4JYSA

Crystal structure of fkbp25 from plasmodium vivax
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
b'DKPYVKTESGILYKDLIDGEGDPIEEGDIVYIHYQGKTTNDFRIIHSTFNSIIPPKIRAGQYDQKHIRAIYEIVIGMKKHTRRQCVVPPHLAYPNHFPSQPLLYEIDVVKVVKKDSQGKTFIEKVEQKIDQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal structure of Plasmodium vivax FK506-binding protein 25 reveals conformational changes responsible for its noncanonical activity
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Isomerase
total genus 30
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jysA00
2MLYA 3CGMA 4QT3A 2RURA 2OFNA 3O5RA 3O5MA 3O5QA 4W9PA 1U79A 3UQBA 1FKBA 3VAWA 2LKNA 4LAXA 4R0XA 3UQIA 2FKEA 2ITKA 2JZVA 5DIUA 2UZ5A 1FKJA 2MLZA 4U86A 4FAPA 1J4HA 1NSGA 4ODMA 4DRIA 4QIBA 4J4OA 3O5FA 2ZR6A 3KAGA 4DROA 2ZQTA 2ZQUA 2MF9A 3JYJA 3KZ7A 3EY6A 1EQ3A 2PV1A 1FKKA 2XP5A 5HTGA 2LGOA 4DRHA 1D6OA 1T11A 4W9QA 5HUAA 1J6YA 4IQCA 3O5PA 4JFLA 3O5DA 1NMVA 4ODLA 1ZCNA 1D7JA 2ZQVA 5B8IC 3PA7A 2VN1A 4C02B 1HXVA 3O5KA 3KACA 5BXJA 1P5QA 4IPXA 2PPPA 1FKHA 1FKSA 3KABA 4IQ2A 2PV2A 4FN2A 4MGVA 3MDYB 5D75A 2KE0A 4JFJA 5HWBA 4W9OA 3TDBA 3WH0A 2XP8A 3O5JA 1EYMA 3UI5A 5J6EA 3O5LA 2KO7A 4TW7A 2PBCA 1F8AB 2K8IA 3KCEA 4O2TA 4DZ3A 4JFIA 2XPBA 4JFMA 3NRKA 2XP7A 3I6CA 1QPLA 3NI6A 2KGJA 2RQSA 2AWGA 2D9FA 1B6CA 2XPAA 4G50A 4MSPA 1Q6IA 1ROUA 1D7IA 1ZK6A 1FD9A 3ODKA 5HW7A 4DRMA 4DZ2A 2ZR4A 5I98A 2Y78A 3RFWA 2F2DA 1FKDA 4DRJA 1FKRA 4JYSA 4TW8A 4DRNA 3IK8A 1TCOC 4BF8A 2RUDA 3LUOA 4ODPA 2F21A 4TW6A 3TC5A 1Q6UA 2PV3A 1J4RA 2IF4A 3JYMA 2RUQA 1J4IA 1C9HA 3O5OA 3O5GA 3O5IA 4J4NA 4N19A 3UI6A 2LJ4A 2M2AA 4DRQA 1Q6HA 2MPHA 4DRPA 1KT1A 3KADA 3JXVA 4NNRA 4TX0A 2XP4A 1JNTA 4LAVA 2PPNA 3KAFA 2Q5AA 4TYOA 3IHZA 4U84A 4DT4A 1FJDA 4G2PA 1QPFA 2F4EA 4ODQA 2LPVA 1F40A 2ZQSA 1M5YA 1YW5A 4ODOA 2DG4A 5HKGA 4LAWA 3UF8A 2N87A 4QT2A 5DITA 1W26A 3FAPA 5GPGA 5HT1A 2M1IA 1YATA 1KT0A 1PBKA 3CGNA 1FKTA 3IKGA 4DH0A 2MLXA 1A7XA 1Y0OA 3PRDA 4GIVA 5DIVA 4TNSA 1FKFA 4DRKA 2MNTA 3IKDA 3B7XA 1L1PA 1Q1CA 4LAYA 2XP3A 1BL4A 2DG3A 1JNSA 2KFWA 2L2SA 1N1AA 2DG9A 1FKLA 3GPKA 1D7HA 4ODNA 3RGCA 2ZR5A 4U85A 2RUCA 4GGQA 4DIPA 1FAPA 2KR7A 3O5EA 3PRBA 4ITZA 1QZ2A 2XP6A 3KAIA 3H9RB 2RSEA 1FKIA 4ODKA 1JVWA 2XP9A 1BKFA 2FAPA 5HW8A 5HWCA 1PINA 5HW6A 3NTPA 1ROTA 3KAHA 1FKGA 2VCDA 2PPOA 3OOBA 3TCZA 1R9HA 4JFKA 3UQAA 2KI3A 1NMWA 3UI4A 2M08A 4ODRA
chains in the Genus database with same CATH superfamily
