4JYUL

Structure of factor viia in complex with the inhibitor (2r)-2-[(1-aminoisoquinolin-6-yl)amino]-2-[3-ethoxy-4-(propan-2-yloxy)phenyl]-n-(phenylsulfonyl)ethanamide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
ICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonbenzamidine acylsulfonamide tissue factor-factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Factor VII light chain
total genus 12
structure length 55
sequence length 55
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 2013-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4jyuL00
2PUQL 1EGFA 1ATAA 4D0FA 1YUKB 2P95L 4MMZB 2I9BA 3KRKA 3P5BL 2K2SB 5IKQA 3LC5B 3ELAL 1DIYA 3GISX 4BDXA 1V3XB 2BZ6L 2JKHL 1PFXL 2Y38A 1G2LB 3LC3B 1HAFA 3ZYJB 4ZH8B 1MQ5L 1YUGA 3CA7A 3M36L 3CFWA 2DDUA 3HS5A 1XDTR 2W86A 1EMOA 1LPKA 4X8SL 2W2ME 1WHFA 1HX2A 1HJ7A 1IQNL 3SW2A 2I9AA 1CEJA 2Y81B 4FM5A 3IJEB 4RRXA 1P0SL 2P16L 3HO4A 2FLBL 1ADXA 1FF7A 1NPEB 2FLGA 4O02B 3HS6A 1FFMA 2EI7B 4D0EA 4BXSA 4NG9L 1RFNB 2WPHE 1FAKL 1W7XL 5IKTA 3GCWE 1G1RA 2BOKL 3KQEL 3NT1A 4NGAL 1IQKL 1HCGB 1HT8A 4OTYA 1NT0A 4RS0A 4G1MB 2Y7ZB 4RUTA 2BQWA 2Y7XB 2RNLA 4E1GA 3KCGL 2BO2A 4ZHAB 1YGCL 3TH3L 3N8VA 4XBMA 3N8XA 3QMOA 1M1XB 2WPJE 1G1SA 3LTGD 1F0SB 1F7MA 1NFUB 1IQHL 1KIGL 2J34B 1DDXA 3IITB 4XL1A 1UZPA 1ATEA 3LN0A 4BTTA 4Z0LA 1LQDA 5L30L 4BXWA 4X8UL 1EMNA 2YGOA 3N8ZA 4XLWA 4A7IA 3SOQA 3ZYGA 1B9WA 3HO5A 2J2UB 4MMYB 1C5MF 1O5DL 3BT2A 4CUFA 1G1TA 2MHPA 4LMFA 1UZKA 3N8YB 1MQ6L 2FZZL 2BOHA 3U7UG 2W2OE 4YT7L 2J94B 1CVUA 3K9XA 5JBCE 3TK5B 1IQML 5IKVA 1CCFA 4JYVL 3KQCL 1APQA 1LPGA 2BOXA 1XFEA 2W2NE 3SOBB 3POYA 1NZIA 2PHBB 3KK6A 3HO3A 2XC5L 1N7DA 3F1SB 1DVAL 5JVZA 1URKA 1XKAL 1IQIL 1IVOC 1WU1B 3OLUA 2RA0L 2W26B 5I46L 1CVWL 2P3FN 2WFXB 1P9JA 4C16A 1TOZA 2W3KB 4O1ZA 1NFXB 2WG4B 1IGXA 2D1JB 1HZ8A 1EPHA 3GCXE 2MGPA 4LORA 2Y5FL 1U67A 2VWOL 1Q4GA 2XBVL 1DQBA 4ZXXL 2J4IB 1NFYB 1IQEL 2VWMK 6COXA 1DX5I 5E8DA 2BOUA 2MGRA 3OLTA 2P3UA 3QH0A 