4JYAT

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4jyaT00
5IWAT 4DV1T 4DV5T 1HNXT 2F4VT 4DV7T 1XMQT 4AQYT 4LF7T 4DR2T 4JI8T 4LF9T 1N34T 4DR5T 3OTOT 4JYAT 2UXCT 4DV2T 4X64T 1XNRT 2UUAT 1J5ET 3T1YT 5BR8T 2UXDT 2ZM6T 1IBLT 4B3MT 4JI1T 2HHHT 4LF5T 2VQET 2UUBT 1XMOT 1IBMT 4DR7T 4JI4T 1N32T 4DUZT 4YY3T 4X66T 4OX9T 4B3TT 4JI3T 2VQFT 1HNZT 1HNWT 4DV3T 4JI0T 4JV5T 4LF8T 4KHPT 4NXNT 4GKKT 5LMUT 4K0KT 2UUCT 2UXBT 1N36T 1FJGT 4DR6T 4X62T 4LF6T 1XNQT 4DR3T 4DV6T 4DV0T 1HR0T 4B3RT 4DUYT 4LFAT 5LMNT 4LFCT 4JI6T 4GKJT 4X65T 1I94T 4JI7T 4LF4T 4NXMT 4JI5T 4DR1T 2E5LT 4LFBT 1IBKT 4B3ST 4YHHT 3T1HT 4DR4T 4DV4T 2UU9T 1N33T 4JI2T
chains in the Genus database with same CATH superfamily
3ZMZB 3AEGA 4PFPA 1D1CA 1Z0PA 4DR2T 3UFGA 1YQ4A 2X0LB 2WDRA 5L2LA 2CBJA 2Q9QD 2LHRA 4YLHA 5JRCB 2MYSA 5J0ZA 3EVYA 2A72A 2IC9A 2IMLA 2DNXA 4M1PA 2D9DA 2V1DB 2E9XC 2B76A 3CKDA 2BG9C 5LGNB 3NWIA 5L4HA 3J9X1 1ZOYA 3AB3B 3LDQB 2V8SV 1WLXA 4MBQA 3CX8B 4C91A 3ETUA 3C98B 4CZZB 1AJ3A 1XNQT 3FXDB 3UTKA 4EAHA 3O9XA 1D0XA 4DV6T 5EZYE 3UUNA 5C8YE 2AXDS 3D0TA 2H7OA 2ZMAA 5HXCA 4TWDA 4TV9E 3SWHA 2VKJA 4X65T 5JVDE 2WWUA 4CN1A 2V7IA 4AKIA 4LFBT 1HX8A 1QSDA 3TLTA 3T1HT 1UK5A 1YQ3A 2XAJB 1WR0A 3ABVA 2WAUA 3UUBA 1CUNA 4JI8T 1N34T 1VOMA 4EEBA 4DR5T 2VL0A 4WYVA 3W15B 2K48A 2B1EA 4Z91A 5F8PA 5L3DB 5IUXA 1Y64B 2XQ8A 5ABFA 4TX5A 2UUAT 2BZBA 2CCQA 4IIJE 2I6HA 5H6RB 5AQQB 4ZS3A 3MJXA 4LF5T 4ZI3C 4ZI7E 3RHWA 2WU2A 2OLTA 1WYBA 4QHOA 3OYZA 3O4XE 2KSRA 2XQ3A 2JPFA 2V6YB 1UGOA 3R84B 4X66T 4O8SA 4OX9T 2WZIA 3ONJA 3FXEB 3K3NA 4YSYA 2VQFT 3PUVF 3GMIA 3O1JA 4ZZBA 2A3DA 2LM9A 5FNVE 2V26A 1YKHB 4X1IE 4DR3T 3ZCIA 3K3QC 3CX6B 5KDMC 3PE0A 4QX8B 1CHUA 3NZPA 4GIWA 4JEHB 5DQVA 2HPLA 2FBWA 4DR1T 2E5LT 5EK2A 2N9DA 3ZYKA 1OEDA 4B3ST 2WQYA 1MNEA 1IZNB 1JNRA 3ZPOA 4HFHA 2N1GA 5LBMA 1L0VA 4O2AE 2HH7A 2D2SA 3L8RA 3NKZA 1D0YA 5HWYA 3RLFF 5AQSB 3TLUA 3KV4A 4AXPA 4ZZCA 2IUBA 1OWAA 3ZJ1A 1HS7A 2E9XB 4PFOA 4F6RC 4QXHB 4OHFA 2BG9B 1KNZA 5JDGA 2CXDA 2LM2A 4EIWA 2QGSA 2CBIA 2CWYA 5HXRA 1FMVA 2XQ9A 5JH7E 2H7VC 3N9PA 4QH4A 1E1HB 5FY7A 5FXXA 2CHNA 2WY2A 5LG4A 2NTYA 2DI4A 4HWCA 1X9BA 1OEDC 4UF0A 3VRAA 1W09A 2W67A 3MA9A 3ZSTA 3RKGA 4AQFA 3J7Yq 5AQVB 2IHR1 4IREA 3H3AA 4PK4A 2XASB 1ZP0A 2YU2A 4KHZF 2XQ7A 3Q5EA 4IGUA 2BBHA 1D0ZA 2AE9A 3Q5XA 2G0UA 5AQPB 3UU5A 4LFCT 3HKEE 3AVSA 2XQYA 3SS1A 4E7SA 2KXPB 3PUWF 4GYSA 4H9QC 3I9YA 2J4GA 3RRCA 1N33T 4JI2T 4DIDB 4DV1T 4ZXLA 4CXXA 3I1AA 3UU3A 2XAFB 5A1LA 2QA7A 4QWNB 2KT9A 3SOLA 3AE5A 1W0AA 4AQFC 2XM2A 3NRYA 1ZKEA 2W66A 1KNRA 5L3CB 2XJ7A 4CI3B 1BR0A 2LRLA 4CI2B 2NOXA 2L3LA 3AEAA 2UUBT 2YEVC 4ZHQE 5AFUL 4H63V 5L4EA 2KNDA 4YHJA 2CEAA 3MK7C 4HGAA 4EZ4A 3PUXF 4QH5A 3E08A 2JRKA 2WMOA 4KP3C 4COFA 2XSAA 5ABFB 2UUCT 2LKHA 4OYJA 4DR6T 2ODVA 1HF8A 1BR1A 3IA3A 3UUMA 1HR0T 4FJOA 4L5GA 4MALA 4OFZA 4DVDA 3O1IA 1MIVA 3VR8A 4WBOA 4HWFA 4O4IE 3MXZA 4IHJE 4IDOA 4H9RC 2YDRA 4QH1A 3CQCB 1GQEA 3JAFA 4P0BA 3VHLA 4UVCB 3ZMSB 4DV5T 2M67A 2LJLA 5LGUB 2V5DA 2D5UA 4DBRA 5AQLB 3FBZA 