4JYSA

Crystal structure of fkbp25 from plasmodium vivax
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
DKPYVKTESGILYKDLIDGEGDPIEEGDIVYIHYQGKTTNDFRIIHSTFNSIIPPKIRAGQYDQKHIRAIYEIVIGMKKHTRRQCVVPPHLAYPNHFPSQPLLYEIDVVKVVKKDSQGKTFIEKVEQKIDQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Plasmodium vivax FK506-binding protein 25 reveals conformational changes responsible for its noncanonical activity
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 30
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jysA00
1BKFA 2MLYA 2F2DA 4TX0A 2ZQSA 1FKJA 1D6OA 2XP7A 2ZQUA 1PINA 1R9HA 2DG3A 3NI6A 3NTPA 4IPXA 3JYMA 4ODKA 4DRKA 4ODQA 1D7JA 1J6YA 1QZ2A 3O5IA 5GPGA 2UZ5A 1TCOC 2XPAA 4JFLA 5D75A 4DRQA 4TNSA 1FJDA 2PPNA 5HT1A 2LKNA 4QIBA 1C9HA 4FAPA 2ZR4A 1Q6IA 3WH0A 1BL4A 2XP3A 1FKLA 3KZ7A 4DT4A 3IKGA 4GGQA 3O5FA 2N87A 2OFNA 2FKEA 1KT1A 1M5YA 1NMWA 3O5GA 2MF9A 4JFMA 5J6EA 1ROUA 3IHZA 1ZK6A 2XP5A 4JFIA 2XP9A 4DZ3A 3KAFA 1QPFA 2KGJA 3KCEA 3OOBA 4N19A 1P5QA 3KACA 2RURA 4LAWA 3JYJA 4LAYA 4W9QA 4BF8A 1YATA 4G50A 4W9PA 2DG4A 4TW6A 5HWBA 5HWCA 4LAXA 1J4HA 1ZCNA 4O2TA 4W9OA 2PPOA 1FKIA 2LJ4A 3O5DA 4TW8A 4DRMA 3RFWA 4U84A 2ZQTA 2L2SA 5DIVA 4DROA 5HTGA 1Q1CA 2KFWA 4DRNA 5HW6A 3O5RA 5B8IC 1U79A 4U86A 4J4OA 1T11A 3LUOA 5DIUA 4JFKA 4R0XA 2FAPA 2RUDA 3O5MA 1D7IA 2Q5AA 3KAGA 4DIPA 4G2PA 1FKKA 4U85A 3O5JA 5HKGA 2AWGA 1ROTA 2ITKA 1FKDA 4FN2A 2VN1A 1JNTA 3I6CA 2RQSA 2KI3A 2M08A 3MDYB 1EYMA 3TCZA 1PBKA 4JYSA 4ODNA 4QT3A 1QPLA 1W26A 4LAVA 1HXVA 2PV1A 3KAHA 4DRPA 3KADA 4IQ2A 2IF4A 1FKTA 5I98A 5DITA 2KE0A 3IKDA 4DRIA 3UQAA 1FKSA 1FKHA 2XP8A 2ZR6A 2KR7A 3PRDA 5HUAA 3EY6A 1N1AA 2D9FA 4J4NA 3UI5A 2PPPA 1JNSA 2RUQA 4C02B 1J4IA 2MPHA 3UQBA 2MLZA 4NNRA 2XP4A 2ZQVA 3KABA 3O5OA 4JFJA 4IQCA 2M2AA 2PV2A 3CGMA 2M1IA 3VAWA 2MLXA 1YW5A 4TW7A 4ODRA 1F8AB 2PV3A 2RSEA 1FKBA 4GIVA 3TDBA 3TC5A 2PBCA 2K8IA 1FAPA 2RUCA 3O5PA 3PA7A 4ODMA 1EQ3A 4MGVA 5HW8A 2Y78A 3GPKA 2ZR5A 3UI6A 2JZVA 3UQIA 1FKFA 2LGOA 4QT2A 2VCDA 3PRBA 1Y0OA 1JVWA 1A7XA 4DH0A 4DZ2A 2KO7A 4ODPA 3UI4A 1D7HA 1Q6UA 3O5EA 1F40A 2XP6A 3O5LA 4TYOA 4DRHA 5HW7A 3RGCA 4DRJA 1KT0A 4ODOA 1Q6HA 1FKGA 3JXVA 5BXJA 3IK8A 3KAIA 1L1PA 3NRKA 3ODKA 1B6CA 3FAPA 3O5KA 3O5QA 4MSPA 3UF8A 2MNTA 4ITZA 1FD9A 2LPVA 2XPBA 3B7XA 3H9RB 2DG9A 2F21A 1NSGA 3CGNA 4ODLA 1FKRA 1J4RA 1NMVA 2F4EA
chains in the Genus database with same CATH superfamily
