4JYSA

Crystal structure of fkbp25 from plasmodium vivax
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
DKPYVKTESGILYKDLIDGEGDPIEEGDIVYIHYQGKTTNDFRIIHSTFNSIIPPKIRAGQYDQKHIRAIYEIVIGMKKHTRRQCVVPPHLAYPNHFPSQPLLYEIDVVKVVKKDSQGKTFIEKVEQKIDQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal structure of Plasmodium vivax FK506-binding protein 25 reveals conformational changes responsible for its noncanonical activity
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Isomerase
total genus 30
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jysA00
1QPFA 1FKHA 4DT4A 2PPPA 1N1AA 3I6CA 3RFWA 3TC5A 1FAPA 4FAPA 4TYOA 3UI4A 1FKSA 1Q6HA 1Q1CA 2ZQUA 1ROTA 2LKNA 3LUOA 5HW7A 1EYMA 4ODMA 4QIBA 4ODLA 1FD9A 3KAIA 1ZK6A 3KCEA 1ROUA 2M1IA 1C9HA 4QT3A 1F40A 3UQBA 4J4NA 1YW5A 2KGJA 2XP5A 2XPBA 2ZQSA 4DRKA 1L1PA 2RQSA 5HUAA 4C02B 5DIUA 1Q6IA 2IF4A 4LAXA 1HXVA 4LAYA 3JYJA 2Y78A 2ZQVA 3TDBA 4DRPA 3UQAA 1FKRA 3O5IA 4DZ3A 4GGQA 4NNRA 4R0XA 3IHZA 1PINA 3NI6A 2ZR6A 3O5RA 1QZ2A 4U85A 1J4IA 5HTGA 5D75A 2XP8A 4DRIA 2PV2A 4DRMA 2DG4A 2VCDA 2MF9A 5J6EA 1M5YA 3KZ7A 5HKGA 1Y0OA 3EY6A 2F2DA 1YATA 2ZQTA 2PPNA 2PV3A 2MPHA 2RURA 1FJDA 3IKGA 1JNSA 4J4OA 4ODOA 1JVWA 4W9QA 2FAPA 2XP6A 2M2AA 2PV1A 2MLXA 1TCOC 1D7HA 3NTPA 3PA7A 1BL4A 1P5QA 4DH0A 4DRJA 1NMVA 2AWGA 2LGOA 3MDYB 2LJ4A 2KI3A 1R9HA 4JFJA 2MLYA 2JZVA 2M08A 2XP3A 3GPKA 3O5MA 2N87A 2DG3A 2ZR4A 1FKTA 3O5EA 3TCZA 3WH0A 1A7XA 2OFNA 3UF8A 3O5QA 2XPAA 3PRDA 1KT1A 2KE0A 5GPGA 3UI5A 1FKDA 2K8IA 3O5LA 3NRKA 3IK8A 4TW7A 3JYMA 3KACA 3O5FA 4MSPA 5BXJA 2XP9A 4IPXA 2XP7A 2DG9A 1B6CA 1D7JA 2LPVA 2L2SA 4JFKA 4BF8A 3O5OA 1J4HA 4ODNA 4QT2A 5HW8A 1PBKA 3B7XA 3JXVA 3KADA 3IKDA 4ODKA 1F8AB 1FKGA 4LAWA 4ODPA 2RSEA 1BKFA 1EQ3A 4U84A 3CGNA 3VAWA 1FKBA 4DIPA 1W26A 3O5KA 2F4EA 2ZR5A 3UI6A 4JFIA 4IQ2A 2XP4A 4LAVA 3CGMA 4DROA 2KFWA 3KAFA 2FKEA 3PRBA 4U86A 2MLZA 4TW6A 1FKJA 4DRNA 3O5DA 3KAHA 3ODKA 5B8IC 1ZCNA 3O5JA 1D7IA 4FN2A 1FKFA 5HWBA 1J4RA 4W9OA 2KR7A 4IQCA 1J6YA 1FKIA 1FKKA 2UZ5A 3FAPA 4ODRA 4DRHA 2Q5AA 4JYSA 1KT0A 4TW8A 3O5GA 4ITZA 4O2TA 1NSGA 4TX0A 4MGVA 1D6OA 3O5PA 4JFMA 3OOBA 2ITKA 2PPOA 4G2PA 5HT1A 3H9RB 1U79A 2MNTA 1NMWA 3KABA 4GIVA 2F21A 4TNSA 4W9PA 5DITA 1T11A 4DZ2A 1Q6UA 2RUCA 2VN1A 2RUQA 3RGCA 5DIVA 5I98A 2D9FA 3UQIA 2KO7A 2PBCA 4ODQA 4DRQA 5HWCA 2RUDA 4G50A 1QPLA 5HW6A 1JNTA 4JFLA 4N19A 3KAGA 1FKLA
chains in the Genus database with same CATH superfamily
