4JYMA

Crystal structure of kai2 in complex with 3-methyl-2h-furo[2,3-c]pyran-2-one
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
267
Chain Sequence
GVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Smoke-derived karrikin perception by the alpha/beta-hydrolase KAI2 from Arabidopsis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Hydrolase, alpha/beta fold family protein
total genus 92
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jymA00
3EQ8A 1ZGBA 4HTAA 5ALFA 4Z49A 2CZQA 3HRHA 3C8DA 1Y7HA 4UFPA 1DQZA 5AKXA 4BP8A 1UK6A 2DSNA 3IVMA 1ODCA 1P0QA 3QPCA 3STVA 5C7YA 3QVMA 3AIKA 3D2CA 3MGAA 2JEZA 1CLEA 4P08A 5JAOA 1DWOA 4LXGA 2WG1A 3WK5A 3WMRA 1Q83A 2QUBA 4BDTA 3WK6A 1VJ5A 1AQLA 1K6EA 3HEAA 4WCVA 5EHNA 5AO9A 2BFNA 1QTIA 2JGKA 1W6RA 5D7BA 1CFJA 3BDIA 1BN7A 3HLKA 3DOIA 4BC0A 1F0PA 1TAHA 3O95A 4AQDA 3FSGD 4L72A 1C4XA 2OQIA 3PF8A 4Y2YA 1CUDA 3I6MA 3C6YA 2DFPA 3R3VA 1LPAB 2OCLA 5E2IA 3CXUA 3T52A 1XRPA 4E11A 3ICVA 5K3FA 2R11A 3EQ9A 2V9ZA 1QE3A 4BB0A 4CIAA 3E0XA 3FLAA 3QH4A 4AO6A 3SX4A 2RHWA 1VE6A 2ZYRA 1P0IA 2VAXA 4WFJA 3QZUA 4UBJA 1WHTA 2P8SA 2GBCA 3SC2A 5CMLA 5ALTA 1CUEA 1DX4A 3QMVA 1U4NA 4MWSA 2E3JA 3I2HA 5AI9A 4C6HA 4ZV7A 1XRQA 1LNSA 1T4MA 2B20A 3S8YA 3QBJA 3KD2A 3PF9A 2HRRA 3IUMA 3LS2A 4UFNA 2WHRA 4DMFA 3WWOA 1PV1A 2PVSA 4U2EA 5I8PA 3ESCA 2YH2A 3WKEA 5ALNA 2H9YA 5D3ZA 3AFIA 4A5SA 4M0FA 1TKRA 3H0CA 4ETWA 2VTVA 1AGYA 1EX9A 1N5RA 3W06A 3VVMA 3ZI7A 3C6ZA 4FNMA 4DMKA 2WJ6A 1N5MA 3WK7A 4H18A 5D6OA 2O2HA 3OG9A 4J0KA 2QJRA 5LZ8A 2FJ0A 2WG2A 4TVKA 4Y2TA 4I19A 4WDQA 4Y2PA 2H7XA 3DS8A 1MAAA 3SWWA 3DNMA 1MAHA 3ZPXA 1FJ2A 1ZGCA 4G8BA 5IVDA 2I3DA 2BAGA 4OB7A 1BROA 3NWOA 4UHCA 2XMGA 4QE3A 3WL8A 4NS4A 4L9AA 1ZJ4A 2D5LA 3FSGA 4OD0A 1SFRA 5AM1A 4ZV9A 1ZOIA 2GYVA 3B12A 2JGMA 5JD5A 2QRUA 5HFNA 4Q3OA 1U65A 4BC1A 1LPBB 3IUNA 5EGNA 1J07A 1XRMA 2ONCA 3ZLUA 5KWJA 1EINA 1UK9A 1B6GA 3L1JA 2XMSA 3H04A 1LPSA 4OSEA 1TQHA 1YB6A 4B7ZA 3DYVA 4AX4A 5CBKA 1JKMA 3L1IA 2XUQA 1R9NA 3UUEA 3FYTA 5KREA 1XZBA 1USWA 1FFCA 1Y7IA 4XJVA 5AKYA 1HLGA 3PFBA 3H2IA 4Y7DA 1LPMA 5IVHA 2VATA 4BE9A 1CUXA 1TRHA 4KE8A 5A6VA 3QMWA 4G4IA 4B0OA 1EVEA 3DL4A 5FV4A 1CUFA 1CUGA 1K4YA 3U0VA 3H2JA 2PBLA 4N8EA 4C4YA 5JZSA 2CJPA 2WIJA 1BU8A 2Z5GA 4KACA 2HIHA 4OUKX 3VKFA 1CUCA 4QDXA 2XLBA 1AMNA 2I03A 5HF6A 4KYVA 4N5IX 4G8DA 1S8OA 1KU6A 2YASA 3QYJA 4Q34A 2AJDA 3WKAA 2WTMA 5AKLA 1IZ7A 4H77A 5ISMA 3K6KA 1LPNA 2XUJA 4BVLA 5A7GA 4X71A 2ZSIA 3D0KA 3M3DA 1XKTA 1YA4A 4H7HA 1DWQA 2PM8A 1ORVA 4W63A 3W2TA 1I6WA 1GKKA 1LBSA 1J06A 5AK5A 4X6YA 1X2BA 4G9GA 2HL6A 3GZJA 3AZPA 4EZIA 4AO8A 5JZ9A 5CT6A 3AIOA 3STTA 4GDMA 3K2IA 1N8SA 2PL5A 3DOHA 2B9VA 1DINA 3JYHA 2WQZA 1K63A 4OU4A 3AIMA 1H2YA 2Z8ZA 1QFMA 3R3XA 1XLVA 5FOQA 1FFBA 3OTQA 4W1SA 2JGFA 3G8YA 2WUGA 2HFKA 2AJBA 1VKHA 5AKHA 4B82A 4EA6A 1J1IA 4XVCA 2BGNA 1EDEA 2FUKA 1XLUA 3HJUA 4NMWA 5EHQA 5C8ZA 4NZZA 2PSDA 2WKWA 4HAIA 2WFMA 1XZFA 3H1BA 3OURA 4H7KA 1E66A 2CMFA 5AICA 3WWPA 2XB6A 1O6FA 5EHXA 5HKAA 4Y2QA 5DTJA 1YAHA 2XLCA 3D5EA 5I9IA 1O6GA 2HFJA 3FYUB 1Q84A 3IA2A 3W9BA 2OLEA 2XMDA 1UKBA 5AOAA 4LXIA 5AKKA 4AXBA 3I2GA 1BRTA 2K2QB 1QIGA 4BE4A 4HZGA 4QZVA 4X6XA 4UHDA 4B83A 1BEEA 5K3EA 3OPMA 3F9CA 2WU4A 4FWBA 4YK7A 4ZWNA 4IQ4A 3DQZA 3GA7A 5AI4A 3QMMA 3RKSA 4EHBA 4CCWA 2QZPA 3G0CA 5AH0A 5LLSA 3O0DA 2GBFA 5FPQA 3M82A 2ZJ7A 2WIKA 4QWWA 5ALXA 3NOXA 4BBZA 1QO9A 5ALIA 1GPNA 4KAJA 5HF5A 4IH1A 3D2BA 3I6ZA 2RONA 5LZ9A 4UBOA 1CUVA 1F8UA 1AUOA 1P0PA 3HABA 4AZ3A 5LZ4A 5AKEA 3I2IA 4MXDA 3BDVA 1FSSA 1GZ7A 3BIWA 1RWQA 4CG2A 5AKJA 1LPOA 5ALEA 4AMZA 4H0CA 4LXHA 4DTCA 3STUA 5K3BA 5ESRA 4HXGA 3AUKA 1XRRA 1EI9A 2BGRA 1XQYA 4FOLA 4LYEA 4YX9A 3DD5A 1DT3A 3F96A 4KAAA 3EIOA 3FWHA 3L1HA 1CUWA 4B81A 3F97A 2WHPB 1VA4A 5J3JA 1VLQA 4K2AA 1H2WA 5DNWA 5ALOA 3BE8A 4PSDA 1XROA 4BCCA 3GROA 1EK2A 1ORWA 5IKXA 5DLPA 3G02A 4RGYA 3E4DA 1GGVA 4W1RA 3V48A 2HM7A 4J0GA 2UZ0A 4BAZA 2ZVDA 2J3QA 2XQIA 1CPYA 2IX9A 3F98A 3WYNA 2OQVA 1SCQA 4KE9A 1C7IA 4KEAA 2AJCA 4DLNA 2Y2VA 3FYUC 3R3YA 2R8BA 4QNNA 3C87A 4PW0A 2RHTA 4EB0A 1Q0ZA 1EH5A 2WIDA 4BATA 5CT8A 4UHBA 3WWDA 2QR5A 2VT6A 1H2ZA 5AM3A 2HA5A 3W04A 1W75A 1JT2A 4BZWA 5ALGA 3QM1A 1HDEA 2HA7A 2Y2UA 5CXUA 4G8CA 3RK4A 3FVRA 3LIPA 1NU8A 4U2DA 5ALVA 3ESBA 1XFDA 1YSCA 5FRDA 1AKNA 4B6GA 4L3WA 5CRIA 2CUTA 4GI1A 1ZD3A 1GPLA 2VJDA 1E8MA 1FFDA 3V1MA 4X7BA 4K5QA 5AK4A 2OGSA 4IHAA 3FVTA 1BCRA 2OCIA 2JEYA 1NX9A 2C7BA 3VVLA 5JAHA 2JGIA 1UK7A 4F21A 4Q05A 5BOVA 4DYHA 5T4HA 3A2NA 3AINA 2XE4A 3E3AA 5AI5A 3OOSA 2XUDA 1UFOA 2O2GA 4XWGA 3WK8A 1A88A 2HU5A 4G9EA 1MNQA 3KSRA 4PSCA 4EBBA 5A71A 5K3AA 5ALZA 1U8EA 4DSAA 2HU8A 4AB1A 2DQYA 5K3DA 4KAFA 2G4LA 3F67A 5LKAA 3PDCA 4QEKA 1Y37A 3IURA 3I2JA 5A62A 2W22A 1CUIA 2W6CX 4DNPA 4X93A 1UZAA 1XKLA 1L7RA 3AZQA 1JI3A 4I4CA 3V9AA 1W1IA 2JGEA 4DNFA 3HI4A 4AN0A 2VAVA 3G7NA 5F4ZA 3DYIA 1IMJA 5ALKA 4W9RA 2QJWA 2WM2A 2WFZA 4N8SA 1XZJA 1WOMA 4LHEA 4PO3X 2DR0A 4P93A 1JU3A 4AO7A 3GBSA 2QKYA 3LIIA 5AKIA 2ROQA 4MJ3A 3MVEA 4FLFA 5T4FA 3BF7A 4FKBA 3I2FA 5CH8A 2IIVA 2OGZA 5E4YA 5JANA 4KJXA 1OILA 2ZJFA 1XZIA 3WQHA 3YASA 1PJAA 3C5VA 4B9AA 3V1NA 