1BKFA 2F2DA 1FKJA 1D6OA 2ZQUA 1PINA 2DG3A 4WIWA 3NTPA 3JYMA 1NWTA 1LL6A 2UZ5A 4DRQA 5HT1A 1C9HA 4FAPA 2ZR4A 1Q6IA 3OA5A 1ZL1A 1E6NA 2DT3A 4GGQA 4MTVA 2OFNA 5DF0A 2FKEA 3O5GA 4IT6A 2MF9A 4PTMA 3B9DA 4DZ3A 3FY1A 4W9QA 1NWUA 1YATA 1SR0A 4W9PA 4MNJA 4TW6A 5HWBA 1OGBA 1JNDA 4TW8A 4DRMA 3RFWA 4U84A 4Z2KA 1E15A 2L2SA 2ZQTA 4DRNA 4R5EA 3CZ8A 4WKFA 1D7IA 2DT0A 2P4VA 4G2PA 5GPRA 5HKGA 1FKDA 2DSWA 4LGXA 2M08A 1EYMA 3WQWA 1TFVA 4JYSA 1QPLA 1W26A 4P8WA 4MNMA 5I98A 3UQAA 1FKSA 2XP8A 2KR7A 4P8UA 3EY6A 4MAVA 1HKMA 3RMEA 3B9AA 3RM9A 2XP4A 4JFJA 2ETNA 3ARZA 2M2AA 3VAWA 1YW5A 4TW7A 4ODRA 1JCHB 3TC5A 2PBCA 2RUCA 1FAPA 3O5PA 4DWSD 2JZVA 3ARWA 1JVWA 3ARPA 1OGGA 2A3CA 3PRAA 2XP6A 4TYOA 3AS1A 1NWSA 3RGCA 4DRJA 3CHCA 4MNLA 5BXJA 1SYTA 4WK9A 3O5QA 4MSPA 3ALFA 2MNTA 4ITZA 1FD9A 1LL7A 2LPVA 3B7XA 4ODLA 2DG9A 1H0GA 3UQBA 1GRJA 4TX0A 2ZQSA 4IPXA 1R9HA 2DSVA 1W1YA 1HJXA 1RD6A 1J6YA 1E9LA 4TNSA 3ARUA 4QIBA 3WH0A 1BL4A 3WKZA 3WD1A 1HJVA 4JFMA 1GOIA 4JFIA 4S3JA 3KAFA 4N19A 3KACA 4BF8A 4G50A 2DG4A 4LAXA 4W9OA 2PPOA 2DT1A 4AY1A 1Q1CA 1LG2A 2FAPA 2RUDA 3WD3A 1FKKA 1VF8A 1UR8A 2AWGA 4FN2A 2VN1A 3TCZA 3B9EA 3WQVA 1FFQA 3WL0A 4LAVA 4IQ2A 2KE0A 3IKDA 4DRIA 2F23A 2PPPA 4P8VA 2RUQA 2MLZA 2ZQVA 3O5OA 2PV2A 3CGMA 2M1IA 4P8XA 1KFWA 1F8AB 2PV3A 3FXYA 2RSEA 5GQBA 4Z2IA 1LL4A 1EHNA 3PA7A 4ODMA 4MGVA 1NWRA 3UI6A 2LGOA 4QT2A 2VCDA 3PRBA 1HKKA 2KO7A 1EDQA 1Q6UA 3O5LA 5HW7A 3AS3A 4WKHA 4ODOA 1Q6HA 1W9PA 2ESCA 3ARSA 1E6ZA 1UR9A 2WLYA 4KQZA 3PR9A 3B8SA 4NZCA 4MPKA 2F21A 2XPBA 1NSGA 3H9RB 1NMVA 2F4EA 2MLYA 3KAIA 3RM8A 4ODKA 3NI6A 1ZBCA 4Q7NA 4UDMA 1W1VA 4DRKA 1QZ2A 3O5IA 2XPAA 5D75A 2PPNA 2YBUA 4ZS6A 4Q22A 1CTNA 5HBFA 3AROA 3IKGA 3O5FA 2N87A 5DO2A 1KT1A 1NMWA 1ROUA 4KR0B 1ZK6A 4HARA 2XP9A 1QPFA 2KGJA 3KCEA 3G6MA 1P5QA 2RURA 4LAWA 3JYJA 4LAYA 1J4HA 1OWQA 1WB0A 1FKIA 2LJ4A 3O5DA 1IX5A 5HTGA 4DROA 5HW6A 3O5RA 5B8IC 1U79A 4U86A 4J4OA 3O5MA 4DIPA 1HKIA 4U85A 1E44A 3ARVA 1X6NA 3AS0A 3I6CA 4IT4A 4DWSC 2RQSA 2KI3A 2B5UB 4ODNA 4QT3A 1HKJA 4Z2HA 3ARXA 1HXVA 1WNOA 2PV1A 3BXWA 1X6LA 3KAHA 5DITA 4ZPTR 1FKHA 2YBTA 1K9TA 4J4NA 4ZPVR 3UI5A 1JNSA 4L72B 4NNRA 3GTYX 2DSZA 2MLXA 1FKBA 4HBEA 4GIVA 3TDBA 4Z2JA 1LG1A 2WM0A 1FKFA 4S3KA 5DEZA 3W4RA 1Y0OA 1ZB5A 1E6PA 2FDMA 1ZBWA 3ARYA 1O6IA 2AOSA 3UI4A 1D7HA 3O5EA 5JH8A 1F40A 4Z2GA 2DT2A 1KT0A 3QOKA 3JXVA 3IK8A 1L1PA 3ODKA 2A3AA 3CHDA 1FKRA 1LJYA 2PN0A 3CGNA 1J4RA 4JFKA 3ALGA 2WK2A 2IUZA 2XP7A 4ZPWR 1D2KA 2O9OA 4ODQA 1D7JA 5GPGA 2EULA 4WKAA 1TCOC 4JFLA 4URIA 4HBOA 1FJDA 2LKNA 1HJWA 1W1TA 4XAKA 2XP3A 1FKLA 4WJXA 3KZ7A 3WL1A 4L3NA 2G41A 1M5YA 3ARTA 5J6EA 4DWSA 1NH6A 2O92A 3BMBA 3IHZA 2XP5A 3GU0A 3OOBA 2A3BA 3G6LA 3WIJA 4MNKA 3CHEA 2OLHA 5HWCA 1EIBA 1ZCNA 1E6RA 4O2TA 2QF8A 3ARQA 1W9UA 5DIVA 2KFWA 1W1PA 3EIPA 1T11A 3LUOA 1LQ0A 2DPEA 5DIUA 4R0XA 3WD0A 2Q5AA 3KAGA 1FFRA 2PI6A 3O5JA 1ROTA 2ITKA 1W9VA 1JNTA 4NSBA 3AS2A 3MDYB 4W5UA 1GUVA 1PBKA 1ZBVA 1GPFA 4DRPA 3KADA 2IF4A 1FKTA 1JNEA 3RM4A 2ZR6A 3CHFA 3PRDA 5HUAA 1N1AA 2D9FA 1ITXA 4Z2LA 4C02B 1J4IA 2MPHA 3KABA 1XRVA 4IQCA 1XHGA 4QZVB 1ZBKA 1WAWA 2K8IA 1EQ3A 5HW8A 4ML4A 2Y78A 1ZU8A 3GPKA 2ZR5A 3UQIA 3WD4A 2G8ZA 3AQUA 1A7XA 1H0IA 4DH0A 2B31A 4DZ2A 4ODPA 2WLZA 1FKGA 2DSUA 2A3EA 3NRKA 1B6CA 3WD2A 3FAPA 3O5KA 3UF8A 3ARRA 4DWSB 4DT4A 3CH9A 4DRHA
