4JYPA

Crystal structure of kai2 apo form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
267
Chain Sequence
b'GVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, alpha/beta fold family protein
publication title Smoke-derived karrikin perception by the alpha/beta-hydrolase KAI2 from Arabidopsis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 94
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jypA00
2XQGA 2DR0A 1DWOA 5LZ8A 4Y2QA 5EHQA 2OCKA 2JGFA 2PSHA 2WIJA 5DYYA 2XLCA 1YA8A 5AM4A 3AZOA 1R50A 3PE6A 4OB6A 1ISPA 4X95A 2RIPA 4EHBA 2EEPA 4BDSA 1XRRA 3UUFA 4CCWA 4EY6A 1QE3A 2WIFA 3FVTA 5JADA 2DSNA 4Y7DA 1USWA 4XWGA 4B0OA 2O2IA 1EDBA 3HEAA 3ILSA 2OXEA 2FJPA 2R8BA 4WY8A 4BYMA 3OURA 4TGLA 4FWBA 2WG1A 3VXKA 4Z49A 2AJDA 4Y2RA 3STYA 4G8DA 3HLKA 1AGYA 4M0EA 3AJAA 4Y9SA 1BN6A 2WG2A 4EUSA 1LPAB 4B83A 5LZ7A 5JIBA 5CT9A 1WPXA 2GZRA 4KJXA 1WHTA 2I78A 1AMNA 1MU0A 3VJLA 1CUZA 3QPCA 3QPAA 3B5EA 3RKSA 3R3UA 4AO6A 2FUKA 4QDOA 2CKMA 4CCYA 4E14A 5CRIA 3TJMA 3W04A 5JARA 5EHNA 3DJYA 1GPLA 3O0DA 4H7KA 3C5WP 3G0BA 2PM8A 1MT3A 3ESBA 4BB0A 4AB1A 5FPPA 2JGKA 4MQLA 3G9TA 1ZJ5A 5AOAA 2WKWA 4BZWA 1XLUA 5AM2A 3QMWA 4BATA 4FTWA 5JASA 4ZXFA 1SOMA 4RE5A 3FSGD 3EQ9A 3HRHA 1YAHA 1CUUA 2XMBA 3ICVA 5CXUA 3GROA 2QXUA 5EIEA 1P0IA 2HL6A 2Y2UA 5ALXA 2H7YA 3M3DA 5AKEA 3F98A 4U2EA 1XQXA 3STWA 3EF3A 4BE9A 5AO9A 4UHFA 4X7BA 5CT6A 5AKYA 3N0TA 5ALFA 3G7NA 5IVIA 2XMZA 4HS9A 5JANA 4Y2YA 4QDZA 3QMVA 4J0CA 1M33A 4U2GA 4FNMA 1FFBA 4X6YA 4CIBA 5DNVA 1XFDA 5AKGA 4EBBA 5AJHA 4BDTA 1ZJ4A 3HYSA 2XQIA 5D6OA 3MGAA 1XZIA 4J3JA 3MVEA 2AJBA 3VJMA 1C7IA 1CUXA 3F67A 4I19A 2OCGA 2OAGA 4BTVA 3C87A 1X2BA 4BTLA 1X70A 5J3JA 5AK3A 1RP1A 4MXDA 1GGVA 4MEBA 4HAIA 1CVLA 2J4FA 1ACLA 2D0DA 3CCBA 4UBOA 5A2GA 3O4IA 3O4GA 3FYUA 1QIHA 4DSZA 1MTZA 5AH0A 3BL8A 4G1FA 4UBNA 1EI9A 3DDUA 2WUFA 1XQYA 4J0JA 5ALJA 1QIKA 2XUGA 1TKRA 2PL5A 3NOXA 2VJBA 2XI4A 1UWCA 2Y6VA 4DIUA 1IUOA 4B85A 2EDCA 2XMSA 1WB6A 1ORWA 1TIBA 3OC0A 3LIPA 4H7EA 3CN9A 1J06A 2PKYX 5HFAA 1FSSA 4N8SA 5HF8A 5K3FA 4Q05A 4X71A 3WYNA 3AZPA 3WQHA 3BE8A 5ALMA 1WHSA 3C45A 1MNAA 4KAJA 1VXOA 1R9MA 4G4JA 2OG1A 1MPXA 2PSEA 1E89A 3G0CA 3WL5A 4BC0A 4BRSA 4UBIA 2OQVA 1EDDA 2OGSA 2VJCA 3V1KA 1HQDA 5KBYA 1CUDA 3WL6A 3V1LA 5SYMA 3V1NA 2GYWA 3WK8A 1VE7A 4OSEA 3WKBA 3GFFA 1EB8A 4KE7A 3SWWA 3LP5A 3STVA 1DX6A 1CUIA 3FSGA 4FDMA 4DNPA 1OILA 3IVMA 5E2IA 4ZV7A 1H22A 2CMFA 3I1YA 1QFMA 3M81A 4AMYA 3HI4A 4HZGA 5DJ5A 1CUYA 4FKBA 4AN1A 2PSDA 1YAJA 1ETHA 3PUIA 2V97A 5DNWA 1KU0A 3WKAA 2HU7A 3WKEA 3WK9A 2O7VA 4NVRA 2W22A 4LYEA 1ZI8A 4BVKA 4FOLA 2HADA 1B41A 4UFOA 1UXOA 3H19A 4RNCA 4D9JA 2XMDA 3F8SA 2P8SA 5AI0A 3KWFA 5A7HA 2XUJA 2JEZA 2EDAA 5AKKA 3WMRA 1U4NA 2B20A 4F5ZA 1MAAA 3H2JA 4FLEA 2QMQA 2WG0A 5DTJA 3PICA 2Z5GA 3IA2A 1W76A 3V9AA 1VLQA 2VF2A 3A6ZA 4C01A 5HQ3B 1YASA 2QVBA 3WZMA 2QJRA 2QM0A 3C5VA 1HL7A 2XUQA 4FFWA 1F0PA 5C8VA 4DLNA 2HU8A 2AXEA 1G66A 1CUGA 1IUNA 4B6GA 5C81A 1UOQA 1AQLA 4K2AA 5E4TA 2Z8ZA 4FBMA 2PBLA 3SX4A 1E8NA 4PSDA 4K5QA 3SC2A 4J0DA 1QFSA 1CFJA 5CT4A 2XT0A 3AZQA 3AUKA 2RHTA 2O7RA 5LZ5A 1UKBA 2ES4A 3E3AA 3JYHA 3WK6A 1LPBB 3G0GA 3U0VA 3WWEA 4UPDA 4DMKA 5CH8A 1PFQA 4DM7A 5JYCA 1VOTA 5FLKA 1WM1A 3WIBA 3KXPA 2J4CA 2QTBA 4TPKA 3FYUC 2G5TA 1R4ZA 4P08A 3VISA 4LXIA 5JAUA 4B81A 5AOCA 2QXTA 2ONCA 2Z8XA 2W6CX 5C8ZA 3RLIA 5LZ2A 3DD5A 3B3QA 2OGTA 1XZHA 1Z68A 1CQZA 2VAXA 3WI7A 5AOBA 1LNSA 1QTRA 4BC1A 3WWDA 2QOEA 1VKHA 1C4XA 1IZ7A 2JIDA 1JMYA 2GBFA 4W9RA 1LZLA 1UOOA 1EINA 2YXPX 3P2MA 4ZV9A 4WCVA 5I7UA 5JALA 2G4LA 3WWOA 4MWTA 4BE4A 4WFIA 1MX5A 2QJWA 5ALLA 1R9NA 2CJPA 1AX9A 3STXA 1B6GA 2QS9A 2XDWA 1UK8A 2BUAA 4N5HX 2VTVA 4MWSA 4X92A 4F0JA 1YS2X 1GT6A 1XQVA 4CG3A 1UK7A 2J3QA 5LZ4A 5ALTA 1AC5A 5D3ZA 4GDMA 4PO3X 2HM7A 1PJAA 1W6RA 3N2ZB 3C6XA 3C8DA 3HXKA 3DL7A 4X97A 1XRPA 1KEZA 4WY5A 5E4JA 3WL8A 4BAGA 1XRQA 3V1MA 3CN7A 5EIHA 2Y1KA 4JEIA 5ALKA 4HRXA 1BCSA 4BBZA 5K3DA 3BDVA 3RK4A 1H2ZA 1EDEA 4UHHA 1E5TA 2C5GA 5FKJA 2QKYA 1BEEA 3ZPXA 2XQFA 1CEXA 2RGUA 2BCEA 1ZGBA 2CBGA 2VT7A 4OCZA 3I2IA 4OYLA 3ANSA 2HFJA 3FLAA 2B4KA 1GXSA 1QGED 3H1BA 3R41A 4UHCA 4PSCA 5ALNA 1ZD4A 3AFIA 1DQZA 4OPMA 2PSFA 3F96A 1JU4A 1OCEA 5JAHA 3V48A 1HLGA 2PUHA 4K6KA 5FV4A 3UUEA 5IVKA 5HZGA 2AJCA 3TRDA 1SCIA 2ORYA 3IUMA 1CPYA 4I4CA 1ZI6A 3WZLA 1ZOIA 1XZKA 5AKIA 2HHAA 3O9MA 4ARBA 2C58A 2JF0A 5ALRA 4CG1A 2X8BA 1AZWA 5T4FA 3W9UA 2BGRA 4L72A 3DCNA 4M0MA 4W1RA 4GW3A 2XE4A 4PSUA 4GXNA 4BZZA 4C4YA 1FFEA 4B9AA 1VA5A 5HQ3A 2FX5A 3K6KA 3WL7A 3WJ2A 1GPNA 1THTA 5H3HA 5LKAA 5LZ9A 5AM1A 4HRYA 5AI5A 1ORVA 4H7JA 5LIPA 3VDXA 2GBIA 3IURA 4NS4A 1L7RA 1CUBA 3R0VA 5K3CA 3ZV7A 2AJ8A 3TEJA 3W9BA 3AINA 1QO9A 4UHDA 4OU5A 1QO7A 2WLSA 2XUPA 5AM5A 1XKTA 4FHZA 1W52X 1G4HA 2I03A 1TRHA 1K5PA 1AURA 1LBTA 3OOSA 1E3QA 2GBCA 2V98A 1LPOA 2CZQA 1UK9A 3G9UA 3D5EA 3HACA 2B9VA 1JI3A 3A2MA 1I6WA 4K6HA 1YS1X 4EY8A 5K3BA 5K3AA 1CR6A 2RI6A 4JYMA 1A7UA 3YASA 3AIMA 3BJMA 1YB7A 1DTEA 1P0PA 2HU5A 4YK7A 3Q0TA 3VVMA 3HJUA 4JYPA 4NMWA 4EY7A 4X90A 2ECFA 3GUUA 4FBLA 2C5FA 1QLWA 4B9EA 4DMHA 2WUGA 3X3HA 2X76A 4IO0A 1H2XA 2Z3WA 2WTNA 3E0XA 5AK5A 