5LKRA 4CG3A 4ITVA 4U2BA 4DIUA 4UHHA 1UOQA 4H35A 4X95A 4WY8A 2QS9A 2HU7A 2OCGA 5CURA 5HF8A 1GQRA 1BCSA 3DJYA 1WPXA 5D3KA 5JIBA 1MTZA 2PSFA 2QUAA 5A2GA 4RE6A 1C7JA 3CN9A 2PX6A 5K3CA 2PU7A 3LP5A 2BUCA 1CUBA 2G5TA 5K3FB 3G9TA 2DCMA 1LZLA 3DEAA 1EDBA 2Y6UA 3WYDA 1HPLA 1CUUA 1ZICA 1YCDA 4MQLA 1RP1A 4W1PA 4Y2JA 5H3HA 4M0EA 3A6ZA 1FFAA 4QA9A 1CIJA 4H7IA 1WM1A 4U2FA 3IB3A 1UXOA 4BTLA 1VXRA 5CH3A 1JJIA 5CH5A 4X92A 3VJMA 4BRSA 1E3QA 5DTIA 4AZ0A 2GZRA 1MX5A 2ORYA 2XUKA 3VDXA 4G4GA 1L7QA 1Z68A 4ROTA 4JUIA 2YYSA 1ZD4A 4X6UA 4JYMA 4J0IA 3WWCA 4U2CA 1P0MA 2I3ZA 3S2ZA 2PSEA 1ZIXA 5AM5A 5AK3A 2J4FA 4OYLA 4MYDA 2WSLA 3C6BA 5AHXA 2HHAA 4UUQA 5AM0A 4HRYA 3U1TA 3DLTA 5LZ7A 3STWA 3PE6A 4AN1A 1UT6A 4DGQA 3WL5A 3H2KA 3CCCA 1YS1X 3WKBA 1WPRA 4DNOA 1DU4A 3H17A 1QJ4A 5HK8A 1JMKC 1MU0A 3G0GA 2WUDA 4KRYA 3ZWQA 1IUOA 1ODTC 2OXEA 5HK9A 3N0TA 1EK1A 1BEZA 1AX9A 4X3CA 2NW6A 1HBJA 3MUOA 5CW2A 4FFVA 3WI7A 5JASA 4B85A 4IH4A 2VJBA 4F0JA 4OB8A 1R3DA 1CUSA 2O7VA 2XUIA 1MX9A 1XRNA 5KBYA 4ZI5A 4X94A 3DCNA 4DNQA 1TCCA 2J4CA 3I2KA 4U2GA 4CCYB 1CUZA 3STYA 1X2EA 4BCDA 2C0PA 2GBGA 4EY4A 1CQZA 4FTWA 5JAUA 5IVKA 2XUOA 1TK3A 2QM0A 1THTA 5FP0A 2CKMA 3AILA 1R1DA 1GPKA 5JAPA 3ESDA 1R9MA 3F8SA 1QGED 1QIFA 4FBMA 3IDAA 3BWXA 2DHCA 3EF3A 5SYNA 2X76A 2QT9A 4GECA 1QIDA 3M81A 2Z3WA 4KE7A 4X85A 5JD6A 3ANSA 2D0DA 4ZRDA 3ZLVA 1CRLA 4BZZA 4C01A 4C88A 3CN7A 1ETHA 4EY8A 3EBLA 3QPAA 1ACJA 1XRLA 4OCZA 4UBIA 1XZKA 2J3DA 4K6GA 1WB5A 2VT7A 4X00A 1D07A 4FFWA 4UPDA 5C8XA 1AC5A 5JD4A 2CBGA 4ZREA 3H1AA 3AZOA 4FLEA 4JNCA 1E8DA 4HVTA 1XZAA 4P9NA 5T4EA 4LKOA 5ALWA 4TGLA 5ALSA 1NU6A 1KU0A 4DSZA 2WILA 5LYYA 4BCBA 4LYDA 1ZD5A 1XZMA 1SC9A 4CFSA 1MNAA 2WJ3A 4KR0A 2AJLI 1CUJA 2WJ4A 4UFOA 3IULA 3AJAA 2V97A 2Q0XA 3QPDA 1IZ8A 4X91A 1EB9A 1H2XA 2O2IA 3NUZA 4FLMA 4J7AA 3R3UA 1E5TA 4ARAA 1XQXA 4A23A 1QFSA 1QZ3A 3GELA 5FUMA 2BJHA 5FKJA 3BL8A 4QDZA 3FOBA 4Q3LA 2QXUA 3FAKA 1B41A 2ZYHA 1DX6A 4QLAA 4G4JA 4TPKA 2OGTA 2VEOA 4GXNA 5JATA 2VA9A 1PFQA 2WUEA 2AXEA 5HQ3B 2Z3ZA 1CUAA 2XQKA 3RLIA 1HKHA 4RNCA 5DYWA 3VISA 3B5EA 3LLCA 3WL7A 4Y2RA 3O4IA 4Y2SA 4UBMA 4Y9SA 1IUPA 1WB4A 1XZEA 4M0MA 5AI8A 5HFAA 1QIJA 1Q0RA 1GXSA 1TCBA 1ZI8A 2C58A 1KEZA 5SYMA 4PQEA 5ALDA 4GBGA 3WA7A 3O4GA 3PI6A 1W4LA 2Z8XA 4CIBA 4Q3KA 2O7RA 3WLAA 4BAGA 2ZYIA 5EIEA 3JW8A 2XUPA 4C4XA 2H1IA 4DMHA 4N8DA 5DNVA 1HL7A 2C5GA 4B84A 2OCKA 1VOTA 2ZJ6A 4J0JA 1BN6A 2ZYSA 3C8HA 4X90A 2QMQA 5ALYA 2RIPA 5JZBA 1ZD2P 1YS2X 4H7DA 3FLEA 4L0CA 5JARA 2X8BA 3LCRA 1G5FA 3C45A 3G0DA 2FJPA 3JWEA 1QLWA 1OCEA 4YPVA 3HYSA 1CVLA 1MT3A 4OU5A 2FX5A 3GFFA 2G5PA 5T4BA 3VJLA 1N1MA 2OAEA 4C89A 5EHZA 5ALUA 5CT9A 4ZXFA 1VXOA 4BVKA 5AOCA 1CQWA 3PUHA 3FNBA 4F60A 1EB8A 1A8SA 4UBKA 3G0IA 3ZLTA 3WWEA 1JU4A 5ALHA 2AJ8A 1DWPA 1UK8A 1RYYA 3KWJA 4OB6A 1JJFA 4FDMA 2H7YA 2B4KA 3A70A 2EDCA 5AP9A 4J3JA 3WZLA 4W1QA 3BJRA 2V96A 2CB9A 2X5XA 2JBWA 2GYUA 4NVRA 1JJBA 1MN6A 2OPHA 3WK4A 2XUHA 2WIFA 5FDFA 4O08A 3I1IA 4MEBA 3D3NA 5K5EA 3RARA 3R41A 4EY5A 2WLSA 4P92A 2XQFA 5ALMA 5DWDA 2GYWA 3ILSA 5AI6A 1MPXA 4EY7A 4MQMA 4BYMA 1VZ3A 3I6YA 2B61A 4GWLA 5AJHA 5LIPA 2HA2A 1QOZA 1IVYA 1VE7A 5YASA 2LIPA 1WCYA 4XIIA 2JGJA 1CUHA 2IITA 5DNUA 4BRZA 1A7UA 1EA5A 3PICA 3OC0A 1ODSA 5EIHA 4J03A 2RAUA 2BCEA 1G42A 4QDOA 1CV2A 2DHDA 1LLFA 4JEIA 5HKBA 4GW3A 4J0CA 5C81A 5AOBA 3G9UA 4OPMA 1W76A 4G1FA 2OG1A 5CTAA 4QDUA 5LZ5A 1XQWA 2PKYX 1BS9A 3H2GA 5A7FA 7YASA 5HQ3A 4IO0A 4OYYA 3X3HA 4BVJA 1THGA 3IIIA 5IH7A 2C5FA 2QTBA 2HADA 4WJLA 2C4HA 2VJCA 3HACA 4JH0A 4BP9A 3TEJA 5JADA 1XZGA 3WA6A 4A16A 1ZI9A 4YASA 3FCXA 3WKCA 3KOOA 5HZGA 3ICWA 4H7EA 3E1GA 4D9JA 2GZSA 2YXPX 2HA3A 3KWFA 4V2IA 1WHSA 4PF1A 1XZLA 5HF9A 2ES4A 3NGMA 6YASA 4E15A 1M33A 3IUQA 3ZV7A 2VSQA 2JIDA 2EDAA 3BIXA 1E89A 4B9EA 5JALA 1R4ZA 2WHQA 2XQJA 4B0PA 5AM4A 1EXWA 1G4HA 3W9UA 1CEXA 3G0BA 1SOMA 5CT5A 4WFIA 4HXFB 3K9BA 5HCUA 2ZSHA 5AKZA 2PU5A 4LIPD 1MJ5A 3TRDA 1UKAA 1YA8A 4INZA 3FCYA 4H7FA 3WJ2A 1T2NA 3OM8A 1QIKA 2I78A 1JFRA 4FBLA 4N5HX 3R40A 1YB7A 4B80A 3O9MA 5BWCA 1XZHA 5DYYA 5AKGA 1DT5A 2QOEA 2PPLA 4WY5A 5FPPA 3D2AA 3WK9A 5AK6A 5AIAA 2HRQA 3O4JA 3RM3A 4WFKA 1F0NA 2RGUA 3T4UA 3V1LA 1VA5A 3PUIA 2WUFA 3W05A 5E4TA 4K6HA 4ARBA 4DMCA 5BV7A 4QDTA 2XDWA 3UUFA 4EY6A 2DQZA 3H2HA 1E8NA 1K8QA 1CUYA 1MX1A 2BKLA 3A2LA 4C87A 3D7RA 3B3QA 3TJMA 3BXPA 1U2EA 4RPCA 1LPPA 2XUGA 3C70A 2EEPA 4XX1A 5AM2A 1DTEA 4CCYA 4BDSA 1R88A 2XMQA 4HS9A 3D4LA 4G5XA 1UOPA 1ISPA 2RI6A 3O9VA 3GUUA 1QIMA 3IBTA 3N2ZB 4J0HA 2WIGA 3M83A 1GQSA 3D59A 4Q82A 3SK0A 2GBIA 4X97A 5EFZA 2WFLA 1XQVA 3VXKA 1W52X 4UHEA 4UBLA 3R3ZA 3WZMA 1A8QA 2XMBA 3TGLA 1CR6A 3WJ1A 1K5PA 1YR2A 4CI9A 2OAGA 4EUSA 4ZGBA 1H22A 5IVIA 4I3FA 4CG1A 4HRXA 3KDAA 3ANTA 4QWMA 1R50A 3MUNA 4PSUA 2XUFA 3H19A 3HZOA 4QLOA 2XMRA 2ACEA 4GLBA 1QIHA 2H7CA 4RE5A 4MYSA 1ZJ5A 4FHZA 5JYCA 1A8UA 1L7AA 1OXMA 4DM7A 1XLWA 2HA0A 1GKLA 3WIOA 3Q0TA 3BF8A 1LBTA 2HDWA 1UOOA 3WL6A 4PNZA 5AI0A 1IUNA 2PSHA 3WKDA 2ECFA 3KXPA 2V98A 2XT0A 5A7HA 3R0VA 5ALPA 1BE0A 4BTVA 3QITA 1SCKA 1J2EA 3WIBA 4KRXA 2HA6A 3G9ZA 2BUBA 2JGLA 3PFCA 3C6XA 3HXKA 3ED1A 3BJMA 2WHPA 3C5WP 1QONA 2DHEA 3FYUA 4J0DA 