4ZPWR 2DT1A 3TC5A 1N1AA 1Q1CA 1ROTA 2IUZA 4WIWA 4ODLA 3AROA 3BXWA 1HKJA 3CHDA 3CZ8A 2WM0A 1W1VA 3KCEA 2P4VA 2M1IA 1C9HA 4LGXA 3FXYA 4LAXA 4S3JA 2Y78A 2ZQVA 3O5IA 2A3EA 3IHZA 3O5RA 1QZ2A 1J4IA 2F23A 1Y0OA 3EY6A 2ZQTA 1FJDA 2PV3A 1OGBA 3IKGA 4ODOA 4W9QA 3WD2A 3WQVA 1W9PA 1TCOC 1D7HA 3B8SA 5DF0A 1NMVA 1X6NA 2KI3A 4JFJA 2JZVA 2M08A 2XP3A 3O5MA 2ZR4A 1FKTA 3O5EA 1K9TA 4MPKA 1HKIA 1KT1A 5GPGA 1FKDA 2K8IA 3IK8A 3JYMA 3KACA 4MNKA 2XP9A 1HJVA 2XP7A 4IT4A 4BF8A 3OA5A 3B7XA 3GU0A 3JXVA 3FY1A 4P8WA 1H0GA 4ODKA 4R5EA 4ODPA 2DT0A 3VAWA 2F4EA 4JFIA 4IQ2A 1E6RA 4LAVA 4DRNA 5GPRA 3O5DA 4WK9A 4FN2A 1D7IA 1EIBA 1J4RA 4ODRA 2Q5AA 4JYSA 4Z2GA 3O5GA 4ITZA 1UR8A 3AS3A 3GTYX 3O5PA 3OOBA 4WJXA 3ARTA 1WB0A 1U79A 4WKFA 4GIVA 1NMWA 5DITA 3B9AA 4TNSA 2RUCA 2RUQA 3WIJA 1NWRA 4DRQA 4DWSD 4L3NA 3QOKA 1ZBKA 1QPLA 4JFLA 1QPFA 1SR0A 4DT4A 1LG1A 1O6IA 4FAPA 1FAPA 3UI4A 1CTNA 1ZBCA 3LUOA 5HW7A 4ODMA 4QIBA 1FD9A 4HBOA 3KAIA 1ROUA 1RD6A 4QT3A 4J4NA 2KGJA 2XP5A 4DRKA 4ML4A 2RQSA 4C02B 4P8VA 1Q6IA 1X6LA 1LL7A 2ESCA 4LAYA 3G6LA 3UQAA 1LJYA 4AY1A 1PINA 4U85A 2XP8A 4DRIA 2PV2A 4HARA 4P8UA 4DRMA 3WKZA 5J6EA 1XHGA 1M5YA 3KZ7A 1YATA 1NH6A 2MPHA 3WD4A 1GRJA 1JVWA 1LL4A 2FAPA 4UDMA 3RM8A 2M2AA 1HKMA 3NTPA 1BL4A 1P5QA 3AS0A 4MNLA 1ZL1A 4HBEA 2MLYA 3GPKA 2N87A 2DG3A 3TCZA 3WH0A 2OFNA 3UF8A 2XPAA 3EIPA 3O5LA 4Z2IA 4L72B 3ARYA 2G8ZA 4IPXA 2LPVA 2L2SA 4JFKA 3O5OA 1J4HA 1PBKA 1OWQA 2O92A 1HJXA 1BKFA 5GQBA 1EQ3A 4DIPA 2A3BA 4QZVB 2ZR5A 1XRVA 4DROA 2XP4A 3CGMA 3KAFA 3PRBA 4TW6A 1FKJA 3WL1A 3ODKA 5B8IC 1EDQA 3O5JA 1FKFA 4W9OA 4NZCA 1FKIA 1FKKA 3FAPA 1W1YA 1NWTA 4DRHA 1KT0A 1LG2A 3AQUA 4TX0A 2YBUA 4JFMA 2WLZA 5HT1A 3ALGA 1W9VA 4W9PA 1E44A 3ARQA 3PR9A 3ARXA 5I98A 1HJWA 2PBCA 4ODQA 3ALFA 5HWCA 3WL0A 3RMEA 2O9OA 2RUDA 5HW6A 3WQWA 3AS1A 1FKLA 1JCHB 1FKHA 2YBTA 3I6CA 3RFWA 4WKHA 4TYOA 1Q6HA 1EYMA 2B5UB 1TFVA 2EULA 1GOIA 4DWSB 2ZQSA 1L1PA 5HUAA 4URIA 4S3KA 2IF4A 1E6ZA 1JNDA 1HXVA 3JYJA 4DRPA 3CHCA 4DZ3A 1LQ0A 4R0XA 4NNRA 4WKAA 3NI6A 5HTGA 1VF8A 5D75A 4XAKA 2DG4A 2WLYA 2F2DA 2PPNA 1JNSA 1UR9A 3ARVA 4Z2LA 3PA7A 1ZU8A 4DRJA 4DH0A 2AWGA 2DSUA 2PI6A 1W9UA 3O5QA 2KE0A 1ZB5A 4ZPVR 2FDMA 3NRKA 2B31A 3ARRA 3O5FA 4MSPA 4NSBA 2DG9A 1B6CA 1D7JA 1H0IA 1E9LA 1FKBA 1W1PA 5JH8A 4U86A 2MLZA 3KAHA 1E15A 3CH9A 1J6YA 2KR7A 4IQCA 1IX5A 2UZ5A 3AS2A 3W4RA 2DSZA 4Q7NA 1NSGA 1GPFA 2QF8A 2ITKA 2PPOA 4G2PA 2MNTA 1T11A 4DZ2A 4P8XA 2D9FA 1ITXA 2KO7A 5DEZA 1NWSA 3CHEA 2DPEA 3KAGA 1E6PA 3G6MA 1SYTA 2PPPA 4MNMA 1FKSA 2ZQUA 2LKNA 3ARSA 2A3AA 3WD1A 2DSWA 4DWSA 4DWSC 1ZK6A 2ETNA 4W5UA 1F40A 3UQBA 4PTMA 3ARUA 1YW5A 2XPBA 4KR0B 5DIUA 1W1TA 2A3CA 1NWUA 3WD0A 4Q22A 1D2KA 4Z2KA 3TDBA 2G41A 1FKRA 3ARWA 4GGQA 3ARZA 2ZR6A 1WAWA 1JNEA 2VCDA 3RM9A 2MF9A 2DT2A 1WNOA 5HKGA 2RURA 4J4OA 4Z2JA 2XP6A 2DT3A 2PV1A 2MLXA 1KFWA 1E6NA 2AOSA 2LGOA 4ZS6A 3ARPA 3MDYB 2LJ4A 1R9HA 3PRAA 1ZBVA 1FFQA 4MTVA 1A7XA 3PRDA 3UI5A 4TW7A 2PN0A 5BXJA 4Z2HA 1ZBWA 5HW8A 4QT2A 4ODNA 1LL6A 3KADA 1EHNA 1FFRA 3IKDA 1F8AB 1FKGA 2WK2A 4LAWA 2RSEA 4U84A 5DO2A 3CGNA 1W26A 3O5KA 3UI6A 1GUVA 2KFWA 4ZPTR 2FKEA 1OGGA 1ZCNA 4KQZA 5HWBA 3B9DA 1HKKA 4TW8A 4O2TA 3RM4A 4MGVA 1D6OA 2DSVA 2OLHA 4IT6A 3H9RB 3BMBA 4MNJA 3KABA 2F21A 1Q6UA 2VN1A 3RGCA 5DIVA 3WD3A 3B9EA 5HBFA 3UQIA 3CHFA 4MAVA 4G50A 1JNTA 4N19A
