4JYAT

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4jyaT00
4DV0T 4DUZT 1N34T 1IBKT 4GKKT 2ZM6T 1HNZT 1IBMT 2UXBT 4B3MT 1N33T 4OX9T 2VQET 1HR0T 2UUBT 2UUAT 4LFCT 4JI7T 4KHPT 5BR8T 2F4VT 4X66T 4JYAT 2UU9T 3OTOT 1HNWT 4DV1T 4DR3T 4B3ST 5LMUT 4DV2T 4LF4T 3T1YT 4X65T 4JI5T 4JI2T 4JI8T 4DV6T 1J5ET 4YHHT 4DR4T 2UXDT 4AQYT 4B3RT 4DUYT 4DR7T 4LF5T 1XNQT 1I94T 1IBLT 4JI4T 1XNRT 2VQFT 2UUCT 4JV5T 4LF9T 4X62T 4X64T 4K0KT 5LMNT 4DR5T 4GKJT 4JI3T 4B3TT 4NXMT 2E5LT 4LFAT 1XMQT 5IWAT 1HNXT 1XMOT 4LF7T 4DV4T 4NXNT 4YY3T 4DV5T 4DR2T 4JI1T 1N36T 3T1HT 2UXCT 4LFBT 4JI0T 4DR1T 1N32T 2HHHT 4JI6T 4LF8T 4DV3T 1FJGT 4DR6T 4DV7T 4LF6T
chains in the Genus database with same CATH superfamily
2YDRA 3ZYMA 1IJ5A 3AEAA 3U3IA 3E08A 2LJLA 3UU3A 3OVUA 2PG8A 2WMNA 5LGTB 1N34T 3QC9A 5HYAA 2XQ5A 2YINA 4PJNA 3JCFA 2D9DA 3E0ZA 2V5DA 5EK3A 1FIOA 1SHZC 3ZLIA 4F8HA 5JH7E 4P0AA 2DNXA 4JI1T 2LKGA 2V7LA 2BS4A 5DJQC 4U2ZA 5LCYA 2KLQA 4ANJA 1Y64B 3ZYLA 2D2SA 1FMWA 1Z0PA 2XQAA 4HKAA 1N33T 3C4ZA 4IREA 3RYFE 2VQET 1T8BA 3VR9A 5IUXA 1QUUA 2W4XA 2UUBT 3ESLA 3ONJA 2UUAT 3CIRA 2FJBA 4CN4A 2WM9A 1YW0A 3EHZA 5FL0A 2E5VA 4YJ3E 3AE6A 1WCRA 2UXNB 3FBZA 4GOUA 2FJEA 1OEDA 4BA9A 1KEYA 3AE3A 3V5SA 3C4XA 3FZKB 3HKCE 2JIWA 4IE7A 4I0UA 2KINB 4KHZF 4B3ST 2UXXB 2C5JA 2X9HA 2ACZA 3LK42 4O4HE 4DV2T 2PJQA 4QXBB 3B13A 2IC9A 4ZEYA 1YQ3A 3T1YT 2W61A 1IAPA 2VVNA 4WYVA 2I0MA 2Z6EA 2YDSA 3P4RA 4ZOLE 1B7TA 1OXZA 3EVYA 4CZZB 4QX8B 2XJ7A 4AKRB 1NEKA 3PJAA 5KMGP 2BG9B 2JJ9A 4HFEA 4IDQA 5FY7A 4JI2T 2JQHA 3RGLA 3RH3A 5AQFB 2VL0A 3PURA 5L47A 5ABHA 4YHHT 3AXJB 5JRCB 4EGWA 2LKHA 3P4WA 4PNIA 4ZZBA 3I1AA 2V7IA 3UUBA 3DTOA 3FZLB 3RX6A 4UVBB 3ZYKA 2JRKA 2VB6A 4B3RT 2D0UA 3UUMA 3AAEB 5LB7B 1NENA 2CPTA 3PUXF 2X0LB 3AA1B 3RIFA 3TLVA 2HH7A 2I6HA 2XPKA 4H9RC 4HFIA 4ZZCA 1QSDA 4XBFB 3ONLC 3AA7B 2V8SV 4KBMB 1UGOA 1XNQT 4JI4T 2LM2A 1XNRT 5J2TE 2W2UA 3GN5B 4X20E 5HEHA 3L09A 5FXXA 3I9WA 3NBXX 3ZMUB 5CA0E 5LG3A 2ACXA 4C90A 1G73A 4AQFC 2VQFT 3B5MA 2M6IA 3PUQA 2WZHA 2YOEA 4HWDA 2N1GA 4O2BE 4YTNA 2LOPA 1OEDB 4AISA 2LE8A 1ZEEA 3KFWX 2LSGA 3HKDE 2XQ7A 4E7ZA 4H9PC 3P50A 2BBHA 1CUNA 4DMVA 1KNPA 4YT0A 1MMGA 3KINB 3UUNA 3SRZA 2PBIA 3KV4A 2CBIA 2WDVA 4O4LE 4DO0A 2YKSA 2AE9A 5AQLB 4B3TT 2X66A 2BVMA 3FZMB 5LXTE 5JREA 2WP9A 2EHOA 5IWAT 2MAWA 2JMHA 4ILCA 3O1IA 2CA5A 2I59A 5HXCA 3ONXA 4ADZA 2X9YA 2H88A 3ANWB 3C4WA 3ETVA 3GMIA 4O2AE 2KT9A 2P9BA 2IUBA 5LJMA 2CXDA 4DNDA 2LEHA 3K1SA 2DLRA 4DV4T 1ZHCA 2MTQA 1LVKA 1W9RA 4UF0B 3ZSSA 4ASKA 3PUZF 2N2NA 4FI5A 4DV5T 1N36T 3FXDB 3N9MA 3N5LA 3ZSTA 2BVLA 4GK5E 2VKHA 3CX8B 2CHOA 3UQ7A 2HPJA 2M67A 2WZIA 4HFHA 2UXCT 3VKHA 1ZV4X 3LJCA 2ODUA 2LT3A 4YLHA 3PJAJ 4IIJE 1MNDA 5ETWA 2NW7A 1N32T 4JEHB 3ZMSB 4L5GA 3PUWF 5DABA 2KWIB 4H9QC 1X9BA 4I55E 5L3CB 5ABEA 2XAGB 3IBPA 3PV0F 3K3NA 2RP4A 1M62A 4NPPA 3GWHA 2Q9QD 2Q9QB 1J5WA 2LHNA 4EYUA 3RRWA 3MK7C 4DV7T 4IDOA 2WWUA 5HWYA 2JQKA 4TV8E 4OK0A 1HX1B 2VKDA 2JQ9A 4PW8A 4AKIA 2E9XB 2J47A 3D0TA 4GKKT 2J1DG 4PK4A 4CI3B 3FXEB 2DHRA 2AXDS 