chains in the Genus database with same CATH topology
1BKFA 2F2DA 1FKJA 1D6OA 2ZQUA 1PINA 2DG3A 4WIWA 3NTPA 3JYMA 1NWTA 1LL6A 2UZ5A 4DRQA 5HT1A 1C9HA 4FAPA 2ZR4A 1Q6IA 3OA5A 1ZL1A 1E6NA 2DT3A 4GGQA 4MTVA 2OFNA 5DF0A 2FKEA 3O5GA 4IT6A 2MF9A 4PTMA 3B9DA 4DZ3A 3FY1A 4W9QA 1NWUA 1YATA 1SR0A 4W9PA 4MNJA 4TW6A 5HWBA 1OGBA 1JNDA 4TW8A 4DRMA 3RFWA 4U84A 4Z2KA 1E15A 2L2SA 2ZQTA 4DRNA 4R5EA 3CZ8A 4WKFA 1D7IA 2DT0A 4G2PA 5GPRA 5HKGA 1FKDA 2DSWA 4LGXA 2M08A 1EYMA 3WQWA 1TFVA 4JYSA 1QPLA 1W26A 4P8WA 4MNMA 5I98A 3UQAA 1FKSA 2XP8A 2KR7A 4P8UA 3EY6A 4MAVA 1HKMA 3RMEA 3B9AA 3RM9A 2XP4A 4JFJA 3ARZA 2M2AA 3VAWA 1YW5A 4TW7A 4ODRA 3TC5A 2PBCA 2RUCA 1FAPA 3O5PA 4DWSD 2JZVA 3ARWA 1JVWA 3ARPA 1OGGA 2A3CA 3PRAA 2XP6A 4TYOA 3AS1A 1NWSA 3RGCA 4DRJA 3CHCA 4MNLA 5BXJA 1SYTA 4WK9A 3O5QA 4MSPA 3ALFA 2MNTA 4ITZA 1FD9A 1LL7A 2LPVA 3B7XA 4ODLA 2DG9A 1H0GA 3UQBA 4TX0A 2ZQSA 4IPXA 1R9HA 2DSVA 1W1YA 1HJXA 1RD6A 1J6YA 1E9LA 4TNSA 3ARUA 4QIBA 3WH0A 1BL4A 3WKZA 3WD1A 1HJVA 4JFMA 1GOIA 4JFIA 4S3JA 3KAFA 4N19A 3KACA 4BF8A 4G50A 2DG4A 4LAXA 4W9OA 2PPOA 2DT1A 4AY1A 1Q1CA 1LG2A 2FAPA 2RUDA 3WD3A 1FKKA 1VF8A 1UR8A 2AWGA 4FN2A 2VN1A 3TCZA 3B9EA 3WQVA 1FFQA 3WL0A 4LAVA 4IQ2A 2KE0A 3IKDA 4DRIA 2PPPA 4P8VA 2RUQA 2MLZA 2ZQVA 3O5OA 2PV2A 3CGMA 2M1IA 4P8XA 1KFWA 1F8AB 2PV3A 3FXYA 2RSEA 5GQBA 4Z2IA 1LL4A 1EHNA 3PA7A 4ODMA 4MGVA 1NWRA 3UI6A 2LGOA 4QT2A 2VCDA 3PRBA 1HKKA 2KO7A 1EDQA 1Q6UA 3O5LA 5HW7A 3AS3A 4WKHA 4ODOA 1Q6HA 1W9PA 2ESCA 3ARSA 1E6ZA 1UR9A 2WLYA 4KQZA 3PR9A 3B8SA 4NZCA 4MPKA 2F21A 2XPBA 1NSGA 3H9RB 1NMVA 2F4EA 2MLYA 3KAIA 3RM8A 4ODKA 3NI6A 1ZBCA 4Q7NA 1W1VA 4DRKA 1QZ2A 3O5IA 2XPAA 5D75A 2PPNA 2YBUA 4ZS6A 4Q22A 1CTNA 5HBFA 3AROA 3IKGA 3O5FA 2N87A 5DO2A 1KT1A 1NMWA 1ROUA 4KR0B 1ZK6A 4HARA 2XP9A 1QPFA 2KGJA 3KCEA 3G6MA 1P5QA 2RURA 4LAWA 3JYJA 4LAYA 1J4HA 1OWQA 1WB0A 1FKIA 2LJ4A 3O5DA 1IX5A 5HTGA 4DROA 5HW6A 3O5RA 5B8IC 1U79A 4U86A 4J4OA 3O5MA 4DIPA 1HKIA 4U85A 3ARVA 1X6NA 3AS0A 3I6CA 4IT4A 4DWSC 2RQSA 2KI3A 4ODNA 4QT3A 1HKJA 4Z2HA 3ARXA 1HXVA 1WNOA 2PV1A 3BXWA 1X6LA 3KAHA 5DITA 4ZPTR 1FKHA 2YBTA 1K9TA 4J4NA 4ZPVR 3UI5A 1JNSA 4L72B 4NNRA 2DSZA 2MLXA 1FKBA 4HBEA 4GIVA 3TDBA 4Z2JA 1LG1A 2WM0A 1FKFA 4S3KA 5DEZA 3W4RA 1Y0OA 1ZB5A 1E6PA 2FDMA 1ZBWA 3ARYA 1O6IA 2AOSA 3UI4A 1D7HA 3O5EA 5JH8A 1F40A 4Z2GA 2DT2A 1KT0A 3QOKA 3JXVA 3IK8A 1L1PA 3ODKA 2A3AA 3CHDA 1FKRA 1LJYA 3CGNA 4JFKA 