4JYPA

Crystal structure of kai2 apo form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
267
Chain Sequence
GVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, alpha/beta fold family protein
publication title Smoke-derived karrikin perception by the alpha/beta-hydrolase KAI2 from Arabidopsis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 94
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jypA00
2WIDA 5DJ5A 3STYA 4ARAA 3KSRA 2XMZA 3IUQA 2PU5A 3V48A 5AIAA 1QIEA 2GYUA 2G5PA 4AO6A 4P08A 1EVQA 3WWEA 2JF0A 3DJYA 7YASA 4L3WA 4UFOA 5T4BA 4CIBA 3AZQA 4X00A 4BAZA 3GBSA 2J4FA 1YB7A 2OGSA 3WJ1A 2XB6A 5JAHA 3F9CA 3DL4A 5EHNA 2WJ3A 4H77A 2WJ4A 4W9RA 3KXPA 1XRPA 3BIWA 3EIOA 2G63A 3IBTA 4MEBA 4LXHA 5ALKA 2QZPA 1UK7A 3A70A 3EQ8A 4K6HA 1F6WA 2CKMA 2R8BA 1G66A 3UUEA 2DHCA 3FWHA 4DIUA 4PSCA 5JATA 3BDIA 2RHWA 2I3DA 2HA5A 1CUSA 3D5EA 2PSJA 5D3ZA 4UBMA 1JMYA 5EHZA 4UBNA 1XZMA 2CBGA 3STVA 4W63A 3ZLUA 2Y2VA 2DQZA 3KOOA 4WDRA 4OYYA 1GPKA 4J0HA 4Y2SA 2XUAA 5EGNA 3C43A 1LBSA 2HA3A 1ZGCA 3A2MA 3B12A 4KE9A 5K3CA 2ES4A 3PICA 3WK5A 5AM3A 1Q0ZA 2YASA 3LP5A 2BUCA 3N2ZB 5CW2A 5LLSA 3FVRA 5T4HA 2RAUA 4OYLA 3FNBA 5ALLA 2VAXA 4E15A 1HKHA 2XUGA 3HJUA 3V1KA 1GPLA 3OC0A 5AI0A 5D6OA 2OCLA 3WKCA 3IA2A 1EX9A 4UBLA 2WIKA 4Y2YA 4N8SA 4O08A 5CRIA 4B0PA 4CG2A 5LZ9A 1Y37A 4FNGA 2JIDA 3WLAA 5K5EA 3PFCA 1P0PA 1LPNA 2VJCA 2FX5A 2ZSHA 4YX9A 1DINA 4KYVA 2V98A 5JAOA 3R3VA 3VJLA 2WSLA 3M81A 1H22A 2H1IA 4BYMA 4U2CA 4MXDA 4OPMA 1ZGBA 2HA6A 5K3EA 3R3WA 2JGLA 5AKIA 2XE4A 2WUEA 2H7YA 3WK8A 5ALJA 2QKYA 3OPMA 2WM2A 3ESBA 4JYMA 1EINA 1IMJA 3WQHA 1W6RA 5A7HA 4H35A 2VAVA 3MGAA 5ALEA 5FV4A 4QLAA 1JKMA 5AO9A 1E66A 1YA8A 3AIOA 3V9AA 1H2ZA 2OCGA 2ZJ7A 3WA6A 1WHSA 5AH0A 2JGKA 2PSEA 1EDBA 1LNSA 4L0CA 3FOBA 4QWWA 4QE3A 4BAGA 5D7BA 4G9EA 5CTAA 3WKDA 5JADA 4C89A 3N0TA 4JH0A 5FDFA 4G8CA 1QFMA 4HZGA 3D2BA 1DTEA 3TEJA 3PUIA 1H2WA 4G8DA 1A8UA 1C7IA 2HA2A 1CVLA 1A8QA 2WQZA 4JYPA 3G0BA 4FLEA 2B20A 2VTVA 2CMFA 3OM8A 5HK9A 3ILSA 3MVEA 4DSAA 2JGFA 2GBFA 2QS9A 2QUBA 4GECA 2AJLI 4I4CA 4HS9A 2VJBA 3I6MA 1AURA 2HA7A 3STTA 5SYMA 1WCYA 3FAKA 2X76A 3H04A 3I1IA 2YXPX 5DNUA 5AM5A 4EZIA 4KAAA 2XQGA 2QJWA 4Q1VA 5ISMA 2JGEA 3H1AA 1MX9A 4CCWA 4BCCA 2AJDA 2WHPA 4AB1A 5YASA 4X92A 4ZV9A 2RGUA 2ZYRA 3H1BA 4W1QA 1UOQA 4IH9A 2D5LA 2O2IA 1GGVA 3VKFA 2UZ0A 1VLQA 4H7FA 4Y2VA 2WHQA 4BDSA 3QPCA 3HYSA 3D0KA 5E2IA 5AICA 1XZBA 5JD6A 3LLCA 3P2MA 4GBGA 1EA5A 4QZVA 2DFPA 1ZI9A 1XLUA 1D07A 1TK3A 1WM1A 5JD4A 1ZICA 5AK4A 3WIOA 2QVBA 4G5XA 3F67A 1LZKA 5DTJA 4QEKA 1NU6A 5FPPA 1UT6A 1K6EA 2NW6A 2XLCA 5AM0A 5AM1A 2VF2A 2XQFA 2DR0A 3ICWA 3O4JA 5FKJA 3ANSA 1BS9A 4HXFB 4XIIA 4EY8A 1PJAA 1HLGA 4ROTA 1JT2A 1C4XA 3C6ZA 3F8SA 2BCEA 4B9AA 2O2GA 1DQYA 1F0NA 5ALMA 4M0FA 5DYTA 1A7UA 3WK6A 3WYDA 3WK4A 2GBGA 5K3DA 3C6BA 1OXMA 2HADA 3A6ZA 2XMBA 1EXWA 3RM3A 1MU0A 1LPAB 1AQLA 3O4HA 5EFZA 1G4HA 3F98A 2Q0XA 2XUDA 4AZ0A 2WKWA 4GDMA 2WTNA 5ALDA 1ETHA 3DS8A 2JEYA 4PV7A 2JEZA 1UWCA 1UZAA 1XZDA 4RPCA 2ACEA 2C5FA 3WKAA 2QMQA 1USWA 3QBJA 1Q83A 2VT6A 3S2ZA 4K6KA 1E8NA 3FCYA 3FCXA 2J3QA 4OD0A 5CXUA 1JFRA 3W05A 5ALIA 3K9BA 1QIFA 4QDZA 3BF7A 2XUHA 1CPYA 1EK1A 3V1LA 2HU8A 4MYSA 1UKCA 1FFCA 4DTCA 5HK8A 3VVMA 2WTMA 4PSUA 3BJRA 1MN6A 1LLFA 5A2GA 2PM8A 2R11A 1BN6A 1VXOA 2ZJFA 4KACA 3WWCA 5BWBA 5HZGA 1X70A 4KJXA 3QPAA 2HA4A 1N5RA 5EI5A 3ICVA 1XQXA 4LKOA 3TRDA 1VE6A 3ED1A 3F96A 5AM2A 1U65A 5FPQA 1J07A 2Y2UA 2OAGA 1QOZA 1R9NA 3D4LA 4Z49A 2Z5GA 1CUGA 3D2AA 1XZHA 1A88A 5JIBA 2J3DA 3CN9A 3G7NA 2DHDA 3O9VA 1SFRA 2PL5A 3HSSA 3WK9A 4DMHA 1WHTA 1RWQA 1UKAA 3G9UA 1K63A 4G1FA 4KE6A 4Q82A 2GZSA 3GROA 4IHAA 3QH4A 3O9MA 4B7ZA 2JBWA 5ALQA 4J0GA 1CUVA 4Y7DA 5A7GA 4BRSA 1IZ7A 3IUJA 3PF8A 1R1DA 2QTBA 1MNAA 4IO0A 2XUFA 1C7JA 2IITA 1XFDA 3V1MA 4Q3OA 2VQ6A 4KRXA 3FSGD 1OCEA 1BCSA 5I8PA 2G5TA 2XQKA 3DLTA 1FFDA 3ZPXA 3WA7A 5KWJA 2HU5A 1YS1X 3NWOA 1P0MA 4RE5A 1XRQA 1OILA 4UHCA 4E11A 2D0DA 4B80A 4Y2UA 1TAHA 3ESCA 4BZZA 5EIAA 3WL5A 5HCUA 2JGIA 1VZ3A 5E4JA 1KU6A 1AMNA 3WL8A 4XX1A 5AK6A 1ACJA 1GQRA 3MUNA 5K3FB 3DCNA 5DLPA 4H7DA 4B83A 4AO8A 1RP1A 2V96A 4QWMA 2XMRA 3BWXA 1XZGA 1Y7IA 3CCCA 2WFZA 1VOTA 1EI9A 1NX9A 3EQ9A 4ZRDA 3A2LA 1ZD3A 5AOBA 3H2GA 1JJIA 2WHPB 4X94A 4DSZA 1TCCA 1LBTA 1MT3A 3AZOA 2WU4A 2Y6VA 4UHBA 4DNPA 3QITA 4K2AA 5CT6A 1UK9A 2WU3A 3DKKA 2CUTA 3FVTA 4GWLA 3I1YA 4AXBA 1MJ5A 1R4ZA 1JU3A 3H17A 3I2HA 4NMWA 1E3QA 2P8SA 5FUMA 1CLEA 3H0CA 3DNMA 3UUFA 5LP1A 5JZ9A 5C8ZA 4IH1A 1FSSA 3CN7A 2GZRA 4OUKX 3G9TA 4BP8A 2QRUA 4G4IA 1IUOA 1QZ3A 1LGYA 1VKHA 3RARA 2OCKA 1CFJA 3G0IA 3W04A 2AJBA 3IB3A 4FMPA 5JANA 4J0KA 4DNFA 4CCYA 3VJKA 2XUOA 2VA9A 2DCMA 2C58A 4E14A 1UKBA 5C8VA 1FFAA 4DMCA 4MWSA 2BAGA 1G5FA 2EEPA 4H18A 5C81A 1YB6A 1CEXA 3EF3A 4QDTA 2GBCA 4U2EA 1DWPA 4GW3A 1YAHA 4CI9A 3I6YA 3WKBA 5AKHA 3STUA 2X5XA 2G4LA 1BROA 2WUDA 1BN7A 4WY5A 1DT5A 4Y2JA 2QUAA 3STXA 5AOCA 2CB9A 1BEZA 5CMLA 3WIBA 1O6FA 3H2HA 5HF9A 3WJ2A 1QIMA 2YH2A 4CG1A 4FBLA 5BOVA 2ZYIA 4ZV7A 1PFQA 3FBWA 1YR2A 3L1HA 4W1SA 2ZJ6A 2C4HA 1EDEA 2OQVA 3DEAA 3RKSA 1K4YA 2IIVA 3GFFA 4P9NA 3OURA 5JARA 1AZWA 5IH7A 2JGJA 