4ZPVR 1VF8A 2OFNA 3O5RA 3RM4A 2LKNA 4R0XA 2ITKA 3RMEA 1FKJA 2MLZA 1J4HA 1ITXA 2G41A 2ZQTA 1GOIA 4Q7NA 2ZQUA 2MF9A 5DF0A 4WIWA 3KZ7A 2XP5A 5HTGA 3ARVA 1H0GA 1HKMA 3O5DA 2DSUA 1X6NA 1ZCNA 4ZPWR 1HKIA 1P5QA 3MDYB 5D75A 2KE0A 3WD0A 1EYMA 3WD2A 2A3CA 1F8AB 3KCEA 4DZ3A 2XPBA 1NWTA 1LQ0A 4MPKA 3ARYA 1QPLA 1UR8A 3B9DA 1B6CA 4G50A 3FY1A 1D7IA 1ZK6A 4Z2KA 4DRMA 4DWSA 5I98A 3RFWA 4DRJA 4DRNA 4BF8A 3CHEA 3ARSA 4ODPA 2F21A 4TW6A 2O9OA 3O5GA 1Q6HA 2MPHA 1FFQA 4WKFA 4IT6A 3G6LA 4TYOA 3IHZA 4WK9A 1QPFA 1ZL1A 5DEZA 2DG4A 5HKGA 1WB0A 2WK2A 2DT3A 4LAWA 2N87A 5DITA 3OA5A 3FAPA 5GPGA 2M1IA 3CGNA 4DH0A 2MLXA 3PRDA 1Y0OA 4TNSA 2MNTA 3B7XA 1LL4A 1Q1CA 2DG3A 4L72B 2A3AA 2L2SA 3GTYX 4P8XA 4ITZA 3ARWA 4ODKA 1JVWA 4PTMA 3W4RA 1ROTA 3WL0A 4Z2IA 3WKZA 3ARXA 1NWSA 4HBOA 3CGMA 4QT3A 2RURA 3RM8A 3O5QA 3UQBA 1FKBA 2YBTA 2FKEA 2JZVA 5DIUA 2QF8A 4U86A 4FAPA 1ZBVA 4ODMA 4Z2HA 1E6RA 3KAGA 2B31A 4MAVA 1E6ZA 2PV1A 1J6YA 5HUAA 2B5UB 4IQCA 4R5EA 1EDQA 4W5UA 3KACA 3ARZA 1X6LA 1FKSA 5DO2A 5HWBA 4JFJA 2DSWA 2XP8A 3O5JA 1W9VA 2DT2A 5J6EA 4Z2JA 3O5LA 2KO7A 4TW7A 3FXYA 2K8IA 4O2TA 3WIJA 4ZPTR 1HJVA 3I6CA 3NI6A 1GPFA 2AWGA 2D9FA 2XPAA 1NWUA 1Q6IA 1SYTA 2WLZA 2G8ZA 3ODKA 5HW7A 1UR9A 2F2DA 2DT1A 1FKDA 4P8UA 1FKRA 4TW8A 2DPEA 1LG2A 1Q6UA 1J4RA 2RUQA 1J4IA 4N19A 3UI6A 2LJ4A 3CH9A 4DWSB 1KT1A 3KADA 1FFRA 1JNTA 2PPNA 3KAFA 1F40A 1ZB5A 1M5YA 1YW5A 2ZQSA 4ODOA 1CTNA 1K9TA 3AQUA 4GIVA 4DRKA 1FJDA 1FKFA 3IKDA 1L1PA 4LAYA 2XP3A 1BL4A 2KFWA 3G6MA 1FKLA 4P8WA 4DIPA 2KR7A 3PRBA 1QZ2A 3KAIA 4ML4A 3H9RB 1EHNA 3AS3A 1JCHB 1BKFA 4L3NA 5HWCA 3KAHA 1E9LA 2PPOA 3OOBA 3CHCA 1WAWA 3UI4A 2M08A 4ODRA 2MLYA 1U79A 2DSZA 4LAXA 1ZBWA 3CHDA 2EULA 2FDMA 2WM0A 2PI6A 1W1YA 2UZ5A 4HARA 1XRVA 4DRIA 4QIBA 4J4OA 3CHFA 3O5FA 3B9EA 4DROA 1SR0A 3PRAA 3EY6A 1EQ3A 1FKKA 2LGOA 3GU0A 4W9QA 3ARTA 3O5PA 1NMVA 4C02B 1E15A 5BXJA 4IPXA 2PPPA 3KABA 4KR0B 2PV2A 3WH0A 4Z2LA 1E44A 4LGXA 1O6IA 2PBCA 1WNOA 4JFIA 4JFMA 2XP7A 4Z2GA 3QOKA 4S3JA 2A3EA 2RQSA 4MSPA 1ZU8A 2P4VA 3WQVA 1ROUA 1FD9A 4DZ2A 2Y78A 4JYSA 3WD3A 4P8VA 3EIPA 4DWSD 1W1VA 1TCOC 2A3BA 1GRJA 2IF4A 3JYMA 2AOSA 3O5OA 3O5IA 2F23A 4DRQA 4DRPA 3JXVA 4NNRA 4TX0A 2DSVA 4DT4A 4U84A 1HKKA 2Q5AA 3AS2A 2F4EA 4ODQA 2LPVA 4MTVA 3WL1A 4UDMA 1W26A 1YATA 5JH8A 1KT0A 2IUZA 1W1TA 1FKTA 3B8SA 1A7XA 1ZBKA 3AS0A 1LG1A 1JNSA 1ZBCA 3GPKA 1D7HA 3RGCA 4U85A 2RUCA 2PN0A 1FAPA 3O5EA 2XP6A 2RSEA 1FKIA 4AY1A 2XP9A 2FAPA 5HW6A 1JNDA 2VCDA 3TCZA 1E6NA 3O5MA 4W9PA 5GQBA 3AS1A 3VAWA 4ZS6A 3UQIA 4HBEA 1EIBA 2OLHA 4KQZA 3ALGA 4QZVB 1NH6A 1NSGA 3ARQA 3ARRA 4IT4A 2ZR6A 4MNKA 3JYJA 4S3KA 4URIA 4DRHA 1D6OA 1T11A 4DWSC 3B9AA 4JFLA 4ODLA 3WQWA 1IX5A 1D7JA 1NWRA 2ZQVA 5B8IC 3PA7A 2VN1A 1HXVA 3O5KA 1FKHA 4IQ2A 1E6PA 4WKAA 4WJXA 4FN2A 3BMBA 4MGVA 2YBUA 3PR9A 1LJYA 1OWQA 4W9OA 3TDBA 3BXWA 3WD1A 3ARPA 1HKJA 3UI5A 4Q22A 1W1PA 1OGBA 3NRKA 3WD4A 2KGJA 3ARUA 4MNMA 2ESCA 2ZR4A 1D2KA 4MNJA 2WLYA 4NSBA 1OGGA 3IK8A 2RUDA 3LUOA 2ETNA 1XHGA 1RD6A 1HJWA 3TC5A 2PV3A 1C9HA 4J4NA 3ALFA 2M2AA 1JNEA 3CZ8A 2XP4A 4LAVA 5HBFA 4MNLA 4G2PA 4NZCA 3AROA 1TFVA 3UF8A 2O92A 4QT2A 5HT1A 1LL7A 1W9UA 1PBKA 3IKGA 5DIVA 2DT0A 3RM9A 4WKHA 1N1AA 2DG9A 4ODNA 2ZR5A 4GGQA 1W9PA 4XAKA 1LL6A 5HW8A 5GPRA 1PINA 3NTPA 1HJXA 1FKGA 1GUVA 1KFWA 1R9HA 4JFKA 3UQAA 2KI3A 1NMWA 1H0IA