1GQRA 1EXWA 4A23A 4P92A 2DFPA 2AJLI 4JNCA 3CXUA 2H1IA 4Y2UA 5FRDA 1DQYA 3PF8A 2LIPA 5T4BA 1E8DA 5ALDA 5AK4A 4FNGA 4MYSA 1XQWA 4HXGA 1CUAA 4E11A 1YSCA 4ZWNA 2XMRA 3DKRA 2BJHA 4Q34A 2CUTA 5A7GA 4U2BA 1BS9A 4L3WA 1AUOA 3T4UA 5HCUA 1TK3A 4QNNA 4KAFA 3NGMA 3OPMA 4YX9A 4X93A 4G4GA 3H18A 3BIWA 4X6XA 2OCLA 1VZ3A 4M0FA 5EHXA 1BU8A 4GLBA 1XZAA 5JZBA 2VT6A 5K3EA 1CUSA 2HA2A 2PVSA 4H7HA 4P93A 3IIIA 4FMPA 1IMJA 1BROA 5ALIA 2Y6UA 4U2FA 1CUVA 3ICWA 1L7QA 2BFNA 3R3WA 4DNOA 4QE3A 1F0NA 4H7DA 4CG2A 4IH4A 2JGIA 1UOPA 2HIHA 4H35A 1R1DA 4XVCA 4AQDA 1TCAA 4J7AA 1XZMA 1H23A 4ZGBA 4IH9A 1SFRA 3ZLUA 5CBKA 4TVKA 1MNQA 1G42A 1W4LA 3OG9A 4I3FA 5HKBA 1EX9A 1HDEA 1QIFA 1Q84A 3I2FA 3C70A 4QDXA 1U65A 3LCRA 2JBWA 5AK6A 3IUJA 1H2WA 2ACKA 3FLEA 5AKLA 1GQSA 1JKMA 2PPLA 4AXBA 1WOMA 1DWPA 4ARAA 4Y2XA 1CLEA 2ROQA 3ANTA 3NWOA 1KU6A 3GZJA 1TCBA 3S8YA 5CURA 3IBTA 2ZJFA 2HFKA 4X3CA 4B84A 2CB9A 1OXMA 4Y2VA 4BRZA 4J0GA 1XROA 3RM3A 4U2DA 3DLTA 4DSAA 5CT8A 5C7YA 2VA9A 5SYNA 4C6HA 3I6YA 1GKKA 1EK1A 1NU8A 4ZRDA 3LLCA 1VE6A 2I3ZA 3R3VA 3I28A 2JGMA 1QONA 3QM1A 2HA3A 4XX1A 3STTA 1EHYA 3G8YA 4KYVA 1ODTC 4L0CA 2XMGA 3EQ8A 2PX6A 2OLEA 3FVRA 2OAEA 4LYDA 1HBJA 1J2EA 3MUNA 2IIVA 2QUBA 4BP8A 5IVDA 1XKLA 5ALVA 4KE9A 2Y2VA 3JW8A 2ZJ6A 4F21A 1EB9A 2HA7A 3C8HA 3L1JA 4BAUA 1YA4A 3G0IA 4MEAA 4DNFA 5JD5A 1J07A 3PFCA 5ALEA 4UBJA 5JD6A 2XUAA 4WDRA 1YCDA 5T4EA 5DLPA 4CIAA 1U8EA 3FNBA 4QLAA 2BUBA 2QRUA 5CT5A 1N5RA 2OQIA 3M82A 4RGYA 2ZYRA 4C89A 5CW2A 3H2KA 4G8BA 1ZIXA 4ZREA 4INZA 1JT2A 5I8PA 1CUFA 1XRMA 3D3NA 4FFVA 4AO7A 1K6EA 4X85A 3S2ZA 4DTCA 5E4YA 1LLFA 4J0KA 3L1IA 5JAPA 1FFAA 2HRRA 3WLAA 1C7JA 2PSJA 4ZI5A 1FFCA 1O6GA 1CQWA 1DINA 1X2EA 1XZDA 1VJ5A 3GELA 3C6BA 4LXHA 5IKXA 4LIPD 5AI4A 5JD4A 3I1IA 4OD0A 5HF9A 3WIOA 3FOBA 3DOHA 2OGZA 2BAGA 3A70A 3PDCA 3F97A 1LPSA 1GZ7A 3D2BA 5CH5A 4Y2TA 2H9YA 3ZWQA 1THGA 2WHPB 3A2LA 1XZFA 4IHAA 2VATA 1FFDA 2VEOA 1J1IA 1VZ2A 4MYDA 3BDIA 1DT3A 5AP9A 5FP0A 5I9IA 4O08A 3QVMA 4YASA 3W2TA 4GWLA 4LHEA 4A5SA 3D4LA 4OUKX 3GBSA 4QDTA 4YPVA 1MAHA 4QEKA 2JGEA 4KEAA 1NX9A 4ITVA 2B61A 4EY5A 5CH3A 1ACJA 3ZI7A 1E8MA 2XUOA 3ZLVA 5A6VA 2C0QA 4G4IA 1UZAA 1XRLA 1EH5A 3I2GA 3GA7A 4WFJA 4MQMA 1XZBA 2WTMA 4DMCA 3WA6A 2ACEA 1GPKA 1DWQA 4BCBA 2JGJA 3O4HA 1QOZA 1IUPA 3HZOA 4Q82A 5JZSA 4Y2JA 2WILA 2NW6A 1O6FA 1Y7IA 2ZSIA 4J03A 4WFKA 1BN7A 1N5MA 3HC7A 3W06A 2CEKA 2K2QB 5DWDA 4WJLA 2VQ6A 1ZI9A 3E4DA 1VXRA 4XJVA 2QR5A 2WFMA 1UKCA 3G0DA 5T4HA 3H2IA 2X5XA 1Y37A 4KRYA 3FYTA 4NZZA 2WIGA 1MN6A 2VJDA 4QA9A 3MUOA 2WJ6A 4FLMA 4G8CA 4UHEA 3KOOA 5LYYA 2IX9A 3WK7A 5KREA 3ED1A 2DCMA 1RWQA 2G5PA 4UFNA 2HA4A 1EK2A 4B0PA 1ZD5A 3O9VA 4X94A 4Y2PA 3FCXA 5AKXA 3K2IA 4G9EA 2YH2A 3H04A 4A16A 5A62A 3KDAA 1XZLA 1XZEA 1P0MA 4GEGA 3FAKA 2C7BA 4C4ZA 2WIKA 3PF9A 3H2HA 4N5IX 1D07A 1MX9A 2WQZA 3BJRA 3I2HA 4OU4A 3VKFA 5F4ZA 4QWMA 2DHCA 4OB8A 4BP9A 4RPCA 4X00A 1F8UA 2WHQA 1Q83A 5KWIA 1Q0RA 1TCCA 4QDUA 4UFPA 5ALSA 3BIXA 4C88A 2XUIA 4AMZA 2J3DA 3IDAA 4H7IA 3T52A 1ZIYA 4BAZA 4EB0A 4EA6A 3G9ZA 1W1IA 4GHWA 5D3KA 4UUQA 5EI5A 4QLOA 2ZSHA 1UT6A 3DYIA 5EGNA 3BWXA 3C6YA 4BVJA 1NU6A 1TQHA 2Q0XA 4W1QA 4LXGA 1Q0ZA 1QIGA 3ZLTA 4DMFA 4H77A 1K4YA 1QJ4A 4QZVA 4H18A 1YR2A 2PU5A 1WB5A 3H17A 1DX4A 1WB4A 2XUDA 1AKNA 5HK8A 1XLVA 3WKCA 4W63A 3R3ZA 5D7BA 2I3DA 1CRLA 4Q3LA 4J0HA 1DU4A 5ALPA 1UK6A 3O4JA 1EVQA 3QITA 2V9ZA 3H2GA 3DQZA 5IH7A 1W75A 5EHZA 3H1AA 5BOVA 4J0IA 1CV2A 5DTIA 1QTIA 2DQYA 2R11A 1A8UA 4Q3OA 1ZICA 1A8QA 2ZVDA 3WYDA 2XQJA 4ETWA 3PUHA 2WHPA 2BUCA 2XMCA 5AKHA 3D2AA 3D0KA 1XRNA 5AKJA 1HPLA 4GECA 1LGYA 4AX4A 1Y7HA 2WU4A 3WJ1A 1XLWA 4CI9A 2OCIA 3D7RA 1ZD3A 3KSRA 2D5LA 2PU7A 1H2YA 2BKLA 1T4MA 4KR0A 5AM0A 1PV1A 4EZIA 5HF6A 3IB3A 3OM8A 4RE6A 5FDFA 1U2EA 5JAOA 4N8DA 3WK5A 4UBKA 3DNMA 1UKAA 4EY4A 1CUJA 3FBWA 5AKZA 4C87A 1CIJA 4PW0A 5AI6A 4KAAA 4XIIA 2Z3ZA 1L7AA 4JH0A 3KWJA 4GI1A 4HVTA 1UFOA 1XZCA 5BWCA 2QUAA 3VJKA 3EBLA 3BXPA 4MJ3A 5K5EA 1JMKC 3I6MA 4E15A 1MO2A 3WWPA 4WDQA 2DHEA 4U2CA 2WHRA 1G5FA 1BCRA 4CFSA 1LPNA 1K8QA 1IVYA 2WFLB 4P9NA 4PNZA 5HF5A 3DOIA 5DYWA 2QZPA 1R88A 3G9XA 2HDWA 3DL4A 5DNUA 1GKLA 1WCYA 5ESRA 3WKDA 1LZKA 3D59A 3EQ7A 4PF1A 3Q8WA 1CUEA 5YASA 4HXFB 4DNQA 4OYYA 4UBLA 4B82A 3HABA 3FCYA 4V2IA 4GBGA 4AZ3A 5CTAA 5LKRA 1P0QA 7YASA 4BVLA 1A88A 3DS8A 4FLFA 3K9BA 3BF8A 2OPHA 4DGQA 1K63A 2G63A 2XLBA 2XMQA 5HKAA 2WJ4A 1E66A 1CUWA 3I2KA 1QIMA 4KACA 4AZ0A 5LLSA 3ESDA 2XUFA 5ALWA 4KRXA 4KE8A 4UHBA 1SC9A 3JWEA 5FOQA 3B12A 4BCDA 4W1SA 5HK9A 1ZGCA 2ZYSA 3W05A 3L1HA 5EFZA 2H7CA 2RHWA 4UBMA 1R3DA 5LP1A 3R3XA 5A71A 2ZYIA 5EIAA 3I2JA 5KWJA 3LS2A 5BWBA 4CCYB 5ALYA 2WU3A 5C8XA 5AIBA 5AIAA 5BV7A 2V96A 4H7FA 4DYHA 4W1PA 4Y2SA 4Q3KA 1JU3A 3M83A 2FJ0A 3WK4A 4S0XA 4C4XA 1N8SA 3QPDA 4X6UA 1YB6A 4LKOA 4G9GA 1QIEA 1XZJA 5AHXA 2XUKA 1DT5A 2HA5A 2ZYHA 5ISMA 2DHDA 5ALQA 2UZ0A 5FPQA 2JEYA 3DYVA 4IH1A 2O2GA 2WFZA 5AM3A 2RONA 3WWCA 3IUQA 2XB6A 3AIOA 3QYJA 3VVLA 1JJFA 3QH4A 4HXEB 2HRQA 3AIKA 4PQEA 1T2NA 2WUDA 2GYVA 4F60A 1QIIA 4N8EA 1ZD2P 5HFNA 1BEZA 1LBSA 3KD2A 3CCCA 3DEAA 2C0PA 3D2CA 5FUMA 2QT9A 5CMLA 4OB7A 1QIDA 2GBGA 3QZUA 3NUZA 1MX1A 2H7XA 1N1MA 