1ZI6A 3IVMA 1YAJA 2OXEA 1TCBA 1XRRA 1EK2A 4BZWA 4X6YA 5ALNA 5AI5A 3H2KA 4UBIA 5CBKA 4B82A 5BV7A 2PPLA 2OQIA 4J3JA 2V97A 4ZREA 4GHWA 5KREA 4FFWA 5IVDA 5AKEA 2RHTA 1CUDA 1CUHA 3H2JA 2HM7A 2Y6UA 4BE9A 4BC1A 5AI9A 3LIIA 4Q3LA 3W9BA 4BB0A 1W1IA 2I78A 5JZSA 1E8MA 5K3AA 4V2IA 4G8BA 3JW8A 1CUXA 3GELA 5LYYA 2HFJA 2PX6A 1XQVA 3WZLA 4E46A 4AZ3A 4U2DA 1ZIXA 1UOPA 3DYVA 1ISPA 3K2IA 3H18A 1ACLA 3QPDA 1CQWA 2BGRA 2ROQA 4IH4A 4WY8A 4AO7A 2XMSA 1XZKA 4ETWA 3FSGA 4LIPD 4C88A 1CQZA 3V1NA 4A23A 4X85A 5CT4A 3T52A 3HEAA 3PDCA 3ESDA 1MNQA 2XDWA 4K6GA 1JI3A 4F21A 1DWQA 1H2XA 4MWTA 4BP9A 1XRMA 4U2FA 4C87A 4X93A 1CUUA 4N8EA 3WI7A 3QVMA 4FHZA 3IURA 4Y2TA 1JJFA 3BE8A 3HXKA 4Y2QA 1CUYA 4FLFA 1QFSA 4L72A 4C4XA 1XROA 2WIFA 4HVTA 4RGYA 3KD2A 3R3ZA 4B0OA 2GYWA 4CIAA 2HA0A 1GXSA 3PUHA 2Z8XA 3C6XA 3QM1A 4X95A 2XT0A 1QIDA 4FOLA 3G0CA 1QIIA 3M3DA 1LPOA 1YA4A 1F8UA 3AILA 2WILA 3WL7A 4DLNA 3PE6A 4FWBA 5J3JA 5CXXA 4BCDA 1RYYA 3G9XA 5AK5A 2PSDA 4KE8A 1GKKA 4GI1A 2OGZA 2DHEA 4QA9A 2PBLA 4UPDA 4RNCA 2FJ0A 1WPRA 1THGA 4QDOA 5KBYA 4EY6A 1DU4A 3EBLA 3JYHA 3DKRA 4KRYA 2PUHA 3QZUA 1I6WA 2B4KA 3C8DA 4XJVA 5E4TA 4AN1A 4KAFA 4PW0A 4UHDA 2WUFA 3WZMA 3TGLA 4F0JA 1WB4A 2Y1KA 1XZIA 4CG3A 4HRXA 1S8OA 1ODSA 4HXEB 2HL6A 2HFKA 1PV1A 3DD5A 5AP9A 4BVJA 4H7JA 4BAUA 4UUQA 4CCYB 3W2TA 3BF8A 3AIMA 4OU4A 5ALOA 1ZD4A 2BGNA 1R9MA 3SK0A 1CUFA 3VJMA 1CUBA 2EDAA 4Y2PA 3KWFA 4B9EA 2XI4A 4F60A 1XLVA 3A2NA 1BCRA 5JZBA 3BXPA 1O6GA 4UFNA 2Z3WA 2RI6A 4N8DA 5AI4A 1R50A 2HRRA 4J0IA 3I2FA 3E3AA 1E89A 2C5GA 5HFNA 5IVHA 1Q84A 4INZA 4MQLA 5AKYA 4X71A 1CRLA 3D7RA 4J03A 1N1MA 4EBBA 3R40A 2Z3ZA 1E8DA 4JUIA 1MPXA 4EHBA 4LXGA 2XUJA 4DNQA 1EDDA 4QDUA 3QMWA 4TGLA 3HZOA 3M82A 4FFVA 2DSNA 2C0PA 4GLBA 3DOHA 5AKJA 2J4CA 2H9YA 3DL7A 4B84A 1W4LA 5D3KA 2BUAA 1AKNA 5CH3A 5E4YA 4DMKA 1NU8A 4PO3X 1XKTA 5ALFA 3G02A 4QNNA 3LS2A 3HC7A 4C01A 2EDCA 5FXMA 2JGMA 3QYJA 4ZGBA 5FP0A 1HBJA 3D2CA 1XRLA 1X2BA 4ZI5A 1ORVA 1CUJA 1BRTA 4NZZA 2WUGA 4Q34A 5LZ2A 3G0DA 2WFLA 1EB9A 1QO9A 5ALGA 4JEIA 3I2KA 2IX9A 4WFIA 3DQZA 3HACA 1CUZA 4IQ4A 1XZFA 4PQEA 3FYTA 4A5SA 3F97A 2HDWA 3T4UA 4FKBA 4FTWA 3FYUA 1P0IA 1W52X 4HXGA 3C45A 3QMVA 3H2IA 4Y2RA 4P92A 1AUOA 2VJDA 5IVKA 1THTA 3DYIA 5JAPA 3O95A 5CT9A 3I2GA 4XVCA 2BFNA 5T4EA 2W22A 3WWDA 4BC0A 4BVLA 1XRNA 1UK6A 4PF1A 3IDAA 2OGTA 4DNOA 3WWPA 2FJPA 4OU5A 5I9IA 1ODTC 4PSDA 4U2GA 5EHQA 5LIPA 2K2QB 1VA4A 3IIIA 5KWIA 3STWA 1CUIA 2XMGA 4H7HA 4X91A 5AI8A 4YPVA 5ALZA 3E4DA 5ALSA 2OPHA 1X2EA 4J0JA 3GA7A 1LPPA 3X3HA 5JALA 4UBKA 4UBOA 3TJMA 1T2NA 1UXOA 1Y7HA 1XQWA 2C7BA 2XQJA 3AIKA 2AJCA 2OAEA 4MEAA 3K6KA 1SCKA 3H19A 3AUKA 5T4FA 5LZ4A 4MQMA 4B85A 3O4IA 4EY4A 2RONA 4BTVA 5HQ3A 2ORYA 4F5ZA 1FFEA 3ZI7A 1TCAA 6YASA 3WKEA 4UHFA 5ALHA 4C4YA 2WIGA 4M0EA 3W9UA 4FLMA 3B3QA 5LZ5A 5ALWA 1AC5A 5ALXA 1LZLA 4WFJA 5LZ8A 3YASA 2Z8ZA 3R0VA 4BBZA 1ZD2P 5AK3A 4DMFA 4A16A 1XZCA 2PSFA 5ALPA 1BEEA 2XMQA 5DWDA 2QR5A 4HTAA 2WLSA 3E1GA 1QE3A 2VT7A 1H23A 4FNMA 2QM0A 1VJ5A 4AMYA 5CT5A 2BJHA 2XUQA 1HQDA 2LIPA 3UMJA 4OB7A 1N8SA 1W75A 1QTIA 3PF9A 1BU8A 4C4ZA 2PU7A 4W1PA 4X6XA 4LHEA 1BE0A 2ACKA 5ALYA 4WDQA 1AX9A 5CH5A 1EB8A 1HDEA 4DGQA 4K5QA 1R88A 4OSEA 5CH8A 1SOMA 2PKYX 1QIJA 1XZJA 3ZV7A 5CURA 1QONA 3VVLA 4W1RA 3RLIA 2VSQA 1UOOA 5AKXA 3S8YA 4BDTA 5HKAA 1H2YA 3R3YA 1E5TA 2WJ6A 4YASA 5A62A 4RE6A 4WCVA 4G4GA 2XMCA 4OCZA 1K5PA 2W6CX 1MO2A 1IUNA 4N5HX 3WK7A 3G8YA 2ZVDA 3I28A 3ANTA 2V9ZA 2QJRA 1Z68A 1U2EA 1TKRA 5AHXA 2PVSA 3SWWA 1DWOA 1WB6A 5ESRA 3U1TA 4BCBA 5AIBA 5HF8A 2QXUA 1EHYA 1TIBA 3CXUA 5SYNA 3VXKA 4DYHA 2CZQA 3LCRA 4EY7A 4QDXA 5ALUA 3FLBA 3G9ZA 3PFBA 1QIHA 1EVEA 3ZWQA 2AJ8A 1CUCA 3C6YA 3HI4A 4KEAA 1QJ4A 2VEOA 2XQIA 1B6GA 3D59A 4ZWNA 5ALVA 5AKGA 3C70A 3IUNA 5I7UA 5DYWA 2XLBA 5LKAA 1EH5A 1MTZA 2ONCA 1JU4A 3BIXA 2E3JA 4Y9SA 3L1JA 3C87A 4DM7A 5DTIA 2OG1A 4ARBA 2DQYA 1N5MA 4UFPA 1DQZA 3I2JA 2QOEA 1JJBA 5AOAA 3G0GA 2WG2A 2YYSA 4GEGA 1R3DA 2CJPA 4FBMA 3ZLTA 4AN0A 4LXIA 4WFKA 5K3FA 3DDUA 1ZIYA 1VZ2A 1HPLA 1Q0RA 4I3FA 1ZD5A 4HRYA 3VDXA 2XUIA 2BUBA 3R3UA 2WFLB 3CCBA 4KR0A 2XUKA 2B9VA 3Q0TA 1QGED 4X7BA 4YK7A 3SX4A 4EUSA 2X8BA 1P0QA 4BTLA 2QXTA 3O0DA 2CEKA 5ALTA 2OLEA 4QLOA 1AGYA 4EB0A 1QIKA 4UBJA 3W06A 4G9GA 4MJ3A 3GUUA 1ZOIA 3FYUB 3OOSA 2ZYSA 4ZXFA 1ZI8A 1QLWA 3AJAA 1XKLA 1UFOA 4EA6A 4OB6A 2HU7A 3PI6A 3BJMA 2ZYHA 4TPKA 2WFMA 4AMZA 2H7XA 4BE4A 1JMKC 4UHEA 5H3HA 5C8XA 3NGMA 3BL8A 3B5EA 3FLAA 2WG1A 3IULA 5ALRA 2HIHA 3NUZA 3QMMA 1CUEA 1DX4A 4FDMA 3AINA 4M0MA 2C0QA 5K3BA 5DNVA 3GZJA 3OG9A 4HAIA 1XZEA 1CR6A 4PNZA 3WMRA 5AJHA 4X3CA 2GBIA 3ESAA 2ZSIA 1CUWA 2VATA 1ZJ5A 2WIJA 1FFBA 4UHHA 5FLKA 5A6VA 1XZAA 3O4GA 4P93A 1CIJA 3FLEA 4KE7A 2PUJA 3DOIA 1J2EA 2HRQA 3VISA 1VA5A 4NVRA 3NOXA 4TVKA 5HQ3B 3I2IA 5F4ZA 1U4NA 4I19A 1MX5A 4ITVA 1L7AA 5IKXA 5IVIA 4BVKA 3RK4A 4C6HA 5A71A 5AI6A 1LPSA 4H7KA 4LYEA 1GKLA 5EHXA 1GPNA 1J1IA 1SC9A 2VJAA 1GZ7A 1KEZA 4BRZA 1U8EA 4L9AA 2OCIA 1LPBB 3KDAA 3WWOA 1KU0A 1XLWA 3Q8WA 3M83A 5AKKA 1J06A 3IUMA 5JD5A 5HF5A 1L7RA 4Q05A 4G4JA 3ZLVA 1T4MA 1IUPA 4KAJA 1GT6A 2O7RA 3C8HA 4CFSA 3L1IA 1IVYA 5DYYA 1ORWA 3KWJA 5FOQA 1UK8A 5JYCA 4Q3KA 