1G73A 2WDVA 2C0SA 5HEJA 4IE6A 3RRWA 3Q2MA 2KWIB 2BS2A 1JNZA 3T1YT 3NRXA 3FZHB 2H89A 3A5XA 3A8YC 1OEDB 2VKDA 4PNIA 5L47A 5LA6E 5J2TE 3GA8A 2MOZA 3A7MA 3N9MA 5FVKA 5HXSA 2PBIA 3PUGA 2I0MA 3PDYA 2VKOA 3HL6A 4LF8T 3ONLC 4B6XA 3NZQA 3AVRA 1MNDA 3P8CD 2H3RA 3OBVE 3PU3A 4E7ZA 4X62T 3CPZA 4U33A 5C3JA 5AQJB 3ZMUB 4AKRB 5BMVE 2JJ9A 1I94T 2BS4A 3QK6A 5AQTB 2UXNB 2XTLA 4UF0B 3PJAJ 3U78A 4P1NA 3M3ZB 3QUJA 5HEGA 3PUAA 1VRBA 2CXLA 1T98A 2DHRA 2BKPA 2ZLYA 3IF8B 5ABGA 2XZEA 3WI3A 2M6BA 4NUVA 3AAAB 3LSVA 1V9DA 2BVMA 2PFVA 4MFRA 2CM0A 3ZJ2A 2PJQA 5JREA 3KV5A 3ZMVB 2WCAA 4QXBB 4UV8B 3Q5WA 5LHHB 1YW0A 2LHNA 1MIYA 4X1YE 3C51A 3PJAA 4PW8A 5CGMA 5HYAA 4JI0T 2J1DG 5GONE 3CQGB 3H3MA 2FJBA 5LBQB 3AEEA 2J62A 3ZN0B 3LK3B 2VURA 3PTRB 2YKSA 4IL4A 4DV0T 5FXVA 2X68A 2VKHA 3P50A 3AA1B 4TWHA 1KNPA 3DTOA 1XDOA 4GKJT 4ERRA 2FJAA 4GK5E 5HEUA 3B13A 3KINB 2UU9T 1VCSA 5LCYA 5JQGE 5IWAT 3TLSA 5CFBA 1QUUA 1XMQT 4KI0F 5ABEA 3KVBA 5HXHA 4AISA 4JYAT 1U4QA 2ODUA 3LBXA 4AIUA 2OA5A 4IT4A 4EEDA 4ISTA 3UU4A 5BR8T 1T8BA 4JUYA 2L8KA 4A56A 4U3CA 3KVAA 2W61A 3UQ4A 1VCTA 5DABA 3K1SA 4CI1B 4X1KE 3IBPA 2Y48B 2LSYA 4WZXA 5LHGB 1T7SA 4PK6A 2KMFA 2JQKA 4U31A 3EUHA 4GKKT 1NEKA 3ANWA 1BR4A 3L39A 4U72A 1XZYA 2Q9QB 2W63A 4OYKA 3RQUA 2LEHA 3ZSSA 5HXEA 1E2AA 2V7JA 4B3RT 2HN1A 4KMCA 3C4WA 2BKOA 5IHYA 3AEBA 3JAEA 1FMWA 1HTJF 4U7IA 2MPKA 4H9NC 2J47A 2YDQA 2LE8A 3MZKB 1E7PA 3BK9A 4EB6E 4GK0E 3E0ZA 3P4QA 2XHEB 4UXNB 2F4VT 1I6ZA 5E0OA 3ZC1A 4AQYT 1NENA 1SE7A 2BS3A 3DJBA 2X9YA 5JDFA 4UVBB 2HN2A 4O2BE 2V6XA 1H7CA 4DBQA 1FIOA 5J2UE 3EDVA 4GOUA 2VL8A 3RIAA 5HEOA 2ACZA 1B7TA 3N2GE 5FYMA 2DWGA 2EHOA 3ZT7A 2NW8A 3QB5K 1NAFA 2VASA 4HWDA 1Z8UA 5AQRB 4BJMA 1HFAA 5CA1E 4YSZA 4BA9A 2FUPA 4XZCA 3ONXA 3VR9A 4A98A 4DNDA 2X9WA 4AQGA 4A5XA 3RKOA 2YN6A 3P7IA 5JDNA 3N9OA 4XAXB 4LF4T 4NXMT 3AA6B 2E2AA 2M6IA 3N2KE 3AE9A 4J2CA 2ES0A 4LMLA 5FL1A 2NR4A 2EHOC 4LF7T 3AE1A 2W0GA 4PJMA 2SPCA 4DMVA 2CWOA 4NIQA 2IIUA 2BVLA 3OTOT 2VK9A 3CK6A 4YSXA 4JBWF 2WZHA 3LJCA 4HWHA 2LSJA 3PUQA 1KEYA 4MLKA 4ZOLE 3LK2B 2HHHT 5KXJA 3I9WA 4I50E 2NW7A 4H9SE 2LOSA 3ZYLA 3ETVA 3OYXA 3ZLIA 4JI4T 3KV9A 4KUMB 2X67A 4HEAA 4TNVA 4K0UA 2LLYA 3PURA 2W4XA 1M62A 3LBXB 5HAXA 2WS3A 1SUMB 3UULA 4X5TA 2LSGA 3HI2A 2H88A 4ADZA 5CJ5A 2EHOD 2OV9A 4IDZA 4H9PC 2L9QA 4CXWA 2LSIA 2ZM0A 4ILAA 2JMHA 4YTPA 3P4SA 3UUXB 4UELA 4PAGA 4IE7A 3BQIA 1IBKT 3KV6A 1S94A 1O3XA 3P4RA 5L3BB 3JC6D 4IL9A 3TKLB 3I0QA 4LMKA 3UQ7A 1US7B 3AAIA 3QC9A 2VVNA 4MHCA 1U5PA 4AKLA 3AE2A 2R6GF 1KK7A 2RPAA 2A2FX 3CVRA 4HFDA 1IBLT 4U7YA 5CB4E 1MMAA 4Q25A 2MTQA 1IBMT 2X0YA 4I4TE 3AA0B 3B5MA 3EI0A 2YDSA 5FVLA 5AQIB 2IAKA 3RPUA 4ZI2D 4ZS2A 1HG5A 3I0OA 3OKQA 4JI7T 3Q5DA 2EHOB 4HFEA 3R6NA 2CMRA 3JCFA 3LK42 3N9NA 1J5WA 5AQNB 2JMKA 3SFEA 1UX4A 4DV4T 4O4HE 3GN5A 2Y8DA 4V1Av 5J1GA 4YJ2E 4U2ZA 2WSSV 2E8IA 2XAHB 3UU8A 2X66A 3QOFA 2GK9A 2V7MA 3RF1A 1Y01A 2W00A 3ZKRA 3RH3A 4QX7B 1BR2A 4L9IA 1WR6A 4UVAB 4BAYB 5LNKA 3P4PA 2WWVA 2ZM6T 3AXJA 1OXZA 4X20E 3QB5A 5FMNA 2KWHA 2RP4A 3RI5A 4LMJA 