3KVAA 2Q9QA 2K5BB 3OKQA 5LOVE 3HKBE 3UFGA 4WBNE 3MJXA 2V7MA 2K48A 3HL6A 3P4PA 3P4SA 3ZPOA 3OJAA 4IGUA 4IL9A 3ZMZB 1HNZT 1IBMT 3I0QA 3KV9A 4HWIB 4B3MT 3PUGA 3AEDA 2NWBA 1YKHB 3BK9A 4TX5A 5CFBA 2ZM2A 3FBLA 3QB5A 3ZKRA 3RLFF 3SS1A 2XM1A 3EI0A 4LFCT 4KHPT 2YU2A 3FZHB 5KDMC 3CKDA 1ZOYA 5HEOA 1Y01A 4C91A 4IE5A 1MIYA 1T98A 4A98A 5CA1E 2CBJA 1LKXA 3WI3A 3AE7A 2KWHA 2PTFA 3FB2A 5H6RB 2E9XC 3TLUA 2YEVC 2DCFA 3VRBA 4DV1T 4DR3T 3N2OA 4IE0A 4NIQA 4AIUA 4QH1A 2JPFA 2N9DA 2PFVA 5E0OA 4BJNA 2VASA 4UVAB 2V6YB 1SA0E 4TZ4C 1BR1A 4ZS3A 2L3LA 5AQJB 5F5WA 1KNZA 1R8IA 2CCQA 4EAHA 3KBUA 3A5XA 1UK5A 5HAXA 4A5XA 1KFYA 5LGUB 2W67A 2QRXA 1D1CA 5JDQA 2IC6A 3OYZA 4PJLA 1J5ET 3OYXA 2FBWA 4QKNA 2CXFA 2EHOB 2XQ4A 5F3JA 5JDGA 1G8XA 3LFMA 2UXDT 3HI2A 3HR0A 4EB6E 2CEAA 5JQGE 1HF8A 1BR2A 2BKOA 1JNZA 5DQVA 3SOLA 5HXEA 2CWOA 2WDRA 3M65A 3RIUC 4EEBA 2XAJB 2DWGA 4YXDA 4OYKA 2KZ7B 3NWIA 1I94T 2LSJA 2HN2A 5CGMA 3V5UA 5J2UE 5FNVE 3O1HA 5FVKA 2BKPA 4ZI2D 4OFZA 5C3JA 5JDNA 2XUEA 2L8KA 3AE5A 5LJNA 4AKHA 4ILAA 4JV5T 1YQ4A 1CHUA 2LSYA 5HXHA 3ZJ1A 1X79A 3LDQB 4X64T 3N9NA 4I4TE 3RQWA 2XAFB 4HWCA 2XSAA 2CXLA 3OBVE 5AQUB 4ISTA 4F6RC 4YSZA 2BBJA 2BZBA 5FY0A 3VR8A 4HFDA 1D1BA 1SE7A 1WYCA 2LHRA 3PUSA 5JR9A 3S4UA 3TLWA 3ZJ2A 4DR5T 1HR0T 3Q5DA 2ODVA 2J4GA 2YK0A 3L39A 4TV9E 3H3AA 4U31A 4AKLA 4HEAA 4EV6A 3J7Yq 2XTLA 3PTRB 4P1NA 5JDLA 3EDVA 3PUAA 4LFAT 3FZFB 4MLKA 4EIWA 1XDOA 1KNRA 1HNXT 3KVBA 3KDSE 3RI5A 5HWXA 1KF6A 2V5CA 2WBLA 5FYMA 3ZEFB 1XMOT 1DU2A 1U4QA 4QH5A 1W0BA 4QXCB 4NXNT 2KMFA 3E22E 4O4JE 4P09A 2E2AA 3UU4A 3VU7H 3T8OA 3ZMVB 3Q5WA 2WDQA 3MA9A 4U7IA 3EABA 3AEEA 3PU8A 3RIUA 1NWMX 3UUXB 2H7VC 4EYYR 3AECA 1E1HB 2VURA 3AE8A 4DIDB 2JMKA 2WU5A 2K24A 5TAOA 3RYHE 4JI0T 1UCUA 3UULA 5LHHB 3AVRA 2SPCA 3TKLB 3NZPA 3QB5K 4COFA 4YSXA 4JI6T 4LF8T 5L3GB 5IHYA 3LK2B 3AEBA 1OEDC 3O9XA 4LF4T 4FJOA 1FJGT 3AE2A 5IYZE 3LK3B 2A2FX 5FL1A 5JTGA 1BR0A 3QK6A 2MBGA 3O1JA 3RQUA 4CXWA 3GN5A 3RC3A 4LF6T 5HCMA 1D1AA 4H9NC 2BG9E 5AQVB 1Z8UA 3ZT6A 4DMWA 2XASB 4EZ4A 2OA5A 5J0ZA 2A9UA 4QHOA 1D0ZA 3K3QC 1IBKT 3I9YA 3CPZA 2X0HA 5JR9B 5LGNB 2NW8A 2VKOA 3QUJA 3N2GE 2V6XA 3ANWA 4IDNA 2WB5A 5AQTB 2KSRA 3AVSA 2MPKA 4ZHQE 2LRLA 1T7SA 1E2AA 5HEGA 5AQKB 4M1PA 3RIAA 4CI1B 2DWKA 4UELA 4E7SA 2UXBT 4AQFA 2H7OA 2YU1A 5AQPB 5BMVE 5LHGB 4OX9T 2KXPB 2BG9A 4NUUA 3ZC1A 4CXXA 5JDFA 3N9QA 3PUYF 2W00A 3P4QA 4UVCB 5AQHB 4OHFA 4JLEA 5FXVA 4X1KE 4JI7T 1JNRA 1WFDA 2ES0A 2H89A 5BR8T 4X66T 5C2TA 2HPLA 4AKGA 4ERRA 1VRBA 5LNKA 2LM9A 5JDHA 3EUHA 1HG5A 1S35A 3G06A 4ZS2A 4Z91A 5L3FB 5FY1A 2X51A 2D0TA 2LRKA 3C64A 4U74A 5CB4E 4KP3C 2WU2A 3N9OA 3JADA 3JC6D 5AQSB 2CRBA 3A7MA 1UX5A 2B76A 3N2KE 1VCSA 2VWAA 2XZEA 1AJ3A 1XDPA 4X65T 4XZCA 4JI5T 2W62A 1YD8G 2WY2A 4B6XA 4EOZB 4KUMB 3O4XE 3PUVF 4QXHB 3AA6B 4AXPA 4DR4T 2W66A 4HE8A 4IHJE 4OYJA 4IDZA 1LVFA 1E7PA 2BS3A 4DUYT 4DR7T 1I6ZA 1OWAA 5AQRB 2XQ3A 3UT5E 4LF5T 4EXTA 1XZYA 4UV8B 4HFVA 3SFDA 4ZI3D 2RA1A 4CXYA 3F57A 3MXZA 3IA3A 5AQIB 2Y8DA 3IF8B 1FEWA 2C0SA 3IEEA 2CWYA 2XQYA 2ZLYA 