2AXEA 2H7CA 1ODCA 1CV2A 1LPMA 5JAUA 1MAHA 1G42A 4OB8A 4Y2XA 3FYUC 1M33A 4LYDA 3JWEA 4AQDA 5AKLA 4BATA 2HHAA 1GQSA 1IZ8A 2I3ZA 4H0CA 1YCDA 1WOMA 1K8QA 1XQYA 4AX4A 3R41A 3SC2A 1CUAA 1WPXA 3EQ7A 4JNCA 1TRHA 3WL6A 2BKLA 2QT9A 4H7IA 4B6GA 1SCIA 3HABA 3OTQA 3MUOA 2XUPA 4XWGA 3D3NA 4J0DA 5DNWA 1F0PA 2O2HA 3E0XA 2WG0A 5EIHA 1YS2X 4D9JA 3AZPA 4WJLA 1SCQA 4N5IX 5HFAA 5AM4A 1QIGA 5C7YA 5AKZA 4B81A 4NS4A 4J7AA 2WHRA 5FRDA 4X6UA 2B61A 3HLKA 4X97A 3U0VA 1MAAA 1W76A 2O7VA 3C5WP 4MYDA 4S0XA 5HF6A 1XZLA 5HKBA 4EY5A 3I6ZA 3C5VA 1TQHA 1YASA 3LIPA 1WB5A 3AFIA 5LKRA 4X90A 1DT3A 3R3XA 2XMDA 4J0CA 4H7EA 1QO7A 3HRHA 1HL7A 2GYVA 2FUKA 5CT8A 5BWCA 5A7FA 1YSCA 1DX6A 1ZJ4A 5JASA 1A8SA 5LZ7A 1VXRA 2I03A 3WYNA 3BDVA 1VE7A 1FJ2A 2PSHA 4GXNA 5EIEA 1L7QA 4U2BA 2ECFA 1B41A 1QTRA 2RIPA 1MX1A
chains in the Genus database with same CATH superfamily
5BORA 5CFMA 2WIDA 3STYA 3UBMA 2R1TB 3C8UA 1V0JA 3X0DA 1OC2A 4ARAA 2XMZA 1CKEA 2I4OA 3IUQA 3JQAD 5BMVA 2AFIA 1IOZA 3CT4A 1SHKA 3G6KA 5AYVA 2VZEA 5B6PA 3U39A 2PU5A 2BYTA 3RRFA 1DC5A 3RVMA 3FUTA 3V48A 1CC1S 2ZG6A 3RYHA 2GYUA 2E1RA 4J1NA 5I9NA 2LXNA 4URUR 4WXYB 2G5PA 1SUAA 2AJTA 4C06A 4MV3A 3CFYA 3FIUA 4A03A 3GNTA 3CZQA 4Y1RA 4PC2A 1XKXA 4ER5A 3L0PA 4N82A 3U7QA 1RVDA 7YASA 1OX4A 1PX0A 3R9IA 5SY9A 1P1RA 4BJ5A 5HM6A 4BGUA 2J7PD 5T4BA 2G71A 3D7NA 1K7SN 3FZNA 1ZJ6A 3NVKI 3O3MB 3OU2A 2H2FA 1EP1B 2CLFB 2N0SA 2J4FA 3OPVA 3KLOA 4Z2YA 3K1ZA 3HJBA 2OGSA 1S8NA 3PUJA 5JJLA 2GHTA 4C9BA 1NIJA 4DIFA 3IMFA 3QPWA 3FWNA 1HO3A 1WKCA 1NN3A 4BQFA 3DL4A 1O3YA 3LKDA 2WVHA 2OV8A 1KJQA 3U4CA 2KLBA 1MQSA 1XRPA 2P9CA 3KBBA 3ZCUA 4LHSA 3EIOA 2XSZD 4IXNA 1YJ8A 2V8BA 1W5BA 4JKYA 3H5WA 4LXHA 1WULS 2L42A 4CTMA 2M6RA 4KYUA 3V7FA 1LS6A 3K0CC 3FB1A 2E82A 2ZS8A 3EQ8A 1WG8A 3DLHA 4L0MA 3SQMA 2ZAOA 1ORDA 2VYVA 5B3JA 3FWHA 4CIXA 3CRRA 1EFVA 3G2OA 3VZBA 3GAZA 3I09A 3MG9A 4IHJA 2IIPA 1CJKC 2G0TA 2R7AA 5DYNA 1QOPB 1FLNA 2QGNA 3Q7PA 2V59A 1X1SA 5SY4A 3SEAA 3FM9A 1Z4JA 3OMLA 4ZVUA 4E5UA 2O8DA 5C51B 1CUSA 3D5EA 4PVCA 2A0WA 4PEVA 2RJOA 3HV0A 5L53A 3PJDA 2YW2A 4Q4HA 1E6KA 1LX7A 3OM1A 2WPDD 3ONEA 4J1TC 2G80A 3I34X 3KKQA 1JHRA 4OP3A 4MNTA 5FNZA 3T95A 1XTBA 5FUYA 4HFRA 2ZITA 5LC1A 1XZMA 3HA3A 4DA4A 3BZBA 3NETA 5LU8A 1Y9AA 3SYRA 1IATA 3X43A 3KSUA 3W2IA 3V34A 3PNSA 3KOOA 5JWHA 7REQB 2C59A 4WDRA 2WSSD 4JLUA 3KSBC 1PHRA 1HEYA 3BTUA 1PKXA 4I5DA 4RIEA 1SXGA 4CN9A 5JFTA 3NTRA 2G4CA 3BWDD 4MQBA 1E6EA 4BMXA 1LK0A 4D8XA 1D4ZA 4KE9A 3ORFA 5FPHA 1ZUHA 3DTVD 4MPDA 3GJRA 4YV0A 1YL7A 3OA2A 4JL6A 4JEUA 4BO7A 2Q5JA 4V39A 3FMPB 4NYJR 4WN3A 4YAEA 3L2OB 3LQ2A 4W5OA 1K27A 1P29A 1Q0ZA 4C3OB 4YAKA 1UPBA 4V1CB 2Y93A 5KQPA 3LP5A 4NBUA 3C39A 4D41A 2BUCA 3N2ZB 4KI7A 1ZM7A 2B8JA 3N8IA 4DLBA 1R6BX 2W8ZA 2AR0A 3FUVA 1KI1A 3F2IA 1GPBA 4OX9Y 4AJ9A 3UXHA 1GSIA 4B2IA 1PHPA 1MJFA 4QG7A 3GGJA 1BHO1 2GETA 1ZLXA 3OUUA 4OYLA 5EP2A 5HPYB 4KQGA 4NI5A 1WSDA 4E15A 3FPFA 1PZHA 4NYMR 4LE0A 2XF8A 1J20A 2XUGA 3HJUA 4HX9A 4JA0A 4CLOA 1P19A 1A7AA 4RKQA 3J7AC 3LLMA 3PPWA 4DCUA 5D6OA 3VPAA 1W5FA 3C24A 1U90A 3D8NA 4ZAYA 1QCCA 2O3TA 3ZWBA 5I7EA 2C1ZA 1EX9A 3ZH9B 2VOJA 2NTEA 2WIKA 4IEIA 3IO3A 4ZRNA 4HFMA 1VLLA 1V41E 2PN1A 1L7NA 1V9LA 2JIDA 2P2DA 3T1VA 3GP8A 1DTSA 2CEAA 4Z1MD 1B1CA 1N0VC 1MO5A 3HEBA 3VDRA 4MS1A 1FYFA 4RZXA 2H2HA 2DT8A 2TRSB 4NCNA 4ZOBA 1K8RA 2EG9A 4CTJA 1AOXA 2XT9A 2YIMA 1Z6XA 4JCOA 2QA5A 5DCWA 1NW6A 2KB0A 3PFCA 2H3EA 2LZ0A 3NGLA 4LYAA 2AEJA 2VJCA 4UVEA 4KXQA 5I7WA 4OGKA 2FHSA 4OK3A 3JQFC 3COJA 3C6MA 1JP7A 4QUJA 5AJUA 4S24A 1JEAA 1S7GA 4YX9A 2PAAA 1G19A 3VX4A 2W48A 1ECLA 3OQ6A 5DM0A 3C1AA 2PNJA 1NNUA 2BDTA 3ICPA 1IBLB 4UPEA 1HM5A 3MAAC 1RI1A 3R3VA 1EDZA 2XOEA 3KXLA 3U4DA 1CTQA 1NXTA 1P31A 3HMKA 1M34E 1E5LA 4MVJF 5EGSA 1UBTS 1R0LA 2HZ7A 3LBFA 4X1YA 1FFYA 3EFOA 3WGKA 4BYMA 4MR8A 4MXDA 1EU1A 4OQZA 1K5HA 2V54A 3K35A 4GPTA 4KV9A 1WR8A 3HXTA 1GNPA 3IE0A 1T15A 1QU3A 2HA6A 3B53X 4LQLA 2JIBA 3UANA 5TT0A 1IBSA 3JVVA 1NW7A 3FSEA 3H9BA 1N7JA 3L40A 3V4SA 1W96A 2I6QA 1TYZA 1X87A 2YWJA 3TIGA 1RM4A 1OZAA 4XFDA 4RF5A 2XE4A 4FOPA 3W7VA 5KAMA 4CKYA 2JAOA 4BLRA 3CX3A 2WUEA 3A6GA 4FS3A 1PFVA 2IHVA 2CXPA 5ALJA 4P7FA 1T10A 4EW6A 4EG5A 1RCFA 2QBYA 4PO9A 3S44A 1LSSA 2QV7A 2NZ2A 3V8MA 3H16A 1HZZA 3GJ6A 4QUHA 1A9OA 2RGNA 2HHCA 4JYZA 3AG6A 4RA9B 3UW1A 3RW9A 3MGAA 2I1QA 2C95A 4OM7A 4MDHA 2NADA 2A5JA 3PNYA 3T7DA 4CLRA 4JWKA 4YRKA 3T1YB 3AVXA 1U2RA 3A6KA 4FYYA 1YBMA 4L7VA 3C16C 1YI0A 2J6IA 1QAQA 1X42A 4YRJA 3V9AA 3OQVA 3PPXA 1PT7A 1X77A 1KORA 3VSBA 3HSYA 4DA9A 3NG1A 2CNOA 5AH0A 1N36B 1X1RA 2R62A 2X2PA 4UD6A 2GHIA 2PSEA 3VZRA 3WB9A 1LA2A 5D01A 5EKXA 1U80A 4X3OA 1II0A 3ZWWA 1JEOA 1LNSA 1RQ2A 4LXXA 1BH6A 3DM5A 4OMUA 1U2DA 1Z7BA 5FA8A 1HE8B 4GE3A 4J2HA 4UEOA 3FOBA 1R5BA 4HX5A 5H59A 3FDZB 4QE3A 2A14A 5ES3A 4BAGA 4G9EA 3ZNNA 5IWAB 1I1QB 4MQFA 1RTKA 4FFBB 1X7YA 2NVWA 1Z6PA 3T7KA 1L4LA 3C7TA 1WIWA 1ZR2A 5B37A 4BUZA 1KI6A 1ICIA 3CM0A 3SC2B 2E85A 3QBVA 4UJ5A 3CG4A 4F9GA 3TEJA 4P31A 5IHXA 4NESA 1K7YA 2A9OA 1D04A 3G2HA 4G8DA 1SA0B 1C9NA 2CNNA 5DB4A 2WQZA 1B93A 4JYPA 1BX1A 2C7RA 4IYJA 1MC1A 3G0BA 5FL7A 3L84A 3RIEA 1P39A 2NPFA 3OIVA 4QU8A 