3V64C 4COXA 1EBVA 2ADXA 1FE2A 5K0HB 2XC0L 4ISHL 1JBUL 4Y6DB 5L2ZL 3LIWB 3M37L 1Z6CA 4RRWA 1EPJA 1KSNB 4X8VL 2XBYL 3LTFB 2BQ6A 4M11A 1IOXA 3ASIA 2WPLE 1PRHA 1FSBA 3CS7L 1IQLL 2Y5GL 3KL6B 2P3FL 3LAQA 1KLOA 3QCWA 4NA9L 3H5CB 5CISA 1EQGA 5JBAE 1XKBA 3ZYIB 2VVVL 2UWLB 4X8TL 2J95B 2NPRA 1IP0A 1ZAQA 3NJPC 1APOA 1UZQA 2KB9A 1FAXL 5F19A 3FFGL 2OYUP 3TGFA 1TPGA 3F6UL 1N1IA 1AUTL 3R05A 1PXXA 1JV2B 2WPME 4BDWA 5JB8E 1UZJA 3SOVA 1IQGL 2GD4A 1NQLB 2KL7A 1F0RB 4JZFL 4Z0KB 1J9CL 5IKRA 1ATBA 2Q1JB 4OTJA 1NFWB 2CJIB 1SZBA 2WYJB 4BTUA 4CUEA 5JB9E 2J38B 1EAIC 1IJQA 4JZEL 2RHPA 3BT1A 1JL9A 4RRZA 1Z6EL 2WPIE 3EGFA 3N8WB 2VH0B 5JVYA 2FD6A 1HREA 1BF9A 1F7EA 1HAEA 3CENL 3V65B 1EPGA 3C9AC 1EQHA 2VJ3A 4M10A 2VVCK 2B7DL 3DEMA 4CSYA 2EI6B 2WFTA 3MDLA 5KIRA 4Y7BB 4ISIL 3TBDA 2P26A 2P93L 5F1AA 4TGFA 1QFKL 1L3YA 5CKNA 1HRFA 1PGEA 2BQ7A 1IGZA 3BPSE 3HPTA 5L2YL 3NTGA 5EGMB 2VWNL 2W3IB 1CQEA 3KQDL 4Z6AL 5CKMA 5COXA 3RR3A 1COUA 2P3TA 1W8BL 4Y7AB 4BTIA 4D90A 1G1QA 2Y5HL 3ENSA 4ZXYL 5JW1A 1MOXC 1IOEL 1U8CB 1WHEA 2WG3C 2Y82B 1EPIA 1X7AL 3U73A 4CUDA 2VWLL 1OB1C 5CKQA 4MMXB 4YZUB 2VVUL 2PR3B 1KLJL 1K37A 3N8YA 1L5GB 2FLRL 1EZQB 3KQBL 2K2TA 3Q7DA 2W2PE 4JZDL 3MQEA 2F9BL 5KN5C 1LMJA 2WYGB 3TZIA 1I0UA 2XC4L 1CX2A 1PTHA 3LN1A 1LPZA 2EI8B 4PH9A 2AYLA 2TGFA 4ZAEB 4JYUL 2OYEP 3HS7A 1YO8A 2G00L 1KLIL 2M74A 2YGPA 3FCSB 2P28B 2UWOB 2WPKE 2KV4A 4Y76B 1CCVA 1GK5A 3FBYA 1G2MB 1ATDA 5JBBE 1IQFL 4Y71B 1FJSL 4Y79B 1K36A 2W2QE 2Y80B 1IQJL 2XBXL 2XBWL 2VH6B 5FDQA 2P94L 3NTBA 3Q3KB 1YUFA 3N8WA 2H9EL 4AQTA 4YT6L 1HT5A 1A3PA 2UWPB 4RRYA 2BMGA 1TLEA 3TK6B 3PGHA
chains in the Genus database with same CATH superfamily
2PUQL 1EGFA 1ATAA 4D0FA 1YUKB 2P95L 4MMZB 2I9BA 3KRKA 3P5BL 2K2SB 5IKQA 3LC5B 3ELAL 1DIYA 2BSFA 3GISX 4BDXA 1V3XB 2BZ6L 2JKHL 1PFXL 2Y38A 1G2LB 3LC3B 1HAFA 3ZYJB 4ZH8B 1MQ5L 1YUGA 3CA7A 3M36L 3CFWA 2DDUA 3HS5A 1LK9A 1XDTR 2W86A 1EMOA 1LPKA 4X8SL 2W2ME 1WHFA 1HX2A 1HJ7A 1IQNL 3SW2A 2H9EC 2I9AA 1CEJA 2Y81B 