3B57A 3CQXC 3FHNA 2CLYB 2NTXA 1MMDA 3BQKA 5LG4A 2RPAA 3ZC0A 5AFUL 5L3EB 3CQCB 3HA4A 5ABFA 5H6QB 4IL4A 4P0BA 5L2LA 4TUYE 2GK9A 5HEUA 4X62T 4DBRA 1IZNB 3VKGA 3N9LA 3ABVA 3CX6B 2EHOC 3N9PA 4H9OC 4U2YA 4X1IE 2CE7A 5FP3A 2DI4A 4TNVA 3RYIE 4CQIA 1HS7A 2QGSA 4BJMA 3ZT7A 4QX7B 3GA8A 4JI3T 3RKGA 2YDQA 4HTEA 2NR4A 3HKEE 1HCIA 2X9XA 3NZQA 4TWFA 1XMQT 1QLBA 4Z90A 4HWFA 3NVOA 2LSKA 4MALA 5LYJE 4LF7T 2VK9A 4HN9A 2WWVA 5FMNA 4WNKA 4DBQA 2Y48B 3UU6A 4KMCA 4DR2T 3AXJA 3ZT5A 4PK6A 4ILUA 5AQGB 5A1LA 1T72A 3W15B 1S94A 3SWHA 5C8YE 4H63V 3ZCIA 4HGAA 5M4YA 4EZHA 1U5PA 4UF0A 2NP9A 3ZCJA 4MBQA 2L9QA 3PE0A 4DR1T 3CQGB 2NTYA 4DVDA 2HHHT 3MKDA 3Q5EA 2V6YA 3TLTA 1W0AA 3IHRA 1BR4A 4DV3T 3KBTA 4UV9B 5LBMA 3F2EA 2XM2A 4MFRA 4QWNB 2WS3A 4JBWF 5DQWA 4K0UA 3LBXA 3Q2MA 5JVDE 3R6NA 2K9AA 5LP6E 4I50E 2NW9A 5L4EA 2D5UA 3P8CD 5JR9C 1UUSA 4V1Av 2EHOD 4ZI2C 4DUZT 1HX8A 3L3PA 1YKEB 4HWHA 1WR6A 2QVAA 4WBOA 5HXRA 2A72A 4BAYB 3H3MA 3I0OA 2MOZA 4TWHA 5HCJA 3AE4A 2WSSV 3LG7A 4IE4A 4HFCA 2ZM6T 1WRDA 2WMOA 3Q9DA 2V26A 1SUMB 4ZI3C 3UQ4A 2C5IT 3AAIA 3L8RA 5JRCA 1V9DA 1MIWA 2FJDA 1UX4A 5ABGA 1NAFA 2LOSA 2VVSA 2XHEB 3ZMTB 4NUVA 2OLTA 2YN6A 3CVRA 1M7KA 4CI2B 1IJ6A 3UTKA 5FVLA 2BKNA 2NOXA 2B1EA 3BQLA 3LBXB 2F4VT 3CMLA 1MMNA 3AB3B 3Q5XA 4LMKA 4U3CA 4WW0A 2UU9T 4LMJA 3F31A 4PFPA 3OTOT 1VCTA 2X68A 3VRAA 3PDYA 1W09A 1YXRA 1HNWT 1D0YA 2BDEA 4LMLA 3OPCA 4IDPA 2V7JA 2LSIA 2IAKA 4O8SA 1OEDE 4TNWA 4YFSA 3ZN1B 1GQEA 2IDOB 4TWDA 5LMUT 4DV0T 1MIVA 1VOMA 3NRXA 4JYAT 3ZN0B 5FKYA 5AQMB 4Q25A 4H63H 4YSYA 2LLYA 2ZMAA 1WLXA 4UIGA 2IIUA 2Q9QC 4XAXB 4J2CA 2W0GA 2Y6XA 2M6BA 4YJ2E 1MNEA 2HN1A 4JI8T 5EZYE 1HG2A 2XAHB 4GK0E 4IT4A 4DV6T 5L3DB 2E9XD 2MYSA 2X67A 3C50A 3CX7B 4KI0F 3AEGA 1UURA 2KNDA 3NRYA 1HFAA 2JQQA 4GYSA 4X5TA 1HTJF 3X1DA 2XQ6A 4ZXLA 4AQYT 2XSBA 4GYRA 4L9IA 4HFBA 5JDMA 2W63A 3BQIA 5KX5E 4JUYA 5L3BB 4U7YA 2XQ9A 2ZM0A 4G63A 2WCAA 4ISSA 4UXNB 2R6GF 5AQNB 5GONE 3KV5A 3RPUA 1IBLT 5HEJA 1WYBA 4PFOA 2A3DA 3MACA 3AE1A 3AE9A 1D0XA 4X1YE 3QOFA 4AI6A 1MMAA 2OV9A 5L4HA 4A56A 3EDUA 4JEUB 4U72A 2UUCT 1FMVA 4AQGA 3AEFA 3J9X1 4CN6A 4ZI7E 5HXSA 2DL1A 2FJAA 2K3WA 5AQQB 2V1DB 4LF9T 1US7B 5FXZA 2CHNA 3P7IA 2QA7A 3QNUA 3C98B 3EAMA 1L0VA 3WAKA 4K0KT 4GIWA 1J1JA 5LMNT 4L0RA 2H3RA 5J1GA 2XAQB 4ILBA 4PJJA 4U33A 2QYWA 3M3ZB 3UU8A 4UR9A 2IHR1 3VHLA 4QH4A 2CM0A 5CJ5A 4GKJT 2E9XA 4G2AA 2BG9C 1H7CA 4NXMT 1ZKEA 4Z8XA 2E5LT 4MHCA 3KV6A 2FUPA 2VL8A 2XY8B 4UEMA 3TLSA 5ADXL 5LHIB 3WAJA 3JAEA 5AQOB 1XWMA 1ZP0A 2G0UA 3NKZA 3K8PC 5EK4A 3PU3A 5LA6E 3CK6A 2IW5B 3RRCA 2CLYC 3K3OA 1EZ3A 2WQYA 4YY3T 4WZXA 2V7KA 4O4IE 3RYCE 5EK2A 3AA0B 3DP7A 3U78A 2C5KT 3T1HT 3CWZB 3RC8A 3UFEA 4N78D 2ZM8A 4PAGA 3SFEA 4I43B 4LFBT 2CMRA 5F8PA 3H37A 4EEDA 3JC6C 3LSVA 5FXWA 4YTPA 3ETUA 3R84B 3MZKB 4KX6A 5KXJA 3RHWA 2VKJA 2E8IA 2XQ8A 3A8YC 3C51A 3DJBA 2X0YA 3RKOA 2BS2A 4TN7B 5ABFB 1WR0A 4PK5A 4H9SE 4A97A 4DR6T 1LRZA 4CN1A 3AAAB 4YHJA 3RF1A 4IE6A 1KK7A 3JAFA 2J62A 5LBQB 4PJMA 1O3XA 2IMLA 2X9WA 2WAUA 4YTMA 3UU5A