4EHFA 2O6HA 4LE2A 4DJFC 3NCTA 3MJCA 1A95A 4RQAA 3ADKA 4ZT7A 4P54A 3DE7X 3DDZX 2PR2A 1BWPA 4QFBA 1CJCA 2IQIA 1CULC 3SFVA 1Q44A 1H0HA 2J5XA 3KJZA 2RAVA 4PLWA 1KETA 4XD7A 3WWYA 2G1KA 2VJBA 2QTVA 2P9GA 1TCUA 3BSSA 1AURA 2DKNA 4RIGA 2MSLA 4TQ9A 3TRIA 4IDHA 1MA0A 2VP5A 3FAKA 4LFCB 1TVCA 2QR3A 2EGGA 3I1IA 5DNUA 5I7RA 3LCUA 4KFTA 4LZOA 5IBRA 4EZIA 4KAAA 4G0XA 1KJYA 2XQGA 5E6RA 1V5GA 1SEVA 3LUDA 1ZH0A 2C2GA 2JGEA 4FEEA 1MX9A 4ZMBA 4TLAA 3TLCA 4HAVA 2V45A 3Q88A 4NZPA 2FR1A 5EHGA 1C3LA 3TX6A 4J0FA 3P9ZA 5LOVF 3BMNA 1G3MA 1KMQA 1OD6A 2VWHA 2W43A 3Q7IA 4RD3A 3U6BA 4W5NA 2P35A 2UZAA 2YUIA 5YASA 5HQTA 3A0RB 4EGAA 4DR6B 1CYEA 3I4FA 4ZDWA 1OFUA 1RBZA 2GZAA 4W1QA 4LHXA 2B0JA 1PYGA 3NBXX 5CLLA 4C2BA 3Q12A 3GDWA 3GVXA 5DFAA 5FA5A 4G25A 2O2IA 2CFCA 2CNLA 3FGPA 3OEHA 2CLEB 3NP7A 2Z2JA 3GFSA 2Q9BA 4WHMA 4M7PA 4PXYA 3VKFA 4U6SA 3LBYA 2OORC 4LQCA 1CRPA 2ZCJA 2WHQA 4IRXA 2F9LA 4BDSA 2A9RA 1Y5IA 4MWGA 2FFQA 3O75A 2W2KB 3B8EA 5B1DA 1XX6A 2C88A 3KQPA 1OLSB 3D0KA 3C3WA 1PNTA 4EUNA 4YT8A 4NQZA 3JQGA 3S6JA 3HZRA 4NARA 5JD6A 2Q8NA 3UCEA 3P2MA 3SKYA 2FPIB 3QMPA 5EERA 3B2NA 4EJSB 4TTTS 4UE3S 2B4YA 1EA5A 1JG2A 2PLFA 4D4JA 4B76A 4P3XA 1BFDA 2NV2B 1E0SA 5EVCA 1L3IA 5LB2A 1D07A 1UM8A 1R6UA 1HLDA 1WLSA 2GK3A 1AA9A 4Q5IA 1PO7A 2XZTA 4EO4A 5KDOA 4XYLA 3EOZA 1ECJA 3F67A 4BNNA 3K0AB 1T9ZA 1H85A 2FA9A 1ZNQO 3BREA 4OXNA 4Z86A 5KYUA 1BQEA 3DNPA 2P78A 3RUAA 4JUFA 3SX2A 3G82C 4RVDA 5FPPA 4ZVVA 3UM9A 3JQBC 2H51A 1J9EA 1OYWA 3OF2A 4P34A 1ADBA 4WNYA 4YP6A 3TG8A 1FZQA 3SEQA 1K06A 1RT9A 2NW6A 3DO6A 4MGIR 3HWRA 4U3JA 1Q2UA 3R7BA 3W2GA 5JJCA 1QLJA 3WAJA 2GF0A 4JBHA 4F1WA 4OQNA 3RABA 2I6FA 3H5OA 3T38A 1T4BA 5GOZA 3EULA 1DO8A 3QWAA 4A7PA 1I32A 1K9VF 4UUMA 1UINA 2C7QA 3IVXA 1K7EB 4HXFB 3MLAA 2ICAA 4ZVPA 4F3KA 3R7NA 5FQNA 2WT8A 2YWRA 3QJGA 2Z98A 1XN1A 1BS2A 3D3JA 4S35A 1PTJA 1C80A 3RF6A 4EY8A 4Z4HA 3I45A 2IL1A 4CEJA 1PJAA 3JYNA 3BMXA 4NMMA 3S29A 1HLGA 3MWGA 4L5BA 4N7JA 4AJNA 4D9IA 2OL4A 3GY0A 1DG3A 3FRHA 1RC1A 2FG5A 1AKEA 2C8VA 5BWMA 4NPCA 2P1ZA 4JT8A 3DDSA 1YKSA 4KX3A 4V0RA 4Z7OB 3LX5A 1IPHA 1S1MA 1C0KA 1S8FA 2O2GA 3PRJA 1KMIY 1RU3A 3VTFA 2C4UA 5GIOE 4LWQA 4HLDA 3R0QA 1Z47A 1PWEA 2WD7B 2XCQA 3GEDA 3HKBB 4IFIA 5ALMA 5DYTA 1ZL2A 4PS0A 4ZEOA 2FSSA 3TQSA 3PIIA 2FUCA 4BFLA 2JPDA 2A5YB 1YZKA 2C3UA 3K6RA 3WYDA 3ONVA 5K3DA 4FCTA 3HN6A 1ZNYA 1ZAYA 2X9LA 3E9QA 2RGYA 1FDWA 2HADA 2P4EA 3WY9A 3MCUA 5C46F 1X39A 1WDMA 2RGAA 5FYQA 1P1HA 1RQLA 1EXWA 2JI9A 2VDWA 3DDHA 4BNXA 1S89A 1AO3A 4HMOA 2AG1A 4RK0A 3RK1A 1VE3A 1EFTA 1I2BA 1T4CA 2H1CA 2XYPA 1P1IA 4PG7A 1H6AA 1U0JA 4QNRA 5CNMA 5FR1A 4YUWA 4AZ0A 3OLXA 3R76A 1WSWA 1E1LA 2WKWA 2WTNA 4I2VA 3R7SA 1U3WA 1J39A 3DS8A 1JQ5A 4NZNA 5ADWA 4DDWA 3MB8A 5EXEA 3C3CA 3J81A 2H5IA 3HZHA 1IM8A 3P20A 2PDAA 3KAKA 5DYGA 2XZPA 1J1ZA 5CDHA 2X9GA 4HTFB 3SP1A 1MQAA 5IWCA 2ZTUA 2V6BA 3EVEA 4Y0NA 4KN5A 3BWYA 4FHDA 3UAZA 1ZKMA 2JBAB 1NT2A 2O7SA 3DEYX 3QVGB 4RYDA 5KSOA 5B2ZA 5IMBA 3ZGXA 1Y8CA 3FCYA 4D9HA 5DLQC 2RI1A 5HR5A 4ARCA 4TV8A 1JFRA 5IJ9B 1I14A 1BKYA 4MV1A 3AOEA 4LGMA 4GLFA 1AU9A 4K9DA 1LSUA 5JNWA 4B6JA 3K9BA 3G2KA 1P2SA 3I58A 5TGTA 5KJCA 1PZGA 3RS0A 2C82A 5KMGB 1Z29A 3E5HA 2O54A 4RV5A 4KXXA 4CQNA 1MT0A 1JG3A 2IH5A 4KLRA 2ZRQA 4YS6A 3UMCA 4TKVB 1UBCA 2PH7A 3ZLJA 2FVYA 3BF7A 4ALJA 4YPOA 1RI2A 2I9KA 1LBHA 2ID4A 3HUFA 1CR2A 1UBHS 3JALB 1AT1A 2HU8A 2I67A 3FPBA 3PP8A 4I8IA 3CNQS 4MYSA 5DOVA 3NUQA 2Y71A 2KHZA 4EBFA 2F8MA 2HPHA 2YW9A 2RD2A 3TRFA 4KQCA 2D3WA 2FE4A 4NZMA 4OI2A 3RDPA 1WBBA 4KU4A 1E2NA 3PIDA 2IS1A 2ZRGA 2BMWA 2E9SA 2PZ8A 3HN2A 3QBDA 4PSUA 5FBVB 1LLFA 3EWNA 5E6UA 3T7AA 3PFIA 1GGKA 2J59A 2YJ4A 3EMKA 4DR1B 1UDWA 3G0OA 1BN6A 3TKLA 2ZJFA 2IH4A 3CEHA 1DBWA 1Z74A 2FHPA 3DFFA 4I9GA 3QPAA 4AFNA 4KPYA 5EPUA 4PLPA 3LRTA 3H11B 3NYRA 2A8YA 3RT1A 4IIBA 4B31A 2PV7A 4QTZA 4B6RA 1XQXA 2JJYA 2AMFA 5BSMA 3TRDA 2UZ4A 1VE6A 4GEKA 4F06A 1PIWA 2ZYUX 1J21A 4DLUA 3I01M 2HV9A 3ED1A 4YAOA 5KHLB 1ZR4A 4ZYLA 5AM2A 1JGTA 1X1CA 3HGMA 3MS4A 1NVDA 1ZC3A 4GI5A 5ENDA 4ZVNA 3RUDA 4EJSC 4B3CA 1YJ5A 4ZTBA 4FJ1A 4G81A 4HR7A 3KB8A 1J25A 3P1JA 4V0QA 4YJ3A 3E5MA 5FPQA 5FUWA 5C5IA 3CWCA 3IE1A 4C7XA 1P1CA 2F9MA 2O2ZA 4DRXB 1ONOA 4P33A 3M1LA 3ETHA 1C3XA 2DCUA 2DE0X 4Z49A 1ZHOA 1W1WA 4P38A 5BUCA 3O84A 5JS2A 1XZHA 5I3CA 1A2QA 3EODA 1H1LA 3LFUA 2NU9B 4BKMA 1K7XB 5HM8A 3VR5A 1G21E 1PCXA 2PL5A 3VR4D 4UDYX 4A10A 1JW9B 3EOBI 2XNJA 3USZA 1RM3A 1ULZA 3WK9A 4DMHA 2F1IA 1RWQA 3K0KA 3KKLA 4C7KA 3TD6A 1GL3A 2NUAA 4EHDA 2A94A 4LVOA 4YRLA 1RM0A 1A9RA 3MWDA 4KVAA 1L9KA 2FXVA 4BFTA 1VLHA 2QRPA 3FPAA 3BHIA 5IJXA 1C14A 2IU4A 4OHMA 3O9MA 4R7ZA 4INAA 1Y8AA 6REQA 2X3UA 3VNUA 5CD1A 3STHA 1E9EA 3GLHE 3EDCA 3AM5A 3E48A 2H5JA 1OA0A 1NI4B 1H9BA 1YOVA 2R96A 5BSFA 4YUYA 4C78A 1XTRA 3MGBA 3L5OA 3DD1A 3UAVA 1JHPA 2CXQA 3K9HA 2ASVA 5DMXA 1B1AA 5LBTA 4B6SA 1IZ7A 1HQCA 4NATA 1SVIA 4BRSA 1N78A 1KKMA 4OJNA 4LTMA 4RD0A 5EKUA 1K89A 3JVEA 1TD9A 5B7QA 2BM0A 3K05A 1R1DA 1E1YA 1YRWA 4NMXB 2J6HA 4FUTA 4S2EA 4UUNA 1JXAA 3NKLA 3SIPA 2QTBA 4MCHA 1QV9A 1UWLA 1O94A 2ZRCA 1NUUA 4LJ7A 3RTDA 1UDAA 4NV3A 1BMFD 3NDPA 4XLLA 3Q3VA 2GWRA 4YONB 5AFSA 