5IVHA 1CUHA 3R40A 2RAUA 4BCCA 3QBJA 4QWWA 2WIDA 5A7FA 1EVEA 2YASA 4H0CA 5AI8A 2HA6A 2YYSA 3G02A 5ALUA 2VSQA 4K6GA 3IUNA 4B7ZA 5JZ9A 3O95A 2DQZA 1A8SA 1IZ8A 1SCQA 1EA5A 2E3JA 3LIIA 3AILA 4PV7A 1HKHA 3R3YA 4ROTA 3FWHA 1RYYA 5ALZA 1F6WA 4AO8A 5AICA 5JATA 5CXXA 1LPPA 6YASA 5ALHA 5FXMA 3STUA 1BE0A 3ESCA 4AN0A 4KE6A 2PUJA 1CUCA 3A2NA 1QZ3A 1S8OA 3FYUB 1QIJA 3F9CA 5DYTA 2VJAA 3UMJA 4B80A 3PI6A 1XZGA 3RARA 2ZJ7A 3IULA 2VAVA 1JJBA 2WJ3A 3C43A 1VA4A 3I6ZA 2BGNA 4G5XA 5ALOA 3E1GA 3PFBA 2C4HA 2WUEA 3SK0A 2XQKA 4Q1VA 1WPRA 2O2HA 4JUIA 3WA7A 1SCKA 4IQ4A 3OTQA 2WM2A 2WSLA 3U1TA 3TGLA 3QMMA 3C6ZA 3FLBA 5ALGA 3ESAA 2JGLA 3BF7A 5K3FB 1JJIA 2GZSA 5AI9A 2HA0A 4L9AA 1ODCA 1LPMA 1JFRA 3EIOA 1ODSA 1FJ2A 2WFLA 4HTAA 3DKKA 3HSSA 2IITA 4E46A 1MJ5A 2XUHA 2GYUA 1BRTA 3H0CA 4X91A 1TAHA
chains in the Genus database with same CATH superfamily
2IYFA 3V2IA 1JQAA 3HDHA 2O9JA 2CYCA 3T5BA 3M9XA 4Q9LA 4BVGA 3NZEA 3KEQA 3RQIA 1QRTA 3EWIA 3FPHA 4X5OA 3TX2A 3D7LA 1HMYA 3PC3A 2OXIA 3UNXA 2R7LA 1Y8QA 1VP3A 1QH8B 4FDAA 4FX5A 2VOJA 2XLCA 4HGRA 4GBJA 4BMXA 3NTRA 3WFZA 2HAEA 4DC9A 2JCVA 1YDWA 2A14A 2FZ5A 2QD1A 2HCFA 2V5VA 4IWYA 4AJ4A 2HQOA 8OHMA 1M72A 1RM3A 1ZM7A 2VHUA 4XFKA 3GDFA 5DXJA 2HK8A 1C9DB 3QU4A 4J90A 5EJAA 4C05A 5CDHA 2OVBA 1PV2A 4WKPA 1H6DA 2B5WA 4FGJA 1XRRA 3G2IA 3KB6A 5FAXA 3UENA 1IJEA 2DFVA 3W7AA 3W1VA 4O4LB 4H6WA 4DLTA 3FVTA 4KPFC 4D0GA 1CJCA 1JLKA 3UOGA 4N7RA 4QXMA 4QSHA 4BFZA 5KDOA 1CWUA 4PYQA 3WHKA 2I67A 3UO8B 2O2IA 1BFUA 2G67A 4ZEOA 3W4JA 1UEIA 5ESXA 3HEAA 1ZRHA 4OHCA 1HT2E 1SU7A 2FJPA 1JIQA 2QEQA 2R8BA 3PQFA 4WY8A 4BYMA 4JVLA 2PRZA 2WG1A 4YI3A 3OEED 5EXSA 4EMTA 1LDBA 4PYOA 2Q3EA 4X20A 2LDBA 1TTHA 2R84A 1RC1A 3OJFA 3M33A 5IXSA 1NNI1 3U1BA 3VC1A 1JZSA 1PR4A 3AJAA 2O2YA 2ESRA 2FEXA 4AJOA 1YKGA 1ZCFA 3KQQA 4ZYLA 2WG2A 4OP2A 5KQPA 5C34B 3KV3O 2LKDA 3WNDA 1IOWA 2AD1A 3HFSA 4OFBA 5FV7A 2V8OA 4TXLA 2P6PA 2VN8A 4XARA 2ZSFA 4OMUA 4NE7A 4NE9A 1DO0A 2V74B 2H08A 2QGFA 4PWYA 1AMNA 4CM4A 3VKUA 4UPVA 3WWZA 5LU8A 1H85A 1JQJC 1MIHA 2RHLA 3N6VA 4C22A 1A7JA 3PIRA 4UREA 5GV7A 3LWBA 1FS5A 2D06A 4TKUB 4WOCA 1AT1A 3NBMA 3WV5A 4XPIB 2ZI9A 3B5EA 3PUXA 4PQFA 2P68A 4GGPA 4I4LA 1O9GA 4QBIA 3ZXYA 2VWPA 2CKMA 1ZM4A 2M1XA 3AETB 1P4GA 3CV3A 4P33A 2H18A 3EIXA 4OLFA 5DT2A 4CCYA 4EEXA 4DJEC 2CL5A 1X7WB 2ZI4A 3CZ9A 2GAIA 1ZWLA 4ZAVA 3QE2A 1T2UA 5GVSA 4RY9A 4UOEA 2WU1A 4YMIA 3T7CA 3Q3EA 3QX3A 3EIEA 3MTGA 3SU8A 4BU1A 3MTQA 1ISGA 1K3TA 1N3IA 3A1EA 2FPLA 5CX1B 5F9FA 1ES9A 1KO4A 1V4NA 1GPLA 1W35A 2D8MA 2GCGA 2X6TA 2QZ4A 4EVIA 4LAFA 1UEXC 4LDAA 2ATCA 1JFSA 2XOXA 1ISMA 3O0DA 4PGGA 5F7ZA 2C92A 5DNAA 3L7OA 4ZOEA 3TL6A 1JHQA 1MT3A 4HHEA 1Y9AA 4M9ZA 3TVDA 1LD3A 4GKJB 3KUKA 2VSNA 2ZJZA 2IKQA 2WP8J 4WZZA 4PHFA 4KC0A 4P32A 1ZVJA 5AOAA 3LTNC 2DM6A 2LKCA 4ML3A 3A0UA 3TUIC 1GRVA 1M2FA 4L4RA 1GL7A 3T41A 4WESA 4W82A 2GPJA 4P2BA 2GXUA 3DUWA 2R7NA 4Q9IA 5ADWA 1G17A 5TDHA 3A04A 2II6A 5C8DA 1KXJA 5LDHA 2NPFA 1HV8A 1K5DA 4TN5A 3PGXA 1YH3A 4L73A 4RK6A 3S2UA 2ZI3A 3SC2B 4JLWA 3B8EA 2EC5A 1XDSA 1YJCA 1AQ6A 3HRHA 4OLJA 3AT1A 5F2OA 2O3JA 2AWOA 3MSXA 1D2EA 3UG6A 1V3VA 2ZUFA 2NSHA 3EISA 5LMUB 1D2RA 2C57A 4TL7A 2QL5A 4NABA 1UPUA 4M0DA 4C0XA 3AVTA 2AB0A 2BMVA 5EIEA 1ITZA 1PEKE 2O0KA 2PXXA 1P0IA 2G5GX 1M6YA 2J0EA 2ZTSA 1ORDA 2FY8A 2Y2UA 3N2LA 5ALXA 1F6BA 1R5NA 3TZEA 1GTMA 1EUYA 2YY7A 3KQYA 2ALJA 3IJPA 2PG3A 1RHKA 1HYBA 3RW9A 3F98A 4BGEA 4DR4B 2C20A 1XQXA 2GAOA 3FIJA 4Q21A 3BK1A 4BE9A 3OA0A 2IXGA 4UHFA 1YUMA 1JZQA 1IBRA 4X7BA 4BV9A 1GHTA 2I3AA 2ZWVA 4MS4B 3P0FA 4EHAA 3N0TA 3P2OA 4EJSC 2Y76A 2CW5A 5B57C 5JH7A 5DW3A 4EM6A 4FZJA 5ICGA 4HS9A 2PLFA 3PFFA 1ZEMA 4PO9A 3HM2A 2ZE7A 4RSGA 1TQDA 2GHQA 4IJMA 1VYTA 4Y2YA 1I7QB 2COUA 1EFRA 1NIJA 1QYXA 4J0CA 1VLMA 4PPGA 3EA0A 4OJQA 5ECDA 3G85A 1FFBA 2GI4A 4FNMA 4IV0A 2QVYX 5AJUA 1XELA 5M3BA 4UE6A 1QFZA 1VJGA 5A3SA 5A03A 4BXOA 2OB2A 1ECFA 4BL5A 3NDJA 4BV2A 4DXHA 5KNCA 3AESB 4KQGA 1RI2A 1H2FA 3HYSA 4UMFA 2W00A 2FYTA 3N2IA 1XA3A 5D6OA 1UBRS 3HPQA 1JKJB 2W6ZA 3LQQA 2X0EA 5BNZA 1XZIA 3MT9A 2VXOA 3FPJA 4Q01A 4YT5A 4J3JA 2ANCA 3VJMA 2PRYA 3F67A 5GM1A 5JSYA 2F3SA 4BTVA 3DDZX 2QTGA 4XGIA 3RPEA 1F7VA 2RSLA 3V4RA 3RVBA 4CXMA 3VPBA 3X1ZA 4FD2A 4Q9JA 4ZCTA 2YZMA 1NBWB 1MJGM 2HHCA 2HU2A 1H4VB 2DVMA 2ZR8A 3IVAA 4OG2A 4HWTA 4E31A 3DAPA 1KYIA 2AC2A 1EBFA 1PD0A 1KP2A 3NBAA 1PTJA 4BX9A 1DP4A 2BP7B 2VP9A 2OCAA 3CCFA 1STOA 2GTIA 2ODEA 5A4KA 1RP1A 4IY1A 1SBHA 4GP7A 4ZCQA 3UTDA 2WD8A 1N92A 1M5TA 2J4FA 1VQ1A 3OOEA 1UP4A 4AUKA 3SEAA 2NTEA 3QTLA 4PZUA 4U7JA 2VHJA 3CCBA 4E5YA 5DW0A 3M5CA 3CE9A 5A2GA 4K7JA 2VHYA 3GT0A 2VBCA 3RIHA 1QZXA 2AFRA 3W6NA 3O75A 1RLOA 4OX9Y 1XEXA 3NWPA 1DRJA 4H31A 1K5GA 3RRXA 3BL8A 4LFCB 4AIRA 1GQOA 1GA6A 2E21A 3BXHA 1Z47A 4HNAA 5D5PA 1AQUA 1CD5A 1WD7A 1EI9A 1BYUA 2EV9A 3I32A 2WUFA 3PV0A 4MWZA 2BYTA 2BR4A 4J0JA 3PDWA 5ALJA 4LWOA 5JJBA 2PL5A 4XWYA 3UOWA 4RK5A 4IIGA 5MGBA 4CMKA 2XI4A 1PX2A 3IIEA 3KPUA 4KXUA 3V8NA 4U7DA 5FPSA 2PZKA 2F1HA 1F0YA 4RVHA 1IUOA 2EDCA 1LU9A 1VL1A 3E4CA 1E3MA 2PY6A 1L7VC 2IPAB 2PD4A 3UA4A 3VC2A 4LDRA 2OO3A 1K9VF 1QGOA 5CVDA 4CM8B 4H7EA 5E9AA 1SVOA 3F7MA 