1AURA 1LZKA 5ALJA 5ALRA 4FMPA 2WG0A 4F5ZA 1EDDA 3A2MA 4HXEB 1SCIA 1TIBA 4Y2UA 5CXXA 1HQDA 1QIIA 4H7JA 3ESAA 5FXMA 1QO7A 5AIBA 1UKCA 4PV7A 1DQYA 1WB6A 1JMYA 2XMZA 2Y6VA 2XUAA 5KWIA 3UMJA 4S0XA 5DJ5A 2CEKA 5FLKA 4UBNA 1ZIYA 3CCBA 4AMYA 1QTRA 4Q1VA 3C43A 4JYPA 1AZWA 3FBWA 1EHYA 3O4HA 1H23A 1TCAA 1MO2A 2JF0A 3FLBA 2PUHA 2G63A 3H18A 1G66A 5ALLA 5EI5A 4GEGA 4C4ZA 2XMCA 4MEAA 1XZDA 1EVQA 1UWCA 2ACKA 3I28A 5ALQA 1X70A 4E14A 2WFLB 3G9XA 1LGYA 3I1YA 4IH9A 2VJAA 5EIAA 4UHFA 1XZCA 5C8VA 5CT4A 1ZI6A 1VZ2A 1GT6A 3DKKA 2XQGA 4Y2VA 4BAUA 2HA4A 2QVBA 3VJKA 3DKRA 2Y1KA 4WDRA 5E4JA 5LZ2A 5BWBA 3DL7A 4GHWA 2C0QA 2QXTA 2WTNA 3HSSA 4Y2XA 2PUJA 3STXA 1FFEA 2VQ6A 3P2MA 5I7UA 2VF2A 2BUAA 3R3WA 2WU3A 3V1KA 4KE6A 3Q8WA 2PSJA 4MWTA 3HC7A 1QIEA 4FNGA 1F6WA 1ACLA 5LP1A 1YAJA 4E46A 3DDUA 2XI4A 5DYTA 3EQ7A 3IUJA 4K6KA 1YASA
chains in the Genus database with same CATH superfamily
2X0FA 3GJ8A 2Q45A 3F3KA 4HTAA 3HO1A 3IDOA 2P1ZA 2M98A 4MEJA 5EZYB 4BV8A 3A6JA 4DJJA 4F84A 5JCOC 3C98A 1KHTA 1CY2A 1KP9A 2AHOA 2CLSA 3JAWA 1U7DA 5ALFA 4BFZA 1MOQA 4Z49A 4V1CA 2B2CA 1EX7A 4R71A 1JAYA 2PJRA 3GCWA 1AHIA 3PUXA 2LPMA 4D3XA 4S3MA 1XE3A 3HRHA 1WBDA 1Y7HA 2IPXA 2OM2A 3AVTA 3MWLA 1DHRA 1YHYA 2Y27A 3M4JA 4YCBA 4E5UA 1GAQA 1J23A 1BDJA 2HQOA 5LQNA 3GG2A 2DSNA 2FSSA 1DG3A 2P65A 3ZDBA 3QPCA 2I0FA 1U7ZA 1QCZA 3STVA 5I7OA 2JFYA 5DX1A 1XNQB 1TKBA 2RHBA 2SBTA 3FUCA 5EQJB 1Q7RA 3QVMA 3BBPA 3WGHA 2OYSA 3WIUA 1KS9A 2X3FA 5ES3A 4EEZA 2MSCB 2P62A 2WG1A 3M2TA 4D9EA 1Q83A 3L82B 3PEYA 1C3LA 3IP5A 1JJ7A 4R9RA 3TINA 1N6HA 4ZMRA 3KR2A 4H6VA 1ULUA 1KQPA 1ZOSA 3JVDA 1SKYE 3FPKA 4ZJUA 1JHAA 1UIRA 4OQQA 3WFIA 2KS6A 4US2R 5AW2A 4FONA 3M89A 3AY7A 1YQUA 1S2IA 2OCYC 1VCIA 3ZE0B 3EDCA 3GFRA 1WCIA 4WCVA 4GX1A 4YFVA 1SXPA 4RNDB 1QTIA 3LY5A 1Y33E 4EECA 4NL4H 3M6WA 1KAEA 4G1CA 1W6RA 3GCGA 1E2BA 4LGMA 1CFJA 1G41A 2XB8A 3LT1A 4YY3B 4KVGA 2GZDA 2Q0SA 2JJQA 3BDIA 3MTIA 4CLOA 4PIMA 3VTFA 1IBKB 1E7YA 3FRIA 2J9GA 3DOIA 2XB2A 1DO0A 3HHPA 4KN6A 2BDUA 3QOWA 1A2BA 4G3XA 3D7SA 3L46A 3TRHA 1R6UA 1QZZA 1F0PA 1RACA 2I1QA 3P7MA 3RC7A 3ZV3A 5JAZA 5GADl 1UBUS 3O95A 3FSGD 1H0HA 4AQDA 5JXHA 2ODBA 2BLLA 3DW1X 4CQMD 5ABPA 4CLDA 3PF8A 4UTVA 1FW6A 4J07A 4YP0A 4C7OA 2H4JA 4P3NA 1NLYA 1O0BA 4YQEA 1W8DA 2QPLA 1VMAA 5GJVC 1J42A 1Y6GA 1LPAB 1R0ZA 1FPMA 1WD5A 2OOSA 5I3CA 3VTZA 2FVXA 2VPZA 4QX6A 3WGLA 4PNEA 3N7UA 4D8YA 5K0GA 4FD2A 5BSUA 3MELA 1SEVA 1ECPA 3FCAA 2CLEB 2RFLA 3DFZA 1KQFA 4EW2A 2LCQA 3UAVA 4CKBB 1M75A 2YVKA 4MWGA 3IODA 3JWHA 2R4TA 1CRZA 3C3PA 4EX7A 1QE3A 2G9UA 1USKA 1PNQA 1NW7A 3QH4A 1RLTA 2QM7A 5IKOA 3EXIB 3IAS6 1VE6A 2ZYRA 4JGBA 3AVVA 5A9TA 2MR6A 1J8YF 1Q1NA 2DBVO 4WI1A 3VC7A 1JEOA 1Z8NA 2R3SA 1MG0A 5JPIA 4BN5A 2H2IA 3K9NA 1HT2E 1HE2A 3SC2A 1L8AA 1WMSA 3CIOA 2B25A 1RKBA 3PC7A 1UZLA 3HB7A 1U4NA 3W5BA 2E3JA 3I2HA 1JQ5A 3E5NA 1V47A 3WE7A 2C2OA 2VPWA 1HFKA 3M70A 2GD2A 1KI3A 2EIHA 1OTHA 3OSZA 4JLWA 4A82A 4DLPA 3AI7A 4C0WA 2YWFA 4Y0NA 1OWPA 4ZV7A 3HA7A 3TLCA 1XRQA 1WP9A 4A6EA 3ITNA 2YUTA 1IM2A 3C1TA 3R24A 2B20A 2LCIA 3C5CA 3WB2A 2JZCA 5IG2A 3QBJA 3KD2A 5KYNA 3S8YA 2H2WA 3N1UA 4UEQA 4FGWA 4LJ6A 2FQ1A 1JEEA 3E03A 2HRRA 1T3LA 5CM9C 1OAOA 4V0ME 5P21A 5TQ0A 5HW0A 5JNSA 4ITRC 1UC9A 2FXIA 2WHRA 6CHYA 4QBKA 3ETEA 1K06A 3RGWS 5A9SA 3GFPA 3ZDAA 4KHPB 2W2KB 1E2MA 3ESCA 3KKZA 4MR9B 5AVKA 3WKEA 4I99A 5ALNA 1M5RA 2QAGB 4ENUA 1Z2CA 4M0FA 1KPGA 1UFQA 1G7TA 1TKRA 1E2FA 2J5KA 4M9UA 521PA 4EVQA 3UWSA 4WNAB 4RC9A 2VTVA 4IHJA 3ZHSA 1ES9A 2Q1SA 4WZBA 3QUSA 2C9CA 3ZI7A 3C6ZA 5EESA 4FNMA 2BEUA 4TS3A 2WJ6A 3JQ7B 1K8YB 2AV6A 1E32A 2B8EA 2C7VA 4JENA 2BKAA 5EJFA 4XQEA 1Y98A 2O57A 3EVDA 3OG9A 1CF2O 3S2SA 3SZ3A 1GAXA 1YRYE 4E3WA 2FJ0A 4R7TA 4J1QA 4TVKA 2C2XA 3KT3A 4Y2TA 3V7YA 2B4YA 4AP9A 5JLJA 1F17A 3L7JA 5FUYA 4RJIA 4WERA 1P3JA 4QYIB 1II8B 2FLVA 2ZYWX 4Y2PA 1FQKA 3BCRA 3GBVA 1M10A 2H7XA 4EL5A 5JYDA 3C4VA 3SZUA 3DNMA 1L5NA 3H9CA 3T1NA 3VPGA 1M83A 3ZPXA 4YH1A 1S7CA 2C3UA 2Q99A 1MAWA 1SO8A 2I80A 4L8WB 4ROSA 3HVIA 4YGXB 2O2YA 3I9LA 1X7YB 1JN0A 4L27A 2C2BA 3IT3A 3ZHCA 4B2PA 1LKZA 1VE5A 4S04A 4L9RA 5G40A 4U0KA 2PH5A 3FCOA 1JZTA 1VIAA 3K0AB 4GMGA 2YV1A 4FGJA 1W73A 1ZPDA 1Z17A 2DWQA 3UO8B 2WVJA 3LTEA 3ZTTA 1E3SA 1SEPA 2NSYA 3G2OA 4PCLA 2V9PA 4YRAA 1PFWA 1Y81A 4FE4A 5DN6A 5JH7B 2YFYA 3R1IA 2I8AA 1BXRA 4KV9A 4ILEA 3WL8A 4IIJA 4Z9BA 1U11A 1ZJ4A 3QVSA 5EXXA 4D92A 3VU3A 1EFRD 3E7XA 2J3IA 2QTVA 4GXTA 5EZYF 5C0OE 2WSIA 1BWPA 3NCTA 2GYVA 4NMXB 2QDKA 1STOA 2GARA 2GN0A 1WXWA 3B12A 4HX2A 4QRIA 4D45A 4ZEMA 1ZW1A 1TA9A 3TNYA 2RC5A 1XDGA 4MQFA 2Q4RA 5EEGA 4E0BA 4BEWA 1U65A 1A82A 1CZUA 1L2TA 2XUZA 1LVGA 2WD9A 1X92A 3G2KA 1Q3KA 4Y6RA 3WL6A 1RQPA 1TVKA 2OFOA 5U1PA 1DNPA 3VZCA 4JODA 2X9VA 4QVIA 4DA4A 4NONA 3BL6A 3VU1A 4RKEA 1WY7A 2A84A 1QHGA 2Z5FA 2QW8A 3L1JA 1QAQA 2GD1O 2H2GA 5C1OA 4YAKA 2XMSA 3P5SA 2CHGA 4C6SA 4NZYA 1DC5A 1TQHA 3CNOA 5I8ZA 4O5AA 1NN3A 1YB6A 4OHPA 5A1TA 2CT8A 2MHCA 2DFDA 1JKJB 4XD7D 3EEYA 1LC3A 2JG3A 1Q7TA 1SZDA 3PFKA 2P5TB 2PTGA 3QV1A 4Y98A 1J8DA 1DRWA 2LZ0A 2QM3A 1JKMA 3C7CB 1H2AS 2P6UA 5HBGA 1OF1A 4D1YA 3UUEA 3HGQA 1VRWA 1FUUA 2NTJA 1HE1C 4P31A 4DARA 4Q7KA 