2ZSEA 3K1JA 1U0HC 3QX3A 1GPAA 2XUFA 2W2NA 4AS3A 2IBTA 2ZOSA 2IITA 4I1IA 3UMYA 1XFDA 2XNSA 2IHJA 4MKGA 1C0LA 1TZJA 2VQ6A 1KI7A 2AOVA 3PCRB 1BG6A 1M0WA 4KRXA 1AV6A 2ESRA 3E61A 4OM8A 5I8PA 2G5TA 2E87A 2Z2YA 5KPDA 5CA1A 3PGJA 1XTZA 3COYA 3AY0A 1UDRA 1DUVG 1FFDA 2HHLA 2Z5VA 3FTCA 3MBOA 3ZGOA 1NVXQ 1XALA 2HDOA 3QVWA 3WA7A 1HE1C 1T5DX 2P6RA 4RXMA 4KK4A 4JUDX 3ORQA 3A3KA 2P68A 1JQBA 4LC1A 5FF9A 1ZJYA 1MCZA 2GBPA 3OPYB 3WBBA 1NXSA 4DR2B 4LECA 5TB5A 3WMWA 4RE5A 1GTL1 2DFNA 2WT4A 3O1JC 3KO8A 3WHPA 1MOPA 5H02A 1KDOA 4GZ5A 2CCJA 2AOUB 4IKEA 3UMMA 1TFUA 3O3CA 3S7TA 1GRNA 4EW2A 1IJKA 5LLTA 2OYSA 2CLLB 1TO1E 1XL0A 1U0NA 2GS9A 1NUHA 4E11A 4FDLA 2QYTA 4H15A 4TS3A 4HNVA 3RU2A 4DY6A 4RIIA 3L0YA 1FLAA 4GNKA 4P1ZA 1S3GA 2FMUA 1DGQA 1B8OA 4G63A 1V7PC 1WXXA 4YNBA 3WL5A 1LBIA 5HCUA 1DEOA 1UJ6A 4YHBA 3QFTA 2ZAIA 2GESA 5HMLA 5DT9A 3ZS9A 3PB3A 3N6XA 4FXPA 1E2QA 3BERA 4QOHA 4Q7EA 1N6RA 5ESXA 3SBDA 3NASA 1I30A 2A7QA 1YRQA 1ZO8A 1A8HA 2WJYA 3IP6A 4LBWA 4O8CA 4GXRA 5L3ZA 2XAAA 4A0GA 1FU8A 1PWHA 5A9RA 2QNIA 3PKJA 1RYEA 4RL6A 4D9FA 4TSFA 1DWUA 1GQRA 3MUNA 2V58A 2VDVE 1RRCA 3PGMA 4H7DA 4EQZA 4M0LA 5CYPA 1FXSA 4AURA 4DV4B 2VQEB 4ZICA 4D8UA 4HAYA 1ULUA 4JGIA 2XMRA 1Y8RB 1TIKA 5CM9C 4KUEA 4JLBA 5EZQA 1KS2A 3CZ4A 3VAZA 2IS4A 1M83A 3D0OA 4PPNA 2P4SA 4WE3A 1U7HA 3GLKA 1V6CA 4PLYA 5EJ2A 2X1MA 3EQ9A 4ZOAA 3LUAA 1DUSA 3L0BA 1U8UA 3TIXB 3TXXA 4OL9A 2F4VB 2HR1A 3H2GA 4BEBA 1KK0A 5KDDA 3KEMA 3JQPA 5EE1A 1L8OA 1LBTA 4JC8A 2H4ZA 3DAOA 2PE5A 3ZCXA 1SBQA 2J8ZA 1N6IA 4A6PA 4UHBA 1WDLA 2PD3A 3K72B 3R7WA 1JQ3A 1NSYA 3H65A 2RGBA 1CQXA 4K2AA 1XCPA 3GLQA 5JCJA 3BGSA 4FCCA 1E7YA 3QOYA 2FFAA 4GSLA 4WUTA 1BA2A 2PO7A 5LQAA 1UBOS 1QHIA 1QRDA 1FTNA 2EWWA 1K7FB 2IZ1A 4PZZA 1JF8A 1NZDA 1E1NA 3OESA 3FVTA 3DEHA 3CUUA 4OGGA 4RY9A 4LJKA 2OXIA 2Y8EA 3SX0A 2BEWA 4EP1A 1VJDA 1L8QA 1T34A 4AJ1A 2O48X 3FNFA 1XWIA 4Z8YA 4AXBA 1WRBA 1SU4A 3GVCA 4KRGA 3L7OA 1N1DA 1GSOA 1JU3A 1TF5A 2ODBA 2A1TR 2WAAA 3BMOA 3H17A 3O03A 2HCFA 4DANA 1P2DA 2VJPA 5KUTA 1QJCA 2I8LA 2AE2A 2P8SA 2Y3IA 3W3ZB 1CLEA 4K2HA 1OAAA 1CDZA 1KZYC 3H3JA 4BEJA 2RJ3A 3HJHA 4Y9RA 5EE3A 2HDHA 1IJBA 2Q3FA 3ITDA 3BE4A 3EC7A 5JZ9A 5CHYA 3E4CA 1LVGA 3C1TA 4Q19A 4RFSB 3I9KA 3DOCA 4QYIB 1WKBA 2MU1A 5F7ZA 3ZVLA 1KRXA 4BJ1A 1FSSA 4EZEA 2KBFA 2ZJZA 2O8CB 2IXEA 2NN3C 2IE8A 1J9ZA 4RS4A 5CVCA 4V0MA 4YRZA 3TCKA 3EXAA 3R6GA 1YR8A 5DRTA 4CM5A 3K4QA 3Q8MA 1RI5A 4G4IA 2ATXA 1ONNA 3FA2A 1A5AB 4XDGA 3AETB 1Z6TA 1RYNA 2VDLB 2GPBA 2Q21A 2AMVA 2OCKA 4M86A 4BLSA 2AJBA 1DXOA 4AJIA 4BWGA 3T99A 2XCOA 3JQAB 4IFTA 4PTYA 1TYEB 3AWIA 1Z6GA 1VI2A 1X94A 1W36C 1UC4B 4CKEB 4DUPA 2O8BA 1QE5A 3AUTA 3S2SA 4XGNA 3ZJ5A 3GJXC 3FUCA 4HJXA 3UC9A 2HW8A 3HUTA 3JYQA 1VHWA 1A04A 3OU7A 4PGFA 4FHEA 5H4HA 2G5GX 3GEPA 5E3JA 3D6JA 3GFPA 3ZR4B 5C5CA 1A3CA 3M2PA 3EXHA 5C8VA 4JI5B 2AFHE 3N2KA 3W6OA 4D5EA 1LTHR 4XX0B 4EX6A 3F9IA 4CTOA 4GGMX 1XEXA 2A5LA 4RTNA 4MWSA 3HYLA 5DBIA 5HRUA 4C6RA 1J2RA 1XDWA 1YJBA 2R5WA 2Z2KA 3IBCA 2SKCA 3U4QA 3I0MA 2RBEA 5DHAA 1T8SA 4YJHB 2GBCA 4U2EA 4B3BA 2H0AA 1A5SB 2MSDB 2GPWA 4LDNA 4YJFB 5CVVA 3VZCA 2IH2A 2X8JA 3HHEA 5IN4A 4CIYA 3UHAA 5KDLA 1WU7A 3E7DA 4FYVA 4YJDA 5TGZA 4G0WA 4Z1OA 2WSYB 4TS1A 1IZ0A 4X41A 4QYMA 1POXA 1YIAA 1KZ6A 1YAHA 2EHJA 3IAM6 3I6YA 3IQDB 3NUGA 3QHAA 2GERA 4JNKA 5BSRA 1QU2A 4PRKA 3JV7A 1M2JA 3HKCB 2NP7A 5JNLA 2B4RO 1MAWA 1RKXA 2K87A 2Q4RA 2WJGA 2XA9A 2ZJ2A 3AERA 3FGOA 4ZI3A 5KCZA 2JIPA 3HPRA 3ROQA 1ADJA 1JN0A 1V1MA 3PHGA 4IJWA 3LZDA 1X80A 3GJ5A 5AW9A 3EW7A 2NTNA 4L1KA 1UFRA 2OUKA 2Y0BA 4QOEA 3S2YA 3ISTA 4I1YA 1FXUA 3L0ZA 2IW1A 2BISA 5DHRA 3GRUA 4NZYA 4N03A 3I04A 2XKBA 3F6RA 2YICA 3N53A 3NU1A 3PITA 4P4NA 3RTCA 3STXA 4CV0A 1T8PA 3CZPA 4P4SA 3CPJB 1O9HA 1MB9A 1QQ6A 4EF6A 1Q12A 3DFKA 4NE9A 4O63O 4HAXA 5JISA 2P6OA 1WABA 1X7WA 1YACA 1LW6E 2Q3CA 4PIMA 4L8VA 3HO6A 4LMRA 3CVWA 1U7OA 4KQ6A 2NPOA 2PA3A 4YGXB 1M1YE 3KJXA 4UW9A 1RD4A 3NWJA 4X54A 1UANA 1MEEA 3VX3A 4CIVA 4MQ6A 3DE6X 3MTGA 1O6FA 3EIXA 5TDHA 3DPUA 1SU6A 3T4XA 1YGPA 4LZJA 3OH8A 5HRAA 1R0XA 1QIMA 2P6PA 3A1CA 2IYEA 2WWIA 2NO0A 4NH0A 1U3CA 1NX6A 4N49A 2BGWA 3Q10A 5BW6B 3P9XA 3I4CA 4CG1A 2I3BA 3ZEIA 3AVVA 1TAGA 3H9JA 4PR0A 2AYXA 1Q7EA 2K7ZA 5JSZA 2G70A 3NTQA 1BDMA 4JEMA 4K3VA 1PFQA 5KQRA 3K0BA 2C42A 2XEXA 3RIYA 1GG5A 3UUWA 2C61A 3X2EA 4W6ZA 1UP7A 3ZVKA 1JRLA 2C4HA 3E7FA 1F6BA 3IYLW 4ZO7A 9ABPA 3G5LA 1US8A 3ZTTA 3DEAA 3RC1A 1NPYA 1O6CA 3X1YA 2VRBA 4D6YA 4P9NA 1Z83A 4KZPA 4NV1A 5BSVA 1RXVA 1FVFA 3VPSA 4DHEA 4GYWA 3CINA 5JARA 3IILA 4TTAA 3SBEA 5IH7A 2JGJA 4DLXA 4RHYA 4PYJA 4O6VA 2V1XA 1KOLA 2PEYA 1H05A 5DOZA 3OZRA 2HSEA 3VPXA 3PPIA 1YAJA 4F2WA 2B36A 4J2TA 3HXLA 1JHXA 2EBUA 1N75A 5SICE 1OT3A 3KZNA 5LFAA 1TCBA 3BCRA 1FP2A 4Y0AA 4ON9A 4BFZA 1EK2A 4O2AA 2IXTA 1RFGE 1TM2A 4M1WA 1L4BA 4UEQA 1E61A 1WCIA 1N2JA 1DEKA 2JFYA 2P9FA 2ZROA 5COQA 5EP4A 1NVGA 4IJVA 2I7DA 4M1ZA 2G9NA 3N0WA 1KQ3A 4ZTZB 3CSDA 5F7JA 1SQFA 2R6ZA 4FE3A 3IJ5A 4X6YA 3IMKA 3KK0A 5ALNA 5EQJB 3REGA 3CE6A 5IZCA 3CW2A 5JNTA 1NZJA 3QELB 2G36A 3J7TA 3B2QA 2HQBA 4P2GA 3U61B 3BRCA 1YZGA 4PE5B 1TFRA 4B82A 2EX0A 1C29B 3ETJA 3BSWA 2VT3A 5J1TB 1NPDA 