1J4RA 3ALGA 2WK2A 2IUZA 2XP7A 4ZPWR 1D2KA 2O9OA 4ODQA 1D7JA 5GPGA 4WKAA 1TCOC 4JFLA 4URIA 4HBOA 1FJDA 2LKNA 1HJWA 1W1TA 4XAKA 2XP3A 1FKLA 4WJXA 3KZ7A 3WL1A 4L3NA 2G41A 1M5YA 3ARTA 5J6EA 4DWSA 1NH6A 2O92A 3IHZA 2XP5A 3OOBA 2A3BA 3G6LA 3WIJA 4MNKA 3CHEA 2OLHA 5HWCA 1EIBA 1ZCNA 1E6RA 4O2TA 2QF8A 3ARQA 1W9UA 5DIVA 2KFWA 1W1PA 1T11A 3LUOA 1LQ0A 2DPEA 5DIUA 4R0XA 3WD0A 2Q5AA 3KAGA 1FFRA 2PI6A 3O5JA 1ROTA 2ITKA 1W9VA 1JNTA 4NSBA 3AS2A 3MDYB 4W5UA 1GUVA 1PBKA 1ZBVA 1GPFA 4DRPA 3KADA 2IF4A 1FKTA 1JNEA 3RM4A 2ZR6A 3CHFA 3PRDA 5HUAA 1N1AA 2D9FA 1ITXA 4Z2LA 4C02B 1J4IA 2MPHA 3KABA 1XRVA 4IQCA 1XHGA 4QZVB 1ZBKA 1WAWA 2K8IA 1EQ3A 5HW8A 4ML4A 2Y78A 1ZU8A 3GPKA 2ZR5A 3UQIA 3WD4A 2G8ZA 3AQUA 1A7XA 1H0IA 4DH0A 2B31A 4DZ2A 4ODPA 2WLZA 1FKGA 2DSUA 2A3EA 3NRKA 1B6CA 3WD2A 3FAPA 3O5KA 3UF8A 3ARRA 4DWSB 4DT4A 3CH9A 4DRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKF A;  2MLY A;  2F2D A;  4TX0 A;  2ZQS A;  1FKJ A;  1D6O A;  2XP7 A;  2ZQU A;  1PIN A;  1R9H A;  2DG3 A;  3NI6 A;  3NTP A;  4IPX A;  3JYM A;  4ODK A;  4DRK A;  4ODQ A;  1D7J A;  1J6Y A;  1QZ2 A;  3O5I A;  5GPG A;  2UZ5 A;  1TCO C;  2XPA A;  4JFL A;  5D75 A;  4DRQ A;  4TNS A;  1FJD A;  2PPN A;  5HT1 A;  2LKN A;  4QIB A;  1C9H A;  4FAP A;  2ZR4 A;  1Q6I A;  3WH0 A;  1BL4 A;  2XP3 A;  1FKL A;  3KZ7 A;  4DT4 A;  3IKG A;  4GGQ A;  3O5F A;  2N87 A;  2OFN A;  2FKE A;  1KT1 A;  1M5Y A;  1NMW A;  3O5G A;  2MF9 A;  4JFM A;  5J6E A;  1ROU A;  3IHZ A;  1ZK6 A;  2XP5 A;  4JFI A;  2XP9 A;  4DZ3 A;  3KAF A;  1QPF A;  2KGJ A;  3KCE A;  3OOB A;  4N19 A;  1P5Q A;  3KAC A;  2RUR A;  4LAW A;  3JYJ A;  4LAY A;  4W9Q A;  4BF8 A;  1YAT A;  4G50 A;  4W9P A;  2DG4 A;  4TW6 A;  5HWB A;  5HWC A;  4LAX A;  1J4H A;  1ZCN A;  4O2T A;  4W9O A;  2PPO A;  1FKI A;  2LJ4 A;  3O5D A;  4TW8 A;  4DRM A;  3RFW A;  4U84 A;  2ZQT A;  2L2S A;  5DIV A;  4DRO A;  5HTG A;  1Q1C A;  2KFW A;  4DRN A;  5HW6 A;  3O5R A;  5B8I C;  1U79 A;  4U86 A;  4J4O A;  1T11 A;  3LUO A;  5DIU A;  4JFK A;  4R0X A;  2FAP A;  2RUD A;  3O5M A;  1D7I A;  2Q5A A;  3KAG A;  4DIP A;  4G2P A;  1FKK A;  4U85 A;  3O5J A;  5HKG A;  2AWG A;  1ROT A;  2ITK A;  1FKD A;  4FN2 A;  2VN1 A;  1JNT A;  3I6C A;  2RQS A;  2KI3 A;  2M08 A;  3MDY B;  1EYM A;  3TCZ A;  1PBK A;  4JYS A;  4ODN A;  4QT3 A;  1QPL A;  1W26 A;  4LAV A;  1HXV A;  2PV1 A;  3KAH A;  4DRP A;  3KAD A;  4IQ2 A;  2IF4 A;  1FKT A;  5I98 A;  5DIT A;  2KE0 A;  3IKD A;  4DRI A;  3UQA A;  1FKS A;  1FKH A;  2XP8 A;  2ZR6 A;  2KR7 A;  3PRD A;  5HUA A;  3EY6 A;  1N1A A;  2D9F A;  4J4N A;  3UI5 A;  2PPP A;  1JNS A;  2RUQ A;  4C02 B;  1J4I A;  2MPH A;  3UQB A;  2MLZ A;  4NNR A;  2XP4 A;  