1J06A 2C59A 2QTLA 1WMDA 1H94A 3V4VB 4O4JB 2PKYX 3DTVD 4P5DA 1RJFA 1ZESA 1O58A 1TJ5A 4N8SA 3TW0A 3VU3A 5DXFA 2YXLA 5K3FA 3AVWA 4X71A 3GN1A 2ZB8A 3AZPA 4FFDA 1E7YA 1BE8A 3NDBB 4KBYA 1NT4A 1R0XA 1YQEA 5TMBA 5B1DA 4FKMA 1L8QA 1QFJA 2IYUA 4J29A 4S0ZA 3OZBA 5DULA 2JH8A 5TEVA 2ZDHA 4BKUA 1VXOA 1R9MA 5TVGA 2JVKA 3TW4A 1M6HA 4G4JA 1URPA 4UQOA 3WG9A 4QVIA 5FTLA 5B3AA 1THMA 1JRLA 3IOYA 4XQ9A 1IN6A 2FLWA 3ZDZB 2AIRA 3N9IA 1ENZA 1AXEA 5GV8A 4I7EA 3TDKA 3H97A 4MR8A 5JZOA 1HQDA 4ZKEA 2OORA 1CUDA 1JYSA 2OZVA 3IC5A 4HSEA 4K9SA 5H3CA 2QM7A 3AR8A 3TTTA 3WL6A 5HRCA 3ZE1B 4CKBB 3SI7A 2GN8A 1XDZA 1XVAA 5JCXA 2ZSUA 3WK8A 1RE0A 2C5EA 3WNVA 1KZHA 1L0BA 2QV0A 1QU3A 5IN5A 2X9NA 3TEFA 1RKXA 3HV2A 1E9SA 1G7RA 4W5OA 4KDRA 2F9MA 2X40A 3CEPB 3CIFA 1U8TA 3RJMA 3WKBA 1NLMA 2Q50A 1L5LA 4UM5A 1OWMA 5FDFA 3JATA 1FMJA 2CXPA 2P75A 1CUIA 1BWPA 3WMGA 2ZS8A 3D3QA 3RYTC 4MWGA 2HWXA 1MABB 2MR6A 2HW8A 2CDRA 2FPPA 1LX7A 2DP4E 3G88A 4ZVSA 1OILA 5P21A 4K9KA 1Z0SA 3CF6R 4MPTA 5KAMA 1PE0A 1F2DA 1RWWA 3BAZA 5E2IA 3FUWA 3NO4A 5EOVA 4DEVA 1AKQA 2VF4X 1Y8RA 4JK3A 1UODA 3T8YA 4DCMA 2PANA 3G13A 5IZ4A 3PU6A 2QRLA 2CL0X 2C2OA 4AMYA 3D8HA 2F59A 4JJKA 4C4TA 3MJ4A 4ARZA 4KNYA 1C8KA 1OAKA 1TECE 2HUNA 3O3NB 3M1YA 3THSA 3FCUB 1P91A 1RVV1 4AN1A 5FUBA 4YAFA 4BWGA 3HYCA 4HNSA 4QJ5A 3PD1A 2X2PA 4MPDA 3ITDA 5KTYA 3SHTA 3OZUA 4IFIA 1FSFA 1P7VA 3DEYX 3NHZA 1ZM3A 4IXDA 3V4OA 4CT4B 3I01M 1V9LA 2PUVA 4C5AA 2ODQA 4F6CA 2QD5A 1JMVA 5T8KC 4P98A 3ZY4A 4LYEA 3T4EA 5HSGA 2KSQA 5I7WA 1AO3A 4KH1A 1RXCA 3ZBUA 1JEAA 4BVKA 2BGMA 4TYWA 3K9HA 3E22A 3G8AA 5EUQB 3THWB 2HADA 3QTTA 2ZTHA 1PX0A 2BFWA 4QHYA 1NOIA 1B41A 2Z8YA 4EDHA 4D9JA 2NO0A 4CFYA 1Y7PA 5FBKA 1PZEA 2Y0BA 3SOZA 3V4FA 3ZI0A 4CM6A 1S6YA 3TUJC 3MCAA 4DTIA 1L4BA 2D1SA 5FBLB 1UBEA 1Z5NA 5A5EA 1E6WA 1R00A 1Z88A 2NADA 2XY4A 3A1NA 2R65A 1L5KA 4JV5B 1T26A 3KWFA 3ORFA 4NNPA 4XCVA 1CSEE 2EDAA 4CEJA 1M54A 3E9NA 5AKKA 3WMRA 4DSNA 4YRZA 4DR5B 2XNHA 1QGUA 1T6ZA 4RORA 1AKEA 4RZSA 2YUIA 2EKDA 5H9VA 3U3KA 3ID6C 4PLPA 1HG0A 3VZPA 4C20A 2ZXUA 5DTJA 1J56A 2C9BA 2CHVA 3P0JA 3T9BA 2NQ2C 3OE7A 2BFAA 2P8JA 1V8DA 3K1JA 4R2KA 1KMMA 4DA0A 4IKPA 5FOUA 4LJ8A 5HQ3B 1JKXA 4M9RA 4C01A 2XTZA 5FLXA 2VDKB 3CHYA 2LCQA 3SZLA 5BVGB 4W5JA 5EAIA 2X0DA 3TNFA 3AP2A 4E5DA 5I9NA 3IOMA 3T9AA 3ISTA 4B2PA 3GRCA 1XVTA 2EBFX 5E2AA 1GSIA 1NBMA 3K2QA 5J4KA 5K0JA 5ITZB 4JFRA 3VR2D 3UK0A 3EXEB 4LX0A 1VIVA 2FP4B 4FOOA 3U16A 5EY5B 1RC0A 3AUUA 3BA6A 3CJTA 4O5AA 1LW7A 1OF1A 3UXEA 5HM6A 3M4XA 1CUGA 4H4EA 2VF5X 4UUBA 4MW7A 4W6QA 5C7OO 4AWAA 4ZPJA 5C81A 4A2QA 1H1DA 1L8XA 3RROA 3WGIA 3NW9A 2AQIA 2SCUA 1G1MA 2JASA 2QR3A 2Z8ZA 1ZK2A 3AL2A 4FBMA 5E4TA 3SX4A 5BOSA 5IDXA 1EYZA 1XCLA 4XJTA 2N1BA 2FXIA 4LDNA 4LEIA 1KMHB 4JI0B 4DUGD 4R31A 3A6LA 5G4LA 3WS7A 4UNSA 4PC6A 4J0DA 1VBNA 2X4DA 3QHAA 4LY9A 2OSVA 4ZAFA 1CFJA 5EUBA 1O0CA 4JLNA 3THOA 2XT0A 3AZQA 2VQEB 2RHTA 2B78A 2IT1A 2XYRA 3FWYA 2FMXA 1QCCA 5KEIA 4NV3A 4UJ5A 5ULLA 1SC3A 1G0OA 1BZYA 1M0WA 1UKBA 3KKEA 1J5EB 2GRAA 3UWMA 1UZNA 1BXRB 1NXOA 5EIBD 2VJMA 4W4TA 5A3VA 1CQJA 4NX2A 5GVRA 3TVTA 3WK6A 1F12A 2W2VA 4FYVA 4NL4H 4M1WA 2ID4A 3ZKWB 1WMAA 1JAZA 5A3RA 1KYWA 1TLTA 2VYFA 1NVWQ 1UBUS 4QT4A 2LE0A 2VJYA 1HE2A 4BHTA 2HWWA 4UXJA 3HR4A 2A9VA 1RQ7A 3AF1A 2D1YA 1WM1A 3T7TA 1NVDA 5D86A 2YFKA 2J4CA 2W6QA 1Q7TA 4F4DA 1U3UA 1M83A 4ZZIA 2D1RA 3I64A 1YDEA 4PYKA 5JNLA 3WGYA 5AVQA 4CLRB 4JQCA 4N76A 4Z4QA 2NUPA 3TWOA 1ZVKA 1S2MA 3ACDA 3LPDA 3HJHA 1PLJA 2JIZA 2RBKA 3HCEA 4KN5A 4TQAA 5JEDA 2W6JD 1IBMB 1XMSA 4IICA 1YJXA 4LBYA 5FNVA 3MELA 3G17A 2AYZA 2QZZA 2ONCA 2Z8XA 3SHVA 4OMFG 3LFUA 3WMFA 4A0SA 1P33A 3K7EA 1X9HA 4DIDA 4INOA 5LA6B 4YRIA 1ESMA 3IILA 4I81A 3K9CA 2A9KA 4EYOA 2JHPA 3EDRA 5F77A 1TU3A 2HH9A 1Z68A 5HPYB 3C7CB 5HQJA 2K2WA 4PRKA 2RG1A 4LE1A 1W4BA 4IXTA 3WI7A 3B2QA 3LBNA 1CJTC 4RM3A 5DM2A 4JL5A 1QTRA 4KNWA 1S2DA 4M1TA 3RFTA 5BMVB 3IXQA 5LWQA 1CEEA 2FFRA 4QFMA 3RI3A 4OBWA 4D8VA 1NL3A 1G5QA 2J31A 3JV7A 3JQEA 3VDMA 1EAMA 3UK2A 1EGMB 5IH3A 3QJ5A 2GBFA 1Z25A 3X1KA 1CS4C 3JQAA 4KN8A 3R7LA 3P2MA 4C7BA 2MSCB 3NHFA 4D79A 5JALA 1Q6ZA 4KQKA 2FG6C 2YV3A 4YTEA 3BZWA 4LJ7A 4O4JF 2N46A 5CIYA 4EJFA 1O0BA 1YOBA 4QPDA 1X1QA 2PRSA 1J8DA 1I4WA 4RM2A 3BRQA 1JPNA 3ZXIA 3EY4A 5FULA 3ANXA 1YIOA 3ZNPA 2QJWA 4BQOA 1AXRA 2AG5A 4KSCA 3IOCA 4R83A 5CDTA 1AX9A 3A9CA 4PYRA 3TLJA 1H1TA 1E4EB 2B69A 2GKGA 3STXA 4KXNA 3OLWA 2G9UA 2DHRA 1G7SA 1HXHA 3DC2A 4U6QA 4BUZA 2J87A 3ZWYA 4U0KA 5IXYA 1KZ7B 3TD6A 5FI5A 2BGJA 5A9RA 3U13A 1DBPA 4KHZA 3JYNA 3BH6A 1IAVA 4K9DA 5JHHB 2IIQA 3X2SA 1YS2X 1NP3A 3GMSA 5H16A 1NBIA 4XA8A 3FYCA 3QBEA 5TE9A 2O8BB 5BRNA 4NZOA 3E35A 4KXMA 3SNKA 2GCOA 5EMKA 5FPHA 1GPBA 3A3OA 5D87A 1K8RA 1YR7A 2YCLA 1NMSA 2PWAA 3I3OA 3OZEA 1AC5A 4UZEA 5LZ4A 4PO3X 2QX6A 4WASA 2E18A 3GNLA 4IFBA 2WD7B 2BM8A 2W2PA 3QEKA 3RVDA 4JUCA 3HXKA 3MLEA 1VHLA 3C3JA 4N9QA 4ANFA 3C1OA 4DLWA 1HEUA 4LYFA 4D02A 3GQVA 2MHCA 4ZYVA 3SDZA 1PZNA 2JVJA 3LWNA 5TV2A 1U5AA 1SPXA 4YROA 4GLFA 1I1NA 5U9CA 2PS1A 5LLTA 3MOIA 4GC9A 2E49A 4IOKA 3RRNA 1V4BA 3A4NA 1K6IA 2DPXA 3ZHQA 1UQTA 4LJLA 2JFQA 4O29A 4I3GA 5H5JA 2GUWA 2H1HA 3SM9A 