chains in the Genus database with same CATH topology
4DV0T 4DUZT 1N34T 1IBKT 4GKKT 2ZM6T 1HNZT 1IBMT 2UXBT 4B3MT 1N33T 4OX9T 2VQET 1HR0T 2UUBT 2UUAT 4LFCT 4JI7T 4KHPT 5BR8T 2F4VT 4X66T 4JYAT 2UU9T 3OTOT 1HNWT 4DV1T 4DR3T 4B3ST 5LMUT 4DV2T 4LF4T 3T1YT 4X65T 4JI5T 4JI2T 4JI8T 4DV6T 1J5ET 4YHHT 4DR4T 2UXDT 4AQYT 4B3RT 4DUYT 4DR7T 4LF5T 1XNQT 1I94T 1IBLT 4JI4T 1XNRT 2VQFT 2UUCT 4JV5T 4LF9T 4X62T 4X64T 4K0KT 5LMNT 4DR5T 4GKJT 4JI3T 4B3TT 4NXMT 2E5LT 4LFAT 1XMQT 5IWAT 1HNXT 1XMOT 4LF7T 4DV4T 4NXNT 4YY3T 4DV5T 4DR2T 4JI1T 1N36T 3T1HT 2UXCT 4LFBT 4JI0T 4DR1T 1N32T 2HHHT 4JI6T 4LF8T 4DV3T 1FJGT 4DR6T 4DV7T 4LF6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 T;  4DUZ T;  1N34 T;  1IBK T;  4GKK T;  2ZM6 T;  1HNZ T;  1IBM T;  2UXB T;  4B3M T;  1N33 T;  4OX9 T;  2VQE T;  1HR0 T;  2UUB T;  2UUA T;  4LFC T;  4JI7 T;  4KHP T;  5BR8 T;  2F4V T;  4X66 T;  4JYA T;  2UU9 T;  3OTO T;  1HNW T;  4DV1 T;  4DR3 T;  4B3S T;  5LMU T;  4DV2 T;  4LF4 T;  3T1Y T;  4X65 T;  4JI5 T;  4JI2 T;  4JI8 T;  4DV6 T;  1J5E T;  4YHH T;  4DR4 T;  2UXD T;  4AQY T;  4B3R T;  4DUY T;  4DR7 T;  4LF5 T;  1XNQ T;  1I94 T;  1IBL T;  4JI4 T;  1XNR T;  2VQF T;  2UUC T;  4JV5 T;  4LF9 T;  4X62 T;  4X64 T;  4K0K T;  5LMN T;  4DR5 T;  4GKJ T;  4JI3 T;  4B3T T;  4NXM T;  2E5L T;  4LFA T;  1XMQ T;  5IWA T;  1HNX T;  1XMO T;  4LF7 T;  4DV4 T;  4NXN T;  4YY3 T;  4DV5 T;  4DR2 T;  4JI1 T;  1N36 T;  3T1H T;  2UXC T;  4LFB T;  4JI0 T;  4DR1 T;  1N32 T;  2HHH T;  4JI6 T;  4LF8 T;  4DV3 T;  1FJG T;  4DR6 T;  4DV7 T;  4LF6 T; 
#chains in the Genus database with same CATH topology
 2YDR A;  3ZYM A;  1IJ5 A;  3AEA A;  3U3I A;  3E08 A;  2LJL A;  3UU3 A;  3OVU A;  2PG8 A;  2WMN A;  5LGT B;  1N34 T;  3QC9 A;  5HYA A;  2XQ5 A;  2YIN A;  4PJN A;  3JCF A;  2D9D A;  3E0Z A;  2V5D A;  5EK3 A;  1FIO A;  1SHZ C;  3ZLI A;  4F8H A;  5JH7 E;  4P0A A;  2DNX A;  4JI1 T;  2LKG A;  2V7L A;  2BS4 A;  5DJQ C;  4U2Z A;  5LCY A;  2KLQ A;  4ANJ A;  1Y64 B;  3ZYL A;  2D2S A;  1FMW A;  1Z0P A;  2XQA A;  4HKA A;  1N33 T;  3C4Z A;  4IRE A;  3RYF E;  2VQE T;  1T8B A;  3VR9 A;  5IUX A;  1QUU A;  2W4X A;  2UUB T;  3ESL A;  3ONJ A;  2UUA T;  3CIR A;  2FJB A;  4CN4 A;  2WM9 A;  1YW0 A;  3EHZ A;  5FL0 A;  2E5V A;  4YJ3 E;  3AE6 A;  1WCR A;  2UXN B;  3FBZ A;  4GOU A;  2FJE A;  1OED A;  4BA9 A;  1KEY A;  3AE3 A;  3V5S A;  3C4X A;  3FZK B;  3HKC E;  2JIW A;  4IE7 A;  4I0U A;  2KIN B;  4KHZ F;  4B3S T;  2UXX B;  2C5J A;  2X9H A;  2ACZ A;  3LK4 2;  4O4H E;  4DV2 T;  2PJQ A;  4QXB B;  3B13 A;  2IC9 A;  4ZEY A;  1YQ3 A;  3T1Y T;  2W61 A;  1IAP A;  2VVN A;  4WYV A;  2I0M A;  2Z6E A;  2YDS A;  3P4R A;  4ZOL E;  1B7T A;  1OXZ A;  3EVY A;  4CZZ B;  4QX8 B;  2XJ7 A;  4AKR B;  1NEK A;  3PJA A;  5KMG P;  2BG9 B;  2JJ9 A;  4HFE A;  4IDQ A;  5FY7 A;  4JI2 T;  2JQH A;  3RGL A;  3RH3 A;  5AQF B;  2VL0 A;  3PUR A;  5L47 A;  5ABH A;  4YHH T;  3AXJ B;  5JRC B;  4EGW A;  2LKH A;  3P4W A;  4PNI A;  4ZZB A;  3I1A A;  2V7I A;  3UUB