1USWA 2J5XA 4L5BA 3WJ7A 2PWAA 2WF5A 3C3CA 4X1IB 3EUEA 5AVZA 2PZGA 3FPAA 4KFUA 5D51S 5ED4A 3T41A 3QTTA 4ZHQB 1HLGA 1WXEA 3ZHTA 4OJKA 2HGSA 5IVHA 1C8LA 2K7FA 5GMOA 1Q7GA 3SZGA 3HDVA 3OQNA 2A0FA 1EPUA 2P6NA 1G18A 4U0JA 3IV6A 2FSGA 1TOAA 3QXCA 5CA0A 1DPFA 4CDNA 3RS0A 4IJKA 4R51A 1MA0A 3FNEA 2OBMA 5ICEA 1KJJA 2XGSA 3T35A 1FJXA 3WQSB 4F56A 3M6AA 4URHA 2QN9A 4EHKA 3SI7A 4LG1A 1UP6A 1L7XA 2B3TA 3KLNA 4YCMA 5JI3E 3OZBA 1FXWF 1SWWA 4N9QA 3ZZMA 4DF3A 2VH5R 4JSTA 1OI3A 3CIFA 4OM8A 3KSBC 5CK4A 3TLKA 3WC4A 4DREA 2R79A 3Q7TA 1K0FA 5FV4A 4MQ5A 2B5VA 4D9FA 1K4YA 2Q1UA 2IUEA 1JLRA 2X1HA 3WFZA 2BGLA 3E8MA 4Y1RB 1P73A 3NU1A 4B2IA 2IOFK 4R2HA 3TUIC 4BPBA 1Q11A 4JZYA 1EUCB 1G8YA 1UQTA 2G88A 3OIFA 4V0QA 3ZU6A 3U44A 2C7RA 1R37A 3LDGA 3KOMA 5ENVA 4KK3A 3GCZA 2NX2A 4EFDA 1X86B 3VO9A 2CJPA 2Z5GA 3KQPA 4KACA 3COVA 3CKKA 5DISB 5DM60 4P98A 4ZJPA 4EL0A 4QIHA 3OLZA 3PR3A 1RXUA 3BE6A 3FUXA 1XD2B 4MPDA 4D4GA 4CM1A 2R62A 4IWXA 3I23A 4Z9XA 3S1SA 1WEHA 1CU1A 1GCGA 2IHKA 1TW3A 3K94A 3OU6A 4DLSA 1APBA 3WHIA 4QJ5A 2Z8YA 3A7EA 4N65A 3P2IA 1L8XA 4FEYA 4TLAA 3VR0A 3DTVB 2IUUA 2DOKA 2OR3A 1W1UA 4XD7A 2EWMA 1KWGA 1Y1QA 4PBRA 2GERA 2FN9A 2W6QA 3RK1A 1P2GA 2AJDA 5JS2A 3CISA 4RMHA 1IZ7A 1M73E 3HCBA 1MB0A 5C4GB 1BE1A 3W2GA 1RM5A 2XAAA 3Q2IA 4X1KB 4E5NA 3AOEA 5K8TA 1KRXA 2X4LA 1VGVA 1O6CA 5AVUA 4DG5A 2YIDA 1SPXA 3OPVA 1GYPA 4G6ZA 1XWIA 3MWJA 3RC1A 3BQMB 1H69A 2C1EA 3K6KA 3KALA 1LPNA 3ZK9A 3LC1O 4ZN6A 3EMBA 4N03A 3QLVA 3PRKE 4DV0B 3D0KA 5EPEA 3HCPA 2QJTA 3U7IA 4ETMA 1YJQA 3BXFA 2H0AA 1XKTA 2BHTA 1PSZA 3F7OA 1O54A 3RVPA 1HT0A 2PM8A 2IJGX 1MHPA 3MCAA 5THXA 1J06A 5KKCA 1C8BA 1SD1A 3K53A 2BKVA 3L0DA 5ER6A 5HR5A 1EFRA 5AK5A 4K40A 4TVSA 2JC3A 3GLSA 3WP1B 4A9AA 4I5IA 3UGJA 4JOQA 2AK2A 3EUWA 4L6CA 1SKMA 3PQ3A 4V3CA 4XYBA 2VRCA 1TPYA 1U0GA 3E3OA 3GZJA 2WMNB 3HUFA 3LYHA 5JPCA 2WM3A 1Z6ZA 3AIOA 3STTA 3W1VA 3WQRA 2C2GA 2D2VA 3C5HA 3FDZA 4Y18A 3R5SA 3WOVA 4WBNB 5JJLA 4TMFA 3E3NA 1RXYA 1JVBA 5HHTA 5BR8B 3LP8A 2FQWA 2G1AA 3ZCQA 2FDRA 2GVDC 3KB1A 4N0EA 1DINA 1K9VF 1ONNA 2IDJA 1EWRA 2ID9A 3D9QX 2V03A 3BRSA 4HLCA 1CXZA 3VM6A 4X65B 4G5YA 3MJTA 4HZUB 4EJMA 2O1EA 1K63A 1CX9B 1GR0A 1NQOA 2J9YB 3EVFA 2JFHA 3N8NA 3T9FA 4BJ3A 5CCBA 3WXMA 2QLJA 3BA6A 3DE2X 1H2YA 3TIVA 3Q41A 1GZ6A 1ZS9A 1BFUA 3JZMA 4HGRA 5TPZA 2L19A 4QKQA 1JT9A 3IC5A 3ILYA 4R16A 1C50A 3EXIA 4BU1A 3M6UA 1PJRA 2VOEA 4UNIA 3PX2A 1YE3A 2HDOA 4FXPA 3OF5A 2XZPA 1A8PA 2JGFA 4ZVPA 2BGUA 3G8YA 2AB0A 4EJFA 1GCOA 3UJ7A 3ORYA 3QX7A 3K70D 2ONYA 3QJ5A 4IDCA 1OFUA 4Z4FA 1AM4D 2AJBA 3GLQA 1U98A 1EVJA 2ECQA 1VKHA 3MMZA 5AKHA 3KE8A 3CHYA 2IFTA 4EA6A 1J1IA 1EU1A 5FPYA 2PPVA 3PJRA 2BGNA 1IY2A 2CFSA 4EJSA 3TB4A 2Z58A 4XDZA 5A1JA 1F2UB 4R40A 5IN4A 4E4TA 3BULA 4NMWA 3MUFA 4ZK6A 1SKQA 2WMOB 3UCFA 5C8ZA 4NZZA 5K9ZA 1DRJA 1WUKS 3B53X 5B3AA 1T43A 4ZFNA 721PA 1UBFA 2CLLB 3DMFA 2P4EA 4B3MB 2OC4A 2DUMA 2W2TA 3CZRA 2WFMA 3AF6A 4N5NA 3LDHA 3VYWA 3KPUA 1SH7A 5JS1A 3OURA 1SVSA 3IEMA 4GP7A 4QDKA 2C94A 4I6GA 3WZ2A 1E66A 2CMFA 4KVFA 1T1RA 3OQIA 3QXJA 1X7YA 1FU8A 4WVLA 3O26A 2XB6A 1TMGE 1Y4SA 1WV0A 1J24A 2LXNA 2PIDA 3B2EA 3IUBA 2FQQA 1E2UA 3IP9A 2LD4A 3KPWA 1W59A 4M2LA 4U7WA 1ISFA 1ULAA 2XLCA 5DTJA 5IAKA 1L4LA 1VSBA 2HXSA 2IYAA 3NHLA 3D5EA 4PPGA 3RUEA 3RSOA 1PD0A 2ZOSA 4AU1A 5I9IA 1G8FA 1QZUA 4IICA 4TLMB 2R6DA 3LUGA 1PZEA 2J32A 5AJXA 2OHFA 4CNQA 4TSKA 2ERYA 4YECA 1Q84A 2E4ZA 2PO5A 3U09A 3K5HA 2GOYA 3SEFA 3GWZA 3FWPA 3NHFA 5A6SA 1UODA 2Y67A 3I2GA 4HFRA 5F1PA 5AW8A 2AOUA 3DHEA 1BRTA 4Y1GA 2K2QB 4XYMA 1R0BA 3FB4A 3G2JA 5IJ0A 2XKJE 3VYTB 5I48A 1H9BA 1PJ2A 4NOJA 4AWXA 5JNTA 4RTLA 1JSLA 1FUEA 5JCOA 3U13A 3SJZA 1ZH0A 2JIPA 2VC2B 3E58A 1TLFA 2E21A 2VF7A 1MQ8B 3PC8A 4GIBA 4PONA 3TOVA 3NDBB 2M1XA 3F9CA 3PQFA 3SMVA 1FFXB 4XWYA 4MW2A 4YK7A 5EWLA 3T9CA 4ZI7A 4KVAA 3U40A 2C03A 1KDZA 1D9XA 4A27A 3EOZA 5FTNA 5LMZA 3IE1A 1PVOA 5BUSA 4Q3AA 2LNDA 3LXMA 3I6QA 3OD1A 5JROA 4DBLC 2A30A 2FDCA 4XUDA 4XX0B 3R9IA 4G5GA 4IDHA 4UNPA 5LLSA 2OWDA 1G5QA 2WTEA 2QENA 3O0DA 4IUYA 2M2IA 5JQWA 2GBFA 2DTXA 5J4LA 2GHIA 1Z8DA 1P62B 4EATA 3N8DA 3CUWA 3HEBA 1GWNA 4QWWA 4UUOA 3JTEA 4AYWA 3CPSA 1DELA 3OJXA 3VTAA 3SFZA 1MO5A 1N5LA 2EBWA 1QO9A 3CG4A 4RDCA 3Q9SA 5HF5A 4IH1A 1GNRA 2L69A 3PNBA 3QK7A 4J2HA 3ADOA 1HZJA 3TMAA 3K8OE 1V4NA 4XWAA 2OD9A 1RZVA 1TVKB 3LT4A 3Q9LA 3KUKA 4BEVA 4AWBA 5B58T 5TVKA 4JLMA 4KGDA 2XDQA 4WCFB 1F8UA 1C1HA 2XA1A 1P0PA 2NOAA 2ZRLA 1JFVA 3BC1A 4K9NA 4C21A 3U62A 1P4GA 4Z8YA 3HB9A 5FTLA 1X1SA 3I2IA 4MXDA 3BDVA 4F12A 4RZ3A 4YALA 1CB0A 4I50B 5TQ2B 1Z16A 2VS1A 3BIWA 4I4LA 3NUGA 4QO7A 4NU0A 5BPFA 3ODGA 5GVRA 4AJ2A 2YMLA 1Z45A 2C9DA 3UICA 4PGFA 1GG8A 2I7XA 3IRUA 3GLIE 2FRDA 4AMZA 2C8KA 1ZRSA 4H0CA 1OI2A 5LN1A 4KQKA 3MOIA 3ZBTA 4MDFA 2LR0A 4EMSA 3PNPA 2WU1A 1LBQA 3STUA 5FADA 3FZNA 2JLBA 2HMTA 3URKA 2COEA 4BOYA 5K3BA 4IFBA 2C2HA 5A0FA 4HB0A 5ESRA 1O58A 1D2EA 4PN7A 1EFPA 4EF5A 1Z18A 1EI9A 1JDBC 4PTLA 4TTAA 5GJWC 1J20A 1XD2A 2GF0A 4XYGA 4D99A 3HZZA 4YX9A 3W1EA 5B1YA 5CD9A 5KEIA 3S6JA 4BZXA 5KTRA 3BQ9A 1VHTA 3K70B 2GKGA 2PXCA 4MCJA 2ISQA 2JA1A 1DX9A 3E1SA 4N5DA 3F3MA 1P74A 2BEVB 1T0UA 3TZCA 2B8WA 