R T;  2UXC T;  2F4V T;  1N32 T;  4JYA T;  2HHH T;  4JI3 T;  4OX9 T;  2UUC T;  4DV0 T;  4DR4 T;  2UUB T;  1IBM T;  1I94 T;  1XNQ T;  4JI8 T;  2UU9 T;  2UUA T;  4DR3 T;  1N36 T;  4DV5 T;  2UXB T;  4LFB T;  4LF9 T;  4LF4 T;  4X62 T;  1N34 T;  4LF8 T;  4DV6 T;  4DR2 T;  4X65 T;  1HNX T;  2E5L T;  4KHP T;  1FJG T;  4NXN T;  4B3T T;  3OTO T;  1N33 T;  4DUZ T;  5LMU T;  1XMQ T;  3T1H T;  1IBK T;  4LF5 T;  4DR7 T;  4X64 T;  4DR6 T;  4DR5 T;  4LF6 T;  4X66 T;  1IBL T;  2VQE T;  4JI1 T;  4JI4 T;  1XMO T;  4B3S T;  3T1Y T;  4B3M T;  1J5E T;  4K0K T;  1XNR T;  4LF7 T;  1HNW T;  4JI7 T;  1HNZ T;  4LFA T;  4YY3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...