4FM5A 3IJEB 4RRXA 1P0SL 2P16L 3HO4A 2FLBL 1ADXA 1FF7A 1NPEB 2FLGA 3HS6A 4O02B 1FFMA 2EI7B 4D0EA 4BXSA 4NG9L 1RFNB 2WPHE 1FAKL 1W7XL 5IKTA 3GCWE 1G1RA 2BOKL 3KQEL 3NT1A 4NGAL 1IQKL 1HCGB 1HT8A 4OTYA 1NT0A 4RS0A 4G1MB 1KKEA 2Y7ZB 4RUTA 2BQWA 2Y7XB 2RNLA 4E1GA 3KCGL 2HORA 2BO2A 4ZHAB 1YGCL 4A94C 3TH3L 3N8VA 4XBMA 3N8XA 2BT7A 3QMOA 1M1XB 2WPJE 1G1SA 3LTGD 1F0SB 1F7MA 1NFUB 1IQHL 1KIGL 2J34B 1DDXA 3IITB 4XL1A 1UZPA 1ATEA 3LN0A 4BTTA 4Z0LA 1LQDA 5L30L 4BXWA 4X8UL 1EMNA 2YGOA 3N8ZA 4XLWA 4A7IA 3SOQA 3ZYGA 1B9WA 3HO5A 2J2UB 4MMYB 1C5MF 1O5DL 3BT2A 4CUFA 1G1TA 2MHPA 4LMFA 1UZKA 3N8YB 1MQ6L 2FZZL 2BOHA 3U7UG 2W2OE 4YT7L 2J94B 1CVUA 3K9XA 5JBCE 3TK5B 1IQML 5IKVA 1CCFA 4JYVL 3KQCL 1APQA 1LPGA 2BOXA 1XFEA 2W2NE 3SOBB 3POYA 1NZIA 2PHBB 3KK6A 3HO3A 2XC5L 1N7DA 3F1SB 1DVAL 5JVZA 1URKA 1XKAL 1IQIL 1IVOC 1WU1B 3OLUA 2RA0L 2W26B 5I46L 1CVWL 2P3FN 2WFXB 1P9JA 4C16A 1TOZA 2W3KB 4O1ZA 1NFXB 2WG4B 1IGXA 2D1JB 1HZ8A 1LMMA 1EPHA 3GCXE 2MGPA 4LORA 2Y5FL 1U67A 1V1IA 2VWOL 1Q4GA 2XBVL 1DQBA 4ZXXL 2J4IB 1NFYB 4GU3A 1IQEL 2VWMK 6COXA 1DX5I 5E8DA 2BOUA 2MGRA 3OLTA 2P3UA 3QH0A 3V64C 4COXA 1EBVA 2ADXA 1FE2A 5K0HB 2XC0L 4ISHL 1JBUL 4Y6DB 5L2ZL 3LIWB 3M37L 1Z6CA 4RRWA 1EPJA 1KSNB 4X8VL 2XBYL 3LTFB 2BQ6A 4M11A 1IOXA 3ASIA 2WPLE 1PRHA 1FSBA 3CS7L 1IQLL 2Y5GL 3KL6B 2P3FL 3LAQA 1KLOA 3QCWA 4NA9L 3H5CB 5CISA 1EQGA 5JBAE 1XKBA 3ZYIB 2VVVL 2UWLB 4X8TL 2J95B 2NPRA 1IP0A 1ZAQA 3NJPC 1APOA 1UZQA 2KB9A 1FAXL 5F19A 3FFGL 2OYUP 3TGFA 1TPGA 3F6UL 1N1IA 1AUTL 3R05A 1PXXA 1JV2B 2WPME 4BDWA 5JB8E 1UZJA 3SOVA 1IQGL 2GD4A 1NQLB 2KL7A 1F0RB 4JZFL 4Z0KB 1J9CL 5IKRA 1ATBA 2Q1JB 4OTJA 1NFWB 2CJIB 1SZBA 2WYJB 4BTUA 4CUEA 5JB9E 2J38B 1EAIC 1IJQA 4JZEL 2RHPA 3BT1A 1JL9A 4RRZA 1Z6EL 2WPIE 3EGFA 3N8WB 2VH0B 5JVYA 2FD6A 1HREA 1BF9A 2WZPP 1F7EA 1HAEA 3CENL 3V65B 1EPGA 3C9AC 2KNIA 1EQHA 2VJ3A 4M10A 2VVCK 2B7DL 3DEMA 2JJLA 4CSYA 2EI6B 2WFTA 3MDLA 5KIRA 4Y7BB 4ISIL 3TBDA 1V1HA 2P26A 2P93L 5F1AA 4TGFA 1QFKL 1L3YA 4GU4A 