2AL7A 2C4WA 1W2GA 4RK6A 4D8UA 1YR7A 3DOFA 4HDCA 5F2NA 2KW5A 1W4CA 4L9WA 1H2WA 4RORA 3V32A 3WLRA 3MAAC 2GESA 4ND6A 1T13A 4B6FA 3O74A 5AVYA 4BO2A 1SUPA 2IA5A 3B13B 3TQSA 5F33A 2EP5A 1EK2A 2QHXA 3IPYA 4J76A 3FF4A 1GEEA 3IH5A 5DLPA 1V7QA 3E18A 1M8KA 1W49A 3VOAA 4YT2A 3E4DA 2O7SA 5SZIA 3K0KA 1ISMA 2O23A 3LUCA 4MRVA 3RUCA 4XRGA 4W1RA 1J9ZA 2BTQA 2P4QA 2VDJA 4I1IA 5F52A 1ADFA 3HCNA 2YIVX 1IJFA 1SZCA 2WYWA 2XQIA 1NVDA 2IX9A 3F98A 3IAS1 3L6RA 1M6NA 3IP7A 2I6UA 3DGEC 4X63A 3ZJVA 2Z4SA 1C7IA 4JR0A 4KEAA 2QE7D 4E13A 2Y1XA 3T7CA 1SKUA 1AKTA 4MDEA 1KO8A 2P0AA 2P9YA 2Y2VA 3QBEA 4OQXA 3FYUC 5FUWA 9LDBA 2ZU6A 3ON5A 4GMKA 2W7TA 4MQ4A 3D8NA 4EGFA 4MI1A 4UDNA 4QOJA 4RTJA 5JXIA 1I1HA 1NBME 4I46A 4RAQA 2RBEA 1ZGGA 4LJ5A 1NQ5A 5TF0A 4ENSA 5BSHA 2RHTA 3QOFA 1DRUA 4EB0A 1YS9A 1Q0ZA 3SICE 3UV3A 2WIDA 1V3QE 2J30A 4S05A 1VG9B 2IIBA 4M60A 4YAGA 1NFRA 1WEKA 1H3FA 4UHBA 1Q95A 4BGUA 3WWDA 1MHTA 2C00A 1VTKA 3TSCA 1H2ZA 3PUWA 5AM3A 1IQ0A 1QGDA 4KPUB 3W04A 4NENA 3JQ9A 1HMYA 3L8HA 1GO2A 2CNOA 4LZZA 5GQSA 1VLVA 4L5AA 3DZHA 3KLOA 4XSHA 4LF7B 3EZ2A 3K0BA 2QN3A 3VI3B 2YNMD 3N0XA 3KSAC 1F14A 3LVFO 4G8CA 4TZKA 4WIAA 2QX7A 1BGXT 3RRXA 2V5VA 2W4QA 4TKUB 1ZEMA 1NU8A 2JAOA 5FX2A 1UINA 4TS4A 4EO4A 2NU6A 2VF5X 1ESEA 1V3TA 2GAIA 1X7XA 3EXG2 3F74A 1SG9A 2HK7A 1QF9A 1M6WA 2AFIB 2X0JA 4B6GA 1Z88A 1J90A 2CUTA 1T24A 1NVWQ 3AL2A 3RAPR 4GI1A 1ZD3A 4EMTA 1GPLA 2HLDD 5C52B 3L02A 4MVJA 3FZEA 2W98A 4X7BA 3HRIA 4K5QA 4CUZA 3EEOA 2UVDA 3PGLA 2R8EA 4O4JF 3S0JA 2OCIA 821PA 5GINE 4BKRA 3R9XB 1KYZA 2JGIA 1R0WA 3RFCA 4EHDA 2O5RA 3C8ZA 3C5EA 1JEQA 4TUYA 4IYJA 5FA8A 2NU9B 5CB4F 4Z7NB 1NI3A 2IXFA 2QVYX 3BK2A 4QQKA 5BOVA 5T4HA 5CB0A 4X1YA 3AINA 1T9KA 1AT1A 5JT1A 2AG8A 2XUDA 5DFAA 5EY5B 5JNWA 1FUIA 3RF7A 5AVVA 1PKXA 1Z34A 5BSEA 1XEWY 3M4NA 2AYXA 5CP8A 2VDPB 1GG5A 3EODA 2HWYA 1K6XA 1V71A 3OP4A 5KO2A 4TTSA 5B1IA 2BW0A 3NI2A 2JIZD 2ZBVA 4DL9A 2LRHA 4L4XA 1XVIA 4OBEA 3TUZC 1GTSA 2HU8A 1MENA 5EFOA 3ED5A 1J0EA 3UJPA 4FT2A 3RVQA 3HWSA 1V1RA 1XEWX 2EQ5A 3IOYA 2DERA 3T3GA 3MD0A 4EX6A 1V11B 3NM6B 4KAFA 2WJZB 2D2FA 1QHNA 4RDHA 3CRW1 3KPVA 4ABTA 2PWYA 2MU1A 2QBYA 5EINA 1YJBA 2CV1A 2OV2A 4IDNA 4K9LA 1JR3A 3QKRB 3IAEA 4Y9DA 5KMGA 4NAUA 5EKSA 1GUYA 4PGGA 1H1LA 1RHKA 2IYSA 3IURA 1X7HA 1PSWA 1VRCA 1CVRA 3MOSA 1JIKA 2W22A 4U3JA 3GOQA 4G36A 1E1QA 1TZKA 2AFVA 1YS6A 3ZW7A 2VKQA 3ASZA 4LRUA 2A57A 4QFMA 4E5MA 2AOWA 4GI7A 2N46A 4G1UC 5C2JB 4CETA 4V03A 1XKLA 1NXPA 3C15C 5JUWA 1YJXA 4UM7A 4PQRA 2IZ5A 3N3AC 2XTZA 4MS1B 2BFFA 3NVKI 4H27A 2ZVPX 2PUTA 1RAEA 2Q8NA 4G81A 1VB5A 4ZZIA 2E7ZA 3H5WA 2QR2A 1JA1A 1MEJA 2XRFA 4Y9TA 5F76A 4P7GA 3HKDA 3BGIA 5F4ZA 1E4YA 1U3TA 4B3HA 1B8UA 2G1UA 1E96A 3JWPA 3SP1A 1EJ0A 1PD1A 5KX5F 4O4JA 4NULA 3G5TA 2RK4A 2WM2A 3BZBA 3BD8A 4W8GA 1I2BA 4MKIA 4Q16A 5J2UB 3D0QA 3PX7A 1SIOA 4PZPA 1DEHA 1Z4JA 1KXJA 2BGWA 2G1PA 4FN5A 3TKLA 1E9CA 1DAOA 1QHHA 4PO3X 4RIGA 3C7KA 4B87A 4OLFA 4P93A 1XXHB 5KWEA 2K7ZA 1JU3A 4AO7A 2V6MA 2QKYA 1EFAA 4MJ3A 3IAM1 4RYLA 3I9NA 1MO3A 1UWLA 3MJDA 1ZKMA 2VEDA 3MWEB 4U6SA 5TS3A 3NBUA 2R4UA 1RC1A 1Z4OA 3PGJA 4WCFA 1V8PA 2XB4A 5CH8A 2PZLA 2IIVA 5EIFA 5E4YA 3ZYCA 4DCUA 3KUUA 3B9PA 2HMYB 3TFWA 1FX0B 2JB9A 4KUGA 3WLPA 2BI4A 1ZD1A 3D54D 2ZJFA 3QYPA 3WQHA 3KLPX 5I01A 1Q1GA 2EZ4A 4HT3B 2O3SA 2PZ8A 2COKA 2ZJ2A 2VVTA 4MTLA 1G5IA 3V1NA 2WD7A 2AEEA 1G8AA 1N2CE 1Y63A 3UW3A 4CG3A 3BX1A 1LWOA 3B1JA 5K2MA 2QTGA 2CD7A 1FDVA 4GBMA 1UJ5A 4ENTA 4KPEC 3ICPA 2RHGB 1XOIA 4JJ6A 3WHPA 3BWDD 1IIRA 2QLTA 1CY7A 2YBDA 1ZCFA 5ILOA 4O2AB 4X95A 3TXYA 1WZEA 1XRSB 2AA3A 4N48A 4BBJA 4UU0A 1NR1A 1UDWA 4H4CA 1D1SA 4NBWA 3VR6H 5INTA 5ELXA 1PGOA 4JBLA 5CGZA 4PC1A 4RZUA 3OIGA 1NATA 2OO5C 1EXNA 2CMDA 4WKCA 4HN2A 3ZE9A 3GDGA 1BCSA 1Z0SA 2C95A 1OX5A 2QMEA 4J9VA 1SXJD 1WPXA 5D3KA 5FI3A 1XV5A 5J1TB 3RJ9A 3QX3A 1U63A 2ZUEA 3R9WA 3OA0A 1CQXA 1SQ5A 1AGRA 1GFZA 3N2KB 1T25A 3TFQA 1A2QA 5EE9A 4X45A 1C7JA 4OHWA 3CN9A 4IWYA 1LLQA 1T2VA 2PX6A 5TPWB 4A92A 4BFTA 4NXMB 3LUFA 1I24A 4FHFA 1PX0A 2RG7A 2PYIA 3VR5A 3QJYA 1H6AA 3H4TA 3NIWA 3FGOA 4HAYA 1FNMA 4J1NA 4BLVA 2G5TA 1OVGA 3N8HA 1WDLA 1ZH2A 2XVAA 2DCMA 3CUTA 3LYLA 1WHTB 4GC9A 4RESA 5BN3B 2PY6A 3KSMA 4WLEA 3ZGVA 4DMLA 1FRNA 1YZTA 1E60A 2W90A 5EVCA 1F20A 1OWNA 1RE1A 5F73A 3L07A 5COQA 3LF2A 3PDWA 4JA0A 1BXKA 3UV7A 3WYDA 5HM8A 1Y6QA 2GJ9A 3RREA 3S1AA 2I4NA 1ZICA 1LDNA 3ITDA 3U4QB 1NL3A 2NVBA 3FI0A 3ECAA 1LDEA 2IYQA 1L4BA 5JYEA 3K9CA 1ZN9A 1KQOA 1YCGA 1EVZA 3RWOA 1ZW6A 1WLYA 4MGKR 3ONNA 3SHQA 2A7XA 4WLOA 3W79A 1CRQA 4QC2A 4FK8A 4WN9A 2W6ID 4XDHA 1W19A 4BKMA 5EWMA 4JV5B 3B3AA 3RSGA 3EHEA 4UM9B 5ECWA 4QTUB 2X5KO 4AZWA 5IK2A 4QA9A 3H9EO 2H4YA 2B69A 2NUTB 1Q6YA 4JL6A 1O6ZA 4OX9B 1M34A 3EH1A 2YJTD 3K0HA 4FFBB 3IB3A 3D8RA 3ZKWB 4C29A 2EZTA 1W5SA 1UXOA 2I5PO 4LJKA 2GWRA 4ND5A 4XEUA 5GV8A 2OL4A 2G9NA 3M1IA 3RVNA 4BNVA 4BTLA 1VXRA 4OP1A 4B3JA 2WM8A 4MVJP 4BIMA 3QW2A 2XJ4A 4R1NA 4AZTA 1JJIA 4QJ3A 1UBMS 3OX2A 3ZTWA 4DWVA 3D1LA 5JJIA 1HC7A 2RGYA 2VP6A 3IVCA 1C9NA 4X92A 4BRSA 3HM9A 5DTIA 1GNLA 3E22A 1YVEI 2HTEA 4AZ0A 4BNZA 3AJEA 3UK6A 4CV1A 3EPLA 2OO7A 2IZ1A 2ZAYA 3HDHA 3LK7A 3PA6A 5KWSA 1E7MA 2AGVA 