3EISA 4UQOA 4TYNA 1PUXA 2HCJB 4OHRA 5DT2A 2YYZA 3JD0A 4WCFB 4J3JA 3GB9A 5I7HA 4YACA 4E5VA 1U2GC 3P9NA 3K7EA 4IUCS 4WTOA 1NVVQ 5WRFA 4KO4S 2OP0A 4F8EA 2AEMA 3GFRA 2PUDA 1KVSA 1O5IA 5IVDA 1XA0A 1ONSA 3MD9A 4XDZA 2OB2A 4C29A 5HZHA 2GAOA 2FMXA 5JPCA 3DV9A 4CDNA 1CBUA 4E32A 2GPTA 1P4RA 4GKJB 4R2WA 5JSFA 2HM7A 3MJ4A 2FWBA 4N5DA 1XEWX 3HKEB 4CM4B 4CKCB 3AUXA 1DX9A 2O0LA 4ND3A 3WXBA 6Q21A 1E8MA 2VP0A 3GCZA 1JLKA 1TZMA 3LLSA 2XZLA 1Q6ZA 2PS9A 2YQZA 2F00A 2WF9A 3OEWA 3I61A 4R1LA 3FCAA 3H87A 3UB2A 4MRMB 2KSQA 1QDUA 2PX6A 1XQVA 3H4MA 5LXTB 1QHFA 1NTOA 2L2QA 1SCJA 1L3BA 1OX6A 1D2HA 1ZIXA 1UOPA 1ZM3A 2WSIA 3JD3A 2Y66A 5K8CA 2YMMA 4WK4B 5G1NA 4A27A 4B33A 5J63A 1LDYA 1AKQA 4UDOA 5IKMA 2BIFA 1GUDA 2J0UB 1HDCA 3R77A 4MW2A 3IQFA 5AW6A 5JEEA 521PA 4QTUB 2CWWA 2BGRA 4WACA 3VI4B 5CBPA 1K2VN 1HZJA 3M6LA 4KNWA 3T3NA 4MRAA 3R4VA 5ENVA 1OGYA 4FGLA 4GS5A 4ENRA 1QKKA 3FSGA 1N5LA 1CQZA 2GPJA 3V1NA 3KT6A 4PTZA 1C9JA 5EXPA 3GG2A 2X7HA 4DMRA 1K97A 1OZFA 1DTWA 3QLVC 4BFSA 1ZA1A 3M9WA 3LNCA 1OI7A 5EMLA 1CW2B 2AG8A 3ABRB 3DMGA 1A9SA 1IN7A 2IYVA 3KHUA 2XDWA 3CLHA 4DCVA 2CXUA 3AYXB 2MIIA 2H17A 4RESA 4UQPA 1H2XA 4BQIA 4P22A 3AR5A 1N3YA 1VP9A 2QB5A 1FUKA 4ZJYA 1PFWA 2PBZA 1DI0A 3QYAA 4G65A 3M7IA 1FSFA 4K46A 5FI3A 4C87A 4E1AA 2RGEA 1Z5UA 1Z13A 2WOOA 1D1SA 3CLTC 3JCZA 3QVMA 4KBYA 4W9NC 2VBFA 1QG4A 1G64A 4YCNA 2YJ6A 1NRWA 1I3LA 3P19A 3TRJA 1JJFA 3AF0A 2F90A 1SBCA 2VJOA 1FLVA 4IF4A 1CJMA 2WBLC 1GVHA 3HM2A 1D4FA 4RADA 1F17A 4HEJA 1QFSA 4L5AA 3COZA 4L72A 1E7SA 1JH8A 3KKNA 1JLLB 1OF1A 4ILEA 1N32B 2VPYA 3DBRB 1S4MA 3VR4H 3VNAA 1W47A 1WWKA 4G36A 3TW6A 1CY7A 3KQKA 1XMXA 4QO7A 1QBGA 2FDXA 2BBTA 5IZ4A 4QYXA 3SF8B 5CGZA 1QR2A 4CR7A 2AHRA 2Y99A 2O19A 2B1GA 2FWAA 3Q5GA 5H16A 2B2CA 2GA8A 3DZGA 3B7GA 2Q07A 3I8SA 3MS7A 2YV4A 4WWHA 2P4HX 4YGYA 4FNOA 3WRVA 4D4IA 4ZEVA 3VOTA 2XTNA 1VYVA 5DXJA 1M5RA 1U9ZA 3RYHB 1MZVA 1P1KA 4WXMA 4YV1A 3G0CA 3LKZA 5CM2Z 3P96A 1D4AA 1LPOA 1WA5A 3OP4A 4DCMA 1AH2A 3GHHA 2ZRDA 3EZXA 1F8UA 2ON6A 2BOVA 5EZ5A 5I5EA 1E2JA 1TVMA 3WL7A 1IXRC 1L5MA 5HGXA 1GM5A 3CNHA 3H1FA 1NJ5A 3AUSA 3L6DA 4IIHA 4XYEA 4EI2A 1A72A 3QLUA 1MJGA 4JLMA 2NG1A 1G2IA 4FONA 5CXXA 4EGQA 4GF5A 1RYYA 5CIQA 3HY3A 1DS6A 4YCBA 1XDBA 2IODA 3ZC3A 3TJRA 2X1VA 5K09A 5L3QA 4TLEA 4ZO6A 4AT1A 1P0CA 4ZHQA 1I3OA 2N9UA 2HJRA 4HNAA 1I2ZA 1DJOA 4L4YA 1GKKA 1N3IA 4M1TA 4GI1A 4BJ6A 3UV7A 4DVJA 2W2QA 1RXYA 1PU2A 3H5IA 4IZ6A 3VPBA 4PINA 3F7MA 4R2LA 1TJ3A 5FTWA 2W2LD 2Z9DA 4MRVA 4UE6A 4TWAA 1IL0A 4K88A 4TKUA 5DV9A 1H9CA 1UZUA 4CFZA 2R8EA 4FFPA 1SURA 3V80A 4CMIA 3ICOA 5C5EA 3IBGA 1RS0A 2XVYA 3KT3A 3SC3A 1UMDB 4E5KA 4ZJUA 1Q0PA 5E6SB 4CKBB 4DC9A 4ZGWA 3WLFA 3ZY3A 3S4YA 1D5CA 4CQMA 3OLCX 3AI3A 1OC4A 4ONEA 4WOCA 1OLUB 3SYNA 1YS6A 2ATCA 3HLTA 4EY6A 5KBYA 5DX1A 1N9GA 1BGXT 1GDDA 2X0JA 4W99A 1THZA 2PLRA 1PGQA 3F47A 4FKZA 2EZ8A 3VNQA 1E99A 2ZJOA 2PUHA 1QYIA 2ZS9A 3HFRA 1PN3A 1LB1B 3BCUA 4MVXA 3TOXA 4B6QA 1WETA 3MAJA 4IGIA 1JHZA 2OD2A 4OIFA 4HN4B 3CJTA 4HB3A 3ULKA 4ZYWA 1FYWA 2YJGA 3E1SA 4L9WA 4NAHA 5FOWA 1MQ9A 4G24A 4I4TA 3UY4A 5CCEA 5F51A 1C30B 2HQ1A 4G0OA 2WJZB 1CLUA 1OJ7A 3AUFA 2WPNA 4UHDA 2YHUA 1PSDA 2VLBA 2BP7A 1KEVA 4WV3A 3KCNA 4LX0A 5K01A 4JBNA 2OTCA 2Y1KA 1CE8A 4HWSA 4TXHA 2IBMA 3EVAA 4RCYA 2EKBA 1XZIA 2AUNA 1GKYA 4LCEA 4YDHB 3N0VA 3AU8A 4HXEB 1XVIA 1VMEA 2CLOB 4L0DA 1RPNA 2PT6A 1JNYA 2Y1DA 3GV0A 4FGUA 3NPMA 5G0TA 2V7PA 1NAIA 1XTUA 4I5FA 2BSQA 4YXFA 3DD5A 2O0HA 2V4ZA 4OL0A 1KO1A 3LE8A 1ZXBA 2B78A 2AWNA 1JB1A 1RWOA 4MUFA 2XYQA 3WQSB 2B21A 1J8QA 2B5OA 2BGNA 2VSXA 2YIJA 4LDRA 2PUEA 4HBGA 5DW0A 5DP2A 1YTUA 4Q7QA 1Z26A 1CUFA 3AXTA 4IXMA 4AMUA 3GCGA 3F6EX 1CUBA 5HUQA 3A26A 3PQ5A 1DXYA 2E4AA 2PS1A 1EWRA 1XLVA 2FF5A 1ZIPA 2ZPUA 4GIBA 4RA6A 2G28A 4ZZ1A 1EX6A 5TLSA 1RQPA 3OOEA 1XD2A 3UFXA 4AUNA 1O6GA 1NR5A 1RWWA 2AUTA 2RHHA 2Z3WA 5J2TB 1NF9A 2Q2VA 3K9LA 4UMVA 3LXUX 2ODPA 2SECE 1RKBA 3DE2X 3HWSA 5A3JA 3GP3A 1SXJC 1NXXA 1UDBA 2DVMA 4J0IA 5JVDB 2WNIA 5F52A 1FP4A 1GZ6A 2A5GA 4U0KA 2I99A 2E5LB 5IDXA 1H2BA 1Q84A 1NNLA 4INZA 4MQLA 4OMDA 3SJBA 3UJ3X 4X71A 1CRLA 3D7RA 1N1MA 2MSCB 4I14A 4DT1A 3RS9A 2Q46A 3SJZA 1UEJA 4AY6A 1MPXA 2X0KA 5EWJA 2O1WA 3Q1KA 4RTPA 1VHDA 4DNQA 1D1TA 2C9ZA 4QDUA 1ODFA 4M54A 4PHCA 1ZBDA 3OZXA 4B4WA 2IEDA 3M82A 3PQEA 2EZ9A 2CGEA 4LISA 4EMTA 2DSNA 2QUZA 3OZBA 1I9GA 2ECPA 5G3ZA 3PVSA 3LDHA 3KJHA 4P6VF 3RR2A 2OK7A 3VO2A 2AOTB 1NVKA 2IHUA 5IN5A 3TFOA 5J2UA 1DKLA 4GRAA 1C81A 1NPTO 1T91A 1W4LA 4M9UA 4OSOA 2DERA 2BUAA 5LVAA 2H5LA 4HUTA 3NI2A 2IYPA 5CH3A 4N39A 4TT8A 4DMKA 5KINB 2GWHA 2CJFA 1NU8A 4TT3A 5IT4A 1E9VA 5ALFA 4Q1BA 2GJ8A 1ZRNA 5E8JA 4XJTA 1KE2A 3L0CA 4M9SA 3HWX1 3T0GA 4BMNA 2XITA 721PA 1KEPA 3LS2A 3LHFA 4JJIA 5J4VA 3FFWA 1NF8A 3DW3X 4X1KB 1AGRA 1E3LA 3DH0A 3VYUB 1DC3A 5FXMA 3PNQA 3L8MA 4MI1A 2JGMA 4MKFA 3FMFA 2BEUB 2AT1A 2ADOA 2YXNA 1YUMA 3E1KA 1FXWF 2EIHA 3CZ9A 3WP1B 4MUJA 1KAOA 1N33B 1HBJA 1B6RA 4RVCA 3UEOA 1BRTA 1HH4A 1QH8A 2CNKA 4P81A 3JATA 4PYRA 4C7JA 3EEOA 4K0KB 1E6LA 4H1HA 2EBWA 1KYXA 3QVLA 4HI0E 4ZCLA 4MIKA 4R54A 4TWBA 1ID8A 1DUIA 3I2KA 3I9JA 3Q9UA 3JQ7A 2VUTA 1GILA 3COVA 4P32A 4JJZA 