3EAMA 2V5CA 3IEEA 2X51A 4DUZT 1YXRA 4HFIA 3T8OA 2XQ6A 4B3TT 1HNWT 2X9XA 2CLYC 4KHPT 5FXWA 2WBLA 4AKGA 2CXFA 1LRZA 3F31A 3NVOA 2KINB 2BG9A 3N5LA 2CA5A 3ZN1B 4P09A 3SFDA 4DMWA 3RQWA 3X1DA 1W0BA 3OJAA 3UU6A 3F57A 1QLBA 3RIFA 5LXTE 4I0UA 2V7KA 3BQLA 3RYCE 4TZ4C 5DQWA 2FJEA 3EHZA 5LP6E 4TWFA 2N2NA 5CA0E 2DCFA 2XY8B 2NWBA 1D1AA 4N78D 3HKCE 3HKBE 2UXXB 5LJNA 1XWMA 1MMDA 4WBNE 4X64T 5LG3A 1DU2A 4EXTA 2UXDT 3U3IA 5AQGB 4PJJA 2QVAA 4I43B 3RIUA 5HWXA 3H37A 2CHOA 3ZT5A 1KF6A 4YT0A 3TLWA 1XDPA 3PUYF 1N32T 5FP3A 3S4UA 2W2UA 3BQKA 4YJ3E 3CIRA 4AI6A 5HCMA 4XBFB 4O4JE 4EZHA 2XM1A 3FZMB 3RYIE 3PUSA 4LF6T 3AE3A 4P0AA 3CWZB 2NW9A 5F5WA 2FJDA 1IAPA 3G06A 3RYFE 1IJ5A 3RGLA 2E9XD 2DLRA 5F3JA 2VB6A 2JQQA 5JTGA 4PJNA 4PK5A 3KBUA 4HFCA 3RIUC 3AECA 2LOPA 4KBMB 1WYCA 3AEDA 4IE0A 1MMNA 1HNXT 5AQOB 2XQ5A 4KX6A 4LF9T 2JIWA 1IJ6A 2BBJA 1MMGA 2D0UA 4TNWA 3ZEFB 4EOZB 1YD8G 4TN7B 3ZMTB 5AQUB 3CQXC 5FXZA 2LSKA 2NTXA 2CPTA 1MIWA 2LKGA 2CLYB 2A9UA 5HCJA 3ZT6A 5H6QB 3GN5B 5JR9A 1FEWA 3RC3A 5LB7B 4WNKA 4Z8XA 3UT5E 4FI5A 4EGWA 2PG8A 4JI3T 5HEHA 2QYWA 5ABHA 4DV3T 4NXNT 1D1BA 1N36T 1FJGT 2K24A 4TUYE 3QNUA 2YK0A 4ILUA 4ILBA 3AXJB 2CE7A 4ZI3D 4DUYT 4LFAT 2K5BB 5M4YA 5LMNT 5TAOA 1ZHCA 3EDUA 5JDHA 3PV0F 2WU5A 5FL0A 4EYYR 4BJNA 3LFMA 4CQIA 2XAGB 2XQ4A 5JR9C 1T72A 3CX7B 3FHNA 2KZ7B 2YU1A 3VRBA 2D0TA 4HFBA 3WAKA 3AE4A 3ESLA 5JDQA 1NWMX 4NUUA 3NBXX 4I55E 2WB5A 1J5ET 3ZC0A 3IHRA 2ZM8A 4JI1T 4YXDA 5ETWA 3C4XA 2XUEA 2XSBA 3FB2A 3FZKB 5EK4A 4DO0A 2X9HA 4YY3T 2K3WA 3RC8A 1UURA 1WRDA 3MACA 5C2TA 1UX5A 2WDQA 4HTEA 3RX6A 1UCUA 4K0KT 3MKDA 3AE6A 3Q9DA 2C5JA 3M65A 5KMGP 3JC6C 5LOVE 2IW5B 3V5UA 4ANJA 1X79A 3OPCA 4F8HA 1HG2A 2BG9E 2IDOB 1YKEB 4HN9A 5FY0A 3VU7H 1S35A 4JI6T 4HE8A 5FY1A 2Y6XA 5JRCA 2DL1A 4U74A 5ADXL 4NPPA 2DWKA 1WCRA 5EK3A 3AE8A 4HFVA 4JLEA 2YOEA 3SRZA 5JDLA 3N2OA 4QXCB 4C90A 1HX1B 2X0HA 5KX5E 2CRBA 5L3EB 2ACXA 3B57A 2W62A 1LVFA 3K8PC 1R8IA 4U2YA 3JADA 2C5IT 1EZ3A 3HKDE 2BDEA 4YFSA 5LHIB 2P9BA 4GYRA 3ANWB 1XNRT 2XAQB 1UUSA 2VWAA 3AAEB 4HKAA 5L3FB 4YTMA 4ZI2C 4IE4A 2VQET 4OK0A 3FZFB 5JDMA 4EV6A 5AQKB 2RA1A 1LKXA 3ZCJA 3C4ZA 2BKNA 4CN6A 4DR7T 1J1JA 3AA7B 5AQHB 3C50A 3OVUA 1HNZT 4A97A 1WFDA 3L09A 5LMUT 4L0RA 3RYHE 2QRXA 3LG7A 2UXBT 1HCIA 2VVSA 5L3GB 2LT3A 1M7KA 4EYUA 2K9AA 4AKHA 3P4WA 2C5KT 3VKGA 3O1HA 3UFEA 4ISSA 4QKNA 4O4LE 4IDQA 3FBLA 1SA0E 2PTFA 4JEUB 4ILCA 2JQ9A 2WM9A 5JR9B 3N9LA 2Z6EA 3C64A 4JI5T 2E5VA 4IDNA 4UIGA 3KBTA 3E22E 3PU8A 3GWHA 2I59A 3N9QA 4UV9B 2Q9QA 3DP7A 5LJMA 2WMNA 4TV8E 2WP9A 4DV7T 2LRKA 4CN4A 2V6YA 1KFYA 4G63A 5LGTB 3F2EA 4H9OC 5DJQC 2XQAA 5AQMB 2UXCT 1G8XA 4DV2T 1W9RA 4UR9A 2IC6A 4CXYA 3WAJA 2V7LA 4B3MT 5FKYA 3AE7A 4ASKA 1XMOT 2NP9A 4WW0A 5AQFB 3FZLB 4IDPA 1SHZC 3TLVA 4JV5T 2Q9QC 2XPKA 4YTNA 3HA4A 1LVKA 3EABA 4ZEYA 3KDSE 3V5SA 2HPJA 4H63H 3CMLA 3KFWX 1OEDE 4Z90A 4PJLA 3PUZF 1ZEEA 2MAWA 4G2AA 2E9XA 4HWIB 3L3PA 3AEFA 3K3OA 1ZV4X 4UEMA 2KLQA 5IYZE 2MBGA 4YHHT 5LYJE 4DR4T 3VKHA 2ZM2A 4IE5A 2JQHA 2YINA 3HR0A 3ZYMA