2ZQV A;  3KAB A;  3O5O A;  4JFJ A;  4IQC A;  2M2A A;  2PV2 A;  3CGM A;  2M1I A;  3VAW A;  2MLX A;  1YW5 A;  4TW7 A;  4ODR A;  1F8A B;  2PV3 A;  2RSE A;  1FKB A;  4GIV A;  3TDB A;  3TC5 A;  2PBC A;  2K8I A;  1FAP A;  2RUC A;  3O5P A;  3PA7 A;  4ODM A;  1EQ3 A;  4MGV A;  5HW8 A;  2Y78 A;  3GPK A;  2ZR5 A;  3UI6 A;  2JZV A;  3UQI A;  1FKF A;  2LGO A;  4QT2 A;  2VCD A;  3PRB A;  1Y0O A;  1JVW A;  1A7X A;  4DH0 A;  4DZ2 A;  2KO7 A;  4ODP A;  3UI4 A;  1D7H A;  1Q6U A;  3O5E A;  1F40 A;  2XP6 A;  3O5L A;  4TYO A;  4DRH A;  5HW7 A;  3RGC A;  4DRJ A;  1KT0 A;  4ODO A;  1Q6H A;  1FKG A;  3JXV A;  5BXJ A;  3IK8 A;  3KAI A;  1L1P A;  3NRK A;  3ODK A;  1B6C A;  3FAP A;  3O5K A;  3O5Q A;  4MSP A;  3UF8 A;  2MNT A;  4ITZ A;  1FD9 A;  2LPV A;  2XPB A;  3B7X A;  3H9R B;  2DG9 A;  2F21 A;  1NSG A;  3CGN A;  4ODL A;  1FKR A;  1J4R A;  1NMV A;  2F4E A; 
#chains in the Genus database with same CATH topology
 1BKF A;  2F2D A;  1FKJ A;  1D6O A;  2ZQU A;  1PIN A;  2DG3 A;  4WIW A;  3NTP A;  3JYM A;  1NWT A;  1LL6 A;  2UZ5 A;  4DRQ A;  5HT1 A;  1C9H A;  4FAP A;  2ZR4 A;  1Q6I A;  3OA5 A;  1ZL1 A;  1E6N A;  2DT3 A;  4GGQ A;  4MTV A;  2OFN A;  5DF0 A;  2FKE A;  3O5G A;  4IT6 A;  2MF9 A;  4PTM A;  3B9D A;  4DZ3 A;  3FY1 A;  4W9Q A;  1NWU A;  1YAT A;  1SR0 A;  4W9P A;  4MNJ A;  4TW6 A;  5HWB A;  1OGB A;  1JND A;  4TW8 A;  4DRM A;  3RFW A;  4U84 A;  4Z2K A;  1E15 A;  2L2S A;  2ZQT A;  4DRN A;  4R5E A;  3CZ8 A;  4WKF A;  1D7I A;  2DT0 A;  2P4V A;  4G2P A;  5GPR A;  5HKG A;  1FKD A;  2DSW A;  4LGX A;  2M08 A;  1EYM A;  3WQW A;  1TFV A;  4JYS A;  1QPL A;  1W26 A;  4P8W A;  4MNM A;  5I98 A;  3UQA A;  1FKS A;  2XP8 A;  2KR7 A;  4P8U A;  3EY6 A;  4MAV A;  1HKM A;  3RME A;  3B9A A;  3RM9 A;  2XP4 A;  4JFJ A;  2ETN A;  3ARZ A;  2M2A A;  3VAW A;  1YW5 A;  4TW7 A;  4ODR A;  1JCH B;  3TC5 A;  2PBC A;  2RUC A;  1FAP A;  3O5P A;  4DWS D;  2JZV A;  3ARW A;  1JVW A;  3ARP A;  1OGG A;  2A3C A;  3PRA A;  2XP6 A;  4TYO A;  3AS1 A;  1NWS A;  3RGC A;  4DRJ A;  3CHC A;  4MNL A;  5BXJ A;  1SYT A;  4WK9 A;  3O5Q A;  4MSP A;  3ALF A;  2MNT A;  4ITZ A;  1FD9 A;  1LL7 A;  2LPV A;  3B7X A;  4ODL A;  2DG9 A;  1H0G A;  3UQB A;  1GRJ A;  4TX0 A;  2ZQS A;  4IPX A;  1R9H A;  2DSV A;  1W1Y A;  1HJX A;  1RD6 A;  1J6Y A;  1E9L A;  4TNS A;  3ARU A;  4QIB A;  3WH0 A;  1BL4 A;  3WKZ A;  3WD1 A;  1HJV A;  4JFM A;  1GOI A;  4JFI A;  4S3J A;  3KAF A;  4N19 A;  3KAC A;  4BF8 A;  4G50 A;  2DG4 A;  4LAX A;  4W9O A;  2PPO A;  2DT1 A;  4AY1 A;  1Q1C A;  1LG2 A;  2FAP A;  2RUD A;  3WD3 A;  1FKK A;  1VF8 A;  1UR8 A;  2AWG A;  4FN2 A;  2VN1 A;  3TCZ A;  3B9E A;  3WQV A;  1FFQ A;  3WL0 