A;  3DTO A;  3FZL B;  3RX6 A;  4UVB B;  3ZYK A;  2JRK A;  2VB6 A;  4B3R T;  2D0U A;  3UUM A;  3AAE B;  5LB7 B;  1NEN A;  2CPT A;  3PUX F;  2X0L B;  3AA1 B;  3RIF A;  3TLV A;  2HH7 A;  2I6H A;  2XPK A;  4H9R C;  4HFI A;  4ZZC A;  1QSD A;  4XBF B;  3ONL C;  3AA7 B;  2V8S V;  4KBM B;  1UGO A;  1XNQ T;  4JI4 T;  2LM2 A;  1XNR T;  5J2T E;  2W2U A;  3GN5 B;  4X20 E;  5HEH A;  3L09 A;  5FXX A;  3I9W A;  3NBX X;  3ZMU B;  5CA0 E;  5LG3 A;  2ACX A;  4C90 A;  1G73 A;  4AQF C;  2VQF T;  3B5M A;  2M6I A;  3PUQ A;  2WZH A;  2YOE A;  4HWD A;  2N1G A;  4O2B E;  4YTN A;  2LOP A;  1OED B;  4AIS A;  2LE8 A;  1ZEE A;  3KFW X;  2LSG A;  3HKD E;  2XQ7 A;  4E7Z A;  4H9P C;  3P50 A;  2BBH A;  1CUN A;  4DMV A;  1KNP A;  4YT0 A;  1MMG A;  3KIN B;  3UUN A;  3SRZ A;  2PBI A;  3KV4 A;  2CBI A;  2WDV A;  4O4L E;  4DO0 A;  2YKS A;  2AE9 A;  5AQL B;  4B3T T;  2X66 A;  2BVM A;  3FZM B;  5LXT E;  5JRE A;  2WP9 A;  2EHO A;  5IWA T;  2MAW A;  2JMH A;  4ILC A;  3O1I A;  2CA5 A;  2I59 A;  5HXC A;  3ONX A;  4ADZ A;  2X9Y A;  2H88 A;  3ANW B;  3C4W A;  3ETV A;  3GMI A;  4O2A E;  2KT9 A;  2P9B A;  2IUB A;  5LJM A;  2CXD A;  4DND A;  2LEH A;  3K1S A;  2DLR A;  4DV4 T;  1ZHC A;  2MTQ A;  1LVK A;  1W9R A;  4UF0 B;  3ZSS A;  4ASK A;  3PUZ F;  2N2N A;  4FI5 A;  4DV5 T;  1N36 T;  3FXD B;  3N9M A;  3N5L A;  3ZST A;  2BVL A;  4GK5 E;  2VKH A;  3CX8 B;  2CHO A;  3UQ7 A;  2HPJ A;  2M67 A;  2WZI A;  4HFH A;  2UXC T;  3VKH A;  1ZV4 X;  3LJC A;  2ODU A;  2LT3 A;  4YLH A;  3PJA J;  4IIJ E;  1MND A;  5ETW A;  2NW7 A;  1N32 T;  4JEH B;  3ZMS B;  4L5G A;  3PUW F;  5DAB A;  2KWI B;  4H9Q C;  1X9B A;  4I55 E;  5L3C B;  5ABE A;  2XAG B;  3IBP A;  3PV0 F;  3K3N A;  2RP4 A;  1M62 A;  4NPP A;  3GWH A;  2Q9Q D;  2Q9Q B;  1J5W A;  2LHN A;  4EYU A;  3RRW A;  3MK7 C;  4DV7 T;  4IDO A;  2WWU A;  5HWY A;  2JQK A;  4TV8 E;  4OK0 A;  1HX1 B;  2VKD A;  2JQ9 A;  4PW8 A;  4AKI A;  2E9X B;  2J47 A;  3D0T A;  4GKK T;  2J1D G;  4PK4 A;  4CI3 B;  3FXE B;  2DHR A;  2AXD S;  3KVA A;  2Q9Q A;  2K5B B;  3OKQ A;  5LOV E;  3HKB E;  3UFG A;  4WBN E;  3MJX A;  2V7M A;  2K48 A;  3HL6 A;  3P4P A;  3P4S A;  3ZPO A;  3OJA A;  4IGU A;  4IL9 A;  3ZMZ B;  1HNZ T;  1IBM T;  3I0Q A;  3KV9 A;  4HWI B;  4B3M T;  3PUG A;  3AED A;  2NWB A;  1YKH B;  3BK9 A;  4TX5 A;  5CFB A;  2ZM2 A;  3FBL A;  3QB5 A;  3ZKR A;  3RLF F;  3SS1 A;  2XM1 A;  3EI0 A;  4LFC T;  4KHP T;  2YU2 A;  3FZH B;  5KDM C;  3CKD A;  1ZOY A;  5HEO A;  1Y01 A;  4C91 A;  4IE5 A;  1MIY A;  1T98 A;  4A98 A;  5CA1 E;  2CBJ A;  1LKX A;  3WI3 A;  3AE7 A;  2KWH A;  2PTF A;  3FB2 A;  5H6R B;  2E9X C;  3TLU A;  2YEV C;  2DCF A;  3VRB A;  4DV1 T;  4DR3 T;  3N2O A;  4IE0 A;  4NIQ A;  4AIU A;  4QH1 A;  2JPF A;  2N9D A;  2PFV A;  5E0O A;  4BJN A;  2VAS A;  4UVA B;  2V6Y B;  1SA0 E;  4TZ4 C;  1BR1 A;  4ZS3 A;  2L3L A;  5AQJ B;  5F5W A;  1KNZ A;  1R8I A;  2CCQ A;  4EAH A;  3KBU A;  3A5X A;  1UK5 A;  5HAX A;  4A5X A;  1KFY A;  5LGU B;  2W67 A;  