5CKNA 1HRFA 1PGEA 2BQ7A 1IGZA 3BPSE 3HPTA 5L2YL 3NTGA 2VRSA 5EGMB 2VWNL 2W3IB 1CQEA 3KQDL 4Z6AL 5CKMA 5COXA 3RR3A 1COUA 2P3TA 1W8BL 4Y7AB 4BTIA 4D90A 1G1QA 2Y5HL 3ENSA 4ZXYL 5JW1A 1MOXC 1IOEL 1QIUA 1U8CB 1WHEA 2WG3C 2Y82B 1EPIA 1X7AL 3U73A 4CUDA 2VWLL 1OB1C 5CKQA 4MMXB 4YZUB 2VVUL 3S6XA 2PR3B 1KLJL 1K37A 3N8YA 1L5GB 2FLRL 1EZQB 3KQBL 2K2TA 3Q7DA 2W2PE 4JZDL 3MQEA 2F9BL 5KN5C 1LMJA 2WYGB 3TZIA 1I0UA 2XC4L 1CX2A 1PTHA 3LN1A 1LPZA 2EI8B 4PH9A 2AYLA 2TGFA 4ZAEB 4JYUL 2OYEP 2BT8A 3HS7A 1YO8A 2G00L 1KLIL 2M74A 2YGPA 3FCSB 2P28B 2UWOB 2WPKE 2KV4A 4Y76B 1CCVA 1GK5A 3FBYA 1G2MB 1ATDA 5JBBE 2YGQA 1IQFL 4Y71B 1FJSL 4Y79B 1K36A 2HOXA 2W2QE 2Y80B 1IQJL 2XBXL 2XBWL 2VH6B 5FDQA 2P94L 3NTBA 3Q3KB 1YUFA 3N8WA 2H9EL 4AQTA 4YT6L 1HT5A 1A3PA 2UWPB 4RRYA 2BMGA 1TLEA 3TK6B 3PGHA
chains in the Genus database with same CATH topology
2PUQL 1EGFA 1ATAA 4D0FA 1YUKB 2P95L 4MMZB 2I9BA 3KRKA 3P5BL 2K2SB 5IKQA 3LC5B 3ELAL 1DIYA 3GISX 4BDXA 1V3XB 2BZ6L 2JKHL 1PFXL 2Y38A 1G2LB 3LC3B 1HAFA 3ZYJB 4ZH8B 1MQ5L 1YUGA 3CA7A 3M36L 3CFWA 2DDUA 3HS5A 1XDTR 2W86A 1EMOA 1LPKA 4X8SL 2W2ME 1WHFA 1HX2A 1HJ7A 1IQNL 3SW2A 2H9EC 2I9AA 1CEJA 2Y81B 4FM5A 3IJEB 4RRXA 1P0SL 2P16L 3HO4A 2FLBL 1ADXA 1FF7A 1NPEB 2FLGA 3HS6A 4O02B 1FFMA 2EI7B 4D0EA 4BXSA 4NG9L 1RFNB 2WPHE 1FAKL 1W7XL 5IKTA 3GCWE 1G1RA 2BOKL 3KQEL 3NT1A 4NGAL 1IQKL 1HCGB 1HT8A 4OTYA 1NT0A 4RS0A 4G1MB 2Y7ZB 4RUTA 2BQWA 2Y7XB 2RNLA 4E1GA 3KCGL 2BO2A 4ZHAB 1YGCL 4A94C 3TH3L 3N8VA 4XBMA 3N8XA 3QMOA 1M1XB 2WPJE 1G1SA 3LTGD 1F0SB 1F7MA 1NFUB 1IQHL 1KIGL 2J34B 1DDXA 3IITB 4XL1A 1UZPA 1ATEA 3LN0A 4BTTA 4Z0LA 1LQDA 5L30L 4BXWA 4X8UL 1EMNA 2YGOA 3N8ZA 4XLWA 4A7IA 3SOQA 3ZYGA 1B9WA 3HO5A 2J2UB 4MMYB 1C5MF 1O5DL 3BT2A 4CUFA 1G1TA 2MHPA 4LMFA 1UZKA 3N8YB 1MQ6L 2FZZL 2BOHA 3U7UG 2W2OE 4YT7L 2J94B 1CVUA 3K9XA 5JBCE 3TK5B 1IQML 5IKVA 1CCFA 4JYVL 3KQCL 1APQA 1LPGA 2BOXA 1XFEA 2W2NE 3SOBB 3POYA 1NZIA 2PHBB 3KK6A 3HO3A 2XC5L 1N7DA 3F1SB 1DVAL 5JVZA 1URKA 1XKAL 