chains in the Genus database with same CATH topology
4ZPWR 2DT1A 3TC5A 1N1AA 1Q1CA 1ROTA 2IUZA 4WIWA 4ODLA 3AROA 3BXWA 1HKJA 3CHDA 3CZ8A 2WM0A 1W1VA 3KCEA 2M1IA 1C9HA 4LGXA 3FXYA 4LAXA 4S3JA 2Y78A 2ZQVA 3O5IA 2A3EA 3IHZA 3O5RA 1QZ2A 1J4IA 1Y0OA 3EY6A 2ZQTA 1FJDA 2PV3A 1OGBA 3IKGA 4ODOA 4W9QA 3WD2A 3WQVA 1W9PA 1TCOC 1D7HA 3B8SA 5DF0A 1NMVA 1X6NA 2KI3A 4JFJA 2JZVA 2M08A 2XP3A 3O5MA 2ZR4A 1FKTA 3O5EA 1K9TA 4MPKA 1HKIA 1KT1A 5GPGA 1FKDA 2K8IA 3IK8A 3JYMA 3KACA 4MNKA 2XP9A 1HJVA 2XP7A 4IT4A 4BF8A 3OA5A 3B7XA 3JXVA 4P8WA 3FY1A 1H0GA 4ODKA 4R5EA 4ODPA 2DT0A 3VAWA 2F4EA 4JFIA 4IQ2A 1E6RA 4LAVA 4DRNA 5GPRA 3O5DA 4WK9A 4FN2A 1D7IA 1EIBA 1J4RA 4ODRA 2Q5AA 4JYSA 4Z2GA 3O5GA 4ITZA 1UR8A 3AS3A 3O5PA 3OOBA 4WJXA 3ARTA 1WB0A 1U79A 4WKFA 4GIVA 1NMWA 5DITA 3B9AA 4TNSA 2RUCA 2RUQA 3WIJA 1NWRA 4DRQA 4DWSD 4L3NA 3QOKA 1ZBKA 1QPLA 4JFLA 1QPFA 1SR0A 4DT4A 1LG1A 1O6IA 4FAPA 1FAPA 3UI4A 1CTNA 1ZBCA 3LUOA 5HW7A 4ODMA 4QIBA 1FD9A 4HBOA 3KAIA 1ROUA 1RD6A 4QT3A 4J4NA 2KGJA 2XP5A 4DRKA 4ML4A 2RQSA 4C02B 4P8VA 1Q6IA 1X6LA 1LL7A 2ESCA 4LAYA 3G6LA 3UQAA 1LJYA 4AY1A 1PINA 4U85A 2XP8A 4DRIA 2PV2A 4HARA 4P8UA 4DRMA 3WKZA 5J6EA 1XHGA 1M5YA 3KZ7A 1YATA 1NH6A 2MPHA 3WD4A 1JVWA 1LL4A 2FAPA 3RM8A 2M2AA 1HKMA 3NTPA 1BL4A 1P5QA 3AS0A 4MNLA 1ZL1A 4HBEA 2MLYA 3GPKA 2N87A 2DG3A 3TCZA 3WH0A 2OFNA 3UF8A 2XPAA 3O5LA 4Z2IA 4L72B 3ARYA 2G8ZA 4IPXA 2LPVA 2L2SA 4JFKA 3O5OA 1J4HA 1PBKA 1OWQA 2O92A 1HJXA 1BKFA 5GQBA 1EQ3A 4DIPA 2A3BA 4QZVB 2ZR5A 1XRVA 4DROA 2XP4A 3CGMA 3KAFA 3PRBA 4TW6A 1FKJA 3WL1A 3ODKA 5B8IC 1EDQA 3O5JA 1FKFA 4W9OA 4NZCA 1FKIA 1FKKA 3FAPA 1W1YA 1NWTA 4DRHA 1KT0A 1LG2A 3AQUA 4TX0A 2YBUA 4JFMA 2WLZA 5HT1A 3ALGA 1W9VA 4W9PA 3ARQA 3PR9A 3ARXA 5I98A 1HJWA 2PBCA 4ODQA 3ALFA 5HWCA 3WL0A 3RMEA 2O9OA 2RUDA 5HW6A 3WQWA 3AS1A 1FKLA 1FKHA 2YBTA 3I6CA 3RFWA 4WKHA 4TYOA 1Q6HA 1EYMA 1TFVA 1GOIA 4DWSB 2ZQSA 1L1PA 5HUAA 4URIA 4S3KA 2IF4A 1E6ZA 1JNDA 1HXVA 3JYJA 4DRPA 3CHCA 4DZ3A 1LQ0A 4R0XA 4NNRA 4WKAA 3NI6A 5HTGA 1VF8A 5D75A 4XAKA 2DG4A 2WLYA 2F2DA 2PPNA 1JNSA 1UR9A 3ARVA 4Z2LA 3PA7A 1ZU8A 4DRJA 4DH0A 2AWGA 2DSUA 2PI6A 1W9UA 3O5QA 2KE0A 1ZB5A 4ZPVR 2FDMA 3NRKA 2B31A 3ARRA 3O5FA 4MSPA 4NSBA 2DG9A 1B6CA 1D7JA 1H0IA 1E9LA 1FKBA 1W1PA 5JH8A 4U86A 2MLZA 3KAHA 1E15A 3CH9A 1J6YA 2KR7A 4IQCA 1IX5A 2UZ5A 3AS2A 3W4RA 2DSZA 4Q7NA 1NSGA 1GPFA 2QF8A 2ITKA 2PPOA 4G2PA 2MNTA 