chains in the Genus database with same CATH topology
4ZPVR 1VF8A 2OFNA 3O5RA 3RM4A 2LKNA 4R0XA 2ITKA 3RMEA 1FKJA 2MLZA 1J4HA 1ITXA 2G41A 2ZQTA 1GOIA 4Q7NA 2ZQUA 2MF9A 5DF0A 4WIWA 3KZ7A 2XP5A 5HTGA 3ARVA 1H0GA 1HKMA 3O5DA 2DSUA 1X6NA 1ZCNA 4ZPWR 1HKIA 1P5QA 3MDYB 5D75A 2KE0A 3WD0A 1EYMA 3WD2A 2A3CA 1F8AB 3KCEA 4DZ3A 2XPBA 1NWTA 1LQ0A 4MPKA 3ARYA 1QPLA 1UR8A 3B9DA 1B6CA 4G50A 3FY1A 1D7IA 1ZK6A 4Z2KA 4DRMA 4DWSA 5I98A 3RFWA 4DRJA 4DRNA 4BF8A 3CHEA 3ARSA 4ODPA 2F21A 4TW6A 2O9OA 3O5GA 1Q6HA 2MPHA 1FFQA 4WKFA 4IT6A 3G6LA 4TYOA 3IHZA 4WK9A 1QPFA 1ZL1A 5DEZA 2DG4A 5HKGA 1WB0A 2WK2A 2DT3A 4LAWA 2N87A 5DITA 3OA5A 3FAPA 5GPGA 2M1IA 3CGNA 4DH0A 2MLXA 3PRDA 1Y0OA 4TNSA 2MNTA 3B7XA 1LL4A 1Q1CA 2DG3A 4L72B 2A3AA 2L2SA 4P8XA 4ITZA 3ARWA 4ODKA 1JVWA 4PTMA 3W4RA 1ROTA 3WL0A 4Z2IA 3WKZA 3ARXA 1NWSA 4HBOA 3CGMA 4QT3A 2RURA 3RM8A 3O5QA 3UQBA 1FKBA 2YBTA 2FKEA 2JZVA 5DIUA 2QF8A 4U86A 4FAPA 1ZBVA 4ODMA 4Z2HA 1E6RA 3KAGA 2B31A 4MAVA 1E6ZA 2PV1A 1J6YA 5HUAA 4IQCA 4R5EA 1EDQA 4W5UA 3KACA 3ARZA 1X6LA 1FKSA 5DO2A 5HWBA 4JFJA 2DSWA 2XP8A 3O5JA 1W9VA 2DT2A 5J6EA 4Z2JA 3O5LA 2KO7A 4TW7A 3FXYA 2K8IA 4O2TA 3WIJA 4ZPTR 1HJVA 3I6CA 3NI6A 1GPFA 2AWGA 2D9FA 2XPAA 1NWUA 1Q6IA 1SYTA 2WLZA 2G8ZA 3ODKA 5HW7A 1UR9A 2F2DA 2DT1A 1FKDA 4P8UA 1FKRA 4TW8A 2DPEA 1LG2A 1Q6UA 1J4RA 2RUQA 1J4IA 4N19A 3UI6A 2LJ4A 3CH9A 4DWSB 1KT1A 3KADA 1FFRA 1JNTA 2PPNA 3KAFA 1F40A 1ZB5A 1M5YA 1YW5A 2ZQSA 4ODOA 1CTNA 1K9TA 3AQUA 4GIVA 4DRKA 1FJDA 1FKFA 3IKDA 1L1PA 4LAYA 2XP3A 1BL4A 2KFWA 3G6MA 1FKLA 4P8WA 4DIPA 2KR7A 3PRBA 1QZ2A 3KAIA 4ML4A 3H9RB 1EHNA 3AS3A 1BKFA 4L3NA 5HWCA 3KAHA 1E9LA 2PPOA 3OOBA 3CHCA 1WAWA 3UI4A 2M08A 4ODRA 2MLYA 1U79A 2DSZA 4LAXA 1ZBWA 3CHDA 2FDMA 2WM0A 2PI6A 1W1YA 2UZ5A 4HARA 1XRVA 4DRIA 4QIBA 4J4OA 3CHFA 3O5FA 3B9EA 4DROA 1SR0A 3PRAA 3EY6A 1EQ3A 1FKKA 2LGOA 4W9QA 3ARTA 3O5PA 1NMVA 4C02B 1E15A 5BXJA 4IPXA 2PPPA 3KABA 4KR0B 2PV2A 3WH0A 4Z2LA 4LGXA 1O6IA 2PBCA 1WNOA 4JFIA 4JFMA 2XP7A 4Z2GA 3QOKA 4S3JA 2A3EA 2RQSA 4MSPA 1ZU8A 3WQVA 1ROUA 1FD9A 4DZ2A 2Y78A 4JYSA 3WD3A 4P8VA 4DWSD 1W1VA 1TCOC 2A3BA 2IF4A 3JYMA 2AOSA 3O5OA 3O5IA 4DRQA 4DRPA 3JXVA 4NNRA 4TX0A 2DSVA 4DT4A 4U84A 1HKKA 2Q5AA 3AS2A 2F4EA 4ODQA 2LPVA 4MTVA 3WL1A 1W26A 1YATA 5JH8A 1KT0A 2IUZA 1W1TA 1FKTA 3B8SA 1A7XA 1ZBKA 3AS0A 1LG1A 1JNSA 1ZBCA 3GPKA 1D7HA 3RGCA 4U85A 2RUCA 1FAPA 3O5EA 2XP6A 