A;  4LAV A;  4IQ2 A;  2KE0 A;  3IKD A;  4DRI A;  2F23 A;  2PPP A;  4P8V A;  2RUQ A;  2MLZ A;  2ZQV A;  3O5O A;  2PV2 A;  3CGM A;  2M1I A;  4P8X A;  1KFW A;  1F8A B;  2PV3 A;  3FXY A;  2RSE A;  5GQB A;  4Z2I A;  1LL4 A;  1EHN A;  3PA7 A;  4ODM A;  4MGV A;  1NWR A;  3UI6 A;  2LGO A;  4QT2 A;  2VCD A;  3PRB A;  1HKK A;  2KO7 A;  1EDQ A;  1Q6U A;  3O5L A;  5HW7 A;  3AS3 A;  4WKH A;  4ODO A;  1Q6H A;  1W9P A;  2ESC A;  3ARS A;  1E6Z A;  1UR9 A;  2WLY A;  4KQZ A;  3PR9 A;  3B8S A;  4NZC A;  4MPK A;  2F21 A;  2XPB A;  1NSG A;  3H9R B;  1NMV A;  2F4E A;  2MLY A;  3KAI A;  3RM8 A;  4ODK A;  3NI6 A;  1ZBC A;  4Q7N A;  4UDM A;  1W1V A;  4DRK A;  1QZ2 A;  3O5I A;  2XPA A;  5D75 A;  2PPN A;  2YBU A;  4ZS6 A;  4Q22 A;  1CTN A;  5HBF A;  3ARO A;  3IKG A;  3O5F A;  2N87 A;  5DO2 A;  1KT1 A;  1NMW A;  1ROU A;  4KR0 B;  1ZK6 A;  4HAR A;  2XP9 A;  1QPF A;  2KGJ A;  3KCE A;  3G6M A;  1P5Q A;  2RUR A;  4LAW A;  3JYJ A;  4LAY A;  1J4H A;  1OWQ A;  1WB0 A;  1FKI A;  2LJ4 A;  3O5D A;  1IX5 A;  5HTG A;  4DRO A;  5HW6 A;  3O5R A;  5B8I C;  1U79 A;  4U86 A;  4J4O A;  3O5M A;  4DIP A;  1HKI A;  4U85 A;  1E44 A;  3ARV A;  1X6N A;  3AS0 A;  3I6C A;  4IT4 A;  4DWS C;  2RQS A;  2KI3 A;  2B5U B;  4ODN A;  4QT3 A;  1HKJ A;  4Z2H A;  3ARX A;  1HXV A;  1WNO A;  2PV1 A;  3BXW A;  1X6L A;  3KAH A;  5DIT A;  4ZPT R;  1FKH A;  2YBT A;  1K9T A;  4J4N A;  4ZPV R;  3UI5 A;  1JNS A;  4L72 B;  4NNR A;  3GTY X;  2DSZ A;  2MLX A;  1FKB A;  4HBE A;  4GIV A;  3TDB A;  4Z2J A;  1LG1 A;  2WM0 A;  1FKF A;  4S3K A;  5DEZ A;  3W4R A;  1Y0O A;  1ZB5 A;  1E6P A;  2FDM A;  1ZBW A;  3ARY A;  1O6I A;  2AOS A;  3UI4 A;  1D7H A;  3O5E A;  5JH8 A;  1F40 A;  4Z2G A;  2DT2 A;  1KT0 A;  3QOK A;  3JXV A;  3IK8 A;  1L1P A;  3ODK A;  2A3A A;  3CHD A;  1FKR A;  1LJY A;  2PN0 A;  3CGN A;  1J4R A;  4JFK A;  3ALG A;  2WK2 A;  2IUZ A;  2XP7 A;  4ZPW R;  1D2K A;  2O9O A;  4ODQ A;  1D7J A;  5GPG A;  2EUL A;  4WKA A;  1TCO C;  4JFL A;  4URI A;  4HBO A;  1FJD A;  2LKN A;  1HJW A;  1W1T A;  4XAK A;  2XP3 A;  1FKL A;  4WJX A;  3KZ7 A;  3WL1 A;  4L3N A;  2G41 A;  1M5Y A;  3ART A;  5J6E A;  4DWS A;  1NH6 A;  2O92 A;  3BMB A;  3IHZ A;  2XP5 A;  3GU0 A;  3OOB A;  2A3B A;  3G6L A;  3WIJ A;  4MNK A;  3CHE A;  2OLH A;  5HWC A;  1EIB A;  1ZCN A;  1E6R A;  4O2T A;  2QF8 A;  3ARQ A;  1W9U A;  5DIV A;  2KFW A;  1W1P A;  3EIP A;  1T11 A;  3LUO A;  1LQ0 A;  2DPE A;  5DIU A;  4R0X A;  3WD0 A;  2Q5A A;  3KAG A;  1FFR A;  2PI6 A;  3O5J A;  1ROT A;  2ITK A;  1W9V A;  1JNT A;  4NSB A;  3AS2 A;  3MDY B;  4W5U A;  1GUV A;  1PBK A;  1ZBV A;  1GPF A;  4DRP A;  3KAD A;  2IF4 A;  1FKT A;  1JNE A;  3RM4 A;  