chains in the Genus database with same CATH topology
5IWAT 4DV1T 4DV5T 1HNXT 2F4VT 4DV7T 1XMQT 4AQYT 4LF7T 4DR2T 4JI8T 4LF9T 1N34T 4DR5T 3OTOT 4JYAT 2UXCT 4DV2T 4X64T 1XNRT 2UUAT 1J5ET 3T1YT 5BR8T 2UXDT 2ZM6T 1IBLT 4B3MT 4JI1T 2HHHT 4LF5T 2VQET 2UUBT 1XMOT 1IBMT 4DR7T 4JI4T 1N32T 4DUZT 4YY3T 4X66T 4OX9T 4B3TT 4JI3T 2VQFT 1HNZT 1HNWT 4DV3T 4JI0T 4JV5T 4LF8T 4KHPT 4NXNT 4GKKT 5LMUT 4K0KT 2UUCT 2UXBT 1N36T 1FJGT 4DR6T 4X62T 4LF6T 1XNQT 4DR3T 4DV6T 4DV0T 1HR0T 4B3RT 4DUYT 4LFAT 5LMNT 4LFCT 4JI6T 4GKJT 4X65T 1I94T 4JI7T 4LF4T 4NXMT 4JI5T 4DR1T 2E5LT 4LFBT 1IBKT 4B3ST 4YHHT 3T1HT 4DR4T 4DV4T 2UU9T 1N33T 4JI2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA T;  4DV1 T;  4DV5 T;  1HNX T;  2F4V T;  4DV7 T;  1XMQ T;  4AQY T;  4LF7 T;  4DR2 T;  4JI8 T;  4LF9 T;  1N34 T;  4DR5 T;  3OTO T;  4JYA T;  2UXC T;  4DV2 T;  4X64 T;  1XNR T;  2UUA T;  1J5E T;  3T1Y T;  5BR8 T;  2UXD T;  2ZM6 T;  1IBL T;  4B3M T;  4JI1 T;  2HHH T;  4LF5 T;  2VQE T;  2UUB T;  1XMO T;  1IBM T;  4DR7 T;  4JI4 T;  1N32 T;  4DUZ T;  4YY3 T;  4X66 T;  4OX9 T;  4B3T T;  4JI3 T;  2VQF T;  1HNZ T;  1HNW T;  4DV3 T;  4JI0 T;  4JV5 T;  4LF8 T;  4KHP T;  4NXN T;  4GKK T;  5LMU T;  4K0K T;  2UUC T;  2UXB T;  1N36 T;  1FJG T;  4DR6 T;  4X62 T;  4LF6 T;  1XNQ T;  4DR3 T;  4DV6 T;  4DV0 T;  1HR0 T;  4B3R T;  4DUY T;  4LFA T;  5LMN T;  4LFC T;  4JI6 T;  4GKJ T;  4X65 T;  1I94 T;  4JI7 T;  4LF4 T;  4NXM T;  4JI5 T;  4DR1 T;  2E5L T;  4LFB T;  1IBK T;  4B3S T;  4YHH T;  3T1H T;  4DR4 T;  4DV4 T;  2UU9 T;  1N33 T;  4JI2 T; 
#chains in the Genus database with same CATH topology
 3ZMZ B;  3AEG A;  4PFP A;  1D1C A;  1Z0P A;  4DR2 T;  3UFG A;  1YQ4 A;  2X0L B;  2WDR A;  5L2L A;  2CBJ A;  2Q9Q D;  2LHR A;  4YLH A;  5JRC B;  2MYS A;  5J0Z A;  3EVY A;  2A72 A;  2IC9 A;  2IML A;  2DNX A;  4M1P A;  2D9D A;  2V1D B;  2E9X C;  2B76 A;  3CKD A;  2BG9 C;  5LGN B;  3NWI A;  5L4H A;  3J9X 1;  1ZOY A;  3AB3 B;  3LDQ B;  2V8S V;  1WLX A;  4MBQ A;  3CX8 B;  4C91 A;  3ETU A;  3C98 B;  4CZZ B;  1AJ3 A;  1XNQ T;  3FXD B;  3UTK A;  4EAH A;  3O9X A;  1D0X A;  4DV6 T;  5EZY E;  3UUN A;  5C8Y E;  2AXD S;  3D0T A;  2H7O A;  2ZMA A;  5HXC A;  4TWD A;  4TV9 E;  3SWH A;  2VKJ A;  4X65 T;  5JVD E;  2WWU A;  4CN1 A;  2V7I A;  4AKI A;  4LFB T;  1HX8 A;  1QSD A;  3TLT A;  3T1H T;  1UK5 A;  1YQ3 A;  2XAJ B;  1WR0 A;  3ABV A;  2WAU A;  3UUB A;  1CUN A;  4JI8 T;  1N34 T;  1VOM A;  4EEB A;  4DR5 T;  2VL0 A;  4WYV A;  3W15 B;  2K48 A;  2B1E A;  4Z91 A;  5F8P A;  5L3D B;  5IUX A;  1Y64 B;  2XQ8 A;  5ABF A;  4TX5 A;  2UUA T;  2BZB A;  2CCQ A;  4IIJ E;  2I6H A;  5H6R B;  5AQQ B;  4ZS3 A;  3MJX A;  4LF5 T;  4ZI3 C;  4ZI7 E;  3RHW A;  2WU2 A;  2OLT A;  1WYB A;  4QHO A;  3OYZ A;  3O4X E;  2KSR A;  2XQ3 A;  2JPF A;  2V6Y B;  1UGO A;  3R84 B;  4X66 T;  4O8S A;  4OX9 T;  2WZI A;  3ONJ A;  3FXE B;  3K3N A;  4YSY A;  2VQF T;  3PUV F;  3GMI A;  3O1J A;  4ZZB A;  2A3D A;  2LM9 A;  5FNV E;  2V26 A;  1YKH B;  4X1I E;  4DR3 