2RSEA 1FKIA 4AY1A 2XP9A 2FAPA 5HW6A 1JNDA 2VCDA 3TCZA 1E6NA 3O5MA 4W9PA 5GQBA 3AS1A 3VAWA 4ZS6A 3UQIA 4HBEA 1EIBA 2OLHA 4KQZA 3ALGA 4QZVB 1NH6A 1NSGA 3ARQA 3ARRA 4IT4A 2ZR6A 4MNKA 3JYJA 4S3KA 4URIA 4DRHA 1D6OA 1T11A 4DWSC 3B9AA 4JFLA 4ODLA 3WQWA 1IX5A 1NWRA 1D7JA 2ZQVA 5B8IC 3PA7A 2VN1A 1HXVA 3O5KA 1FKHA 4IQ2A 1E6PA 4WKAA 4WJXA 4FN2A 4MGVA 2YBUA 3PR9A 1LJYA 1OWQA 4W9OA 3TDBA 3BXWA 3WD1A 3ARPA 1HKJA 3UI5A 4Q22A 1W1PA 1OGBA 3NRKA 3WD4A 2KGJA 3ARUA 4MNMA 2ESCA 2ZR4A 1D2KA 4MNJA 2WLYA 4NSBA 1OGGA 3IK8A 2RUDA 3LUOA 1XHGA 1RD6A 1HJWA 3TC5A 2PV3A 1C9HA 4J4NA 3ALFA 2M2AA 1JNEA 3CZ8A 2XP4A 4LAVA 5HBFA 4MNLA 4G2PA 4NZCA 3AROA 1TFVA 3UF8A 2O92A 4QT2A 5HT1A 1LL7A 1W9UA 1PBKA 3IKGA 5DIVA 2DT0A 3RM9A 4WKHA 1N1AA 2DG9A 4ODNA 2ZR5A 4GGQA 1W9PA 4XAKA 1LL6A 5HW8A 5GPRA 1PINA 3NTPA 1HJXA 1FKGA 1GUVA 1KFWA 1R9HA 4JFKA 3UQAA 2KI3A 1NMWA 1H0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLY A;  3CGM A;  4QT3 A;  2RUR A;  2OFN A;  3O5R A;  3O5M A;  3O5Q A;  4W9P A;  1U79 A;  3UQB A;  1FKB A;  3VAW A;  2LKN A;  4LAX A;  4R0X A;  3UQI A;  2FKE A;  2ITK A;  2JZV A;  5DIU A;  2UZ5 A;  1FKJ A;  2MLZ A;  4U86 A;  4FAP A;  1J4H A;  1NSG A;  4ODM A;  4DRI A;  4QIB A;  4J4O A;  3O5F A;  2ZR6 A;  3KAG A;  4DRO A;  2ZQT A;  2ZQU A;  2MF9 A;  3JYJ A;  3KZ7 A;  3EY6 A;  1EQ3 A;  2PV1 A;  1FKK A;  2XP5 A;  5HTG A;  2LGO A;  4DRH A;  1D6O A;  1T11 A;  4W9Q A;  5HUA A;  1J6Y A;  4IQC A;  3O5P A;  4JFL A;  3O5D A;  1NMV A;  4ODL A;  1ZCN A;  1D7J A;  2ZQV A;  5B8I C;  3PA7 A;  2VN1 A;  4C02 B;  1HXV A;  3O5K A;  3KAC A;  5BXJ A;  1P5Q A;  4IPX A;  2PPP A;  1FKH A;  1FKS A;  3KAB A;  4IQ2 A;  2PV2 A;  4FN2 A;  4MGV A;  3MDY B;  5D75 A;  2KE0 A;  4JFJ A;  5HWB A;  4W9O A;  3TDB A;  3WH0 A;  2XP8 A;  3O5J A;  1EYM A;  3UI5 A;  5J6E A;  3O5L A;  2KO7 A;  4TW7 A;  2PBC A;  1F8A B;  2K8I A;  3KCE A;  4O2T A;  4DZ3 A;  4JFI A;  2XPB A;  4JFM A;  3NRK A;  2XP7 A;  3I6C A;  1QPL A;  3NI6 A;  2KGJ A;  2RQS A;  2AWG A;  2D9F A;  1B6C A;  2XPA A;  4G50 A;  4MSP A;  1Q6I A;  1ROU A;  1D7I A;  1ZK6 A;  1FD9 A;  3ODK A;  5HW7 A;  4DRM A;  4DZ2 A;  2ZR4 A;  5I98 A;  2Y78 A;  3RFW A;  2F2D A;  1FKD A;  4DRJ A;  1FKR A;  4JYS A;  4TW8 A;  4DRN A;  3IK8 A;  1TCO C;  4BF8 A;  2RUD A;  3LUO A;  4ODP A;  2F21 A;  4TW6 A;  3TC5 A;  1Q6U A;  2PV3 A;  1J4R A;  2IF4 A;  3JYM A;  2RUQ A;  1J4I A;  1C9H A;  3O5O A;  3O5G A;  3O5I A;  4J4N A;  4N19 A;  3UI6 A;  2LJ4 A;  2M2A A;  4DRQ A;  1Q6H A;  2MPH A;  4DRP A;  1KT1 A;  3KAD A;  3JXV A;  4NNR A;  4TX0 A;  2XP4 A;  1JNT A;  4LAV A;  2PPN A;  3KAF A;  2Q5A A;  4TYO A;  3IHZ A;  4U84 A;  4DT4 A;  1FJD A;  4G2P A;  1QPF A;  