1K97A 2V7QD 1SCJA 1FFWA 4ZTUB 3L6OO 4FJ1A 3BSSA 4BO3A 1RQ7A 1OJLA 1L4FA 3DULA 2VSOA 3PJDA 4G4GA 1P4RA 4JC0A 1DBIA 5BYJA 1JLSA 2I6XA 4DB2A 4M53A 1CEQA 1L6RA 1DAEA 1YACA 3JRWA 1Z68A 1TD1A 3KFXA 1UMBB 4KSCA 4RZHA 4JUIA 2EKLA 2INGX 4H4DA 1QUFA 3FKSA 1W48A 4U63A 3I92A 1VJGA 4W82A 3W3AH 3WBFA 1OB5A 10MHA 1Q1BA 4J0IA 4RTPA 3NHSA 3A4TA 4FMCB 1T1IA 5HKKA 3T0FA 3QTBA 1GU0A 3FOFC 1G3QA 1VL5A 4LRQA 4UQPA 1DGQA 3DV0A 1FRZA 1P3DA 4UTRA 4NCNA 2MIIA 4LJRA 5A0TA 5DYIA 1AF7A 2CBXA 3PIDA 1T8TA 3BMQB 1I2CA 2B35A 3FVQA 2AOTB 3WGYA 3FWNA 1FMLA 1CR0A 1Z0FA 1PWEA 3K9GA 3VZPA 4MSUA 4D4KA 2J4FA 1DO2A 3L4SO 2A5DA 4MK4A 4PN3A 3VSBA 4C3OB 1YNSA 2R2GA 2O50A 3D6HA 5SZJA 1PEDA 1ZYUA 3B85A 1J56A 4Z1MA 2A5LA 1TX4B 3GRVA 3U1TA 2C4KA 3AEQA 1BOOA 3DLTA 4MW4A 5JAQA 5CFOA 1VBFA 5JEDA 3EWAA 4R2LA 1NPTO 2BCGY 2R6JA 4O2RA 2CVOA 4JFRA 1TYCA 4AN1A 2Z83A 1PLJA 1UT6A 3D0OA 1AKYA 4GSLA 4RQTA 3A28A 5L3RA 5B55A 1IQPA 2PZFA 3DDSA 3L3BA 3H2KA 4EENA 1L9XA 3UJDA 4RVHA 3P9IA 2I87A 5HCIA 3SJCA 1N8TA 2OFFA 4DNOA 1DU4A 5EMMA 5LSAA 1R2QA 1L4GA 1QJ4A 5HK8A 5FO0A 3A8TA 1MU0A 3G0GA 4NBLA 4QFDA 2FUEA 4RM3A 4ARIA 1N6KA 4KRYA 4F6CA 5JDIA 2YC2C 3TR0A 2GI4A 1Z0JA 3DLCA 1YZVA 4GKBA 4WZBE 5BPHA 2H1OA 2FZCA 3DLHA 1OZFA 4MHOA 1RWPA 3U48A 3N28A 5HIKA 3CEAA 1UMCB 3THYA 2PBFA 1OOEA 2VG8A 3PLRA 5AUOB 4L9SA 4BMNA 1MIOB 3FPJA 4X84A 3TLGA 3MUOA 1ZUD1 1E2GA 2ZYVX 1IN4A 1VHWA 2FN3A 2RMKA 4RD4A 4FFVA 5CW2A 3NX4A 4HH3C 4MLDA 3UH1A 3V8NA 2KJQA 3WI7A 4DTIA 3JZFA 1N2EA 4LJSA 3IVXA 4G23A 4PPFA 3GD7A 1OBCA 5L7WA 3BWCA 1J7KA 1SMKA 2HCTA 4ENWA 3FKJA 3B78A 2IUSA 1DRKA 1S01A 4OM7A 1IVNA 4RNCA 1ZH4A 3IO3A 2XA9A 2YMQA 1T1JA 2I4LA 1QYCA 2OBNA 4JT4A 2B4AA 5JAMA 4DNXA 5IS2A 1LI5A 5F77A 3VR5D 3TVYA 1PR2A 2FE1A 2XHEA 3DSRA 1AK2A 1ZJYA 3AI2A 3E1KA 3HB1A 3NYIA 3P9KA 3DE5X 4MGYR 4YJFB 1DAGA 1K98A 5ADWA 1NVUQ 5ENDA 4BVFA 2G6TA 4GF5A 2J4CA 2H1LA 3QVXA 3RK0A 3ZD9A 3R20A 1RLMA 1J9EA 4HWKA 4U2GA 4UDXX 1VECA 4EB3A 2ZR8A 3FNHA 4L8VA 5KOJB 2GB4A 4BCDA 1U0HC 2GBGA 4N47A 4D9HA 5LA6B 5TV2A 4EY4A 4A36A 4TKZA 5DI9A 3ADBA 4XIGS 4FTWA 1H1LB 3CZAA 2FLKA 4ZT3A 1Z07A 4DMUB 3TCKA 3UAZA 1M2WA 1DDGA 2Q2NA 3L79A 3SNHA 3OT5A 5FP0A 2ZFUA 1PWYE 1E2NA 2Q1TA 2CKMA 3V2HA 4ICIA 2GTHA 2VHCA 3ZQKA 1QS0A 3QOYA 4F45A 4EM6A 3FTEA 1SVIA 4MS1A 3A6PC 1R9MA 3FROA 1M1XB 3F47A 4IFEA 4R8MA 2Q4DA 3FNIA 4ND2A 3WGMA 3ZDXB 4DR6B 1VHQA 3RJZA 5AFSA 4FBMA 4B3GA 3IDAA 1GLGA 3WP0A 1IJEA 3EF3A 1SVMA 1KO7A 2O1SA 4QRHA 4PZCA 1KAOA 1XALA 1QIDA 1G2PA 4FYIA 4QREA 3M81A 5CVDA 3W3ZB 4AT1A 4CQMA 3T3HA 4EPRA 2GXUA 3LX6A 4OMFG 3DMPA 1Z0UA 1V96A 2UXBB 3EMVA 3T99A 3W2IA 3ZLVA 5IDWA 2Z56A 3E5HA 5AW6A 3L06A 4LDQA 3ROZA 1G4AE 3G59A 4RHYA 1ETHA 5LQJA 3TDNA 3EBLA 3FYHA 1A9YA 1JIUA 2BHNA 2QV0A 1N5JA 3O94A 3ZDFA 3EASA 2NAFA 5JLAA 1T1EA 3ZY4A 4X00A 2OUKA 3RIGA 3ONFA 1ML4A 2A3NA 2YVQA 3PDIB 1XTSA 4MVJM 4UPDA 5CXSA 4BJHB 1V2GA 4KC0A 4KOAA 4DA9A 4UASA 2XWPA 4LJ7A 4YAUA 2BN4A 1S8NA 3DTVD 1YVUA 3H1AA 4HNRA 4GPIB 1BX0A 2C88A 1L5OA 2CLOB 3PJFA 3T38A 1Y5RA 1GGFA 4FLEA 4O63O 1TJ4A 5J5CA 3IP8A 4JNCA 2ILTA 3CT6A 4DZZA 5FPKA 4HUJA 2VBCA 4D74A 1ST2A 4B3XA 5T4EA 4Q4DA 9ATCA 1IWPB 1MB9A 4UU1A 3JAKA 1QWSA 2QZZA 1J4AA 4IZOA 4PFJA 1KU0A 1UDBA 5KHOC 2W6MA 1S8FA 3E9MA 5KNDD 4GPD1 3G2LA 5B37A 3ZW9A 3EJ6A 2ASVA 4BCBA 4XWWA 1BAPA 2NZUG 4EGCB 1NOJA 1N2IA 1GRVA 2PN1A 3KUXA 3M0EA 3MCWA 5EJIA 2EJTA 5B57C 4PTYA 3LA8A 1X7GA 1XGKA 2DBZA 3E9RA 5FLEX 3QOXA 4JB8A 1SC9A 4MGZR 3VNSA 3LGXA 4IDPA 3OFKA 3AUSA 1LCIA 2LBPA 4D97A 5GWXA 2A3RA 4IXNA 2WJ3A 1NE7A 2XD9A 2O07A 5GZ1A 1MV5A 1LC0A 2EGGA 5K0BA 1SHKA 3DFMA 1BRMA 3TNDA 5BUCA 2A0XA 1Z5ZA 1ZP6A 2A0UA 3OPYB 5FHQA 1IEWA 3HP1A 3L7IA 2G0NA 1SKAA 1S02A 4RD2A 1IOVA 2VP4A 5J59A 4COOA 4MW1A 4KSBA 5IAEA 3OBBA 4NMLA 5ANRB 3AJAA 2XDAA 1V25A 3H3JA 2DHQA 3UTDA 3E81A 1QPGA 4PYIA 4X8HA 1WMDA 2FPPA 4G5OA 1NRXA 2R60A 1EB9A 1WDWB 3A05A 1XA0A 1H2XA 4XD2A 2JFXA 4N6OA 1SN7A 3OX4A 4GKJB 3U3XA 1KJWA 2AXNA 2PNFA 5HJ2A 1N6LA 1V1JA 2QIOA 3VSCA 2OV3A 1KHHA 2P2NA 3EYAA 1VHJA 1F2TA 1M1YE 3GLVA 4NWIA 4LECA 1TDJA 1NXXA 2V45A 1NJ2A 3QLEA 4MYTA 2NYRA 1L5ZA 3RQIA 3TL2A 1XQXA 5L9AA 1QGOA 2F48A 3GELA 4KFSA 4UULA 2EX0A 3FCSB 2FMKA 4AJ9A 2FMTA 1GGJA 2BWJA 2BJHA 1P9LA 2BMWA 4PIVA 2X8LA 1FDTA 4GSYA 3BL8A 3RNOA 4V02A 4QDZA 4YUAA 2IF0A 3DKIA 2PD3A 1NXSA 1ND6A 3ZDRA 3B7WA 3FAKA 2FCAA 3HG7A 2ZYHA 2EJCA 1JWAB 4O2BF 1ESCA 2A7QA 1GKIA 1W88B 4PC3A 2VUIB 1G60A 4PYKA 1VG0B 3R3SA 4S1VA 2WMYA 4GX5A 1XXHE 1ZIOA 4QUHA 1NMZA 3RC8A 2IPAB 4MLCA 5LOVB 2OGTA 3OCCA 3TJZA 3OLCX 2N0SA 1QX4A 4OLBA 2A9KA 1OI7A 3KOZA 1XEXB 1VP3A 3QYAA 5JATA 4FP9A 4L0MA 4NBNA 5B4TA 4C7MA 1N4DA 1QYRA 2MYTA 5L95A 3PXAA 4R7ZA 1IH8A 1XMJA 2HK8A 3HJHA 1YQQA 2I2AA 2JW5A 3H0EA 5GOZA 3UV6A 2I4OA 3V97A 1QU2A 2R8OA 2PT9A 1FP6A 3OFVA 4K26A 4NXNB 1GU7A 1ZVVA 1O1YA 3DWGA 3UMBA 1AIPA 3LAWA 2DH6A 4YTEA 4BO0A 4LSGA 4Q1FA 421PA 3AWIA 2VDWB 3KDPA 4GDFA 1BVUA 5DYWA 1OU0A 1E9BA 4EW1A 4IHKA 1N78A 5TLSA 3EA0A 4N0MA 1GRRA 4Y9SA 4QVKA 1NHWA 4F93B 1GKYA 1XZEA 1MAVA 5AI8A 1T0HB 1MG5A 2AE1A 3E82A 4TL9A 4R4JA 4ZVRA 2R44A 2HI0A 1QIJA 2QG9A 4A10A 3U7RA 1ZI8A 3NDIA 1S1CA 3O1HB 3QUCA 