5EIHA 3AVVA 5DCWA 3VBCA 1WCIB 2Y1KA 4F92B 2FPSA 3AFMA 3NB0A 4QGBA 4QJ3A 5I8WA 4U63A 3LP8A 1XK6A 4JKIA 4AQYB 1JBQA 2F8LA 2E5WA 2QRVB 4YQZA 5K3DA 1VHQA 3UICA 1AS0A 3OC6A 3RJZA 1ZAKA 1WIWA 4JJIA 3D8TA 1K92A 3N5CA 3KZKA 4YMUA 4F3TA 2Q3LA 1XD8A 1HRKA 1Z2PX 2ZUCA 1E5TA 1XUOA 3B1XA 2VAMA 2WRZA 5E95A 4GYJA 2YQ4A 4OMDA 1E6LA 2OBFA 3P4UA 1EHIA 4XWAA 2NQ8A 3RAGA 1NJ8A 4DZRA 3EFEA 2OG2A 2R25B 2CBGA 3ETNA 4GR5A 2YINC 2GEBA 2KW5A 2MMCA 5EG5A 1UAYA 4EI2A 5MGNA 4OYHA 4PU0A 2VNJA 2ZIUB 3I2IA 1Z83A 2XXAB 2EFCB 3ZTYA 3FLAA 2ZRMA 4FMCB 2B4KA 1GXSA 3BMOB 4CMEA 1MIOA 1N0VC 1QGED 4CL8A 5G0UA 3GRZA 1X1BA 3R41A 2FQQA 1U9ZA 3LVQE 5B36A 5CCEA 6GPBA 5HJ2A 4PSCA 5HXAA 4DCOA 2VTDA 3EGEA 3AFIA 1OA0A 3WNCA 2VJOA 4HAYA 4JSYA 1CZHA 1DQZA 2V1UA 4P7GA 1U7XA 2A6PA 1M7HA 2PSSA 3LPAA 5KHAA 4J6EA 3UHAA 2QU8A 4CEHB 3R3HA 1QHHA 1S02A 4LHZA 2PJZA 2QSYA 4GE0A 4RFSA 2BGIA 3WTBA 3K20A 1ENYA 4UQPA 2CYBA 2QGNA 3NHYA 1A82A 3ZCRA 4BLOA 2JZOA 1ESEA 2J9FA 4Y6LA 5DSXA 1KOJA 4F5YA 2VP6A 3ZU2A 4QBKA 3UMGA 1R8XA 2ZI7A 4KI0A 2JARA 5FV4A 2PQMA 1SD2A 4DT1B 5IVKA 3HRIA 4ER0A 1LW6E 1UMDA 5HBGA 3RTEA 3LTEA 4R1PA 3T1YB 2Y0CA 2ORYA 2XRYA 4IWNA 1YMVA 2ZXEA 2OV6A 3PG5A 1CDEA 1RR6A 4HDSB 5BYAA 1E5LA 1P45A 3C24A 3VAYA 4EPVA 1S2GA 2I80A 2IYVA 1I2AA 3QRWA 1JR4A 3MBKA 1I9GA 2HHAA 4PAMA 5E0KB 2QPAA 2GTPA 2QT1A 3Q2IA 1W36B 1X8XA 1G20B 4GL4A 4DJFC 3ANYB 3BT7A 3CH6A 2JF0A 1JDJA 2I54A 1QYWA 3OCYA 5LP6A 4N6GA 2ZPTX 1F2TB 1D5CA 1BD4A 1NI4A 2X8BA 3U3JA 1DI0A 4LCJA 1JLRA 4PY2A 5AESA 1AY0A 2DBZA 1PDWA 5BP7A 3Q5GA 1EE9A 1S4QA 3NPMA 4IVQA 2AE2A 1OUMA 5E9QA 3PB3A 1GGKA 4H3VA 4E3WA 4DCPA 2XE4A 2VQFB 2OBLA 3P9RA 3N2KA 3X43A 1XRJA 1F2UB 4BNWA 4PSUA 4CKCA 4C4YA 1PR1A 3E23A 4JMPA 3KZVA 2HO5A 2EJWA 1NN0A 3MLAA 4B9AA 1W0JD 4G0WA 4DCSA 5LB2A 1UBHS 3MIZA 2FX5A 3VPFA 1OTHA 3K6KA 2RE8A 3HDTA 3NIBA 4EHFA 2M98A 2P9ZA 1OIWA 4XGKA 1J2JA 1IFXA 4FE7A 3AW8A 5EEHA 2HIAA 4XGNA 4ZC8A 4H1UA 5LQCA 1HDXA 2DGDA 1P62B 2GBPA 1TEXA 3DF7A 2DBRA 4YVFA 5G1PA 2XYVA 3PVZA 2XDQB 2QW1A 3GA5A 2H1VA 3PQ4A 2LPMA 4JUAA 4RMIA 1IG3A 5AM1A 5K4GA 1EVIA 3UMSA 1Z0ZA 5EHGA 1ORVA 2RC6A 4H7JA 1RYEA 1YE5A 4A0GA 5C1OA 1JVNA 3ZHOA 5ELXA 4ND2A 1E1QA 1G2OA 2NU9B 1DL5A 2WHYA 1Y98A 4KQEA 1LF0A 3I5UA 4LYAA 3AR4A 221PA 4BNDA 4NNOA 4F9FA 4DDVA 1T3HA 1S0UA 2HPAA 4E33A 4B74A 4E6EA 4WY2A 2VZLA 4FGKA 3NHKA 1E1YA 2X3UA 4CMIA 3TEJA 2HDOA 2HPHA 3GG9A 3ZW7A 2XGMA 1KNXA 1QO9A 4I6JA 3LC0A 2O59A 3T7IA 2HMAA 5TJHA 5LA6F 1IXSB 4HDMA 2H2WA 2XUPA 4OQYA 4ER6A 1KH1A 3K30A 3QMPA 3TTVA 5JXIA 2DWOA 3OWOA 4NBVA 5AM5A 4FHZA 1W52X 2IODA 3ASZA 4IGFA 1IB6A 1P72A 3LF2A 3QFFA 5BRJA 6CHYA 1IBLB 2OGUA 1M2GA 4NPAA 3T7JA 3HJRA 3QVVA 4WBNA 4IDDA 1R0KA 4JQOA 5A1JA 1I4OA 1CG6A 1K5PA 4WV3A 3NBYC 1LJ8A 4JSRA 4MS1B 5TY0A 4MGEA 5F21A 4F04A 4EF6A 1PD1A 1Z39A 3V4PB 5FJIA 1UBOS 3OOSA 5BSRA 2CZQA 1RXVA 1EA7A 2J1LA 2VUSA 1NV8A 2ZJ1A 3G9UA 1SB8A 3GRPA 1ODIA 5C7LO 1NUQA 1JI3A 2VNAA 5IFKA 1FSZA 5DP1A 5CG2A 1QHNA 1PO7A 3O92A 4G0YA 4IDOA 3EMKA 1GQQA 3JSAA 1M2VB 2C7PA 1R0YA 4O4HA 1GTJ1 3ZWNA 2V4UA 4OAPA 3V2HA 1L3CA 2CWWA 4GOKA 2YHAA 1M0TA 2CE7A 3COZA 2YIJA 3BJMA 2P4UA 4WD3A 1UQRA 5TF4A 4EJSB 3BKWA 5JXGA 3SM3A 2QV7A 2QN8A 4WERA 2ZJ5A 3P0IA 1ZBDA 3SSNA 2FSVC 3IO3A 3Q0TA 3E9ZA 4J4TA 4M46A 1NXWA 4RHUA 1H5QA 4JGBA 4MO9A 3ZG6A 5LVAA 4NG4A 4JI5B 2FCAA 2HMWA 1U8FO 2O2SA 4R1NA 4JDUA 1M1YA 2JAQA 2QLBA 5F4BA 4EY7A 4QO7A 1GG5A 2UYYA 1Q1ZA 2EFGA 1PL0A 1PTKA 3CH7A 1WOYA 1Q2XA 1WDKA 4E70A 1K0UA 2FZKA 5E3JA 5CHYA 1I5RA 1XWIA 2XJ9A 3U60B 4FBLA 4O0MA 3Q7RA 4A8HA 1UMCA 3D0QA 1TAUA 3I1FA 1FCJA 4DMHA 2WUGA 3GPCA 1QNFA 2QMHA 4E5NA 3UJNA 2WVHA 2AYYA 5J5VA 3BQ9A 2RH4A 5CYGA 3FKJA 4OHYA 3PJEA 5EYPA 4DLSA 2JK0A 2Z3WA 3AM3A 5FA6A 1MQ9A 4WKNA 2RAVA 4LYJA 5JAQA 1LK0A 1SXJB 1N6LA 4XSHA 4BO2A 4TVOA 2AJLI 4Q4HB 2YZ2A 4FFRA 1O89A 4JUDX 5EWLA 4ISCA 4D3SA 1MZVA 1G16A 1II8B 1W4AA 4B6FA 1V25A 3WXMA 1OASA 3UHJA 2WMYA 4F2WA 1GQ2A 3FDZB 4BN5A 5IKEA 2ZATA 2Q5OA 4YYZA 5FRDA 3TFQA 2BFDB 3RJTA 2EL7A 3UV6A 5J4YA 3PF8A 5F2EA 2LIPA 5IT5A 4DBLC 2YMQA 4I66A 3Q12A 5K1ZA 3CURA 1C9KA 4FFOA 4RPJA 1XLTA 2BDUA 1MO5A 3KELA 5AK4A 5DI3A 1DTWA 4L07A 3TOCA 2WF9A 2Z4TA 3PUJA 4FNGA 3HEMA 2X8LA 1P4RA 4JZYA 5CFQA 2O3UA 1IQUA 4I8XA 4MHSA 3E7WA 2NVUB 4E11A 3PSAA 1YSCA 2BZ0A 4L16A 2P9HA 4XD7D 1AUVA 1ZN2A 4ZWNA 3DLAA 1DO2A 4HWSA 1IXYA 5L95A 1ZVVA 2FWNA 5KCMA 4TX1A 1TB4A 2GPYA 3GF4A 2HXGA 3DZCA 4HP8A 4NYIQ 3HKCB 4Q34A 3D64A 4QXRA 5KDLA 1JYEA 4C7XA 4EHDA 2UVPA 1AUOA 1SQ5A 4RTNA 1R6XA 3A4IA 3H5WA 4FMCF 1E2JA 2FR0A 2G72A 2W48A 1FDSA 1MLDA 2PTGA 1ZG3A 3AHIA 3FUTA 3K05A 1RM0A 3L3BA 4KYTA 3BILA 1VMAA 4AVYA 2Q3BA 1Z5UA 2QAGB 5KDDA 4RA6B 1R15A 1Q1EA 3PHGA 1NXVA 4M0PA 3OPMA 1Y7TA 4QPNA 5F9HA 2L0XA 3ZDCA 4DV2B 2B1QA 2QTNA 1BHSA 2VCEA 4QU5A 3SQDA 4DLKA 3ND7A 3H18A 4ERNA 4X6XA 3B1JA 1N0HA 4KN6A 4R2JA 4JXJA 1KAHA 4EB6A 4CTNA 4X45A 4QTTB 1S4MA 1VZ3A 2QIOA 1LA2A 3E0QA 4A6PA 5HUQA 4YWHA 2IC5A 3OMXA 1OFTA 3HB0A 2GR9A 2C3OA 3DVLA 4M0FA 3NTQA 2CK3D 5BPHA 2G71A 4DV5B 1TM2A 4WZAA 1BU8A 4CL0A 5EHXA 1XZAA 4K9PA 4Q3BA 1A9OA 2HT1A 1CUSA 4DC0A 2I8AA 4LQLA 1OHHA 1RAEA 4ESOA 2JNWA 4FDTA 3TLMA 1T5DX 