1T11A 4DZ2A 4P8XA 2D9FA 1ITXA 2KO7A 5DEZA 1NWSA 3CHEA 2DPEA 3KAGA 1E6PA 3G6MA 1SYTA 2PPPA 4MNMA 1FKSA 2ZQUA 2LKNA 3ARSA 2A3AA 3WD1A 2DSWA 4DWSA 4DWSC 1ZK6A 4W5UA 1F40A 3UQBA 4PTMA 3ARUA 1YW5A 2XPBA 4KR0B 5DIUA 1W1TA 2A3CA 1NWUA 3WD0A 4Q22A 1D2KA 4Z2KA 3TDBA 2G41A 1FKRA 3ARWA 4GGQA 3ARZA 2ZR6A 1WAWA 1JNEA 2VCDA 3RM9A 2MF9A 2DT2A 1WNOA 5HKGA 2RURA 4J4OA 4Z2JA 2XP6A 2DT3A 2PV1A 2MLXA 1KFWA 1E6NA 2AOSA 2LGOA 4ZS6A 3ARPA 3MDYB 2LJ4A 1R9HA 3PRAA 1ZBVA 1FFQA 4MTVA 1A7XA 3PRDA 3UI5A 4TW7A 5BXJA 4Z2HA 1ZBWA 5HW8A 4QT2A 4ODNA 1LL6A 3KADA 1EHNA 1FFRA 3IKDA 1F8AB 1FKGA 2WK2A 4LAWA 2RSEA 4U84A 5DO2A 3CGNA 1W26A 3O5KA 3UI6A 1GUVA 2KFWA 4ZPTR 2FKEA 1OGGA 1ZCNA 4KQZA 5HWBA 3B9DA 1HKKA 4TW8A 4O2TA 3RM4A 4MGVA 1D6OA 2DSVA 2OLHA 4IT6A 3H9RB 4MNJA 3KABA 2F21A 1Q6UA 2VN1A 3RGCA 5DIVA 3WD3A 3B9EA 5HBFA 3UQIA 3CHFA 4MAVA 4G50A 1JNTA 4N19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPF A;  1FKH A;  4DT4 A;  2PPP A;  1N1A A;  3I6C A;  3RFW A;  3TC5 A;  1FAP A;  4FAP A;  4TYO A;  3UI4 A;  1FKS A;  1Q6H A;  1Q1C A;  2ZQU A;  1ROT A;  2LKN A;  3LUO A;  5HW7 A;  1EYM A;  4ODM A;  4QIB A;  4ODL A;  1FD9 A;  3KAI A;  1ZK6 A;  3KCE A;  1ROU A;  2M1I A;  1C9H A;  4QT3 A;  1F40 A;  3UQB A;  4J4N A;  1YW5 A;  2KGJ A;  2XP5 A;  2XPB A;  2ZQS A;  4DRK A;  1L1P A;  2RQS A;  5HUA A;  4C02 B;  5DIU A;  1Q6I A;  2IF4 A;  4LAX A;  1HXV A;  4LAY A;  3JYJ A;  2Y78 A;  2ZQV A;  3TDB A;  4DRP A;  3UQA A;  1FKR A;  3O5I A;  4DZ3 A;  4GGQ A;  4NNR A;  4R0X A;  3IHZ A;  1PIN A;  3NI6 A;  2ZR6 A;  3O5R A;  1QZ2 A;  4U85 A;  1J4I A;  5HTG A;  5D75 A;  2XP8 A;  4DRI A;  2PV2 A;  4DRM A;  2DG4 A;  2VCD A;  2MF9 A;  5J6E A;  1M5Y A;  3KZ7 A;  5HKG A;  1Y0O A;  3EY6 A;  2F2D A;  1YAT A;  2ZQT A;  2PPN A;  2PV3 A;  2MPH A;  2RUR A;  1FJD A;  3IKG A;  1JNS A;  4J4O A;  4ODO A;  1JVW A;  4W9Q A;  2FAP A;  2XP6 A;  2M2A A;  2PV1 A;  2MLX A;  1TCO C;  1D7H A;  3NTP A;  3PA7 A;  1BL4 A;  1P5Q A;  4DH0 A;  4DRJ A;  1NMV A;  2AWG A;  2LGO A;  3MDY B;  2LJ4 A;  2KI3 A;  1R9H A;  4JFJ A;  2MLY A;  2JZV A;  2M08 A;  2XP3 A;  3GPK A;  3O5M A;  2N87 A;  2DG3 A;  2ZR4 A;  1FKT A;  3O5E A;  3TCZ A;  3WH0 A;  1A7X A;  2OFN A;  3UF8 A;  3O5Q A;  2XPA A;  3PRD A;  1KT1 A;  2KE0 A;  5GPG A;  3UI5 A;  1FKD A;  2K8I A;  3O5L A;  3NRK A;  3IK8 A;  4TW7 A;  3JYM A;  3KAC A;  3O5F A;  4MSP A;  5BXJ A;  2XP9 A;  4IPX A;  2XP7 A;  2DG9 A;  1B6C A;  1D7J A;  2LPV A;  2L2S A;  4JFK A;  4BF8 A;  3O5O A;  1J4H A;  4ODN A;  4QT2 A;  5HW8 A;  1PBK A;  3B7X A;  3JXV A;  3KAD A;  3IKD A;  4ODK A;  1F8A B;  1FKG A;  4LAW A;  4ODP A;  2RSE A;  1BKF A;  1EQ3 A;  4U84 A;  3CGN A;  3VAW A;  