3A4IA 1ZC4A 4ZCSA 3EMDA 1WXDA 3V4LA 4TM8A 1UJNA 2A5YB 3HPQA 1W96A 1DV1A 5EMNA 5SYMA 3PPIA 4RVCA 2C1ZA 2EARA 2NWQA 5ALDA 1GR1A 3HJTA 1E2KA 3PDHA 1H6CA 2AOTA 2X9QA 3FE2A 4N7MA 3SVZA 5JJBA 2G5CA 4QXPA 1JVNA 1IY8A 3DZ8A 3I1FA 4FIDA 1YBHA 4G63A 1QPBA 4UPVA 3KZMA 3O4GA 4W9NC 3OESA 3WLSA 3PI6A 1PJZA 1Y8QB 2YZ2A 4XLTA 4CLRB 3L7AA 1JPVA 3ACDA 3A4NA 5FYDA 2Q2OA 4MUIA 3TPFA 5HM6A 4NMMA 1N0UA 3HDTA 3QPWA 4CIBA 3QXHA 3NB0A 4C22A 2A9OA 4L5CA 4JASB 3KDSE 1UXHA 3KYJB 1UPBA 1FXUA 4R1UA 2ZTHA 3U4HA 4MV7A 4Y9RA 3ZEAA 3P9QA 5BNFA 3HDYA 3NGXA 2FFRA 3PB3A 1ZY2A 2NADA 1H9CA 2DZDA 4Z3KA 2F8LA 2H1IA 3NOOA 2VYCA 4PYLA 3TD9A 1Z62A 4FYKA 4HVLA 5KINB 4TQGA 3HY6A 3R0QA 1HL7A 1ADYA 1R15A 2TECE 4AZ3B 2GDJA 4EG4A 2IS1A 3WS7A 1X1QA 3U0BA 4L16A 2J0VA 4Y2GA 4BGDA 4S1TA 4BFLA 1ISHA 1U31A 3WYAA 2GJKA 2G1JA 3D4PA 1W30A 2OP1A 5GGYA 1WP4A 3LM8A 1T5TA 1YGYA 3T1YB 1YL6A 3N6XA 4B46A 4ZAVA 1YS2X 2W2NA 7GPBA 1NW4A 3IPLA 3O8QA 1TYBE 1ZESA 4L0CA 2P40A 1OQAA 2C2ZA 1T91A 2O8DA 2X8BA 4D8VA 1KZ1A 2R6HA 3LCRA 3JASA 3NKFA 2MCFA 1NF9A 1XNJA 2VAMA 2C5HA 3TZ6A 4EEKA 2WZCA 4B7XA 1XN4A 3G0DA 4LZOA 1L1RA 1X9HA 4NYMR 5DM1A 3HR4A 5A4IS 4GXRA 4KHZA 1NVMB 5F3RA 2R6GA 3HYRA 1M7GA 1QLWA 4XGRA 2GXQA 3LQRA 1U9ZA 1YA6A 1FSPA 2HT1A 4YPVA 1OGJA 1IWOA 2XH8A 1CDZA 2XWBF 4PHHA 4C6TB 3Q8KA 2A8YA 4OU5A 3DV9A 4KXLA 4HO1X 1D2NA 5FWAA 1I4WA 1K8ZB 2KWIA 1EP9A 4E3ZA 1JILA 1ZM4A 1PT9A 1XTPA 3FTQA 5DBHX 3BVPA 3B6JA 4CF7A 5EHZA 4QBGB 1BQ3A 2C9OA 1E9SA 1I1QB 1K7CA 1ENPA 1GNSA 4EUKA 5HZKA 3I5AA 5IT5A 2QRQA 2JATA 4YMSA 1VXOA 4BVKA 5AOCA 2E49A 3VC1A 4Y1FA 4Q3BA 3I0ZA 4H9GA 1CQWA 3FLMA 3PUHA 4H2DA 5H3LA 2IE0A 3FNBA 1AQNA 2IS4A 3T7TA 4IS2A 3G2IA 4F60A 4V24A 5BXQC 1BVYF 1SK8A 2NVWA 1TO6A 3UKDA 2IIQA 1KZ9A 3NBXX 2ZPTX 1A8SA 1NMXA 1SC3A 1Y3CE 3A6LA 3G0IA 4IKOA 4ZVVA 2WI8A 2GPBA 3BERA 2BSQA 4MVJG 4B8ZA 2ATVA 5B7PA 1B0ZA 2O2CA 3USES 1NONA 1A9PA 1VJTA 2ZUFA 2ZCJA 1XO1A 4PR3A 2NUAB 3O8DA 5DHUA 4WZBB 4QYIA 2AN3A 2NMVA 2AJ8A 1FL9A 3ME5A 1H42A 4FDAA 1ZZEA 2YHUA 2YJNA 3OIUA 3OQJA 1QRAA 3A70A 3NLLA 3TLBA 6NULA 5HRUA 1GNPA 3GQVA 2GKOA 1H2RS 3OIVA 3GA5A 3NT2A 5ESDA 3ZJTA 1NVAA 3VR2A 1HFWA 4WQMA 5MF6A 4B34A 2X5XA 4R0MA 4EA9A 4U5XA 3K70C 1JHXA 2N3ZA 1JJBA 2GF9A 4OXQA 5D7NA 2OPHA 4CM8B 2D2EA 2HPVA 2KBFA 4KWCA 2XUHA 4OKNA 1G20B 3T5CA 4RH1A 4RJTA 3LPLA 5AR1A 4A6PA 1E6UA 4B71A 4UE2A 1YDGA 2AW3A 3I1IA 1HNNA 3FYCA 2YHBA 2W2KA 4IFIA 5AXCA 3UBMA 4U02A 1S3FA 2X23A 1NUQA 3AKDA 4IIDA 3JD1A 1U0SY 3PQDA 3RARA 4AY5A 1PUJA 3CZ5A 1DJOA 3JYQA 2C9ZA 2WLSA 4DW8A 4P92A 2XQFA 1X38A 5TX7A 4PC2A 1OW3B 1G8PA 3BRCA 2UUAB 5IC5A 2W9XA 2VSFA 1U2QA 2PKXA 3PNKA 1W0JA 1ZA1A 4FEAA 4FD3A 4II3A 4U7FA 4D80A 3ZDCA 4HJRA 2D1FA 2QLBA 4NESA 2E2WA 4UKDA 4TXNA 1H05A 3AVQA 1IXSB 4K87A 2BKEA 4W8HA 1G38A 1BYIA 1MPXA 1SUCA 1KJYA 1OAAA 3D6NB 4IIVA 2M6SA 4GG1A 2KYRA 4BQQA 2PH3A 1RXWA 2IODA 5B2EA 5LBIA 2VBIA 1TECE 2Z57A 5DOVA 3I42A 2EFDB 2GCGA 2HA2A 2IDMA 3DP7A 5IUJC 1IVYA 1JIVA 2OB1A 2ZB3A 2H17A 1VE7A 3CWQA 1E1KA 2LIPA 1PTJA 3TLEA 4CM6A 2JGJA 1E9AA 1X42A 4R6XA 1Z7EA 2Q9AA 5FFMA 5DNUA 1C30B 1LSSA 1MJHA 1Q5PA 2A0WA 3N8IA 4V0RA 5EPUA 5ARBA 4LK2A 3HKEB 3GP3A 4IOKA 1MOZA 3L84A 4UD6A 2W6OA 3OE7D 1VI6A 2D5IA 3HB4X 1U1IA 4W9NA 3URMA 2Q9UA 3X1KA 5IUNC 2CLFB 3GLGE 4WKNA 4LCBA 4EB6B 4NICA 2FQYA 2DHDA 4OJMX 4AJOA 2W6PA 1TUIA 2ZK7A 3PLNA 3EH2A 1H4QA 5SZKB 4HDSA 1JKJA 4GWKA 1CR2A 4JEIA 1T8WA 3DOUA 4NTZA 4TM7A 3WGGA 5C81A 3ZWMA 1OFHA 4YPFA 4OPMA 2BIFA 4B6QA 2FEPA 1B8NA 1BZYA 3F90A 3FN4A 4CM7A 2MSNA 5CTAA 1CHNA 4IRXA 1PEYA 2Z9CA 1ZR2A 3OE7A 4QDUA 1VYTA 4LSMA 3LUJA 1C0EA 5LZ5A 4RXTA 2PKYX 1Y82A 1YZ3A 3QIVA 3M6IA 3PUJA 2VQ3A 4C3VA 4DADA 3OTHA 2JH3A 2I62A 1T6XA 2JGNA 1I0IA 2WJAA 7YASA 1V35A 2BBOA 2B1QA 1Q2UA 4IO0A 2EX4A 3H86A 1KR5A 1S1MA 4ZYZA 3KV1A 1THZA 1NULA 4P58A 4ZTBA 2P6MA 2YJ3A 3IIIA 3IVAA 3SR0A 3P0HA 1U3DA 2X22A 3LFTA 3W6ZA 3FZGA 1PDOA 2NLOA 2O0HA 2HADA 3ZU2A 3OTOB 1E0KA 4W99A 1WW8A 5JC8A 2O0LA 1AUPA 2VJCA 3H6KA 4JH0A 3QFCA 2DUNA 5BRAA 1GUFA 1R0XA 4LJAA 2EG5A 1A98A 2FVYA 4A16A 4EZEA 1V6CA 3O8RA 2AEJA 2H5IA 1EX1A 1UR5A 3L7DA 3OZWA 2C9BA 3G23A 5CLFA 4CV0A 1JIXA 1ZI9A 3DEFA 3FCXA 5DGDA 3VR1A 5L3QB 4YAFA 2RJ3A 3IPRA 1M1NA 4UVIA 4ZGWA 2D3WA 2XNDD 1HYHA 4CUKA 3QNMA 3RAEC 4PBTA 4A91A 2VP3A 4QLBA 3RFUA 5LOVF 4YRCA 2FW7A 1SHLA 3ICWA 4HHEA 3T5BA 3TQCA 3E1GA 3IKLA 4Q4CA 1M34B 3E70C 4F71A 1ZIDA 4N54A 1DJNA 2FYTA 3MAJA 2IZ6A 4WA8A 4D7AA 5GIOE 1FVHA 2XQVA 3V7UA 4NATA 4R3UC 2OSBA 3CWZA 1JG2A 1TM2A 2FEKA 1NM5A 3E05A 3IPCA 4MUFA 4YJGB 4DR5B 2DY1A 3SFTA 5AW3A 1P5ZB 1YQXA 4JHXA 2UUPA 3SBEA 3AWDA 3SDZA 3NGMA 1QNLA 1ONPA 4CZ2A 3RHZA 2QY6A 5HIAA 2D7JA 3H5NA 2HPAA 4HDNB 3ZV7A 3ZHUA 2VSQA 5A4JA 3REFA 2RD2A 1NXQA 4QFCA 4JVMA 3REQA 1YZHA 2QAIA 1UL1X 3GLKA 5AUQA 1XL0A 4KXYA 4F5EA 2HMAA 2PFGA 1RJ9A 3FDXA 2EFHB 5EL0A 8LDHA 2G0AA 4NEGA 2WV7A 2XYRA 2OSVA 1E3IA 3RTDA 4HUQB 1JEDA 1G4HA 1QRSA 2O2EA 1X3SA 1CEXA 2QRHA 3NCHA 1YE8A 5JCPA 1TTHA 3NC4A 3ZXIA 1QR2A 3K1JA 3K9BA 5HCUA 2O8FB 2H11A 2PYDA 2GK6A 1CRWG 3KHSA 2WLTA 2XCUA 3EG5A 4G25A 2HRDA 1MJ5A 1V6SA 3C3XA 4K6CA 5F64A 1ZHFA 1UKAA 3L4EA 5CLJA 3Q11A 1EGHA 1GL9B 