3HA7A 2QN6A 3M5PA 2CLKB 4KG7A 5K4AA 5HKKD 3T9CA 1W85A 3GQBB 5LP6C 5T6MA 2B4AA 3F4KA 3SZOA 3CWQA 2J5BA 4L6IA 2C99A 2HEIA 1WD5A 4QYSA 2XEDA 1DKMA 5E38A 2C88A 4LXUA 1HG1A 3ICWA 2BFNA 3OU7A 3JX9A 1JHPA 1SN7A 1H8EA 4P3XA 2IZ5A 5KMGB 3VNBA 1PGPA 4CNQA 4X44A 1F0NA 2J0VA 3LOQA 2YY5A 4QIHA 4R8RA 1GZDA 2W4IA 2C7OA 1FQOA 2ZRDA 1XD2B 2ON6A 3GVXA 1NG1A 5JDIC 1JS1X 1RKBA 4WMLA 1PJTA 4H35A 1S8AA 1XO1A 1SUDA 1XMXA 3S4YA 4TLMB 4C4SA 1O0SA 1Z18A 3NI2A 5CDFE 1G8GA 2M9MA 4J7AA 4UVDA 4I4NA 4MVJD 2K7ZA 1E1CA 2IY9A 1N7HA 4D0RA 3KR0A 5L6LB 1SFRA 4Z2YA 3ZLUA 1KS2A 4RY0A 1R0RE 2Q5JA 5IK2A 3PFHA 4EGAA 1GGHA 4TVKA 5IT9A 5IKPA 1ZA1A 4ZZ3A 2P40A 1E5VA 4MYUA 2JFPA 5CLIA 3TZBA 3DONA 4URHA 5HKBA 1YTUA 4YIKA 2XCIA 1Y1TA 4DUYB 1I33A 1PRYA 5T64A 2QMZA 1FRQA 4LJ6A 4XQ0A 1C14A 2YHSA 5KUTA 2WEKA 4QDXA 2FK8A 5JXHA 3LW8A 1CCWA 2C9MA 2EYUA 4OF4A 1RYZA 1J8QA 2WTBA 3LHIA 1CC1S 2JA1A 3R1IA 4B7CA 2JGDB 2ACKA 3CWCA 5ARCA 3P9QA 4M8IA 5B53A 1GQSA 2G0TA 1U1FA 4N7BA 5I7RA 3MFQA 4GOND 4AXBA 4B6OA 4HDOB 4JR1A 3EQ2A 3F2VA 3GH3A 1G8PA 3TQFA 2OEPA 1DFGA 2ODTX 3LO8A 1CLEA 2JFXA 2IHBA 4RZXA 4MAAA 1MENA 3ESYA 3EZGA 3NWOA 3M8KA 3OM0A 3PEVA 3N75A 3PQ3A 4PLZA 4KUGA 2JLVA 1WXFA 1SIOA 3EWNA 4H6VA 4BECA 3P9PA 2ISCA 1JEQA 2A78A 5CURA 3A10A 3H42B 3EFHA 1AJEA 2RHGB 1WX1A 2Q0SA 2ZJFA 3EFBA 4WPGA 5FTJA 1CE8B 2P2LA 5F1YA 3V1YA 1OX5A 4Z1OA 1Z28A 4B84A 3JQFC 3AH8A 2HN9A 3O91A 4TMWA 4IO1A 4WOJA 1NKTA 2ERYA 3TN7A 5DCLA 2IIPA 3D6JA 1CJBA 5REQA 3ESRA 1A8HA 1U04A 2RBEA 4RPIA 1OXXK 3P5BA 3OUTA 4CF6A 3HVRA 1SWWA 4HWPA 3DLTA 1WXDA 1BX1A 4ZI2A 3ZDXB 3GUZA 2YWXA 1K8XB 4LDQA 5CVEA 3M4JA 2CVQA 2Q1SA 3U5ZB 1DAKA 4PLHA 5C7YA 1G21E 1LBHA 4OQFA 3S99A 3BFKA 1RJEA 2VA9A 3Q3JB 1XOIA 1Z63A 5D51S 1SR8A 2PZJA 2ZREA 4REMA 3KBOA 3HCWA 5KJ6A 1TZJA 4X3PA 5KWSA 2Q9CA 3EGVA 3I6YA 4NCJA 4QFBA 4FFSA 4AW9A 4TWBA 1VE6A 4NLLA 4R2HA 3UWSA 3UCEA 4OVKA 3SQXA 5IDYA 5MHTA 1PVOA 1QONA 3N0WA 3GGCA 2A59A 1RXUA 1EHYA 3WSWA 2JFFA 4ND6A 4TLCA 4AJNA 1KEEB 4HDCA 2VS1A 1HORA 2JHFA 1M1NB 4NXMB 3FVRA 3L0BA 1BE6A 1M8KA 4D7AA 2NUAA 1CIVA 2RBGA 3EMBA 2C1XA 3ZVLA 1X1RA 1NX6A 4L95C 3M6LA 3MMPA 1GGEA 2IIVA 3S68A 3EDOA 5BSVA 3VAAA 2BI4A 4L8WB 4KWHA 5C80A 3INYA 1L3IA 2KB0A 3AEUA 3PKJA 5F2NA 1GITA 3AEYA 3IB6A 4ND8A 4IIBA 4DMGA 1P2UA 1M2KA 2AZTA 4MV8A 4OK3A 1T4CA 2Z2YA 1ZIOA 3W6UA 2EP5A 1VLLA 3FDFA 5DT9A 4FIZA 5AW1A 1XF1A 4R16A 4M36A 5T5QA 1X92A 4PZ0A 2JBAB 4Y6QA 5G41A 4WLEA 1YBMA 2GVDC 1N4AA 1KOFA 1UKEA 5LC1A 2QY9A 1GR1A 1Y5LA 2ZU0C 3FJOA 1JXOA 3G0IA 4LC9A 3OQJA 1JF8A 4MEAA 4DNFA 4ZYXA 4KMOA 2Q29A 4QFCA 3RAEC 1LFAA 2Q1XA 1OJ7A 3NAMA 5DYIA 4LXYA 5SY9A 2CVZA 2H1LA 3RC8A 4K8OA 3QOXA 4DARA 5CFNA 1VHWA 4G5YA 3RS5A 1YRHA 2BFCB 3GWGA 2ZG6A 1FE8A 1JAHA 4KXQA 3CS3A 5DLPA 3TBKA 4O3MA 2PYZA 4HGOA 4DEXA 4QUGA 1I3OA 1QRRA 1YFLA 3NU1A 4TV8B 1U8EA 3QKUA 1Q74A 4QLAA 3Q4GA 3G2HA 2OESA 4R8SA 1KJQA 3CPEA 4WKOA 1AHHA 3B1WA 3WGQA 1ZUWA 3BXOA 4NI5A 4C0KA 5C1BA 1UWVA 2VXYA 3KVRA 3H2YA 4KX3A 1FLVA 4NFHA 1NLYA 2EP8A 2OQIA 2YBEA 3A06A 3DFIA 1B14A 4YRKA 2H7VA 3FETA 3T1HB 4LK3A 2J9RA 1T9KA 4RGYA 3W9YA 3I30X 1NPYA 2F48A 3ZNNA 5AVOA 4ER5A 5AW2A 5CW2A 4D44A 4AU1A 4G8BA 2XIJA 3GDGA 2C2YA 3K0AB 1JXQA 4ZREA 2OLKA 5IBPA 4EA8A 1JT2A 5I8PA 2FXVA 3PHJA 3QF4A 3PNPA 3SKYA 3VYTB 2GPTA 4FFVA 4AO7A 4IYRA 3Q3VA 3MJDA 2QSJA 1Y9DA 2I1WA 1Y6FA 2F6RA 1L7EA 1QKIA 1NBOA 3JQ8B 1JQDA 3DEKA 3LVRE 1GL3A 3L6RA 3L1IA 5E4YA 3U7IA 4DV3B 1U5BA 1W6UA 2JPDA 4EEKA 1X9IA 3IUYA 1UCFA 3LPMA 1QQTA 4JS0A 2ET6A 4MR7B 3WLAA 4YCSA 1DVRA 1W5SA 3KT8A 4J43A 1A27A 4ZI5A 3COYA 3KPYA 2UZIR 2YWRA 3UJ6A 5A4IS 1IONA 2XNSA 4TOIA 5JE8A 1CQWA 5FBQB 4BFLA 3DZHA 4NHOA 3LX6A 1EG2A 3JCZA 3REQB 4FPXA 2NO9A 4A6EA 3D6NB 5L4SA 1X2EA 3NHUA 2WM9B 3GELA 1MGPA 2GEKA 2QSUA 3NOVA 2XXBA 3QLVA 2W11A 4LXHA 4Q0MA 4RW0A 1N75A 1WP4A 2QVZX 4G0UA 4MZXA 3OZFA 1RCTE 5HMLA 2PUWA 3UK1A 5IAOA 4DQXA 3LPLA 2AXNA 2DSTA 3FOBA 2Z57A 3M6AA 3EDMA 2NACA 4BO5A 1GLVA 3RHZA 2BAGA 4D9CA 2VL7A 3F97A 1FRVA 2H63A 3KFLA 4V3CA 5HIJA 4LSZA 3BL5A 3F78A 4CQJA 1OI2A 5K0EA 4OQEA 3OICA 4QOHA 5CH5A 4YP7A 4KXYA 3HP1A 3O1JC 1MOPA 3ZWQA 2NP7A 3KL4A 4HPWA 2FN7A 1UXGA 1XZFA 1KDPA 2GAFA 2QRZA 4UE2A 2IOQA 2C7RA 1UJ5A 2HC9A 3TLZA 1ZMRA 1YS9A 5TJ9A 4FQ8A 3MB5A 5AXCA 4UNRA 3QVMA 4JP5A 2CCKA 4GWLA 1XMOB 4PCAA 4LHEA 3EQZA 4MW2A 4M89A 2WSIA 5E1DA 3CG4A 3PJRA 1DBIA 2VLIA 2AOWA 5DXAA 5EJ9A 1FX1A 2W6PA 5KYYA 2PX8A 1M74A 3GJTA 1SURA 3GJYA 3HJNA 1Y48E 1GR0A 1RAIA 5FL7D 4DLAA 1PQPA 1LRJA 2DFNA 4DQDA 1N25A 4YLYA 4JXZA 4DPLA 2ABWA 4XOIA 1AHNA 3C98A 5M2QA 4EKDA 2XUOA 3BD9A 1IK6A 4LK2A 1Q12A 3LL7A 1OXKB 2HJRA 3LUDA 3LK6A 3W79A 2AG0A 5CVVA 1UC9A 2JLYA 3ES9A 2C0QA 3OO0A 1DC3A 4HSGA 3NIDB 1UZAA 1U2SA 3PK0A 3UJCA 1NAIA 1ZRNA 3ZE6A 5B7GA 1EH5A 1RWNA 3AMVA 5J2UB 3RYHA 3JYQA 1KRWA 3NHPA 1E3SA 2XH8A 1Q16A 3VOSA 4FMBB 2EARA 3NV7A 3ZTTA 1IXZA 1XJQA 1Z0FA 1E2DA 3HXMA 1SH7A 4JYCA 1E2QA 5KQGA 2FLKA 1H0SA 1XZBA 2P78A 1AU9A 3WA6A 3TQOA 1X7ZA 2VYNA 1O8CA 1DWQA 4YAUA 4HAOA 1XKXA 4XDGA 3BBPA 2C2BA 5I3CA 1MPTA 2GWHA 1QOZA 2JRCA 4ZVOA 4ZVQA 3VYSB 2EWVA 1AGXA 3UC5A 4XB6B 3GD7A 5C4IA 4BWYA 2RGEA 3OTWA 1ZL2A 2NW6A 