3U7IA 1X8KA 3GPLA 4AVYA 1G9XA 4MS4A 2K5UA 2BN4A 3DUFA 2F43A 3U7JA 4RXTA 3FWYA 1XZFA 2HLDA 1TZKA 1UOEA 1YRAA 3FYTA 1A77A 1WUHS 3F97A 4UUPA 4A5SA 2I91A 4R1UA 5J4LA 4PZUA 1UJ4A 4ZT6A 1F2TB 1SXIA 4Y67A 4MMZB 3TH5A 3BYZA 4KR7A 2R6FA 5KNDA 4AQ7A 1RRGA 1SVMA 3S40A 1P0IA 1QPGA 3PCXA 5B3JC 2ZETA 1W52X 2DG2A 1D09A 2D1FA 2GA9A 4HXGA 4GKVA 3R5HA 3QMVA 3H2IA 2J3JA 1HNNA 3GFOA 4XARA 3ONWA 4G1VA 1AUOA 4P92A 3B9PA 3PQ6A 3B1WA 3DYIA 2F17A 2REQB 3U3RA 4PG4A 2JIMA 3U4AA 4DRZA 3O95A 1STOA 2VYFA 2ZRFA 3PNVA 4R8VA 4L51A 3I5YA 3OD1A 1J49A 5CT9A 1VI6A 3I2GA 3ZDRA 5LXTF 4LZWA 4NFSA 3ZD6A 2HBQA 1Z35A 1I51A 2BFNA 4RTLA 2H4JA 2FMKA 2NUTB 2W6JA 2YRFA 1NVTA 4JJ6A 2IZ6A 1YJXA 4UEWA 4PC7A 5BRAA 1C1DB 3P7MA 3B5JA 3DQPA 3OEEA 1KO5A 4FMDB 3I76A 4PC6A 3UH0A 4E03A 1U1GA 2QVXX 4BVLA 5HKLA 3AFHA 1UK6A 3O47A 2GYYA 5BV0A 3FSRA 2A86A 5AUPB 4CM8A 3IKLA 1Z5ZA 1NSTA 4ZGGA 2NYVA 3PRHA 1Z63A 1U0BB 2ZWAA 3CF4A 5KKNB 3MCZA 2VXOA 3CX7A 4DNOA 4QOJA 3V4FA 1SBYA 3EYWA 4DG5A 1GTJ1 2ZJ3A 2HWUA 3VA7A 5DF1A 2C3MA 3R5SA 2FJPA 3K16A 4R8MA 4MLZA 3WL4A 2QX9A 1SHUX 5B53A 4ZVSA 1VIVA 3T9EA 1BO6A 4B48A 1YL6A 4I9NA 3CX4A 1NRXA 2FPRA 2VF8A 2YS6A 5E6RB 4LMAA 4GDFA 2PWYA 4W8GA 5KVVA 2Q45A 4TVOA 1CJBA 4GWGA 1Y81A 5ECYA 3MHTA 1V6SA 2OBNA 1CUIA 3LA6A 3PFWO 4PLTA 4X91A 2DB3A 3OWHA 1AE1A 1DJPA 5ALZA 4YPVA 3BMNB 3VR2D 1XG5A 2BKAA 3QE9Y 2AVNA 2Z2IA 3L0OA 4WZBA 4AJEA 1H0SA 3ILVA 1LPPA 2B34A 2D3TA 4Q03A 4ZQBA 5JALA 1OH6A 1S7CA 3AF6A 2O06A 3EVDA 1JG4A 1J6UA 1RQXA 3UWSA 3A9UA 3KETA 2R0QC 1GA1A 3TPFA 4B3GA 1UXOA 4L8LA 1NAHA 1OE0A 1Y7HA 2WYWA 4AYWA 2PAFA 5JXJA 2VTEA 1WSAA 2X86A 1TF7A 2XQJA 3AIKA 3LH5A 4HUQB 4I7EA 3SM9A 4B7UA 4N76A 2NOAA 2V6MA 5F98A 1A5ZA 2GDZA 1KK2A 2VRWA 3QQ5A 1KXZA 5BW4A 2JH9A 3K6KA 4YCLA 3SF0A 2YKGA 3QX7A 3THXA 4UHJA 3GCXA 3H19A 4KQJA 4M1QA 1GCIA 4D4LA 4YCJA 3WISA 3OCCA 2PXHA 3ZK8A 4TM7A 1L1QA 4M1MA 2ORYA 2PGXA 1EVZA 1UBKS 1OY1A 2ZGVA 3QLJA 1FFEA 2UUPA 1IK4A 3G59A 3I0NA 2YWEA 3WKEA 2PJRA 5KEIA 1I4TD 1C1YA 1EEXB 1Z8FA 5ALHA 2XEDA 1PJSA 4KIFA 3PXBA 3GMIA 3WLTA 4XH9B 1YONA 4HX2A 4GMGA 2XDAA 3C3BA 2CHUA 2PUAA 1JV2B 1NY5A 5HS4A 4PGMA 5HQJA 1N2IA 2RIRA 3AJ9A 5G4KA 3W5IA 3PNBA 1IY2A 2YY6A 4NOMA 4WN9B 5F35A 1ZOOA 1LZLA 5AVWA 2RBGA 2YZGA 4OY3A 3FUUA 4WFJA 3R0VA 3YASA 2AA3A 1ZD2P 1YQWA 2H4HA 2D2FA 1JFFA 3R0IA 4BLQA 3DMFA 1C3OA 2II6A 2WHEA 4DMFA 1F2UB 1FJHA 4DDKA 3LZ6A 2B1RA 1KJIA 1OAKA 1XZCA 2IGTA 3GMDA 4NECA 3KTAB 2QUKA 1BEEA 1KGDA 2H0RA 2R65A 4TQGA 5MGBA 1L1RA 2ZT7A 3QPUA 5JAQA 3QVTA 1F3OA 4MLCA 4KREA 2YIDA 1ZGAA 1QCDA 3GNSA 2C8LA 1NQVA 4HTAA 4KXMA 1F8FA 4REQA 3K4HA 3RBZA 3VU8A 2H85A 4NULA 1RBMA 2A1TS 2ZPTX 3L0IB 3ANLA 3HNRA 3LX4A 2EYQA 5B3KA 4TRNA 2XR1A 1GPYA 3D4OA 2QM0A 3DMRA 4K05A 4LCBA 2FGJA 5JYBA 4OAOA 4AMYA 4DV1B 1MVOA 2EJVA 2HIAA 1HZZC 1NN1A 2I71A 2LIPA 3CXRA 1WZNA 1EAMA 4I81A 2RGNC 2HB6A 1QQ7A 1NVUQ 1W75A 2DC1A 4AP9A 2XTAA 1GR1A 1KDTA 3PF9A 1HR0B 2V65A 4OFXA 2PU7A 3EGOA 5HTOA 4JT2A 5FI0B 1XTIA 2MOKA 1UAAA 4B4UA 3ENWA 4NE7A 1KA9H 2J5QA 4LRYA 1U0EA 4MJLA 1BE0A 2N3ZA 2NO6A 1OBHA 4HEHA 1PLKA 2ACKA 4JLSA 4NG5A 2XKKA 3VRHA 4DHWA 1A9XA 3LBHA 3CNNA 2Q5QA 3R75A 1KJ8A 5CDFA 4YLGA 4Q48A 2J3EA 3RUCA 2WYUA 4G1EB 2IJGX 3WOHA 5TC4A 1AX9A 4OQLA 1YBFA 1R4NA 4EPYA 1ZJWA 1DDGA 3U3KA 1IPEA 5CH5A 3T15A 1QRUA 1TEZA 2BDUA 3BFKA 2AUMA 1IQUA 1R88A 121PA 1UT8A 2H1FA 2H57A 3GN2A 4INJA 5CH8A 2CHQA 4JXKA 5DPMA 1BHJA 2FZWA 2HT1A 2QVGA 4ZAGA 1XPRA 3HPQA 4C3VA 3RO7A 3ZV7A 1WLYA 1Z2DA 1QONA 1BGWA 1Z0DA 4FGJA 4HEA1 3UKDA 1KEKA 5KNCD 3GLRA 3NBAA 3MMSA 1MO4A 1F4LA 2HTEA 2EKPA 3DVQX 3U09A 2BBOA 3W8FA 4J43A 3U44A 4YRTA 4EG0A 5AKXA 1PVOA 2X23A 1A1SA 3OCVA 1H2FA 4IMIB 4BB9A 5BW8A 2J09A 1U5AA 4DZZA 1H2YA 4HMQA 1JL3A 4FS8A 1YDHA 1RZUA 1P75A 2IOYA 2VDUE 4FNAA 4TYPA 4POOA 5J47A 1ULAA 3B7WA 5MF6A 5FV7A 4L74A 3OBIA 1KOFA 4HLQB 4FFSA 4QPCA 1E5TA 5HP4A 1RJWA 2C2ZA 5A9SB 3TM4A 1H4QA 4U7FA 4EPWA 5EEGA 3F6BX 1A71A 4N40A 3C3EA 4P3KA 2OILA 3FFTA 4HH4A 3TLJA 3M1IA 5EQFA 1BYIA 5J2TF 4QQRA 3S8MA 2DT5A 1PLJA 2H4FA 4AY4A 1ISJA 4WZ6A 2V6IA 2W6CX 3FDJA 3EIUA 4I6GA 2IX3A 5JVDF 3RE1A 2A57A 5EJIA 1BVYF 4N5HX 1FUYB 2OCBA 1TQDA 2RK4A 4HWOA 4BMVA 3UBTA 2D6FA 1WMDA 1GN8A 4BVFA 1EMDA 5AW8A 3T9FA 3W1WA 4BVHA 3QE0A 1DFIA 3IKTA 3P0RA 3OE5A 5A3RA 3DNFA 4ZFNA 3P4XA 3LG2A 5CPBA 4A2CA 1MOZA 2ZUSA 1LSOA 5BSUA 1MIOA 3DONA 3A9TA 4EB3A 5KC8A 2G9VA 1IJEA 4QHTA 3QI2A 2JCVA 4R8RA 1DWOA 1YDFA 4EK9A 3LW8A 3OWOA 1BE8A 1NBAA 3WQQA 5JD3A 2IY7A 1LH0A 2FN4A 1GNRA 4MUIA 4FB4A 3KSDO 2FW0A 1M6NA 1HORA 1IC6A 2PIDA 2IHZA 4PRZA 3KSAC 5ERXA 4AJLA 5DSXA 4PX9A 2CZQA 2E4ZA 3LCRA 3RHSA 3PA8A 2HMTA 2A4KA 2YFHA 4P82A 4J0QA 1I2AA 2GCIA 4GH5A 1C7ZA 2IU3A 5BVHB 1HE3A 3FLBA 5DGXA 2JIZA 3G9ZA 3WHIA 4XQ0A 5H3LA 2AK2A 4NKRA 8GPBA 2CLIB 3QV2A 1OREA 1YDEA 3MZ0A 1EVEA 1EUZA 4OFBA 5DU2A 4YLYA 3JWGA 3IJEB 1ZUD1 1OXKB 3ND9A 5FLXA 3KYCA 1GGHA 5K0ZA 4FN5A 2W6MA 2OE2A 2VUIB 2NXWA 2PYIA 3QNWA 5BN3B 4O8ZA 2BGKA 4OHXA 3MWEA 2BW0A 4WY2A 3ODGA 4C7BA 1WSBA 4E3ZA 1TZBA 4ZWNA 5ALVA 3GFVA 2OWDA 3C70A 3IJRA 1H1LB 2AC2A 2W6ID 2WYVA 3IUNA 5DEIA 3ZE2B 5DYWA 4EUFA 4BNFA 5C1OA 1EH5A 4WFQA 2P40A 2B37A 