2F4E A;  4ODQ A;  2LPV A;  1F40 A;  2ZQS A;  1M5Y A;  1YW5 A;  4ODO A;  2DG4 A;  5HKG A;  4LAW A;  3UF8 A;  2N87 A;  4QT2 A;  5DIT A;  1W26 A;  3FAP A;  5GPG A;  5HT1 A;  2M1I A;  1YAT A;  1KT0 A;  1PBK A;  3CGN A;  1FKT A;  3IKG A;  4DH0 A;  2MLX A;  1A7X A;  1Y0O A;  3PRD A;  4GIV A;  5DIV A;  4TNS A;  1FKF A;  4DRK A;  2MNT A;  3IKD A;  3B7X A;  1L1P A;  1Q1C A;  4LAY A;  2XP3 A;  1BL4 A;  2DG3 A;  1JNS A;  2KFW A;  2L2S A;  1N1A A;  2DG9 A;  1FKL A;  3GPK A;  1D7H A;  4ODN A;  3RGC A;  2ZR5 A;  4U85 A;  2RUC A;  4GGQ A;  4DIP A;  1FAP A;  2KR7 A;  3O5E A;  3PRB A;  4ITZ A;  1QZ2 A;  2XP6 A;  3KAI A;  3H9R B;  2RSE A;  1FKI A;  4ODK A;  1JVW A;  2XP9 A;  1BKF A;  2FAP A;  5HW8 A;  5HWC A;  1PIN A;  5HW6 A;  3NTP A;  1ROT A;  3KAH A;  1FKG A;  2VCD A;  2PPO A;  3OOB A;  3TCZ A;  1R9H A;  4JFK A;  3UQA A;  2KI3 A;  1NMW A;  3UI4 A;  2M08 A;  4ODR A; 
#chains in the Genus database with same CATH topology
 4ZPV R;  1VF8 A;  2OFN A;  3O5R A;  3RM4 A;  2LKN A;  4R0X A;  2ITK A;  3RME A;  1FKJ A;  2MLZ A;  1J4H A;  1ITX A;  2G41 A;  2ZQT A;  1GOI A;  4Q7N A;  2ZQU A;  2MF9 A;  5DF0 A;  4WIW A;  3KZ7 A;  2XP5 A;  5HTG A;  3ARV A;  1H0G A;  1HKM A;  3O5D A;  2DSU A;  1X6N A;  1ZCN A;  4ZPW R;  1HKI A;  1P5Q A;  3MDY B;  5D75 A;  2KE0 A;  3WD0 A;  1EYM A;  3WD2 A;  2A3C A;  1F8A B;  3KCE A;  4DZ3 A;  2XPB A;  1NWT A;  1LQ0 A;  4MPK A;  3ARY A;  1QPL A;  1UR8 A;  3B9D A;  1B6C A;  4G50 A;  3FY1 A;  1D7I A;  1ZK6 A;  4Z2K A;  4DRM A;  4DWS A;  5I98 A;  3RFW A;  4DRJ A;  4DRN A;  4BF8 A;  3CHE A;  3ARS A;  4ODP A;  2F21 A;  4TW6 A;  2O9O A;  3O5G A;  1Q6H A;  2MPH A;  1FFQ A;  4WKF A;  4IT6 A;  3G6L A;  4TYO A;  3IHZ A;  4WK9 A;  1QPF A;  1ZL1 A;  5DEZ A;  2DG4 A;  5HKG A;  1WB0 A;  2WK2 A;  2DT3 A;  4LAW A;  2N87 A;  5DIT A;  3OA5 A;  3FAP A;  5GPG A;  2M1I A;  3CGN A;  4DH0 A;  2MLX A;  3PRD A;  1Y0O A;  4TNS A;  2MNT A;  3B7X A;  1LL4 A;  1Q1C A;  2DG3 A;  4L72 B;  2A3A A;  2L2S A;  3GTY X;  4P8X A;  4ITZ A;  3ARW A;  4ODK A;  1JVW A;  4PTM A;  3W4R A;  1ROT A;  3WL0 A;  4Z2I A;  3WKZ A;  3ARX A;  1NWS A;  4HBO A;  3CGM A;  4QT3 A;  2RUR A;  3RM8 A;  3O5Q A;  3UQB A;  1FKB A;  2YBT A;  2FKE A;  2JZV A;  5DIU A;  2QF8 A;  4U86 A;  4FAP A;  1ZBV A;  4ODM A;  4Z2H A;  1E6R A;  3KAG A;  2B31 A;  4MAV A;  1E6Z A;  2PV1 A;  1J6Y A;  5HUA A;  2B5U B;  4IQC A;  4R5E A;  1EDQ A;  4W5U A;  3KAC A;  3ARZ A;  1X6L A;  1FKS A;  5DO2 A;  5HWB A;  4JFJ A;  2DSW A;  2XP8 A;  3O5J A;  1W9V A;  2DT2 A;  5J6E A;  4Z2J A;  3O5L A;  2KO7 A;  4TW7 A;  3FXY A;  2K8I A;  4O2T A;  3WIJ A;  4ZPT R;  1HJV A;  3I6C A;  3NI6 A;  1GPF A;  2AWG A;  