1FKB A;  4DIP A;  1W26 A;  3O5K A;  2F4E A;  2ZR5 A;  3UI6 A;  4JFI A;  4IQ2 A;  2XP4 A;  4LAV A;  3CGM A;  4DRO A;  2KFW A;  3KAF A;  2FKE A;  3PRB A;  4U86 A;  2MLZ A;  4TW6 A;  1FKJ A;  4DRN A;  3O5D A;  3KAH A;  3ODK A;  5B8I C;  1ZCN A;  3O5J A;  1D7I A;  4FN2 A;  1FKF A;  5HWB A;  1J4R A;  4W9O A;  2KR7 A;  4IQC A;  1J6Y A;  1FKI A;  1FKK A;  2UZ5 A;  3FAP A;  4ODR A;  4DRH A;  2Q5A A;  4JYS A;  1KT0 A;  4TW8 A;  3O5G A;  4ITZ A;  4O2T A;  1NSG A;  4TX0 A;  4MGV A;  1D6O A;  3O5P A;  4JFM A;  3OOB A;  2ITK A;  2PPO A;  4G2P A;  5HT1 A;  3H9R B;  1U79 A;  2MNT A;  1NMW A;  3KAB A;  4GIV A;  2F21 A;  4TNS A;  4W9P A;  5DIT A;  1T11 A;  4DZ2 A;  1Q6U A;  2RUC A;  2VN1 A;  2RUQ A;  3RGC A;  5DIV A;  5I98 A;  2D9F A;  3UQI A;  2KO7 A;  2PBC A;  4ODQ A;  4DRQ A;  5HWC A;  2RUD A;  4G50 A;  1QPL A;  5HW6 A;  1JNT A;  4JFL A;  4N19 A;  3KAG A;  1FKL A; 
#chains in the Genus database with same CATH topology
 4ZPW R;  2DT1 A;  3TC5 A;  1N1A A;  1Q1C A;  1ROT A;  2IUZ A;  4WIW A;  4ODL A;  3ARO A;  3BXW A;  1HKJ A;  3CHD A;  3CZ8 A;  2WM0 A;  1W1V A;  3KCE A;  2P4V A;  2M1I A;  1C9H A;  4LGX A;  3FXY A;  4LAX A;  4S3J A;  2Y78 A;  2ZQV A;  3O5I A;  2A3E A;  3IHZ A;  3O5R A;  1QZ2 A;  1J4I A;  2F23 A;  1Y0O A;  3EY6 A;  2ZQT A;  1FJD A;  2PV3 A;  1OGB A;  3IKG A;  4ODO A;  4W9Q A;  3WD2 A;  3WQV A;  1W9P A;  1TCO C;  1D7H A;  3B8S A;  5DF0 A;  1NMV A;  1X6N A;  2KI3 A;  4JFJ A;  2JZV A;  2M08 A;  2XP3 A;  3O5M A;  2ZR4 A;  1FKT A;  3O5E A;  1K9T A;  4MPK A;  1HKI A;  1KT1 A;  5GPG A;  1FKD A;  2K8I A;  3IK8 A;  3JYM A;  3KAC A;  4MNK A;  2XP9 A;  1HJV A;  2XP7 A;  4IT4 A;  4BF8 A;  3OA5 A;  3B7X A;  3GU0 A;  3JXV A;  3FY1 A;  4P8W A;  1H0G A;  4ODK A;  4R5E A;  4ODP A;  2DT0 A;  3VAW A;  2F4E A;  4JFI A;  4IQ2 A;  1E6R A;  4LAV A;  4DRN A;  5GPR A;  3O5D A;  4WK9 A;  4FN2 A;  1D7I A;  1EIB A;  1J4R A;  4ODR A;  2Q5A A;  4JYS A;  4Z2G A;  3O5G A;  4ITZ A;  1UR8 A;  3AS3 A;  3GTY X;  3O5P A;  3OOB A;  4WJX A;  3ART A;  1WB0 A;  1U79 A;  4WKF A;  4GIV A;  1NMW A;  5DIT A;  3B9A A;  4TNS A;  2RUC A;  2RUQ A;  3WIJ A;  1NWR A;  4DRQ A;  4DWS D;  4L3N A;  3QOK A;  1ZBK A;  1QPL A;  4JFL A;  1QPF A;  1SR0 A;  4DT4 A;  1LG1 A;  1O6I A;  4FAP A;  1FAP A;  3UI4 A;  1CTN A;  1ZBC A;  3LUO A;  5HW7 A;  4ODM A;  4QIB A;  1FD9 A;  4HBO A;  3KAI A;  1ROU A;  1RD6 A;  4QT3 A;  4J4N A;  2KGJ A;  2XP5 A;  4DRK A;  4ML4 A;  2RQS A;  4C02 B;  4P8V A;  1Q6I A;  1X6L A;  1LL7 A;  2ESC A;  4LAY A;  3G6L A;  3UQA A;  1LJY A;  4AY1 A;  1PIN A;  4U85 A;  2XP8 A;  4DRI A;  2PV2 A;  4HAR A;  4P8U A;  4DRM A;  3WKZ A;  5J6E A;  1XHG A;  1M5Y A;  