5D84A 1MTZA 4GOXA 3QF7A 3IX7A 3T6KA 4EIWA 3CKKA 1V11B 3ZXIA 1LDNA 3FOZA 3BIXA 2E3JA 3L1JA 1QX3A 3C87A 1DHRA 5DTIA 1T6XA 3I12A 2Z8YM 1ZINA 2GN9A 3FTNA 3JVDA 4IVPA 3N2GB 3CW9A 5F1KA 2UVQA 1OI2A 3MLBA 4MMXB 3ROFA 3SC4A 4ZK2A 3TZQA 5DN9A 5DLDA 5LNK1 3H5AA 2GASA 1MC5A 3I2JA 2HSGA 2DLNA 5A5GA 9ATCA 3SVTA 5J23A 4B3TB 1F12A 1JWAB 4JI4B 1VLVA 3HU5A 2WV9A 5DP1A 3HBMA 4GM1A 3L49A 4DLRA 3GLFE 2PY6A 4YROA 1R3DA 1QRAA 2CJPA 4FBMA 1JDJA 3DFUA 4R8KA 1SC1A 1KC1A 3IMEA 1M1NA 4CKXA 4BPRA 5D3MA 4LOLA 4KPGA 4XGKA 5K3FA 3D64A 2C2XA 3SQOA 4OI4A 1ZIYA 2KQUA 3BJZA 3LPAA 3HVRA 1GPUA 4DEYA 4EGFA 2B8NA 3CEPB 1ZD5A 2VHEA 4FYPA 5TMBA 5IC4A 1N5DA 4RJJA 1KMNA 1Y3HA 2XUIA 3IAUA 1MVLA 1O54A 1OA1A 3F49S 3HCAA 4K9RA 4Y6QA 3VPDA 4KDFA 4R1MA 2P5YA 2WFLB 3AVPA 1E3WA 4ECAA 1Z7WA 3EZYA 1GPMA 4FMDF 1GQFA 3Q0TA 5HCNA 3W5JA 5HJ7A 3MTJA 3JD4A 1VJ1A 4EUSA 3M6IA 2BVNA 2P1RA 5C1PA 5JDCA 3NMUF 2I76A 1UQRA 1GUAA 1QH9A 2UKDA 2VP9A 4EFKA 2QXTA 4M1OA 1A4XA 2EP7A 1AKMA 1O03A 3ZBUA 4X8LA 1K5DA 3KXIA 5ALTA 3E9ZA 1U7XA 4MV7A 3GZTB 4RACA 2OLEA 3DBLA 3U37A 1PFYA 5BYKA 2QRLA 4NL4H 4UBJA 3JWPA 4MGZR 4RSGA 4ZYYA 3KL4A 3O1IC 4QJ5A 3LCVB 3VV2A 3W06A 3GUUA 4TV9A 1AN0A 4D4KA 4DQDA 2JRLA 3FYUB 3WYFA 4BNLA 2ZYSA 4EYGA 3AKCA 2BEVA 1ZI8A 2VHTA 1G16A 3HBAA 5CVJA 4LMBA 3GGCA 3N05A 3EZ2A 4EA6A 1XTPA 3A1DA 3DP9A 5JS7A 4DYVA 4AMGA 3BJMA 2IXFA 1CEYA 1Q3TA 3IIJA 5BQPA 3TPZA 5MGNA 1T29A 1YB1A 3IAXA 3QG1A 3A6JA 3DZJA 4QBFA 4TPKA 2O0MA 1R4AA 3D6UA 5EP3A 3SLKA 4PXAA 1L5OA 4DV7B 4UHEA 5U4QA 2UVDA 1GFSA 2EBFX 3NGMA 4MJ7A 1WUIS 4F84A 3Q8KA 2IYOA 3CTMA 1V7ZA 1MB4A 1RABA 2ZR7A 3A4NA 5L3SB 2QLTA 1WF3A 4M1EA 4XCVA 3DE1X 1K6JA 4YRDA 3TE6A 3AOEC 4IQ0A 3ZJUA 4O1MA 5ALRA 2QTCA 2KWIA 2O4UX 3ER6A 4I08A 1B0UA 2EG5A 2SCUA 2HD4A 4YP1A 2I4TA 5BN4A 1DX4A 2XD9A 4F72A 2ZCUA 3ASYA 3BKWA 4BMZA 2XVZA 4QUDA 3FNIA 5DNVA 1K5GA 3KDPA 1YDMA 3TLGB 1SHJA 3WYCA 3UCFA 4HAIA 4X45A 4GBMA 1IK6A 2MINA 5FLEX 4PC3A 1CR6A 1AF7A 2FZKA 2P0AA 3NHSA 3WMRA 4LJRA 2PZMA 5AJHA 3QK7A 4IWYA 4X3CA 3RSGA 4E09A 4MA5A 1NF2A 1Z12A 1P2TA 2ECQA 4IJUA 2ZRHA 1BNCA 3ESAA 5JTTA 5LYJB 1RZRA 4FE7A 2VN8A 4OLHA 4MRPA 1HURA 3VOBA 2H59A 1QANA 4E30A 1CJVC 2MMGA 4OGWA 1CUWA 1KI8A 4RCVA 1XUOA 2VQFB 5E7QA 4U63A 2IDMA 5ANRB 1W0JA 3OFVA 2VZ9A 2X58A 4M83A 4UNSA 4YCDA 2D13A 3IUBA 3BIOA 3BQ9A 2DR2A 2QYSA 3LO5A 4P93A 3VUFA 1OH7A 1XLTA 2D62A 1CIJA 4H3SA 2OAQ1 1I13A 1KR5A 5C3UA 5HIAA 5ITVA 2QAIA 2PMKA 4NNOA 5TS3A 2VC2B 1NF3A 3LL4A 1GG8A 2P9BA 3DOIA 2BRUA 1O89A 1J2EA 1ZN8A 1YQTA 2F59A 2I4RA 3IQHX 4PHTA 4BWYA 2W6PA 3FJYA 3PUKA 4AP6A 4URVR 4BNKA 5TS2A 3WQBA 4XQCA 2YWBA 4A0RA 1VA5A 2BEWB 4WNAB 4PYNA 4J75A 4CZ2A 2FZVA 5HQ3B 4TMWA 3L1KA 3NV9A 821PA 1A27A 4G5FA 1Z07A 5DBFA 1YJQA 5D86A 2ZU0C 4NYJQ 3NKFA 4ITVA 1L7AA 3CMMA 5IKXA 1R10A 3W6UA 1UPAA 2ZTLA 3UJBA 1T24A 3TXAA 2C94A 2G08A 3DDCA 3RAPR 4EHNA 5EJEA 1C9MA 4PCVA 1GL9B 2MSNA 1HNXB 2WWWA 1U0GA 4OLBA 4UU7A 4WLFA 2EYUA 1E64A 3PXDA 3AVQA 4RZHA 4H7KA 2VPZA 1TT5A 4CF7A 4A2PA 1GKLA 1VI5A 2D7CA 1U11A 4N1AA 3EJWA 3ESXA 3L8HA 4KXWA 1J1IA 2VJAA 5IFLA 1IVSA 4JA2A 2HSZA 2C1XA 2GPSA 3HV2A 2J1LA 2O2CA 2PRZA 2V0NA 2C2WA 4NYMQ 3HQ4O 1I7SB 1U8EA 3VDQA 1VBFA 2PZAA 2VI5A 1A76A 3ECAA 1M73E 3SFZA 4PZDA 2CCKA 1E1QA 3T7IA 3CT6A 3AB3A 3M83A 3GFBA 1Q77A 3KTFA 1JAHA 1OROA 3Q3GE 2QAJA 2W2VA 2OHIA 3IUMA 2GN1A 5IF3A 4LF9B 3Q6IA 4WESA 4EUKA 1R4MA 2AF3C 4Q4JB 1MRSA 1SXJE 4GL4A 3RKUA 4RY8A 1SCAA 5LUBA 1T4MA 1IUPA 3IBYA 3NYQA 4F4HA 1E0DA 3EXHB 1YV9A 2XRFA 3N2KB 3L1IA 3G1WA 1IVYA 2E1PA 4IRMA 3QQPA 3BK2A 4B2PA 5A6SA 5F1OA 3HLYA 5E1BA 2AXEA 1QTQA 1BVHA 2VCEA 3FCOA 2XRMA 3NT5A 4G89A 1CV2A 3D6MA 4QIHA 1G8YA 2BFDA 3OX1A 2CE7A 3EK2A 5L7TA 3KQNA 3U4QB 4AG3A 4C0SA 2VXYA 5AVTA 3GEGA 2C9MA 1YB4A 1CHDA 3FYUC 2X8JB 3OEYA 1U0TA 4TLDA 3AYZB 3O83A 1T8YA 4DV2B 4Q18A 2VH2A 3GLGA 5IAJA 1Z4KA 4BATA 3LXRA 2HJ9A 3GOHA 1EZ4A 1SD1A 1GQSA 5GP1A 2LBPA 4YRAA 4D0LB 1U8YA 4OSPA 2FG7C 2P7IA 3DT6A 5JSYA 1ML4A 4MEJA 2O3UA 4L2IA 3ZJ4A 1ZK4A 3QX9A 4MPRA 1WL8A 3TQHA 2V7EA 4G9BA 4RJIA 1SAYA 4K7JA 5HGJA 1Z36A 2KLHA 2PFKA 3BK1A 3GHYA 4JIGA 1Z2EA 4M22A 1P7YA 1I3CA 2QT9A 4TXMA 4ZDKA 3ABOB 4N48A 1SCIA 3IT0A 4W7IA 3SYLA 2GXAA 4DG9A 1PZFA 4P4SB 4W7HA 3Q3HA 5FFFA 1G1MA 1YZYA 1BWSA 1TADA 2AN5A 1PWYE 2AQIA 3DB2A 2XGSA 5JC1A 4N6OA 5KO2A 5F7XA 1F0PA 1AMOA 3EXFB 2WABA 2HBZA 1X7WB 3E0XA 1E79A 4CEIB 1H8ED 3U81A 4EFMA 2XBUA 6ADHA 4A73A 1DAHA 1Q0HA 3JQRA 4UVIA 3VO8A 5SYAA 2A92A 1JVNA 3CX8A 1AJEA 5FO0A 4PU0A 4P2BA 4WCDA 2CK3A 4PGAA 2XE7A 5G0VA 5HFAA 5AM4A 5EZ6B 1XU9A 3H9CA 1NFQA 2O8FB 3PKIA 4EFLA 1OTYA 4OKNA 1LDBA 3BXGA 1OV6A 5AKZA 2NU6B 4HY3A 4P7JA 4ZT5A 3R74A 3GDOA 3UUGA 4HNTA 4U00A 2GKSA 3IDZA 2WHRA 2QGZA 2XX3A 4WNCA 5FRDA 3T9BA 5JSZB 1AHHA 2R85A 3ELDA 1DKOA 1JSZA 3DL2A 5CIYA 1G60A 3GJ3A 1TMYA 1JEYB 1UIMA 2AI2A 1XD9A 1DAIA 1ZMOA 5JMWA 3QKIA 4M2LA 1N0WA 1E77A 3FSJX 3U0VA 3CRZA 2ZS7A 3UK6A 4D45A 4ETNA 4WJZA 3UNXA 4EY5A 1QAOA 1T2DA 1M3SA 3TKAA 1TQHA 1XTSA 1LEHA 1B8VA 2JVJA 4JZKA 2VAWA 3IESA 4ASUD 1EESA 4QUBA 3JASA 3OCUA 1IUKA 3V9PA 2YV5A 2IEYA 2QPOA 5THXA 3PEWA 1C2TA 1LJUA 3AFIA 1M6HA 1S9HA 2LW7A 5LKRA 3TNFA 2FPGA