2D9F A;  2XPA A;  1NWU A;  1Q6I A;  1SYT A;  2WLZ A;  2G8Z A;  3ODK A;  5HW7 A;  1UR9 A;  2F2D A;  2DT1 A;  1FKD A;  4P8U A;  1FKR A;  4TW8 A;  2DPE A;  1LG2 A;  1Q6U A;  1J4R A;  2RUQ A;  1J4I A;  4N19 A;  3UI6 A;  2LJ4 A;  3CH9 A;  4DWS B;  1KT1 A;  3KAD A;  1FFR A;  1JNT A;  2PPN A;  3KAF A;  1F40 A;  1ZB5 A;  1M5Y A;  1YW5 A;  2ZQS A;  4ODO A;  1CTN A;  1K9T A;  3AQU A;  4GIV A;  4DRK A;  1FJD A;  1FKF A;  3IKD A;  1L1P A;  4LAY A;  2XP3 A;  1BL4 A;  2KFW A;  3G6M A;  1FKL A;  4P8W A;  4DIP A;  2KR7 A;  3PRB A;  1QZ2 A;  3KAI A;  4ML4 A;  3H9R B;  1EHN A;  3AS3 A;  1JCH B;  1BKF A;  4L3N A;  5HWC A;  3KAH A;  1E9L A;  2PPO A;  3OOB A;  3CHC A;  1WAW A;  3UI4 A;  2M08 A;  4ODR A;  2MLY A;  1U79 A;  2DSZ A;  4LAX A;  1ZBW A;  3CHD A;  2EUL A;  2FDM A;  2WM0 A;  2PI6 A;  1W1Y A;  2UZ5 A;  4HAR A;  1XRV A;  4DRI A;  4QIB A;  4J4O A;  3CHF A;  3O5F A;  3B9E A;  4DRO A;  1SR0 A;  3PRA A;  3EY6 A;  1EQ3 A;  1FKK A;  2LGO A;  3GU0 A;  4W9Q A;  3ART A;  3O5P A;  1NMV A;  4C02 B;  1E15 A;  5BXJ A;  4IPX A;  2PPP A;  3KAB A;  4KR0 B;  2PV2 A;  3WH0 A;  4Z2L A;  1E44 A;  4LGX A;  1O6I A;  2PBC A;  1WNO A;  4JFI A;  4JFM A;  2XP7 A;  4Z2G A;  3QOK A;  4S3J A;  2A3E A;  2RQS A;  4MSP A;  1ZU8 A;  2P4V A;  3WQV A;  1ROU A;  1FD9 A;  4DZ2 A;  2Y78 A;  4JYS A;  3WD3 A;  4P8V A;  3EIP A;  4DWS D;  1W1V A;  1TCO C;  2A3B A;  1GRJ A;  2IF4 A;  3JYM A;  2AOS A;  3O5O A;  3O5I A;  2F23 A;  4DRQ A;  4DRP A;  3JXV A;  4NNR A;  4TX0 A;  2DSV A;  4DT4 A;  4U84 A;  1HKK A;  2Q5A A;  3AS2 A;  2F4E A;  4ODQ A;  2LPV A;  4MTV A;  3WL1 A;  4UDM A;  1W26 A;  1YAT A;  5JH8 A;  1KT0 A;  2IUZ A;  1W1T A;  1FKT A;  3B8S A;  1A7X A;  1ZBK A;  3AS0 A;  1LG1 A;  1JNS A;  1ZBC A;  3GPK A;  1D7H A;  3RGC A;  4U85 A;  2RUC A;  2PN0 A;  1FAP A;  3O5E A;  2XP6 A;  2RSE A;  1FKI A;  4AY1 A;  2XP9 A;  2FAP A;  5HW6 A;  1JND A;  2VCD A;  3TCZ A;  1E6N A;  3O5M A;  4W9P A;  5GQB A;  3AS1 A;  3VAW A;  4ZS6 A;  3UQI A;  4HBE A;  1EIB A;  2OLH A;  4KQZ A;  3ALG A;  4QZV B;  1NH6 A;  1NSG A;  3ARQ A;  3ARR A;  4IT4 A;  2ZR6 A;  4MNK A;  3JYJ A;  4S3K A;  4URI A;  4DRH A;  1D6O A;  1T11 A;  4DWS C;  3B9A A;  4JFL A;  4ODL A;  3WQW A;  1IX5 A;  1D7J A;  1NWR A;  2ZQV A;  5B8I C;  3PA7 A;  2VN1 A;  1HXV A;  3O5K A;  1FKH A;  4IQ2 A;  1E6P A;  4WKA A;  4WJX A;  4FN2 A;  3BMB A;  4MGV A;  2YBU A;  3PR9 A;  1LJY A;  1OWQ A;  4W9O A;  3TDB A;  3BXW A;  3WD1 A;  3ARP A;  1HKJ A;  3UI5 A;  4Q22 A;  1W1P A;  1OGB A;  3NRK A;  3WD4 A;  2KGJ A;  3ARU A;  4MNM A;  2ESC A;  2ZR4 A;  1D2K A;  4MNJ A;  2WLY A;  4NSB A;  1OGG A;  3IK8 A;  2RUD A;  3LUO A;  2ETN A;  1XHG A;  