3KZ7 A;  1YAT A;  1NH6 A;  2MPH A;  3WD4 A;  1GRJ A;  1JVW A;  1LL4 A;  2FAP A;  4UDM A;  3RM8 A;  2M2A A;  1HKM A;  3NTP A;  1BL4 A;  1P5Q A;  3AS0 A;  4MNL A;  1ZL1 A;  4HBE A;  2MLY A;  3GPK A;  2N87 A;  2DG3 A;  3TCZ A;  3WH0 A;  2OFN A;  3UF8 A;  2XPA A;  3EIP A;  3O5L A;  4Z2I A;  4L72 B;  3ARY A;  2G8Z A;  4IPX A;  2LPV A;  2L2S A;  4JFK A;  3O5O A;  1J4H A;  1PBK A;  1OWQ A;  2O92 A;  1HJX A;  1BKF A;  5GQB A;  1EQ3 A;  4DIP A;  2A3B A;  4QZV B;  2ZR5 A;  1XRV A;  4DRO A;  2XP4 A;  3CGM A;  3KAF A;  3PRB A;  4TW6 A;  1FKJ A;  3WL1 A;  3ODK A;  5B8I C;  1EDQ A;  3O5J A;  1FKF A;  4W9O A;  4NZC A;  1FKI A;  1FKK A;  3FAP A;  1W1Y A;  1NWT A;  4DRH A;  1KT0 A;  1LG2 A;  3AQU A;  4TX0 A;  2YBU A;  4JFM A;  2WLZ A;  5HT1 A;  3ALG A;  1W9V A;  4W9P A;  1E44 A;  3ARQ A;  3PR9 A;  3ARX A;  5I98 A;  1HJW A;  2PBC A;  4ODQ A;  3ALF A;  5HWC A;  3WL0 A;  3RME A;  2O9O A;  2RUD A;  5HW6 A;  3WQW A;  3AS1 A;  1FKL A;  1JCH B;  1FKH A;  2YBT A;  3I6C A;  3RFW A;  4WKH A;  4TYO A;  1Q6H A;  1EYM A;  2B5U B;  1TFV A;  2EUL A;  1GOI A;  4DWS B;  2ZQS A;  1L1P A;  5HUA A;  4URI A;  4S3K A;  2IF4 A;  1E6Z A;  1JND A;  1HXV A;  3JYJ A;  4DRP A;  3CHC A;  4DZ3 A;  1LQ0 A;  4R0X A;  4NNR A;  4WKA A;  3NI6 A;  5HTG A;  1VF8 A;  5D75 A;  4XAK A;  2DG4 A;  2WLY A;  2F2D A;  2PPN A;  1JNS A;  1UR9 A;  3ARV A;  4Z2L A;  3PA7 A;  1ZU8 A;  4DRJ A;  4DH0 A;  2AWG A;  2DSU A;  2PI6 A;  1W9U A;  3O5Q A;  2KE0 A;  1ZB5 A;  4ZPV R;  2FDM A;  3NRK A;  2B31 A;  3ARR A;  3O5F A;  4MSP A;  4NSB A;  2DG9 A;  1B6C A;  1D7J A;  1H0I A;  1E9L A;  1FKB A;  1W1P A;  5JH8 A;  4U86 A;  2MLZ A;  3KAH A;  1E15 A;  3CH9 A;  1J6Y A;  2KR7 A;  4IQC A;  1IX5 A;  2UZ5 A;  3AS2 A;  3W4R A;  2DSZ A;  4Q7N A;  1NSG A;  1GPF A;  2QF8 A;  2ITK A;  2PPO A;  4G2P A;  2MNT A;  1T11 A;  4DZ2 A;  4P8X A;  2D9F A;  1ITX A;  2KO7 A;  5DEZ A;  1NWS A;  3CHE A;  2DPE A;  3KAG A;  1E6P A;  3G6M A;  1SYT A;  2PPP A;  4MNM A;  1FKS A;  2ZQU A;  2LKN A;  3ARS A;  2A3A A;  3WD1 A;  2DSW A;  4DWS A;  4DWS C;  1ZK6 A;  2ETN A;  4W5U A;  1F40 A;  3UQB A;  4PTM A;  3ARU A;  1YW5 A;  2XPB A;  4KR0 B;  5DIU A;  1W1T A;  2A3C A;  1NWU A;  3WD0 A;  4Q22 A;  1D2K A;  4Z2K A;  3TDB A;  2G41 A;  1FKR A;  3ARW A;  4GGQ A;  3ARZ A;  2ZR6 A;  1WAW A;  1JNE A;  2VCD A;  3RM9 A;  2MF9 A;  2DT2 A;  1WNO A;  5HKG A;  2RUR A;  4J4O A;  4Z2J A;  2XP6 A;  2DT3 A;  2PV1 A;  2MLX A;  1KFW A;  1E6N A;  2AOS A;  2LGO A;  4ZS6 A;  3ARP A;  3MDY B;  2LJ4 A;  1R9H A;  3PRA A;  1ZBV A;  1FFQ A;  4MTV A;  1A7X A;  3PRD A;  3UI5 A;  4TW7 A;  2PN0 A;  5BXJ A;  4Z2H A;  1ZBW A;  5HW8 A;  4QT2 A;  4ODN A;  