2QRX A;  1D1C A;  5JDQ A;  2IC6 A;  3OYZ A;  4PJL A;  1J5E T;  3OYX A;  2FBW A;  4QKN A;  2CXF A;  2EHO B;  2XQ4 A;  5F3J A;  5JDG A;  1G8X A;  3LFM A;  2UXD T;  3HI2 A;  3HR0 A;  4EB6 E;  2CEA A;  5JQG E;  1HF8 A;  1BR2 A;  2BKO A;  1JNZ A;  5DQV A;  3SOL A;  5HXE A;  2CWO A;  2WDR A;  3M65 A;  3RIU C;  4EEB A;  2XAJ B;  2DWG A;  4YXD A;  4OYK A;  2KZ7 B;  3NWI A;  1I94 T;  2LSJ A;  2HN2 A;  5CGM A;  3V5U A;  5J2U E;  5FNV E;  3O1H A;  5FVK A;  2BKP A;  4ZI2 D;  4OFZ A;  5C3J A;  5JDN A;  2XUE A;  2L8K A;  3AE5 A;  5LJN A;  4AKH A;  4ILA A;  4JV5 T;  1YQ4 A;  1CHU A;  2LSY A;  5HXH A;  3ZJ1 A;  1X79 A;  3LDQ B;  4X64 T;  3N9N A;  4I4T E;  3RQW A;  2XAF B;  4HWC A;  2XSA A;  2CXL A;  3OBV E;  5AQU B;  4IST A;  4F6R C;  4YSZ A;  2BBJ A;  2BZB A;  5FY0 A;  3VR8 A;  4HFD A;  1D1B A;  1SE7 A;  1WYC A;  2LHR A;  3PUS A;  5JR9 A;  3S4U A;  3TLW A;  3ZJ2 A;  4DR5 T;  1HR0 T;  3Q5D A;  2ODV A;  2J4G A;  2YK0 A;  3L39 A;  4TV9 E;  3H3A A;  4U31 A;  4AKL A;  4HEA A;  4EV6 A;  3J7Y q;  2XTL A;  3PTR B;  4P1N A;  5JDL A;  3EDV A;  3PUA A;  4LFA T;  3FZF B;  4MLK A;  4EIW A;  1XDO A;  1KNR A;  1HNX T;  3KVB A;  3KDS E;  3RI5 A;  5HWX A;  1KF6 A;  2V5C A;  2WBL A;  5FYM A;  3ZEF B;  1XMO T;  1DU2 A;  1U4Q A;  4QH5 A;  1W0B A;  4QXC B;  4NXN T;  2KMF A;  3E22 E;  4O4J E;  4P09 A;  2E2A A;  3UU4 A;  3VU7 H;  3T8O A;  3ZMV B;  3Q5W A;  2WDQ A;  3MA9 A;  4U7I A;  3EAB A;  3AEE A;  3PU8 A;  3RIU A;  1NWM X;  3UUX B;  2H7V C;  4EYY R;  3AEC A;  1E1H B;  2VUR A;  3AE8 A;  4DID B;  2JMK A;  2WU5 A;  2K24 A;  5TAO A;  3RYH E;  4JI0 T;  1UCU A;  3UUL A;  5LHH B;  3AVR A;  2SPC A;  3TKL B;  3NZP A;  3QB5 K;  4COF A;  4YSX A;  4JI6 T;  4LF8 T;  5L3G B;  5IHY A;  3LK2 B;  3AEB A;  1OED C;  3O9X A;  4LF4 T;  4FJO A;  1FJG T;  3AE2 A;  5IYZ E;  3LK3 B;  2A2F X;  5FL1 A;  5JTG A;  1BR0 A;  3QK6 A;  2MBG A;  3O1J A;  3RQU A;  4CXW A;  3GN5 A;  3RC3 A;  4LF6 T;  5HCM A;  1D1A A;  4H9N C;  2BG9 E;  5AQV B;  1Z8U A;  3ZT6 A;  4DMW A;  2XAS B;  4EZ4 A;  2OA5 A;  5J0Z A;  2A9U A;  4QHO A;  1D0Z A;  3K3Q C;  1IBK T;  3I9Y A;  3CPZ A;  2X0H A;  5JR9 B;  5LGN B;  2NW8 A;  2VKO A;  3QUJ A;  3N2G E;  2V6X A;  3ANW A;  4IDN A;  2WB5 A;  5AQT B;  2KSR A;  3AVS A;  2MPK A;  4ZHQ E;  2LRL A;  1T7S A;  1E2A A;  5HEG A;  5AQK B;  4M1P A;  3RIA A;  4CI1 B;  2DWK A;  4UEL A;  4E7S A;  2UXB T;  4AQF A;  2H7O A;  2YU1 A;  5AQP B;  5BMV E;  5LHG B;  4OX9 T;  2KXP B;  2BG9 A;  4NUU A;  3ZC1 A;  4CXX A;  5JDF A;  3N9Q A;  3PUY F;  2W00 A;  3P4Q A;  4UVC B;  5AQH B;  4OHF A;  4JLE A;  5FXV A;  4X1K E;  4JI7 T;  1JNR A;  1WFD A;  2ES0 A;  2H89 A;  5BR8 T;  4X66 T;  5C2T A;  2HPL A;  4AKG A;  4ERR A;  1VRB A;  5LNK A;  2LM9 A;  5JDH A;  3EUH A;  1HG5 A;  1S35 A;  3G06 A;  4ZS2 A;  4Z91 A;  5L3F B;  5FY1 A;  2X51 A;  2D0T A;  2LRK A;  3C64 A;  4U74 A;  5CB4 E;  4KP3 C;  2WU2 A;  3N9O A;  3JAD A;  3JC6 D;  5AQS B;  2CRB A;  3A7M A;  1UX5 A;  2B76 A;  3N2K