2ZR6 A;  3CHF A;  3PRD A;  5HUA A;  1N1A A;  2D9F A;  1ITX A;  4Z2L A;  4C02 B;  1J4I A;  2MPH A;  3KAB A;  1XRV A;  4IQC A;  1XHG A;  4QZV B;  1ZBK A;  1WAW A;  2K8I A;  1EQ3 A;  5HW8 A;  4ML4 A;  2Y78 A;  1ZU8 A;  3GPK A;  2ZR5 A;  3UQI A;  3WD4 A;  2G8Z A;  3AQU A;  1A7X A;  1H0I A;  4DH0 A;  2B31 A;  4DZ2 A;  4ODP A;  2WLZ A;  1FKG A;  2DSU A;  2A3E A;  3NRK A;  1B6C A;  3WD2 A;  3FAP A;  3O5K A;  3UF8 A;  3ARR A;  4DWS B;  4DT4 A;  3CH9 A;  4DRH A; 
#chains in the Genus database with same CATH homology
 1BKF A;  2F2D A;  1FKJ A;  1D6O A;  2ZQU A;  1PIN A;  2DG3 A;  4WIW A;  3NTP A;  3JYM A;  1NWT A;  1LL6 A;  2UZ5 A;  4DRQ A;  5HT1 A;  1C9H A;  4FAP A;  2ZR4 A;  1Q6I A;  3OA5 A;  1ZL1 A;  1E6N A;  2DT3 A;  4GGQ A;  4MTV A;  2OFN A;  5DF0 A;  2FKE A;  3O5G A;  4IT6 A;  2MF9 A;  4PTM A;  3B9D A;  4DZ3 A;  3FY1 A;  4W9Q A;  1NWU A;  1YAT A;  1SR0 A;  4W9P A;  4MNJ A;  4TW6 A;  5HWB A;  1OGB A;  1JND A;  4TW8 A;  4DRM A;  3RFW A;  4U84 A;  4Z2K A;  1E15 A;  2L2S A;  2ZQT A;  4DRN A;  4R5E A;  3CZ8 A;  4WKF A;  1D7I A;  2DT0 A;  4G2P A;  5GPR A;  5HKG A;  1FKD A;  2DSW A;  4LGX A;  2M08 A;  1EYM A;  3WQW A;  1TFV A;  4JYS A;  1QPL A;  1W26 A;  4P8W A;  4MNM A;  5I98 A;  3UQA A;  1FKS A;  2XP8 A;  2KR7 A;  4P8U A;  3EY6 A;  4MAV A;  1HKM A;  3RME A;  3B9A A;  3RM9 A;  2XP4 A;  4JFJ A;  3ARZ A;  2M2A A;  3VAW A;  1YW5 A;  4TW7 A;  4ODR A;  3TC5 A;  2PBC A;  2RUC A;  1FAP A;  3O5P A;  4DWS D;  2JZV A;  3ARW A;  1JVW A;  3ARP A;  1OGG A;  2A3C A;  3PRA A;  2XP6 A;  4TYO A;  3AS1 A;  1NWS A;  3RGC A;  4DRJ A;  3CHC A;  4MNL A;  5BXJ A;  1SYT A;  4WK9 A;  3O5Q A;  4MSP A;  3ALF A;  2MNT A;  4ITZ A;  1FD9 A;  1LL7 A;  2LPV A;  3B7X A;  4ODL A;  2DG9 A;  1H0G A;  3UQB A;  4TX0 A;  2ZQS A;  4IPX A;  1R9H A;  2DSV A;  1W1Y A;  1HJX A;  1RD6 A;  1J6Y A;  1E9L A;  4TNS A;  3ARU A;  4QIB A;  3WH0 A;  1BL4 A;  3WKZ A;  3WD1 A;  1HJV A;  4JFM A;  1GOI A;  4JFI A;  4S3J A;  3KAF A;  4N19 A;  3KAC A;  4BF8 A;  4G50 A;  2DG4 A;  4LAX A;  4W9O A;  2PPO A;  2DT1 A;  4AY1 A;  1Q1C A;  1LG2 A;  2FAP A;  2RUD A;  3WD3 A;  1FKK A;  1VF8 A;  1UR8 A;  2AWG A;  4FN2 A;  2VN1 A;  3TCZ A;  3B9E A;  3WQV A;  1FFQ A;  3WL0 A;  4LAV A;  4IQ2 A;  2KE0 A;  3IKD A;  4DRI A;  2PPP A;  4P8V A;  2RUQ A;  2MLZ A;  2ZQV A;  3O5O A;  2PV2 A;  3CGM A;  2M1I A;  4P8X A;  1KFW A;  1F8A B;  2PV3 A;  3FXY A;  2RSE A;  5GQB A;  4Z2I A;  1LL4 A;  1EHN A;  3PA7 A;  4ODM A;  4MGV A;  1NWR A;  3UI6 A;  2LGO A;  4QT2 A;  2VCD A;  3PRB A;  1HKK A;  2KO7 A;  1EDQ A;  1Q6U A;  3O5L A;  5HW7 A;  3AS3 A;  4WKH A;  4ODO A;  1Q6H A;  1W9P A;  2ESC A;  3ARS A;  