3WGZA 2VZ8A 2PX3A 1TT5A 4WCFB 3WGNA 5B4VA 3HCOA 3S27A 3MMNA 1Z4IA 4GIBA 1Q44A 1GN9A 1WG8A 1Y7IA 4E09A 3K0EA 1EGAA 3KS9A 4J03A 4Z0NA 4BFYA 1RBZA 4PGHA 4MMXB 5K2MA 2HMTA 3AERB 4B7AA 2P41A 3IR7A 4JELA 4IDEA 5FQOA 3AX6A 1U7OA 3L9WA 3HC7A 1BWQA 2HI0A 3Q7QA 4GX1A 3T6KA 1PZHA 1RU3A 1JHAA 1C1DB 2K2QB 4O02B 2DJ5A 4RV9A 2V3VA 1U2DA 4WJLA 1TKBA 4DJTA 3R6LA 1DTSA 3T06B 3RAPR 4XYBA 2D5IA 1HDOA 2CNLA 3PD0A 4XJVA 4BRUA 1ZNXA 3QW4B 3WMEA 3PPWA 1CERA 1JFVA 3BMQB 3GRAA 1H8HD 4D9MA 4NEGA 3L4EA 1KBZA 1F1JA 1Q2UA 3G0DA 1BCRB 5AT1A 3LHDA 3KAKA 1N5DA 5TPZA 4QC2A 5T4HA 1OU0A 1DUVG 3H2IA 5AVWA 4YO8A 1Y37A 2ZYDA 1Z8NA 1VKJA 3P8ZA 3IHLA 4LW8A 3PZBA 5KNDD 2PAFA 1MB0A 4K03A 1MN6A 2OP1A 3PUWA 1OC2A 5E7MA 3RC7A 1OWOA 1JDBC 1UFVA 2IY8A 1P60A 2K4MA 3DULA 2WJ6A 1OKKA 2YJ3A 4GR4A 1V7ZA 3RVPA 1AF7A 3T3IA 4GI3A 4TL9A 1B3RA 4YHBA 2GPWA 4IGEA 1GUZA 3Q87B 3W8NA 2IX9A 2BTQA 1O95A 2WABA 5LXTA 4D57A 3ANMA 1CNFA 3SVTA 4Y6GB 2QX7A 3IIJA 3PP8A 5KYGA 2ATIA 3ZQUA 4UFNA 4D8WA 2HA4A 1EK2A 1RAAA 4TKMA 2AKAB 4IMIB 4X94A 5AKXA 1JQ5A 2XVAA 4D4LA 3KZMA 1QG2A 1O96A 4I55F 1OBCA 1U4OA 1P5ZB 3OZAA 3OE5A 4Y8VA 3UMYA 1NSFA 3D4NA 3KDAA 1XZLA 4NR0A 4EATA 2FSFA 5DYGA 3TOXA 3ZDEA 4CM7A 4ENRA 3AUXA 3DEFA 3LQFA 2CXXA 1REQB 2BFOA 2SKEA 3V34A 1A95A 2GQ0A 4BLVA 5HVNA 1EXDA 4S2EA 4ALJA 4ZTBA 1E1KA 3MCWA 1PS9A 3JAWB 4P7JA 2JJYA 2ODPA 3K9WA 3JAMA 3EPKA 2DX7A 3V3TA 4DQVA 3U5TA 1CVRA 4IHJF 4AUNA 3S0JA 5CFMA 3FI9A 1ZD1A 2A0FA 1M34B 5CM8B 1AHIA 1MX9A 4B4KA 4FC7A 5B3LA 2WQZA 1TM3E 2VVTA 1RIFA 3EE6A 1T5IA 3ZQKA 4UTXA 1OXBB 3H5RA 1T10A 1TZCA 4G4SO 4KU4A 3BJRA 1KSGA 5B1YA 2BFFB 3LDHA 4QUEA 2B3TA 3BS4A 3VKFA 2HCTA 5JSQA 4QYTA 4U7TB 2F1RA 5E6RB 521PA 3ZUPA 3N8GA 5K8JB 1S2IA 1WDTA 2C1ZA 4OH7A 2W70A 5H0IA 2VUUA 2C96A 3AOGA 1DHRA 1G3MA 3H6HA 3RFCA 4BP9A 3FPBA 4WXRA 4F3KA 4DAEA 1T2AA 1N6NA 2CXRA 2I33A 2IYWA 2NTVA 3KUCA 3LI2A 5K8VA 4M9XA 1UBGA 2Q46A 4D42A 4E07A 4FVTA 5C0OE 1XPJA 4C9BA 4MVXA 4PXSA 4QDUA 2B25A 4YLGA 4MHOA 4L5JA 3PXUA 4KFSA 2X1LA 3B5IA 3K9QO 2ZIFA 5LNK6 1T1JA 4DUZB 4EFNA 3IBFA 2D4AA 1K75A 4KQFA 3SFZA 4IG9A 4MMYB 5EUMA 3AY3A 2IELA 2J0UB 2Y0DA 2OV1A 4WOBA 4DQKA 1II9A 2C3MA 3S7TA 1XCGB 3G9ZA 4GHWA 1XTIA 1WUKS 5D3KA 4DXAA 5JCOC 4YJGA 1WXEA 4WIAA 1TTQB 2WWYA 1R37A 2ZSHA 3I37X 5EGNA 4R5MA 3A6PC 2GUGA 3U39A 4BUCA 2GCNA 3KQLA 3DE5X 4HAVA 1NU6A 2Q0XA 2H2HA 1NYTA 2GMWA 2DMRA 3QLVC 2C5SA 2COEA 2KE5A 3ZH2A 4LXGA 3Q7TA 3R5FA 1T9GS 1PUIA 1PG2A 4MGZR 5FR1A 3TSZA 3R4CA 4NYIR 5IDWA 1QIGA 1T4DA 4OI2A 3ZLTA 4W5NA 4DG8A 1THZA 2Z2JA 3S2IA 1ESNA 4H77A 5JYDA 4FYXA 1F8GA 3C3DA 3QWAA 4A10A 3WJAA 3KSDO 2QL6A 1QJ4A 1ESZA 1I7NA 1DBSA 2QU7A 3D02A 3JVDA 4HB2A 4WAUA 4XIFA 1XI2A 2BFEA 5AJWA 4LWQA 3ZK9A 1J0CA 3QXGA 1U02A 4GPEA 3T3MB 1G8KA 1MEEA 1YR2A 1N6KA 2JJ2A 1XT6A 1Z12A 2P2SA 2PU5A 3B1KA 1B15A 3IDZA 3JWHA 1WB5A 1DX4A 3O7WA 1A4RA 1M1ZA 1N6PA 1WB4A 2D2FA 2C5AA 3CZRA 3FE2A 1CIPA 3KXIA 4FEAA 4MQBA 4F4JA 2V7WA 3EVDA 3EGIA 1YB4A 2JGAA 2HBRA 4OQDA 1Y1RA 5IVPA 1C0KA 4ILEA 1TF7A 3TBFA 2H85A 3U4MA 2AFIE 2YVQA 2BKUA 4W63A 1E92A 3RYIA 1XXHB 4GPD1 2GJ4A 2ZI6A 1ICIA 3Q6NA 1D2NA 3HL4A 3T5DA 4US2R 3VKWA 1XPOA 2WC1A 4M8NE 3FKSD 2A3NA 3K35A 2J09A 3QYFA 4TQ9A 5G1NA 4HR7A 5CD9A 2FR8A 1CRLA 3V42A 2XMPA 3TGPA 4HYQA 5A2QA 4GOXA 2FW0A 3A4YA 3TXYA 5KJFA 2X4LA 3DGFC 3EWSA 5H02A 1KSFX 3H3XA 3QEMA 3HY4A 4IS2A 4GICA 1CETA 1H9BA 1N9KA 1XL0A 3D7NA 3I04M 4FOTA 4QAQA 1EK5A 4E5PA 1JDTA 3GGSA 2IV7A 2I2WA 1U9IC 2AF3C 4NOLA 1BGVA 3ZNQA 3LUJA 3NC4A 3N2EA 4KQ9A 4ZAXA 1SEVA 3GZNB 4BFTA 4CE6A 3H2GA 3KJGA 1Z4LA 4UEOA 1SKYE 4MRMB 5TX7A 1PL8A 2FPRA 3EIHA 1NRJB 4PSKA 1PYOA 5BOVA 1GLNA 1FS4A 1CRPA 3N6XA 3OFVA 2Q1TA 3M1LA 5LMNB 1QTIA 2ECOA 1J39A 3G0OA 5DCUA 3WNZA 1YQ9A 5J2UF 4RD4A 4RLQA 1AF4A 4XR4A 4DEYA 3L6OO 3BJEA 3UWKA 3JWPA 4ALIA 1I4EB 2A9FA 3R7FA 4ETWA 2J3MA 1KJ9A 4QDJA 4PE5B 4G41A 4MEJA 3J7AC 3EXAA 1Y4DE 2BUCA 3ELUA 5EJ2A 1SQ6A 4DFDA 3UFBA 1F14A 4DRXA 5AKHA 1NF2A 2B2CA 4B2YA 1P4HA 3L4SO 1Y7LA 4DC1A 4R9SA 1W0CA 4EG1A 4HD8A 3RIEA 3DUFB 3UGKA 3S70A 5LJIA 1BSVA 3KJFA 3N53A 4L5AA 1XRNA 3FDJA 3T9EA 2PCLA 3IVRA 3HU3A 1D5WA 2QE7A 2WYWA 3VSCA 2NMVA 2DR3A 2V03A 4F9EA 5JQGB 1P3Y1 1SAYA 1JNXX 1LGYA 1ULHA 4NPCA 1GPJA 1W1UA 2R0QC 5JJLA 2ZVPX 3A6GA 2G0AA 1NG9A 2A94A 2CJXA 3F6RA 4EG5A 5K0GA 5CCDA 1SXGA 1TI7A 1CQPA 1XE3A 3QFRA 3R7NA 3GEGA 1CZLA 3V7FA 5LOVA 5ITWA 2D5LA 4TT3A 2IS2A 2BGLA 2EXXA 1I13A 1I36A 3ND9A 4FILA 3HKEB 2PU7A 4R8KA 3UMVA 4CQLA 3KQSA 1ATZA 4GRDA 4JNKA 5AW3A 1H2YA 2GNAA 2NZJA 3G1UA 4DCCA 3IO5A 1JP7A 1Y1PA 1ZJ6A 4QT0A 4Q9HA 2ZIGA 3T0FA 2IS4A 1CS0A 1HWYA 4ZEVA 2JI8A 1KA9H 1W9MA 2YBDA 1PV1A 3DQPA 1X8LA 5AM0A 3K1ZA 1V43A 4MR9A 4EZIA 1ZUNB 4RESA 5CVTA 2H9AA 5B58C 4D26A 3SHQA 5KYUB 1PK9A 3FPLA 4JDPA 2VYVA 4RE6A 2ZRLA 4CT5A 1E2LA 3TQCA 1FP1D 1OFGA 1JQEA 1U2EA 1W96A 1YB2A 2OD7A 4H17A 3TAXA 2FVYA 2Q4EA 3V8EA 4MS3A 4E4YA 1I14A 1RVDA 4F7DA 2G4VA 3KSMA 5D5QA 4DWOA 4EY4A 1R9JA 1ST2A 2P5SA 3FBWA 4JBGA 5AKZA 1ECJA 2P9GA 3E81A 2PUDA 1TJ4A 2J5XA 3MS2A 4PYIA 4E08A 3CR3C 1T2DA 3C97A 1MG5A 3F7TA 3IELA 2O1XA 2XRFA 5DB4A 4BIMA 3ND5A 4MVJH 4XIIA 1FNMA 1L7AA 3ED5A 2VHWA 3JZMA 