T;  3ZCI A;  3K3Q C;  3CX6 B;  5KDM C;  3PE0 A;  4QX8 B;  1CHU A;  3NZP A;  4GIW A;  4JEH B;  5DQV A;  2HPL A;  2FBW A;  4DR1 T;  2E5L T;  5EK2 A;  2N9D A;  3ZYK A;  1OED A;  4B3S T;  2WQY A;  1MNE A;  1IZN B;  1JNR A;  3ZPO A;  4HFH A;  2N1G A;  5LBM A;  1L0V A;  4O2A E;  2HH7 A;  2D2S A;  3L8R A;  3NKZ A;  1D0Y A;  5HWY A;  3RLF F;  5AQS B;  3TLU A;  3KV4 A;  4AXP A;  4ZZC A;  2IUB A;  1OWA A;  3ZJ1 A;  1HS7 A;  2E9X B;  4PFO A;  4F6R C;  4QXH B;  4OHF A;  2BG9 B;  1KNZ A;  5JDG A;  2CXD A;  2LM2 A;  4EIW A;  2QGS A;  2CBI A;  2CWY A;  5HXR A;  1FMV A;  2XQ9 A;  5JH7 E;  2H7V C;  3N9P A;  4QH4 A;  1E1H B;  5FY7 A;  5FXX A;  2CHN A;  2WY2 A;  5LG4 A;  2NTY A;  2DI4 A;  4HWC A;  1X9B A;  1OED C;  4UF0 A;  3VRA A;  1W09 A;  2W67 A;  3MA9 A;  3ZST A;  3RKG A;  4AQF A;  3J7Y q;  5AQV B;  2IHR 1;  4IRE A;  3H3A A;  4PK4 A;  2XAS B;  1ZP0 A;  2YU2 A;  4KHZ F;  2XQ7 A;  3Q5E A;  4IGU A;  2BBH A;  1D0Z A;  2AE9 A;  3Q5X A;  2G0U A;  5AQP B;  3UU5 A;  4LFC T;  3HKE E;  3AVS A;  2XQY A;  3SS1 A;  4E7S A;  2KXP B;  3PUW F;  4GYS A;  4H9Q C;  3I9Y A;  2J4G A;  3RRC A;  1N33 T;  4JI2 T;  4DID B;  4DV1 T;  4ZXL A;  4CXX A;  3I1A A;  3UU3 A;  2XAF B;  5A1L A;  2QA7 A;  4QWN B;  2KT9 A;  3SOL A;  3AE5 A;  1W0A A;  4AQF C;  2XM2 A;  3NRY A;  1ZKE A;  2W66 A;  1KNR A;  5L3C B;  2XJ7 A;  4CI3 B;  1BR0 A;  2LRL A;  4CI2 B;  2NOX A;  2L3L A;  3AEA A;  2UUB T;  2YEV C;  4ZHQ E;  5AFU L;  4H63 V;  5L4E A;  2KND A;  4YHJ A;  2CEA A;  3MK7 C;  4HGA A;  4EZ4 A;  3PUX F;  4QH5 A;  3E08 A;  2JRK A;  2WMO A;  4KP3 C;  4COF A;  2XSA A;  5ABF B;  2UUC T;  2LKH A;  4OYJ A;  4DR6 T;  2ODV A;  1HF8 A;  1BR1 A;  3IA3 A;  3UUM A;  1HR0 T;  4FJO A;  4L5G A;  4MAL A;  4OFZ A;  4DVD A;  3O1I A;  1MIV A;  3VR8 A;  4WBO A;  4HWF A;  4O4I E;  3MXZ A;  4IHJ E;  4IDO A;  4H9R C;  2YDR A;  4QH1 A;  3CQC B;  1GQE A;  3JAF A;  4P0B A;  3VHL A;  4UVC B;  3ZMS B;  4DV5 T;  2M67 A;  2LJL A;  5LGU B;  2V5D A;  2D5U A;  4DBR A;  5AQL B;  3FBZ A;  1G73 A;  2WDV A;  2C0S A;  5HEJ A;  4IE6 A;  3RRW A;  3Q2M A;  2KWI B;  2BS2 A;  1JNZ A;  3T1Y T;  3NRX A;  3FZH B;  2H89 A;  3A5X A;  3A8Y C;  1OED B;  2VKD A;  4PNI A;  5L47 A;  5LA6 E;  5J2T E;  3GA8 A;  2MOZ A;  3A7M A;  3N9M A;  5FVK A;  5HXS A;  2PBI A;  3PUG A;  2I0M A;  3PDY A;  2VKO A;  3HL6 A;  4LF8 T;  3ONL C;  4B6X A;  3NZQ A;  3AVR A;  1MND A;  3P8C D;  2H3R A;  3OBV E;  3PU3 A;  4E7Z A;  4X62 T;  3CPZ A;  4U33 A;  5C3J A;  5AQJ B;  3ZMU B;  4AKR B;  5BMV E;  2JJ9 A;  1I94 T;  2BS4 A;  3QK6 A;  5AQT B;  2UXN B;  2XTL A;  4UF0 B;  3PJA J;  3U78 A;  4P1N A;  3M3Z B;  3QUJ A;  5HEG A;  3PUA A;  1VRB A;  2CXL A;  1T98 A;  2DHR A;  2BKP A;  2ZLY A;  3IF8 B;  5ABG A;  2XZE A;  3WI3 A;  2M6B A;  4NUV A;  3AAA B;  3LSV A;  1V9D A;  2BVM A;  2PFV A;  4MFR A;  2CM0 A;  3ZJ2 A;  2PJQ A;  5JRE A;  3KV5 A;  3ZMV B;  2WCA A;  4QXB B;  4UV8 B;  3Q5W A;  5LHH B;  1YW0 A;  2LHN A;  1MIY A;  4X1Y E;  3C51 A;  