1RD6 A;  1HJW A;  3TC5 A;  2PV3 A;  1C9H A;  4J4N A;  3ALF A;  2M2A A;  1JNE A;  3CZ8 A;  2XP4 A;  4LAV A;  5HBF A;  4MNL A;  4G2P A;  4NZC A;  3ARO A;  1TFV A;  3UF8 A;  2O92 A;  4QT2 A;  5HT1 A;  1LL7 A;  1W9U A;  1PBK A;  3IKG A;  5DIV A;  2DT0 A;  3RM9 A;  4WKH A;  1N1A A;  2DG9 A;  4ODN A;  2ZR5 A;  4GGQ A;  1W9P A;  4XAK A;  1LL6 A;  5HW8 A;  5GPR A;  1PIN A;  3NTP A;  1HJX A;  1FKG A;  1GUV A;  1KFW A;  1R9H A;  4JFK A;  3UQA A;  2KI3 A;  1NMW A;  1H0I A; 
#chains in the Genus database with same CATH homology
 4ZPV R;  1VF8 A;  2OFN A;  3O5R A;  3RM4 A;  2LKN A;  4R0X A;  2ITK A;  3RME A;  1FKJ A;  2MLZ A;  1J4H A;  1ITX A;  2G41 A;  2ZQT A;  1GOI A;  4Q7N A;  2ZQU A;  2MF9 A;  5DF0 A;  4WIW A;  3KZ7 A;  2XP5 A;  5HTG A;  3ARV A;  1H0G A;  1HKM A;  3O5D A;  2DSU A;  1X6N A;  1ZCN A;  4ZPW R;  1HKI A;  1P5Q A;  3MDY B;  5D75 A;  2KE0 A;  3WD0 A;  1EYM A;  3WD2 A;  2A3C A;  1F8A B;  3KCE A;  4DZ3 A;  2XPB A;  1NWT A;  1LQ0 A;  4MPK A;  3ARY A;  1QPL A;  1UR8 A;  3B9D A;  1B6C A;  4G50 A;  3FY1 A;  1D7I A;  1ZK6 A;  4Z2K A;  4DRM A;  4DWS A;  5I98 A;  3RFW A;  4DRJ A;  4DRN A;  4BF8 A;  3CHE A;  3ARS A;  4ODP A;  2F21 A;  4TW6 A;  2O9O A;  3O5G A;  1Q6H A;  2MPH A;  1FFQ A;  4WKF A;  4IT6 A;  3G6L A;  4TYO A;  3IHZ A;  4WK9 A;  1QPF A;  1ZL1 A;  5DEZ A;  2DG4 A;  5HKG A;  1WB0 A;  2WK2 A;  2DT3 A;  4LAW A;  2N87 A;  5DIT A;  3OA5 A;  3FAP A;  5GPG A;  2M1I A;  3CGN A;  4DH0 A;  2MLX A;  3PRD A;  1Y0O A;  4TNS A;  2MNT A;  3B7X A;  1LL4 A;  1Q1C A;  2DG3 A;  4L72 B;  2A3A A;  2L2S A;  4P8X A;  4ITZ A;  3ARW A;  4ODK A;  1JVW A;  4PTM A;  3W4R A;  1ROT A;  3WL0 A;  4Z2I A;  3WKZ A;  3ARX A;  1NWS A;  4HBO A;  3CGM A;  4QT3 A;  2RUR A;  3RM8 A;  3O5Q A;  3UQB A;  1FKB A;  2YBT A;  2FKE A;  2JZV A;  5DIU A;  2QF8 A;  4U86 A;  4FAP A;  1ZBV A;  4ODM A;  4Z2H A;  1E6R A;  3KAG A;  2B31 A;  4MAV A;  1E6Z A;  2PV1 A;  1J6Y A;  5HUA A;  4IQC A;  4R5E A;  1EDQ A;  4W5U A;  3KAC A;  3ARZ A;  1X6L A;  1FKS A;  5DO2 A;  5HWB A;  4JFJ A;  2DSW A;  2XP8 A;  3O5J A;  1W9V A;  2DT2 A;  5J6E A;  4Z2J A;  3O5L A;  2KO7 A;  4TW7 A;  3FXY A;  2K8I A;  4O2T A;  3WIJ A;  4ZPT R;  1HJV A;  3I6C A;  3NI6 A;  1GPF A;  2AWG A;  2D9F A;  2XPA A;  1NWU A;  1Q6I A;  1SYT A;  2WLZ A;  2G8Z A;  3ODK A;  5HW7 A;  1UR9 A;  2F2D A;  2DT1 A;  1FKD A;  4P8U A;  1FKR A;  4TW8 A;  2DPE A;  1LG2 A;  1Q6U A;  1J4R A;  2RUQ A;  1J4I A;  4N19 A;  3UI6 A;  2LJ4 A;  3CH9 A;  4DWS B;  1KT1 A;  3KAD A;  1FFR A;  1JNT A;  2PPN A;  3KAF A;  1F40 A;  1ZB5 A;  1M5Y A;  1YW5 A;  2ZQS A;  4ODO A;  1CTN A;  1K9T A;  3AQU A;  4GIV A;  4DRK A;  1FJD A;  1FKF