1IQIL 1IVOC 1WU1B 3OLUA 2RA0L 2W26B 5I46L 1CVWL 2P3FN 2WFXB 1P9JA 4C16A 1TOZA 2W3KB 4O1ZA 1NFXB 2WG4B 1IGXA 2D1JB 1HZ8A 1LMMA 1EPHA 3GCXE 2MGPA 4LORA 2Y5FL 1U67A 2VWOL 1Q4GA 2XBVL 1DQBA 4ZXXL 2J4IB 1NFYB 1IQEL 2VWMK 6COXA 1DX5I 5E8DA 2BOUA 2MGRA 3OLTA 2P3UA 3QH0A 3V64C 4COXA 1EBVA 2ADXA 1FE2A 5K0HB 2XC0L 4ISHL 1JBUL 4Y6DB 5L2ZL 3LIWB 3M37L 1Z6CA 4RRWA 1EPJA 1KSNB 4X8VL 2XBYL 3LTFB 2BQ6A 4M11A 1IOXA 3ASIA 2WPLE 1PRHA 1FSBA 3CS7L 1IQLL 2Y5GL 3KL6B 2P3FL 3LAQA 1KLOA 3QCWA 4NA9L 3H5CB 5CISA 1EQGA 5JBAE 1XKBA 3ZYIB 2VVVL 2UWLB 4X8TL 2J95B 2NPRA 1IP0A 1ZAQA 3NJPC 1APOA 1UZQA 2KB9A 1FAXL 5F19A 3FFGL 2OYUP 3TGFA 1TPGA 3F6UL 1N1IA 1AUTL 3R05A 1PXXA 1JV2B 2WPME 4BDWA 5JB8E 1UZJA 3SOVA 1IQGL 2GD4A 1NQLB 2KL7A 1F0RB 4JZFL 4Z0KB 1J9CL 5IKRA 1ATBA 2Q1JB 4OTJA 1NFWB 2CJIB 1SZBA 2WYJB 4BTUA 4CUEA 5JB9E 2J38B 1EAIC 1IJQA 4JZEL 2RHPA 3BT1A 1JL9A 4RRZA 1Z6EL 2WPIE 3EGFA 3N8WB 2VH0B 5JVYA 2FD6A 1HREA 1BF9A 2WZPP 1F7EA 1HAEA 3CENL 3V65B 1EPGA 3C9AC 2KNIA 1EQHA 2VJ3A 4M10A 2VVCK 2B7DL 3DEMA 4CSYA 2EI6B 2WFTA 3MDLA 5KIRA 4Y7BB 4ISIL 3TBDA 2P26A 2P93L 5F1AA 4TGFA 1QFKL 1L3YA 5CKNA 1HRFA 1PGEA 2BQ7A 1IGZA 3BPSE 3HPTA 5L2YL 3NTGA 5EGMB 2VWNL 2W3IB 1CQEA 3KQDL 4Z6AL 5CKMA 5COXA 3RR3A 1COUA 2P3TA 1W8BL 4Y7AB 4BTIA 4D90A 1G1QA 2Y5HL 3ENSA 4ZXYL 5JW1A 1MOXC 1IOEL 1U8CB 1WHEA 2WG3C 2Y82B 1EPIA 1X7AL 3U73A 4CUDA 2VWLL 1OB1C 5CKQA 4MMXB 4YZUB 2VVUL 3S6XA 2PR3B 1KLJL 1K37A 3N8YA 1L5GB 2FLRL 1EZQB 3KQBL 2K2TA 3Q7DA 2W2PE 4JZDL 3MQEA 2F9BL 5KN5C 1LMJA 2WYGB 3TZIA 1I0UA 2XC4L 1CX2A 1PTHA 3LN1A 1LPZA 2EI8B 4PH9A 2AYLA 2TGFA 4ZAEB 4JYUL 2OYEP 3HS7A 1YO8A 2G00L 1KLIL 2M74A 2YGPA 3FCSB 2P28B 2UWOB 2WPKE 2KV4A 4Y76B 1CCVA 1GK5A 3FBYA 1G2MB 1ATDA 5JBBE 2YGQA 1IQFL 4Y71B 1FJSL 4Y79B 1K36A 2W2QE 2Y80B 1IQJL 2XBXL 2XBWL 2VH6B 5FDQA 2P94L 3NTBA 3Q3KB 1YUFA 3N8WA 2H9EL 4AQTA 4YT6L 1HT5A 1A3PA 2UWPB 4RRYA 2BMGA 1TLEA 3TK6B 3PGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PUQ L;  1EGF A;  1ATA