3PJA A;  4PW8 A;  5CGM A;  5HYA A;  4JI0 T;  2J1D G;  5GON E;  3CQG B;  3H3M A;  2FJB A;  5LBQ B;  3AEE A;  2J62 A;  3ZN0 B;  3LK3 B;  2VUR A;  3PTR B;  2YKS A;  4IL4 A;  4DV0 T;  5FXV A;  2X68 A;  2VKH A;  3P50 A;  3AA1 B;  4TWH A;  1KNP A;  3DTO A;  1XDO A;  4GKJ T;  4ERR A;  2FJA A;  4GK5 E;  5HEU A;  3B13 A;  3KIN B;  2UU9 T;  1VCS A;  5LCY A;  5JQG E;  5IWA T;  3TLS A;  5CFB A;  1QUU A;  1XMQ T;  4KI0 F;  5ABE A;  3KVB A;  5HXH A;  4AIS A;  4JYA T;  1U4Q A;  2ODU A;  3LBX A;  4AIU A;  2OA5 A;  4IT4 A;  4EED A;  4IST A;  3UU4 A;  5BR8 T;  1T8B A;  4JUY A;  2L8K A;  4A56 A;  4U3C A;  3KVA A;  2W61 A;  3UQ4 A;  1VCT A;  5DAB A;  3K1S A;  4CI1 B;  4X1K E;  3IBP A;  2Y48 B;  2LSY A;  4WZX A;  5LHG B;  1T7S A;  4PK6 A;  2KMF A;  2JQK A;  4U31 A;  3EUH A;  4GKK T;  1NEK A;  3ANW A;  1BR4 A;  3L39 A;  4U72 A;  1XZY A;  2Q9Q B;  2W63 A;  4OYK A;  3RQU A;  2LEH A;  3ZSS A;  5HXE A;  1E2A A;  2V7J A;  4B3R T;  2HN1 A;  4KMC A;  3C4W A;  2BKO A;  5IHY A;  3AEB A;  3JAE A;  1FMW A;  1HTJ F;  4U7I A;  2MPK A;  4H9N C;  2J47 A;  2YDQ A;  2LE8 A;  3MZK B;  1E7P A;  3BK9 A;  4EB6 E;  4GK0 E;  3E0Z A;  3P4Q A;  2XHE B;  4UXN B;  2F4V T;  1I6Z A;  5E0O A;  3ZC1 A;  4AQY T;  1NEN A;  1SE7 A;  2BS3 A;  3DJB A;  2X9Y A;  5JDF A;  4UVB B;  2HN2 A;  4O2B E;  2V6X A;  1H7C A;  4DBQ A;  1FIO A;  5J2U E;  3EDV A;  4GOU A;  2VL8 A;  3RIA A;  5HEO A;  2ACZ A;  1B7T A;  3N2G E;  5FYM A;  2DWG A;  2EHO A;  3ZT7 A;  2NW8 A;  3QB5 K;  1NAF A;  2VAS A;  4HWD A;  1Z8U A;  5AQR B;  4BJM A;  1HFA A;  5CA1 E;  4YSZ A;  4BA9 A;  2FUP A;  4XZC A;  3ONX A;  3VR9 A;  4A98 A;  4DND A;  2X9W A;  4AQG A;  4A5X A;  3RKO A;  2YN6 A;  3P7I A;  5JDN A;  3N9O A;  4XAX B;  4LF4 T;  4NXM T;  3AA6 B;  2E2A A;  2M6I A;  3N2K E;  3AE9 A;  4J2C A;  2ES0 A;  4LML A;  5FL1 A;  2NR4 A;  2EHO C;  4LF7 T;  3AE1 A;  2W0G A;  4PJM A;  2SPC A;  4DMV A;  2CWO A;  4NIQ A;  2IIU A;  2BVL A;  3OTO T;  2VK9 A;  3CK6 A;  4YSX A;  4JBW F;  2WZH A;  3LJC A;  4HWH A;  2LSJ A;  3PUQ A;  1KEY A;  4MLK A;  4ZOL E;  3LK2 B;  2HHH T;  5KXJ A;  3I9W A;  4I50 E;  2NW7 A;  4H9S E;  2LOS A;  3ZYL A;  3ETV A;  3OYX A;  3ZLI A;  4JI4 T;  3KV9 A;  4KUM B;  2X67 A;  4HEA A;  4TNV A;  4K0U A;  2LLY A;  3PUR A;  2W4X A;  1M62 A;  3LBX B;  5HAX A;  2WS3 A;  1SUM B;  3UUL A;  4X5T A;  2LSG A;  3HI2 A;  2H88 A;  4ADZ A;  5CJ5 A;  2EHO D;  2OV9 A;  4IDZ A;  4H9P C;  2L9Q A;  4CXW A;  2LSI A;  2ZM0 A;  4ILA A;  2JMH A;  4YTP A;  3P4S A;  3UUX B;  4UEL A;  4PAG A;  4IE7 A;  3BQI A;  1IBK T;  3KV6 A;  1S94 A;  1O3X A;  3P4R A;  5L3B B;  3JC6 D;  4IL9 A;  3TKL B;  3I0Q A;  4LMK A;  3UQ7 A;  1US7 B;  3AAI A;  3QC9 A;  2VVN A;  4MHC A;  1U5P A;  4AKL A;  3AE2 A;  2R6G F;  1KK7 A;  2RPA A;  2A2F X;  3CVR A;  4HFD A;  1IBL T;  4U7Y A;  5CB4 E;  1MMA A;  4Q25 A;  2MTQ A;  1IBM T;  2X0Y A;  4I4T E;  3AA0 B;  3B5M A;  3EI0 A;  2YDS A;  5FVL A;  5AQI B;  2IAK A;  3RPU A;  4ZI2 D;  4ZS2 A;  1HG5 