A;  3IKD A;  1L1P A;  4LAY A;  2XP3 A;  1BL4 A;  2KFW A;  3G6M A;  1FKL A;  4P8W A;  4DIP A;  2KR7 A;  3PRB A;  1QZ2 A;  3KAI A;  4ML4 A;  3H9R B;  1EHN A;  3AS3 A;  1BKF A;  4L3N A;  5HWC A;  3KAH A;  1E9L A;  2PPO A;  3OOB A;  3CHC A;  1WAW A;  3UI4 A;  2M08 A;  4ODR A;  2MLY A;  1U79 A;  2DSZ A;  4LAX A;  1ZBW A;  3CHD A;  2FDM A;  2WM0 A;  2PI6 A;  1W1Y A;  2UZ5 A;  4HAR A;  1XRV A;  4DRI A;  4QIB A;  4J4O A;  3CHF A;  3O5F A;  3B9E A;  4DRO A;  1SR0 A;  3PRA A;  3EY6 A;  1EQ3 A;  1FKK A;  2LGO A;  4W9Q A;  3ART A;  3O5P A;  1NMV A;  4C02 B;  1E15 A;  5BXJ A;  4IPX A;  2PPP A;  3KAB A;  4KR0 B;  2PV2 A;  3WH0 A;  4Z2L A;  4LGX A;  1O6I A;  2PBC A;  1WNO A;  4JFI A;  4JFM A;  2XP7 A;  4Z2G A;  3QOK A;  4S3J A;  2A3E A;  2RQS A;  4MSP A;  1ZU8 A;  3WQV A;  1ROU A;  1FD9 A;  4DZ2 A;  2Y78 A;  4JYS A;  3WD3 A;  4P8V A;  4DWS D;  1W1V A;  1TCO C;  2A3B A;  2IF4 A;  3JYM A;  2AOS A;  3O5O A;  3O5I A;  4DRQ A;  4DRP A;  3JXV A;  4NNR A;  4TX0 A;  2DSV A;  4DT4 A;  4U84 A;  1HKK A;  2Q5A A;  3AS2 A;  2F4E A;  4ODQ A;  2LPV A;  4MTV A;  3WL1 A;  1W26 A;  1YAT A;  5JH8 A;  1KT0 A;  2IUZ A;  1W1T A;  1FKT A;  3B8S A;  1A7X A;  1ZBK A;  3AS0 A;  1LG1 A;  1JNS A;  1ZBC A;  3GPK A;  1D7H A;  3RGC A;  4U85 A;  2RUC A;  1FAP A;  3O5E A;  2XP6 A;  2RSE A;  1FKI A;  4AY1 A;  2XP9 A;  2FAP A;  5HW6 A;  1JND A;  2VCD A;  3TCZ A;  1E6N A;  3O5M A;  4W9P A;  5GQB A;  3AS1 A;  3VAW A;  4ZS6 A;  3UQI A;  4HBE A;  1EIB A;  2OLH A;  4KQZ A;  3ALG A;  4QZV B;  1NH6 A;  1NSG A;  3ARQ A;  3ARR A;  4IT4 A;  2ZR6 A;  4MNK A;  3JYJ A;  4S3K A;  4URI A;  4DRH A;  1D6O A;  1T11 A;  4DWS C;  3B9A A;  4JFL A;  4ODL A;  3WQW A;  1IX5 A;  1NWR A;  1D7J A;  2ZQV A;  5B8I C;  3PA7 A;  2VN1 A;  1HXV A;  3O5K A;  1FKH A;  4IQ2 A;  1E6P A;  4WKA A;  4WJX A;  4FN2 A;  4MGV A;  2YBU A;  3PR9 A;  1LJY A;  1OWQ A;  4W9O A;  3TDB A;  3BXW A;  3WD1 A;  3ARP A;  1HKJ A;  3UI5 A;  4Q22 A;  1W1P A;  1OGB A;  3NRK A;  3WD4 A;  2KGJ A;  3ARU A;  4MNM A;  2ESC A;  2ZR4 A;  1D2K A;  4MNJ A;  2WLY A;  4NSB A;  1OGG A;  3IK8 A;  2RUD A;  3LUO A;  1XHG A;  1RD6 A;  1HJW A;  3TC5 A;  2PV3 A;  1C9H A;  4J4N A;  3ALF A;  2M2A A;  1JNE A;  3CZ8 A;  2XP4 A;  4LAV A;  5HBF A;  4MNL A;  4G2P A;  4NZC A;  3ARO A;  1TFV A;  3UF8 A;  2O92 A;  4QT2 A;  5HT1 A;  1LL7 A;  1W9U A;  1PBK A;  3IKG A;  5DIV A;  2DT0 A;  3RM9 A;  4WKH A;  1N1A A;  2DG9 A;  4ODN A;  2ZR5 A;  4GGQ A;  1W9P A;  4XAK A;  1LL6 A;  5HW8 A;  5GPR A;  1PIN A;  3NTP A;  1HJX A;  1FKG A;  1GUV A;  1KFW A;  1R9H A;  4JFK A;  3UQA A;  2KI3 A;  1NMW A;  1H0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...