1E6Z A;  1UR9 A;  2WLY A;  4KQZ A;  3PR9 A;  3B8S A;  4NZC A;  4MPK A;  2F21 A;  2XPB A;  1NSG A;  3H9R B;  1NMV A;  2F4E A;  2MLY A;  3KAI A;  3RM8 A;  4ODK A;  3NI6 A;  1ZBC A;  4Q7N A;  1W1V A;  4DRK A;  1QZ2 A;  3O5I A;  2XPA A;  5D75 A;  2PPN A;  2YBU A;  4ZS6 A;  4Q22 A;  1CTN A;  5HBF A;  3ARO A;  3IKG A;  3O5F A;  2N87 A;  5DO2 A;  1KT1 A;  1NMW A;  1ROU A;  4KR0 B;  1ZK6 A;  4HAR A;  2XP9 A;  1QPF A;  2KGJ A;  3KCE A;  3G6M A;  1P5Q A;  2RUR A;  4LAW A;  3JYJ A;  4LAY A;  1J4H A;  1OWQ A;  1WB0 A;  1FKI A;  2LJ4 A;  3O5D A;  1IX5 A;  5HTG A;  4DRO A;  5HW6 A;  3O5R A;  5B8I C;  1U79 A;  4U86 A;  4J4O A;  3O5M A;  4DIP A;  1HKI A;  4U85 A;  3ARV A;  1X6N A;  3AS0 A;  3I6C A;  4IT4 A;  4DWS C;  2RQS A;  2KI3 A;  4ODN A;  4QT3 A;  1HKJ A;  4Z2H A;  3ARX A;  1HXV A;  1WNO A;  2PV1 A;  3BXW A;  1X6L A;  3KAH A;  5DIT A;  4ZPT R;  1FKH A;  2YBT A;  1K9T A;  4J4N A;  4ZPV R;  3UI5 A;  1JNS A;  4L72 B;  4NNR A;  2DSZ A;  2MLX A;  1FKB A;  4HBE A;  4GIV A;  3TDB A;  4Z2J A;  1LG1 A;  2WM0 A;  1FKF A;  4S3K A;  5DEZ A;  3W4R A;  1Y0O A;  1ZB5 A;  1E6P A;  2FDM A;  1ZBW A;  3ARY A;  1O6I A;  2AOS A;  3UI4 A;  1D7H A;  3O5E A;  5JH8 A;  1F40 A;  4Z2G A;  2DT2 A;  1KT0 A;  3QOK A;  3JXV A;  3IK8 A;  1L1P A;  3ODK A;  2A3A A;  3CHD A;  1FKR A;  1LJY A;  3CGN A;  4JFK A;  1J4R A;  3ALG A;  2WK2 A;  2IUZ A;  2XP7 A;  4ZPW R;  1D2K A;  2O9O A;  4ODQ A;  1D7J A;  5GPG A;  4WKA A;  1TCO C;  4JFL A;  4URI A;  4HBO A;  1FJD A;  2LKN A;  1HJW A;  1W1T A;  4XAK A;  2XP3 A;  1FKL A;  4WJX A;  3KZ7 A;  3WL1 A;  4L3N A;  2G41 A;  1M5Y A;  3ART A;  5J6E A;  4DWS A;  1NH6 A;  2O92 A;  3IHZ A;  2XP5 A;  3OOB A;  2A3B A;  3G6L A;  3WIJ A;  4MNK A;  3CHE A;  2OLH A;  5HWC A;  1EIB A;  1ZCN A;  1E6R A;  4O2T A;  2QF8 A;  3ARQ A;  1W9U A;  5DIV A;  2KFW A;  1W1P A;  1T11 A;  3LUO A;  1LQ0 A;  2DPE A;  5DIU A;  4R0X A;  3WD0 A;  2Q5A A;  3KAG A;  1FFR A;  2PI6 A;  3O5J A;  1ROT A;  2ITK A;  1W9V A;  1JNT A;  4NSB A;  3AS2 A;  3MDY B;  4W5U A;  1GUV A;  1PBK A;  1ZBV A;  1GPF A;  4DRP A;  3KAD A;  2IF4 A;  1FKT A;  1JNE A;  3RM4 A;  2ZR6 A;  3CHF A;  3PRD A;  5HUA A;  1N1A A;  2D9F A;  1ITX A;  4Z2L A;  4C02 B;  1J4I A;  2MPH A;  3KAB A;  1XRV A;  4IQC A;  1XHG A;  4QZV B;  1ZBK A;  1WAW A;  2K8I A;  1EQ3 A;  5HW8 A;  4ML4 A;  2Y78 A;  1ZU8 A;  3GPK A;  2ZR5 A;  3UQI A;  3WD4 A;  2G8Z A;  3AQU A;  1A7X A;  1H0I A;  4DH0 A;  2B31 A;  4DZ2 A;  4ODP A;  2WLZ A;  1FKG A;  2DSU A;  2A3E A;  3NRK A;  1B6C A;  3WD2 A;  3FAP A;  3O5K A;  3UF8 A;  3ARR A;  4DWS B;  4DT4 A;  3CH9 A;  4DRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...