A;  3I0O A;  3OKQ A;  4JI7 T;  3Q5D A;  2EHO B;  4HFE A;  3R6N A;  2CMR A;  3JCF A;  3LK4 2;  3N9N A;  1J5W A;  5AQN B;  2JMK A;  3SFE A;  1UX4 A;  4DV4 T;  4O4H E;  3GN5 A;  2Y8D A;  4V1A v;  5J1G A;  4YJ2 E;  4U2Z A;  2WSS V;  2E8I A;  2XAH B;  3UU8 A;  2X66 A;  3QOF A;  2GK9 A;  2V7M A;  3RF1 A;  1Y01 A;  2W00 A;  3ZKR A;  3RH3 A;  4QX7 B;  1BR2 A;  4L9I A;  1WR6 A;  4UVA B;  4BAY B;  5LNK A;  3P4P A;  2WWV A;  2ZM6 T;  3AXJ A;  1OXZ A;  4X20 E;  3QB5 A;  5FMN A;  2KWH A;  2RP4 A;  3RI5 A;  4LMJ A;  3EAM A;  2V5C A;  3IEE A;  2X51 A;  4DUZ T;  1YXR A;  4HFI A;  3T8O A;  2XQ6 A;  4B3T T;  1HNW T;  2X9X A;  2CLY C;  4KHP T;  5FXW A;  2WBL A;  4AKG A;  2CXF A;  1LRZ A;  3F31 A;  3NVO A;  2KIN B;  2BG9 A;  3N5L A;  2CA5 A;  3ZN1 B;  4P09 A;  3SFD A;  4DMW A;  3RQW A;  3X1D A;  1W0B A;  3OJA A;  3UU6 A;  3F57 A;  1QLB A;  3RIF A;  5LXT E;  4I0U A;  2V7K A;  3BQL A;  3RYC E;  4TZ4 C;  5DQW A;  2FJE A;  3EHZ A;  5LP6 E;  4TWF A;  2N2N A;  5CA0 E;  2DCF A;  2XY8 B;  2NWB A;  1D1A A;  4N78 D;  3HKC E;  3HKB E;  2UXX B;  5LJN A;  1XWM A;  1MMD A;  4WBN E;  4X64 T;  5LG3 A;  1DU2 A;  4EXT A;  2UXD T;  3U3I A;  5AQG B;  4PJJ A;  2QVA A;  4I43 B;  3RIU A;  5HWX A;  3H37 A;  2CHO A;  3ZT5 A;  1KF6 A;  4YT0 A;  3TLW A;  1XDP A;  3PUY F;  1N32 T;  5FP3 A;  3S4U A;  2W2U A;  3BQK A;  4YJ3 E;  3CIR A;  4AI6 A;  5HCM A;  4XBF B;  4O4J E;  4EZH A;  2XM1 A;  3FZM B;  3RYI E;  3PUS A;  4LF6 T;  3AE3 A;  4P0A A;  3CWZ B;  2NW9 A;  5F5W A;  2FJD A;  1IAP A;  3G06 A;  3RYF E;  1IJ5 A;  3RGL A;  2E9X D;  2DLR A;  5F3J A;  2VB6 A;  2JQQ A;  5JTG A;  4PJN A;  4PK5 A;  3KBU A;  4HFC A;  3RIU C;  3AEC A;  2LOP A;  4KBM B;  1WYC A;  3AED A;  4IE0 A;  1MMN A;  1HNX T;  5AQO B;  2XQ5 A;  4KX6 A;  4LF9 T;  2JIW A;  1IJ6 A;  2BBJ A;  1MMG A;  2D0U A;  4TNW A;  3ZEF B;  4EOZ B;  1YD8 G;  4TN7 B;  3ZMT B;  5AQU B;  3CQX C;  5FXZ A;  2LSK A;  2NTX A;  2CPT A;  1MIW A;  2LKG A;  2CLY B;  2A9U A;  5HCJ A;  3ZT6 A;  5H6Q B;  3GN5 B;  5JR9 A;  1FEW A;  3RC3 A;  5LB7 B;  4WNK A;  4Z8X A;  3UT5 E;  4FI5 A;  4EGW A;  2PG8 A;  4JI3 T;  5HEH A;  2QYW A;  5ABH A;  4DV3 T;  4NXN T;  1D1B A;  1N36 T;  1FJG T;  2K24 A;  4TUY E;  3QNU A;  2YK0 A;  4ILU A;  4ILB A;  3AXJ B;  2CE7 A;  4ZI3 D;  4DUY T;  4LFA T;  2K5B B;  5M4Y A;  5LMN T;  5TAO A;  1ZHC A;  3EDU A;  5JDH A;  3PV0 F;  2WU5 A;  5FL0 A;  4EYY R;  4BJN A;  3LFM A;  4CQI A;  2XAG B;  2XQ4 A;  5JR9 C;  1T72 A;  3CX7 B;  3FHN A;  2KZ7 B;  2YU1 A;  3VRB A;  2D0T A;  4HFB A;  3WAK A;  3AE4 A;  3ESL A;  5JDQ A;  1NWM X;  4NUU A;  3NBX X;  4I55 E;  2WB5 A;  1J5E T;  3ZC0 A;  3IHR A;  2ZM8 A;  4JI1 T;  4YXD A;  5ETW A;  3C4X A;  2XUE A;  2XSB A;  3FB2 A;  3FZK B;  5EK4 A;  4DO0 A;  2X9H A;  4YY3 T;  2K3W A;  3RC8 A;  1UUR A;  1WRD A;  3MAC A;  5C2T A;  1UX5 A;  2WDQ A;  4HTE A;  3RX6 A;  1UCU A;  4K0K T;  3MKD A;  3AE6 A;  3Q9D A;  2C5J A;  3M65 A;  5KMG P;  3JC6 C;  5LOV E;  2IW5 B;  3V5U A;  