E;  1VCS A;  2VWA A;  2XZE A;  1AJ3 A;  1XDP A;  4X65 T;  4XZC A;  4JI5 T;  2W62 A;  1YD8 G;  2WY2 A;  4B6X A;  4EOZ B;  4KUM B;  3O4X E;  3PUV F;  4QXH B;  3AA6 B;  4AXP A;  4DR4 T;  2W66 A;  4HE8 A;  4IHJ E;  4OYJ A;  4IDZ A;  1LVF A;  1E7P A;  2BS3 A;  4DUY T;  4DR7 T;  1I6Z A;  1OWA A;  5AQR B;  2XQ3 A;  3UT5 E;  4LF5 T;  4EXT A;  1XZY A;  4UV8 B;  4HFV A;  3SFD A;  4ZI3 D;  2RA1 A;  4CXY A;  3F57 A;  3MXZ A;  3IA3 A;  5AQI B;  2Y8D A;  3IF8 B;  1FEW A;  2C0S A;  3IEE A;  2CWY A;  2XQY A;  2ZLY A;  3B57 A;  3CQX C;  3FHN A;  2CLY B;  2NTX A;  1MMD A;  3BQK A;  5LG4 A;  2RPA A;  3ZC0 A;  5AFU L;  5L3E B;  3CQC B;  3HA4 A;  5ABF A;  5H6Q B;  4IL4 A;  4P0B A;  5L2L A;  4TUY E;  2GK9 A;  5HEU A;  4X62 T;  4DBR A;  1IZN B;  3VKG A;  3N9L A;  3ABV A;  3CX6 B;  2EHO C;  3N9P A;  4H9O C;  4U2Y A;  4X1I E;  2CE7 A;  5FP3 A;  2DI4 A;  4TNV A;  3RYI E;  4CQI A;  1HS7 A;  2QGS A;  4BJM A;  3ZT7 A;  4QX7 B;  3GA8 A;  4JI3 T;  3RKG A;  2YDQ A;  4HTE A;  2NR4 A;  3HKE E;  1HCI A;  2X9X A;  3NZQ A;  4TWF A;  1XMQ T;  1QLB A;  4Z90 A;  4HWF A;  3NVO A;  2LSK A;  4MAL A;  5LYJ E;  4LF7 T;  2VK9 A;  4HN9 A;  2WWV A;  5FMN A;  4WNK A;  4DBQ A;  2Y48 B;  3UU6 A;  4KMC A;  4DR2 T;  3AXJ A;  3ZT5 A;  4PK6 A;  4ILU A;  5AQG B;  5A1L A;  1T72 A;  3W15 B;  1S94 A;  3SWH A;  5C8Y E;  4H63 V;  3ZCI A;  4HGA A;  5M4Y A;  4EZH A;  1U5P A;  4UF0 A;  2NP9 A;  3ZCJ A;  4MBQ A;  2L9Q A;  3PE0 A;  4DR1 T;  3CQG B;  2NTY A;  4DVD A;  2HHH T;  3MKD A;  3Q5E A;  2V6Y A;  3TLT A;  1W0A A;  3IHR A;  1BR4 A;  4DV3 T;  3KBT A;  4UV9 B;  5LBM A;  3F2E A;  2XM2 A;  4MFR A;  4QWN B;  2WS3 A;  4JBW F;  5DQW A;  4K0U A;  3LBX A;  3Q2M A;  5JVD E;  3R6N A;  2K9A A;  5LP6 E;  4I50 E;  2NW9 A;  5L4E A;  2D5U A;  3P8C D;  5JR9 C;  1UUS A;  4V1A v;  2EHO D;  4ZI2 C;  4DUZ T;  1HX8 A;  3L3P A;  1YKE B;  4HWH A;  1WR6 A;  2QVA A;  4WBO A;  5HXR A;  2A72 A;  4BAY B;  3H3M A;  3I0O A;  2MOZ A;  4TWH A;  5HCJ A;  3AE4 A;  2WSS V;  3LG7 A;  4IE4 A;  4HFC A;  2ZM6 T;  1WRD A;  2WMO A;  3Q9D A;  2V26 A;  1SUM B;  4ZI3 C;  3UQ4 A;  2C5I T;  3AAI A;  3L8R A;  5JRC A;  1V9D A;  1MIW A;  2FJD A;  1UX4 A;  5ABG A;  1NAF A;  2LOS A;  2VVS A;  2XHE B;  3ZMT B;  4NUV A;  2OLT A;  2YN6 A;  3CVR A;  1M7K A;  4CI2 B;  1IJ6 A;  3UTK A;  5FVL A;  2BKN A;  2NOX A;  2B1E A;  3BQL A;  3LBX B;  2F4V T;  3CML A;  1MMN A;  3AB3 B;  3Q5X A;  4LMK A;  4U3C A;  4WW0 A;  2UU9 T;  4LMJ A;  3F31 A;  4PFP A;  3OTO T;  1VCT A;  2X68 A;  3VRA A;  3PDY A;  1W09 A;  1YXR A;  1HNW T;  1D0Y A;  2BDE A;  4LML A;  3OPC A;  4IDP A;  2V7J A;  2LSI A;  2IAK A;  4O8S A;  1OED E;  4TNW A;  4YFS A;  3ZN1 B;  1GQE A;  2IDO B;  4TWD A;  5LMU T;  4DV0 T;  1MIV A;  1VOM A;  3NRX A;  4JYA T;  3ZN0 B;  5FKY A;  5AQM B;  4Q25 A;  4H63 H;  4YSY A;  2LLY A;  2ZMA A;  1WLX A;  4UIG A;  2IIU A;  2Q9Q C;  4XAX B;  4J2C A;  2W0G A;  2Y6X A;  2M6B A;  4YJ2 E;  1MNE A;  2HN1 A;  4JI8 T;  5EZY E;  1HG2 A;  