1LL6 A;  3KAD A;  1EHN A;  1FFR A;  3IKD A;  1F8A B;  1FKG A;  2WK2 A;  4LAW A;  2RSE A;  4U84 A;  5DO2 A;  3CGN A;  1W26 A;  3O5K A;  3UI6 A;  1GUV A;  2KFW A;  4ZPT R;  2FKE A;  1OGG A;  1ZCN A;  4KQZ A;  5HWB A;  3B9D A;  1HKK A;  4TW8 A;  4O2T A;  3RM4 A;  4MGV A;  1D6O A;  2DSV A;  2OLH A;  4IT6 A;  3H9R B;  3BMB A;  4MNJ A;  3KAB A;  2F21 A;  1Q6U A;  2VN1 A;  3RGC A;  5DIV A;  3WD3 A;  3B9E A;  5HBF A;  3UQI A;  3CHF A;  4MAV A;  4G50 A;  1JNT A;  4N19 A; 
#chains in the Genus database with same CATH homology
 4ZPW R;  2DT1 A;  3TC5 A;  1N1A A;  1Q1C A;  1ROT A;  2IUZ A;  4WIW A;  4ODL A;  3ARO A;  3BXW A;  1HKJ A;  3CHD A;  3CZ8 A;  2WM0 A;  1W1V A;  3KCE A;  2M1I A;  1C9H A;  4LGX A;  3FXY A;  4LAX A;  4S3J A;  2Y78 A;  2ZQV A;  3O5I A;  2A3E A;  3IHZ A;  3O5R A;  1QZ2 A;  1J4I A;  1Y0O A;  3EY6 A;  2ZQT A;  1FJD A;  2PV3 A;  1OGB A;  3IKG A;  4ODO A;  4W9Q A;  3WD2 A;  3WQV A;  1W9P A;  1TCO C;  1D7H A;  3B8S A;  5DF0 A;  1NMV A;  1X6N A;  2KI3 A;  4JFJ A;  2JZV A;  2M08 A;  2XP3 A;  3O5M A;  2ZR4 A;  1FKT A;  3O5E A;  1K9T A;  4MPK A;  1HKI A;  1KT1 A;  5GPG A;  1FKD A;  2K8I A;  3IK8 A;  3JYM A;  3KAC A;  4MNK A;  2XP9 A;  1HJV A;  2XP7 A;  4IT4 A;  4BF8 A;  3OA5 A;  3B7X A;  3JXV A;  4P8W A;  3FY1 A;  1H0G A;  4ODK A;  4R5E A;  4ODP A;  2DT0 A;  3VAW A;  2F4E A;  4JFI A;  4IQ2 A;  1E6R A;  4LAV A;  4DRN A;  5GPR A;  3O5D A;  4WK9 A;  4FN2 A;  1D7I A;  1EIB A;  1J4R A;  4ODR A;  2Q5A A;  4JYS A;  4Z2G A;  3O5G A;  4ITZ A;  1UR8 A;  3AS3 A;  3O5P A;  3OOB A;  4WJX A;  3ART A;  1WB0 A;  1U79 A;  4WKF A;  4GIV A;  1NMW A;  5DIT A;  3B9A A;  4TNS A;  2RUC A;  2RUQ A;  3WIJ A;  1NWR A;  4DRQ A;  4DWS D;  4L3N A;  3QOK A;  1ZBK A;  1QPL A;  4JFL A;  1QPF A;  1SR0 A;  4DT4 A;  1LG1 A;  1O6I A;  4FAP A;  1FAP A;  3UI4 A;  1CTN A;  1ZBC A;  3LUO A;  5HW7 A;  4ODM A;  4QIB A;  1FD9 A;  4HBO A;  3KAI A;  1ROU A;  1RD6 A;  4QT3 A;  4J4N A;  2KGJ A;  2XP5 A;  4DRK A;  4ML4 A;  2RQS A;  4C02 B;  4P8V A;  1Q6I A;  1X6L A;  1LL7 A;  2ESC A;  4LAY A;  3G6L A;  3UQA A;  1LJY A;  4AY1 A;  1PIN A;  4U85 A;  2XP8 A;  4DRI A;  2PV2 A;  4HAR A;  4P8U A;  4DRM A;  3WKZ A;  5J6E A;  1XHG A;  1M5Y A;  3KZ7 A;  1YAT A;  1NH6 A;  2MPH A;  3WD4 A;  1JVW A;  1LL4 A;  2FAP A;  3RM8 A;  2M2A A;  1HKM A;  3NTP A;  1BL4 A;  1P5Q A;  3AS0 A;  4MNL A;  1ZL1 A;  4HBE A;  2MLY A;  3GPK A;  2N87 A;  2DG3 A;  3TCZ A;  3WH0 A;  2OFN A;  3UF8 A;  2XPA A;  3O5L A;  4Z2I A;  4L72 B;  3ARY A;  2G8Z A;  4IPX A;  2LPV A;  2L2S A;  4JFK A;  3O5O A;  1J4H A;  1PBK A;  1OWQ A;  2O92 A;  1HJX A;  1BKF A;  5GQB A;  1EQ3 A;  4DIP A;  2A3B A;  4QZV