4ANJ A;  1X79 A;  3OPC A;  4F8H A;  1HG2 A;  2BG9 E;  2IDO B;  1YKE B;  4HN9 A;  5FY0 A;  3VU7 H;  1S35 A;  4JI6 T;  4HE8 A;  5FY1 A;  2Y6X A;  5JRC A;  2DL1 A;  4U74 A;  5ADX L;  4NPP A;  2DWK A;  1WCR A;  5EK3 A;  3AE8 A;  4HFV A;  4JLE A;  2YOE A;  3SRZ A;  5JDL A;  3N2O A;  4QXC B;  4C90 A;  1HX1 B;  2X0H A;  5KX5 E;  2CRB A;  5L3E B;  2ACX A;  3B57 A;  2W62 A;  1LVF A;  3K8P C;  1R8I A;  4U2Y A;  3JAD A;  2C5I T;  1EZ3 A;  3HKD E;  2BDE A;  4YFS A;  5LHI B;  2P9B A;  4GYR A;  3ANW B;  1XNR T;  2XAQ B;  1UUS A;  2VWA A;  3AAE B;  4HKA A;  5L3F B;  4YTM A;  4ZI2 C;  4IE4 A;  2VQE T;  4OK0 A;  3FZF B;  5JDM A;  4EV6 A;  5AQK B;  2RA1 A;  1LKX A;  3ZCJ A;  3C4Z A;  2BKN A;  4CN6 A;  4DR7 T;  1J1J A;  3AA7 B;  5AQH B;  3C50 A;  3OVU A;  1HNZ T;  4A97 A;  1WFD A;  3L09 A;  5LMU T;  4L0R A;  3RYH E;  2QRX A;  3LG7 A;  2UXB T;  1HCI A;  2VVS A;  5L3G B;  2LT3 A;  1M7K A;  4EYU A;  2K9A A;  4AKH A;  3P4W A;  2C5K T;  3VKG A;  3O1H A;  3UFE A;  4ISS A;  4QKN A;  4O4L E;  4IDQ A;  3FBL A;  1SA0 E;  2PTF A;  4JEU B;  4ILC A;  2JQ9 A;  2WM9 A;  5JR9 B;  3N9L A;  2Z6E A;  3C64 A;  4JI5 T;  2E5V A;  4IDN A;  4UIG A;  3KBT A;  3E22 E;  3PU8 A;  3GWH A;  2I59 A;  3N9Q A;  4UV9 B;  2Q9Q A;  3DP7 A;  5LJM A;  2WMN A;  4TV8 E;  2WP9 A;  4DV7 T;  2LRK A;  4CN4 A;  2V6Y A;  1KFY A;  4G63 A;  5LGT B;  3F2E A;  4H9O C;  5DJQ C;  2XQA A;  5AQM B;  2UXC T;  1G8X A;  4DV2 T;  1W9R A;  4UR9 A;  2IC6 A;  4CXY A;  3WAJ A;  2V7L A;  4B3M T;  5FKY A;  3AE7 A;  4ASK A;  1XMO T;  2NP9 A;  4WW0 A;  5AQF B;  3FZL B;  4IDP A;  1SHZ C;  3TLV A;  4JV5 T;  2Q9Q C;  2XPK A;  4YTN A;  3HA4 A;  1LVK A;  3EAB A;  4ZEY A;  3KDS E;  3V5S A;  2HPJ A;  4H63 H;  3CML A;  3KFW X;  1OED E;  4Z90 A;  4PJL A;  3PUZ F;  1ZEE A;  2MAW A;  4G2A A;  2E9X A;  4HWI B;  3L3P A;  3AEF A;  3K3O A;  1ZV4 X;  4UEM A;  2KLQ A;  5IYZ E;  2MBG A;  4YHH T;  5LYJ E;  4DR4 T;  3VKH A;  2ZM2 A;  4IE5 A;  2JQH A;  2YIN A;  3HR0 A;  3ZYM A; 
#chains in the Genus database with same CATH homology
 5IWA T;  4DV1 T;  4DV5 T;  1HNX T;  2F4V T;  4DV7 T;  1XMQ T;  4AQY T;  4LF7 T;  4DR2 T;  4JI8 T;  4LF9 T;  1N34 T;  4DR5 T;  3OTO T;  4JYA T;  2UXC T;  4DV2 T;  4X64 T;  1XNR T;  2UUA T;  1J5E T;  3T1Y T;  5BR8 T;  2UXD T;  2ZM6 T;  1IBL T;  4B3M T;  4JI1 T;  2HHH T;  4LF5 T;  2VQE T;  2UUB T;  1XMO T;  1IBM T;  4DR7 T;  4JI4 T;  1N32 T;  4DUZ T;  4YY3 T;  4X66 T;  4OX9 T;  4B3T T;  4JI3 T;  2VQF T;  1HNZ T;  1HNW T;  4DV3 T;  4JI0 T;  4JV5 T;  4LF8 T;  4KHP T;  4NXN T;  4GKK T;  5LMU T;  4K0K T;  2UUC T;  2UXB T;  1N36 T;  1FJG T;  4DR6 T;  4X62 T;  4LF6 T;  1XNQ T;  4DR3 T;  4DV6 T;  4DV0 T;  1HR0 T;  4B3R T;  4DUY T;  4LFA T;  5LMN T;  4LFC T;  4JI6 T;  4GKJ T;  4X65 T;  1I94 T;  4JI7 T;  4LF4 T;  4NXM T;  4JI5 T;  4DR1 T;  2E5L T;  4LFB T;  1IBK T;  4B3S T;  4YHH T;  3T1H T;  4DR4 T;  4DV4 T;  2UU9 T;  1N33 T;  4JI2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...