2XAH B;  4GK0 E;  4IT4 A;  4DV6 T;  5L3D B;  2E9X D;  2MYS A;  2X67 A;  3C50 A;  3CX7 B;  4KI0 F;  3AEG A;  1UUR A;  2KND A;  3NRY A;  1HFA A;  2JQQ A;  4GYS A;  4X5T A;  1HTJ F;  3X1D A;  2XQ6 A;  4ZXL A;  4AQY T;  2XSB A;  4GYR A;  4L9I A;  4HFB A;  5JDM A;  2W63 A;  3BQI A;  5KX5 E;  4JUY A;  5L3B B;  4U7Y A;  2XQ9 A;  2ZM0 A;  4G63 A;  2WCA A;  4ISS A;  4UXN B;  2R6G F;  5AQN B;  5GON E;  3KV5 A;  3RPU A;  1IBL T;  5HEJ A;  1WYB A;  4PFO A;  2A3D A;  3MAC A;  3AE1 A;  3AE9 A;  1D0X A;  4X1Y E;  3QOF A;  4AI6 A;  1MMA A;  2OV9 A;  5L4H A;  4A56 A;  3EDU A;  4JEU B;  4U72 A;  2UUC T;  1FMV A;  4AQG A;  3AEF A;  3J9X 1;  4CN6 A;  4ZI7 E;  5HXS A;  2DL1 A;  2FJA A;  2K3W A;  5AQQ B;  2V1D B;  4LF9 T;  1US7 B;  5FXZ A;  2CHN A;  3P7I A;  2QA7 A;  3QNU A;  3C98 B;  3EAM A;  1L0V A;  3WAK A;  4K0K T;  4GIW A;  1J1J A;  5LMN T;  4L0R A;  2H3R A;  5J1G A;  2XAQ B;  4ILB A;  4PJJ A;  4U33 A;  2QYW A;  3M3Z B;  3UU8 A;  4UR9 A;  2IHR 1;  3VHL A;  4QH4 A;  2CM0 A;  5CJ5 A;  4GKJ T;  2E9X A;  4G2A A;  2BG9 C;  1H7C A;  4NXM T;  1ZKE A;  4Z8X A;  2E5L T;  4MHC A;  3KV6 A;  2FUP A;  2VL8 A;  2XY8 B;  4UEM A;  3TLS A;  5ADX L;  5LHI B;  3WAJ A;  3JAE A;  5AQO B;  1XWM A;  1ZP0 A;  2G0U A;  3NKZ A;  3K8P C;  5EK4 A;  3PU3 A;  5LA6 E;  3CK6 A;  2IW5 B;  3RRC A;  2CLY C;  3K3O A;  1EZ3 A;  2WQY A;  4YY3 T;  4WZX A;  2V7K A;  4O4I E;  3RYC E;  5EK2 A;  3AA0 B;  3DP7 A;  3U78 A;  2C5K T;  3T1H T;  3CWZ B;  3RC8 A;  3UFE A;  4N78 D;  2ZM8 A;  4PAG A;  3SFE A;  4I43 B;  4LFB T;  2CMR A;  5F8P A;  3H37 A;  4EED A;  3JC6 C;  3LSV A;  5FXW A;  4YTP A;  3ETU A;  3R84 B;  3MZK B;  4KX6 A;  5KXJ A;  3RHW A;  2VKJ A;  2E8I A;  2XQ8 A;  3A8Y C;  3C51 A;  3DJB A;  2X0Y A;  3RKO A;  2BS2 A;  4TN7 B;  5ABF B;  1WR0 A;  4PK5 A;  4H9S E;  4A97 A;  4DR6 T;  1LRZ A;  4CN1 A;  3AAA B;  4YHJ A;  3RF1 A;  4IE6 A;  1KK7 A;  3JAF A;  2J62 A;  5LBQ B;  4PJM A;  1O3X A;  2IML A;  2X9W A;  2WAU A;  4YTM A;  3UU5 A; 
#chains in the Genus database with same CATH homology
 4DV0 T;  4DUZ T;  1N34 T;  1IBK T;  4GKK T;  2ZM6 T;  1HNZ T;  1IBM T;  2UXB T;  4B3M T;  1N33 T;  4OX9 T;  2VQE T;  1HR0 T;  2UUB T;  2UUA T;  4LFC T;  4JI7 T;  4KHP T;  5BR8 T;  2F4V T;  4X66 T;  4JYA T;  2UU9 T;  3OTO T;  1HNW T;  4DV1 T;  4DR3 T;  4B3S T;  5LMU T;  4DV2 T;  4LF4 T;  3T1Y T;  4X65 T;  4JI5 T;  4JI2 T;  4JI8 T;  4DV6 T;  1J5E T;  4YHH T;  4DR4 T;  2UXD T;  4AQY T;  4B3R T;  4DUY T;  4DR7 T;  4LF5 T;  1XNQ T;  1I94 T;  1IBL T;  4JI4 T;  1XNR T;  2VQF T;  2UUC T;  4JV5 T;  4LF9 T;  4X62 T;  4X64 T;  4K0K T;  5LMN T;  4DR5 T;  4GKJ T;  4JI3 T;  4B3T T;  4NXM T;  2E5L T;  4LFA T;  1XMQ T;  5IWA T;  1HNX T;  1XMO T;  4LF7 T;  4DV4 T;  4NXN T;  4YY3 T;  4DV5 T;  4DR2 T;  4JI1 T;  1N36 T;  3T1H T;  2UXC T;  4LFB T;  4JI0 T;  4DR1 T;  1N32 T;  2HHH T;  4JI6 T;  4LF8 T;  4DV3 T;  1FJG T;  4DR6 T;  4DV7 T;  4LF6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...