B;  2ZR5 A;  1XRV A;  4DRO A;  2XP4 A;  3CGM A;  3KAF A;  3PRB A;  4TW6 A;  1FKJ A;  3WL1 A;  3ODK A;  5B8I C;  1EDQ A;  3O5J A;  1FKF A;  4W9O A;  4NZC A;  1FKI A;  1FKK A;  3FAP A;  1W1Y A;  1NWT A;  4DRH A;  1KT0 A;  1LG2 A;  3AQU A;  4TX0 A;  2YBU A;  4JFM A;  2WLZ A;  5HT1 A;  3ALG A;  1W9V A;  4W9P A;  3ARQ A;  3PR9 A;  3ARX A;  5I98 A;  1HJW A;  2PBC A;  4ODQ A;  3ALF A;  5HWC A;  3WL0 A;  3RME A;  2O9O A;  2RUD A;  5HW6 A;  3WQW A;  3AS1 A;  1FKL A;  1FKH A;  2YBT A;  3I6C A;  3RFW A;  4WKH A;  4TYO A;  1Q6H A;  1EYM A;  1TFV A;  1GOI A;  4DWS B;  2ZQS A;  1L1P A;  5HUA A;  4URI A;  4S3K A;  2IF4 A;  1E6Z A;  1JND A;  1HXV A;  3JYJ A;  4DRP A;  3CHC A;  4DZ3 A;  1LQ0 A;  4R0X A;  4NNR A;  4WKA A;  3NI6 A;  5HTG A;  1VF8 A;  5D75 A;  4XAK A;  2DG4 A;  2WLY A;  2F2D A;  2PPN A;  1JNS A;  1UR9 A;  3ARV A;  4Z2L A;  3PA7 A;  1ZU8 A;  4DRJ A;  4DH0 A;  2AWG A;  2DSU A;  2PI6 A;  1W9U A;  3O5Q A;  2KE0 A;  1ZB5 A;  4ZPV R;  2FDM A;  3NRK A;  2B31 A;  3ARR A;  3O5F A;  4MSP A;  4NSB A;  2DG9 A;  1B6C A;  1D7J A;  1H0I A;  1E9L A;  1FKB A;  1W1P A;  5JH8 A;  4U86 A;  2MLZ A;  3KAH A;  1E15 A;  3CH9 A;  1J6Y A;  2KR7 A;  4IQC A;  1IX5 A;  2UZ5 A;  3AS2 A;  3W4R A;  2DSZ A;  4Q7N A;  1NSG A;  1GPF A;  2QF8 A;  2ITK A;  2PPO A;  4G2P A;  2MNT A;  1T11 A;  4DZ2 A;  4P8X A;  2D9F A;  1ITX A;  2KO7 A;  5DEZ A;  1NWS A;  3CHE A;  2DPE A;  3KAG A;  1E6P A;  3G6M A;  1SYT A;  2PPP A;  4MNM A;  1FKS A;  2ZQU A;  2LKN A;  3ARS A;  2A3A A;  3WD1 A;  2DSW A;  4DWS A;  4DWS C;  1ZK6 A;  4W5U A;  1F40 A;  3UQB A;  4PTM A;  3ARU A;  1YW5 A;  2XPB A;  4KR0 B;  5DIU A;  1W1T A;  2A3C A;  1NWU A;  3WD0 A;  4Q22 A;  1D2K A;  4Z2K A;  3TDB A;  2G41 A;  1FKR A;  3ARW A;  4GGQ A;  3ARZ A;  2ZR6 A;  1WAW A;  1JNE A;  2VCD A;  3RM9 A;  2MF9 A;  2DT2 A;  1WNO A;  5HKG A;  2RUR A;  4J4O A;  4Z2J A;  2XP6 A;  2DT3 A;  2PV1 A;  2MLX A;  1KFW A;  1E6N A;  2AOS A;  2LGO A;  4ZS6 A;  3ARP A;  3MDY B;  2LJ4 A;  1R9H A;  3PRA A;  1ZBV A;  1FFQ A;  4MTV A;  1A7X A;  3PRD A;  3UI5 A;  4TW7 A;  5BXJ A;  4Z2H A;  1ZBW A;  5HW8 A;  4QT2 A;  4ODN A;  1LL6 A;  3KAD A;  1EHN A;  1FFR A;  3IKD A;  1F8A B;  1FKG A;  2WK2 A;  4LAW A;  2RSE A;  4U84 A;  5DO2 A;  3CGN A;  1W26 A;  3O5K A;  3UI6 A;  1GUV A;  2KFW A;  4ZPT R;  2FKE A;  1OGG A;  1ZCN A;  4KQZ A;  5HWB A;  3B9D A;  1HKK A;  4TW8 A;  4O2T A;  3RM4 A;  4MGV A;  1D6O A;  2DSV A;  2OLH A;  4IT6 A;  3H9R B;  4MNJ A;  3KAB A;  2F21 A;  1Q6U A;  2VN1 A;  3RGC A;  5DIV A;  3WD3 A;  3B9E A;  5HBF A;  3UQI A;  3CHF A;  4MAV A;  4G50 A;  1JNT A;  4N19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...