3C3MA 4BO8A 1O94D 5IABA 4DHEA 2XJ4A 3PE4A 4GYYA 3VNUA 4L9SA 1GUDA 1CY7A 3RU3A 5BWCA 3DXZA 3L7NA 1YRAA 4CWAA 2IUFA 4YUAA 1KZ1A 1XR3A 3BHMA 1N57A 1L4EA 4PFJA 4BUJA 1C1YA 3EBLA 3KAQA 4PHHA 3OA2A 2RGCA 3BXPA 3OUUA 4MJ3A 4JI7B 3SYLA 3ZLBA 3HK2A 2W83A 2WJAA 2Z5VA 3ENVA 4JBXA 5EJ5A 1X7YA 1VG1A 4ICIA 5GADl 2X8JB 2UZ4A 1G6KA 4E15A 5K9ZA 1U90A 1MO2A 2DG2A 2WU0A 1QHIA 1ZD9A 2CC2A 3IQXA 4MKGA 2NP6A 3WWPA 2WU8A 4H1WA 1KK3A 3N8HA 3FF1A 3OZSA 4GF5A 4J3NA 3AF5A 8LDHA 1X0XA 4B17A 4F5DA 3VFDA 3U7JA 5IW8A 3A27A 2WHRA 1IUKA 5T3UA 1WV1A 2FW8A 4BASA 3O82A 3GLHB 3KKMA 3DC7A 2CXQA 2YFQA 4HNGA 5GMOA 4QYXA 2AR0A 1IZZA 1TE2A 1TX4B 5IAKA 4I46A 2YWFA 1SVLA 4PNZA 1A50B 3DOIA 4RKEA 5G4KB 2YWCA 1KFBB 3BXXA 4RVSA 1TM4E 3BZUA 1E0KA 3ETCA 3FPFA 4CG0A 4KQHA 5JMPA 5EKSA 4UCWA 4BFUA 3CLUD 3SX2A 1WCXA 4B76A 4OXQA 4YREA 1EUQA 4LV8B 4JLMA 3QVOA 2YS6A 1ABFA 3ESZA 3EUEA 5EA2A 3SX0A 1Z7GA 3SQOA 4DCVA 1N2JA 5TQ2A 3DL4A 5DNUA 5C52B 1P3JA 1QGAA 5JY6A 4FJ2A 4ESEA 3QPBA 3WKDA 1C0EA 5L6MB 1Y8QB 1LZKA 3B48A 4UEJA 3TX6A 3VI3B 3ZDBA 3FZQA 1TVMA 4O0LA 3FW1A 3PX3A 3FPAA 1WUHS 1K68A 1VPLA 4YBRA 3WGHA 4MCIA 1CUEA 3VO9A 3H9GA 3AXTA 5YASA 4ACAA 1M2NA 4QRDA 4YCJA 3SEZA 3T3NA 5CYPA 4CFZA 4WSOA 4R71A 2UXDB 4DLBA 4C2AA 2D8AA 1SGWA 5JECA 3WGJA 2JLQA 4RTSA 2X2FA 4RS3A 5I9BA 2XWBF 2A0YA 1YC5A 2D7DA 2MR5A 1Y3FE 5K0NA 4ZAGA 1NDHA 2Z4RA 4R3WA 4AZ3A 5M34A 4QL3A 4URUR 2DE0X 5LKRA 1P0QA 4QREA 2JAUA 3IEPA 1MRSA 1VMDA 4M98A 1IY9A 2IJGX 2D5AA 3I1JA 1CR1A 2H4FA 2X3YA 4GZLA 1A88A 2CVHA 2PA3A 2W58A 4TMZA 1ECGA 3M4NA 4DGQA 4ZEMA 4X20B 4M7OA 4TTSA 1K63A 2XLBA 5D8DA 2EBHX 2TMGA 5IP5A 5HKAA 2Z9DA 2A4KA 3UFXA 4FJ0A 1QIMA 4AZ0A 1QRSA 1TOAA 5K0FA 2NYAA 1ARZA 1KFJB 3OQNA 3HKBA 1OYOA 3OJCA 3Q3IA 3WYBA 1YJQA 4R4JA 1GG2A 3FN4A 3JWEA 3HN7A 2ONKA 4MZDA 4OLHA 5DOVA 2IEYA 4DUPA 4QUJA 5FBWB 3RJ9A 1RMQA 2OPBA 2VPYA 1E6EA 1CB7A 1MB4A 2CFCA 4BLUA 1BXGA 2R1ZA 4W1SA 3RSFA 2HCJB 4JCCA 3WGKA 5HW0A 5EXTA 1HH4A 2OFOA 3E15A 2XZDA 3HS3A 4XIGS 5GPBA 3W05A 4LX8A 3WTCA 3W5DA 3HNOA 4CM4B 4TSFD 3HCCA 1VSUA 4UBMA 4C6SA 4IQ8A 3U4AA 1T5LA 2R60A 1H5UA 2JFBA 2ZRKA 3K72B 2FR8C 5EIAA 1B0ZA 1LLQA 4LRXA 2I55A 1G6HA 1ONNA 2V7XA 4H0NA 1GSHA 4KR2A 4DV6B 3NMUF 2FN9A 4CCYB 5ALYA 2WU3A 1XTVA 1HY3A 5TARA 2FVXA 3PWKA 1GCIA 5FFFA 4MI1A 1TCUA 5TB5A 5C35A 2PKQP 3MRVA 3FX2A 1NVAA 2ID7A 1M3SA 4K0RA 4W1PA 1ADJA 2O3SA 5JJCA 1TQ6A 1EHCA 4DREA 3NNNA 2FOIA 3G8DA 3M83A 2QUHA 3WK4A 1WNTA 2IGBA 1BVHA 4S0XA 3KKPA 3X1XA 1GAXA 3R7BA 1N8SA 2Y9PB 3QPDA 1RABA 2O0MA 2ZIEA 4X6UA 4EQ6A 1QZUA 2BGGA 1RHJA 4M86A 2WJGA 1E3DA 1Z4PX 3CO5A 4Q3NA 5FUXA 2QPOA 1GAJA 1PKXA 3ZKAA 3DVAA 3TLEA 4RZ2A 2QQFA 1XEWX 2GLUA 1V4VA 3C3XA 4MVJF 5CJPA 3RH0A 2A3RA 3SZGA 4D3DA 2HA5A 2H51A 1QHGA 4Z4EA 4FDVA 3TIVA 1PFYA 3CX7A 3FAZA 2JEYA 2VDWA 3DYVA 4YCBA 4WESB 2CEAA 5HX7A 3O8LA 4IH1A 1M6VA 3Q0IA 1XTKA 1GILA 2HX1A 5L53A 3DDOA 1OH6A 3WWCA 3IUQA 4WXEA 3W8RA 2Y1FA 3EIQA 3MA0A 3SPXA 4XVRA 4O4IB 2XWJI 2OT3B 3B51X 2HRQA 1MAVA 3AIKA 3CEAA 2DUJA 4LOKA 3WHPA 3AR5A 4B34A 4DIMA 2GM5A 1QCZA 1T2NA 4LVOA 1KOGA 3K4PA 1VECA 2WUDA 4F60A 3DAHA 1QVAA 3WLLA 2QW0X 3OP4A 4N8EA 5TRTA 3T9FA 4PX2A 4LE2A 4UXHA 2BDTA 2EGHA 3O90A 4U2KA 3KJIA 3BMCA 1LBSA 2BRUA 3U9LA 3OTIA 2IUUA 4M9QA 2RHDA 2Q1YA 3EZ6A 2DAPA 4L5CA 1F2VA 4BKOA 5KVVA 3PQ8A 1U0RA 4N12A 4RVGA 2FPKA 4HDKA 1PJ4A 1SVIA 2HTEA 3QELA 2I1LA 1QIDA 2GBGA 2ILVA 3QZUA 4QTUB 1IG0A 4RYDA 2HLDA 1R4NA 5TSDA 3J80A 5A9TA 4EW2A 2X7JA 2CFSA 3N05A 4MQUA 4BNJA 3JPWA 4IW3B 3PLRA 1UDAA 4YACA 2XKKA 3EXHA 4CLHA 1NOKA 4XH9B 4P36A 2RAUA 4IYJA 1P6XA 1XJ5A 5JH7B 4AG6A 1XHEA 4P0QB 4G1EB 2WJZB 3AUFA 3F5MA 4BWVA 3F5SA 3MRTA 1I2ZA 2Q4OA 4BQPA 1LF5A 3UXMA 3L7LA 3ZE8A 2C4VA 4WKBA 13PKA 3LQ4A 4ZOLA 1VYVA 4CBVA 2F1JA 2GSDA 3PL1A 3P1JA 1E7QA 2CNWD 2JDIA 3FTCA 4Q1DA 4QPCA 4D0SA 4JR0A 4M37A 2YIDA 3PDJA 2W42A 5AI8A 4MARA 1QNLA 4BXOB 3FWPA 3C48A 3CLVA 3K4QA 1DMSA 3L7YA 4K6GA 3TRIA 1YZFA 3IUNA 4V24A 3QUTA 1A5BB 3C6KA 1NTRA 1QGDA 2BN4A 4JB0A 5JZ9A 2OE2A 2YN4A 4X8MA 4OQPA 5B2EA 5HHTA 2POCA 1OWNA 2JH9A 3KHUA 4GI5A 4F4CA 2QZSA 1M0EA 1M2WA 1EA5A 2PA0A 3PTZA 1OOEA 3Q3HA 1J8YF 4QNMA 4RVCA 2EVWX 3B8HA 3AILA 1SVKA 4QEZA 3H9QA 1HKHA 3CX8A 1Z6AA 2O8VA 3FWHA 4ROTA 2Q8NA 4AL4A 1UIRA 3KWMA 2VBIA 5DEIA 2YJ5A 3AF2A 3FR7A 1HQKA 4II2A 2ZCVA 1V5WA 2OYRA 2JIBA 4WN3A 3SYMA 5B4TA 2IWHA 1Z08A 4J7XA 3DOOA 1KK1A 2H4WA 3I58A 4CQMA 4HUJA 3KLNA 1T9ZA 4KXLA 4JBIA 5DHSA 5E6UA 5GP1A 1AQIA 4F12A 2FDCA 4HNUA 1K9SA 1AN9A 3LDUA 5IAGA 4NESA 1W5AA 3ESCA 2ZBRA 4DJ5X 1V3UA 1PR5A 2AOUB 1XMPA 4AN0A 4DIFA 2FRXA 2PBRA 4MUAA 1S2LA 2VR1A 3RUPA 3A4LA 3GXBA 4EAAA 1E3EA 2RARA 2QRMA 1GZVA 3FNGA 1G4UR 1OFHA 1Y82A 2R1UA 4MVJG 3W3ZB 5JFOA 4HNTA 2O06A 4K46A 1XEXB 5GJWC 3WIUA 3WYCA 1ZHOA 1DIBA 4RYLA 3F9CA 4HNAB 2EZ9A 4XPZA 3AG6A 3CYFA 2VJAA 3D7KA 4RHXA 3UMJA 4H7PA 2G9VA 2JCYA 4DA7A 1ETUA 1L5RA 2Y1CA 4IFTA 2ZJ7A 3OJ0A 3VNQA 3FNEA 1EX6A 2P9YA 2CLLB 1S89A 1JXMA 1TZMA 4G5XA 3E1GA 3SFTA 4Q7QA 1VI5A 2C4HA 2GSWA 5NLLA 1I2BA 4EAQA 1GVHA 3R0ZA 3HDQA 2QQEA 5LQJA 1CQXA 2G06A 3KXDA 2NXCA 3NETA 3SJZA 1WPRA 2X1HA 1YGPA 3DHEA 4TSKA 1XTPA 1QHFA 3VPAA 1A96A 4IQ4A 4RF5A