2Q5CA 2UYGA 1A4IA 4TWJA 2AD5A 3F2VA 4C04A 1WZIA 2NUPA 3BRWA 2IYFA 1OWOA 2AKEA 1QJCA 4PLHA 2WWFA 3JARB 1NVEA 2GEUA 1XKXA 3JASB 1KQ3A 3KL2A 4KQ9A 5I5EA 2XYGA 1G20E 2NQTA 3CLSC 4N5HX 1WQ1R 3R40A 2VF4X 4RHUA 5AJTA 1H0KA 1GUBA 2IF2A 4M46A 4WTOA 4OK3A 5BWCA 2FPGA 1XZHA 2EVWX 2GUGA 3IESA 4NZOA 5AXBA 5SY4A 2G28A 4URFA 5KIAA 5AESA 4CDRA 3RBVA 3FOZA 4X54A 3OZ7A 4E33A 2SNIE 4BUZA 3ONVA 1SBZA 3UQYS 3TG8A 3ZE8A 1P6QA 4E7OA 3WK9A 5AK6A 5AIAA 2WWWA 3IP1A 2GGSA 3FFBA 4XIJA 4EHLA 3O4JA 1EIWA 1NVBA 4WFKA 3RIHA 3UK0A 1EBBA 3A58B 4HZUA 4UDYX 1NUAA 1KS2A 2LGJA 1VA5A 4OX9Y 3O73A 2XWJI 3OZCA 1EWQA 2GJ4A 4C4SA 2W71A 2XEDA 1XPUA 2CLCX 4LGCA 3CF0A 5IMBA 3A6KA 3CMMA 3W05A 1W44A 3KEFA 4K6HA 3UB2A 1PZGA 4E2XA 3ICQB 2E1PA 5BN1A 2J41A 3GNTA 3BWVA 4Q24A 2G67A 5BT9A 2IXTA 4XIFA 3D81A 3FFTA 5FUVA 3GPCA 2CUKA 3IT1A 4AQYB 1WBBA 1RE0A 2X9NA 4LWQA 3UUFA 4R9VA 5LUAA 2QRLA 3OZUA 4PCVA 4EY6A 5ICCA 3V7FA 1ECJA 1E8NA 3T8YA 4BLUA 1KK2A 2R8ZA 3GRYA 4CL8A 1YMQA 2CDCA 4DT1B 4WEQA 1CUYA 2VJMA 3MCTA 1MX1A 2BZSA 4Q9IA 3FBGA 4NABA 3JCZA 2OZLB 3QVLA 1XP8A 2L0XA 2OY0A 4RHCA 2XT9A 1G5RA 5CAEA 4ERXA 5JVDF 1JBKA 1TO1E 4KXXA 4NBUA 5EG5A 1SOWA 4FB4A 3AVXA 1QDEA 2DLNA 3FOCA 4JLPA 1MOPA 3DYBA 1AKVA 4HYYA 1G98A 2ZSBA 4JVLA 4ASUD 4D43A 2RHOA 4MH0R 4GMHA 4P36A 5JZMA 1K7FB 2F4VB 3BE4A 2FPRA 3L9XA 1IBMB 2O8EB 1A7AA 1EG7A 1PU2A 3IS3A 3NHMA 1N0HA 4FBGA 1W5AA 2JAWA 3ZUGA 2J0UB 3KQYA 4OGFA 3A9WA 1AQYA 1TEZA 2GPYA 1N3LA 4AS1A 2YC4C 1M67A 2PKWA 2R1VA 4HG2A 4HS9A 4AICA 4S35A 4BKQA 2WABA 5HVNA 4LYAA 5DASA 1DIGA 3FVWA 5CIWA 1BXGA 1A5TA 3AXTA 2IHNA 2HJSA 1TTQB 1VMKA 3WMFA 1PBTA 1RAGA 3BD6A 3QELB 3D59A 5JWRA 3QEAZ 1U90A 4I4TF 4RGBA 4EJSB 5BWLA 3FPHA 3DMTA 5CG2A 3MG9A 3AVPA 3O83A 1N92A 3QBVA 2WFLA 2IYPA 4ND8A 3E84A 1ZK4A 4Q21A 4PTZA 5I9MA 3JQPA 3PENA 1JDUA 1MABB 2YWJA 3O7MA 4UHEA 3U7QB 3ZH9B 4EKEA 4UTNA 4CHGA 1OYYA 5B3KA 5EJ6A 3GYBA 3L8FA 4JLBA 3WZMA 1A8QA 2XMBA 4WOKA 3TGLA 1S2LA 1XTKA 3WJ1A 2OTCA 2V3VA 2ZT8A 3VBCA 4WLUA 1ZUHA 2RH8A 2OAGA 5D86A 2XZTA 3HA3A 1RFGE 1H22A 3CTPA 3RU7A 3VR3D 2Z2IA 4ZI7B 4M38A 3GLTA 4HRXA 1U5BA 2VAPA 1GILA 5L4NA 2IY8A 3FUTA 5G0VA 4L78A 4OOEA 1ZR4A 2QZSA 3WXBA 1Z15A 2CFRA 4BFUA 3GO4A 4C7VA 2PKQO 2FZKA 2E4YA 2PLNA 3FJOA 2PEZA 2YJGA 3SZRA 3NPAA 3UAXA 4ZV4A 1WCWA 2C7QA 3Q1LA 3NKVA 1NWCA 1PSDA 1VPEA 2XMRA 1DQPA 1SWVA 1KDVA 1U1GA 2YHIB 3RSSA 5CGQB 2VDKB 4XEHA 5GV7A 2QE7A 2CNKA 2D74A 3DAYA 2CWWA 2VJYA 3KJGA 4Q4LA 4UU8A 4Q3NA 4RMIA 3ZNOA 1Q57A 1ZJ5A 3LNTA 4FHZA 3SIRA 5FH9A 5FAKA 3E23A 3O8BA 1U7OA 3KAQA 2ADOA 1I80A 2OO3A 1KBOA 1OXMA 4D02A 5KYWB 3MQFA 2JNWA 1U99A 3NH6A 3HDJA 4HTFA 1ORRA 4DLKA 2AKAB 3WIOA 4JJIA 2WVAA 3BF8A 3L7NA 1QSGA 1K08A 4NNOA 2FAXA 4UXJA 3C3MA 2AMFA 4XM2A 1IOLA 3UMRA 1WVGA 3QLJA 3QUQA 1TU3A 3GN1A 3Q7QA 1TQDA 4AP6A 2JPDA 2F3PA 4Q1EA 2AUNA 1UM9A 3HJFA 4FKZA 1EFHA 4RGQA 1WTCA 3HVUA 5H7XA 5EXDA 5AI0A 5K4AA 1IUNA 1RAFA 4XIYA 1BFKA 1HYBA 1QO0D 3AJ9A 4MPPA 4ABYA 4DDVA 4YUYA 4NCXA 1A3CA 3THRA 1QZTA 3UM9A 2VI5A 3P8ZA 3FDJA 3WY9A 2ECFA 3IR5A 1Z8HA 2PVPA 3LDAA 1D3AA 1W93A 5FL7A 3TAXA 4C2UA 3S1AB 4L0DA 3HO8A 3KELA 3OEHD 3DO6A 1W85A 4KO8A 2BEVA 3L92A 1RPZA 1GP2A 2Z2ZA 4FI3F 3L2OB 4CWAA 1R4NB 1OXBB 3CLTD 4U6QA 1CY4A 3R5XA 4WZ6A 1J2EA 3TTVA 4KRXA 2Q49A 4JR2A 2G08A 4KWHA 2HA6A 4CLEA 4D4JA 2BUBA 4CEIA 5HQJA 4HD8A 1V26A 3MWYW 3C6XA 3SBXA 1N2SA 5H82A 3HXKA 1O5IA 2J46A 3LOUA 4XUEA 3VHXA 4X60A 4RTOA 3Q7IA 5J2TF 5AW1A 1JZQA 3DDHA 3ER8A 1JB9A 1QONA 2DHEA 3FYUA 1Q20A 5I7WA 3H6GA 3KQTA 2YVAA 1GQYA 2A88A 3BK1A 3IO5A 3R5JA 1RC0A 3ACCA 2PD6A 3H3XA 3HGMA 4W5QA 2LVBA 3LBIA 1EDDA 1RQRA 4G37A 4EIWA 4DOMA 2YWDA 4Q93A 5CEJA 1YZNA 3HV0A 2VNIA 4LMAA 5IW8A 2J5BA 5E1DA 3EGXA 1BVRA 3HCOA 3HEMA 4TYNA 1M1YA 1D5WA 5CXXA 2VJNA 1XJCA 1HQDA 3EULA 5EKUA 4ZAWA 1QFYA 1QVAA 5IZCC 1U0TA 3T1QA 5FXMA 3WQBA 4BFXA 1KP3A 2CNBA 5GZ6A 3OKFA 1GN8A 5TGDA 5THKA 4DJFC 4IO1A 3RABA 2EKZA 1E18A 1P8JA 4JYBA 3JD4A 1DQYA 3V2UA 1EFPB 1WB6A 2BR4A 1F2VA 2D8AA 2XUAA 2Y76A 1TGYA 3KYIB 5DB4A 1WRBA 3R7BA 4DYVA 5KWIA 3AEXA 3FZQA 2CDBA 1JQEA 4Q9KA 2QAJA 3GC6A 5FB3A 4S0XA 2ZREA 2GM4A 1KVSA 2CEKA 3ZDYB 4BVGA 2PWPA 3HJCA 2H4FA 1LTHR 4P54A 4U9UA 2R00A 4RD3A 3VO8A 5CFQA 3ZDQA 1OWLA 1QTRA 2HZ7A 3T15A 1HDOA 4L1KA 4CVNA 2EJUA 4O33A 1QP8A 1DFHA 1ODFA 4NENB 3TPZA 2FPGB 2DX7A 3H4IA 2RIRA 4GRIA 2P2SA 2TMYA 3DBIA 1QOPB 3DE3X 2HJRA 2QQGA 5DI3B 4DILA 2ID7A 3CX4A 1IN8A 2WE8A 3FLBA 2PUHA 3R5FA 3V9PA 3WR5A 3ZNNA 4O4HB 4DMMA 2B7BA 1G66A 3ABQB 4OMDA 3SQOA 1BX3A 3KQSA 4OUDB 1GYRA 1ECFA 4HAXA 4AZVA 3LBNA 4I8DA 3D31A 3DA8A 4LOAA 1O2DA 3DOEA 1FYDA 4GWGA 1CYDA 4A1FA 4I1OA 1Z6XA 4EP1A 3QE3A 2RKBA 3CWCA 1ZVQA 2MSWA 1GKUB 1JXOA 2MSDB 3DMTC 3GVXA 3N7AA 4KTVE 2G8LA 1PI3A 1LGYA 1O77A 3I1YA 1Z5VA 2IVFA 1CZRA 1GN9A 2NU7A 3IQHX 4IH9A 4CPDA 2ZBDA 2OAP1 3DGFC 1B00A 1ILWA 3TGWA 2VJAA 3G85A 4B5LA 3RS5A 3IYLW 2WNSA 4PYRA 4W7HA 5EIAA 1QHSA 2R7MA 3CF2A 1MW8X 1GADO 1UM8A 2D0PB 2REQA 3F6PA 2CE7A 2BM0A 3NT5A 1NQAO 3E5RA 3NYQA 3GGPA 4EPWA 1XZCA 4EVSA 3PTZA 3A4MA 4E5YA 2HX1A 4LDPA 1ZI6A 2C4UA 3LD9A 1VZ2A 4MKZA 2ZRHA 4RZQA 4TTJA 3DKKA 4DLZA 1OTYA 2XQGA 2Y1OA 4Y2VA 4YMIA 4FNAA 5TNXA