A;  4D0F A;  1YUK B;  2P95 L;  4MMZ B;  2I9B A;  3KRK A;  3P5B L;  2K2S B;  5IKQ A;  3LC5 B;  3ELA L;  1DIY A;  3GIS X;  4BDX A;  1V3X B;  2BZ6 L;  2JKH L;  1PFX L;  2Y38 A;  1G2L B;  3LC3 B;  1HAF A;  3ZYJ B;  4ZH8 B;  1MQ5 L;  1YUG A;  3CA7 A;  3M36 L;  3CFW A;  2DDU A;  3HS5 A;  1XDT R;  2W86 A;  1EMO A;  1LPK A;  4X8S L;  2W2M E;  1WHF A;  1HX2 A;  1HJ7 A;  1IQN L;  3SW2 A;  2I9A A;  1CEJ A;  2Y81 B;  4FM5 A;  3IJE B;  4RRX A;  1P0S L;  2P16 L;  3HO4 A;  2FLB L;  1ADX A;  1FF7 A;  1NPE B;  2FLG A;  4O02 B;  3HS6 A;  1FFM A;  2EI7 B;  4D0E A;  4BXS A;  4NG9 L;  1RFN B;  2WPH E;  1FAK L;  1W7X L;  5IKT A;  3GCW E;  1G1R A;  2BOK L;  3KQE L;  3NT1 A;  4NGA L;  1IQK L;  1HCG B;  1HT8 A;  4OTY A;  1NT0 A;  4RS0 A;  4G1M B;  2Y7Z B;  4RUT A;  2BQW A;  2Y7X B;  2RNL A;  4E1G A;  3KCG L;  2BO2 A;  4ZHA B;  1YGC L;  3TH3 L;  3N8V A;  4XBM A;  3N8X A;  3QMO A;  1M1X B;  2WPJ E;  1G1S A;  3LTG D;  1F0S B;  1F7M A;  1NFU B;  1IQH L;  1KIG L;  2J34 B;  1DDX A;  3IIT B;  4XL1 A;  1UZP A;  1ATE A;  3LN0 A;  4BTT A;  4Z0L A;  1LQD A;  5L30 L;  4BXW A;  4X8U L;  1EMN A;  2YGO A;  3N8Z A;  4XLW A;  4A7I A;  3SOQ A;  3ZYG A;  1B9W A;  3HO5 A;  2J2U B;  4MMY B;  1C5M F;  1O5D L;  3BT2 A;  4CUF A;  1G1T A;  2MHP A;  4LMF A;  1UZK A;  3N8Y B;  1MQ6 L;  2FZZ L;  2BOH A;  3U7U G;  2W2O E;  4YT7 L;  2J94 B;  1CVU A;  3K9X A;  5JBC E;  3TK5 B;  1IQM L;  5IKV A;  1CCF A;  4JYV L;  3KQC L;  1APQ A;  1LPG A;  2BOX A;  1XFE A;  2W2N E;  3SOB B;  3POY A;  1NZI A;  2PHB B;  3KK6 A;  3HO3 A;  2XC5 L;  1N7D A;  3F1S B;  1DVA L;  5JVZ A;  1URK A;  1XKA L;  1IQI L;  1IVO C;  1WU1 B;  3OLU A;  2RA0 L;  2W26 B;  5I46 L;  1CVW L;  2P3F N;  2WFX B;  1P9J A;  4C16 A;  1TOZ A;  2W3K B;  4O1Z A;  1NFX B;  2WG4 B;  1IGX A;  2D1J B;  1HZ8 A;  1EPH A;  3GCX E;  2MGP A;  4LOR A;  2Y5F L;  1U67 A;  2VWO L;  1Q4G A;  2XBV L;  1DQB A;  4ZXX L;  2J4I B;  1NFY B;  1IQE L;  2VWM K;  6COX A;  1DX5 I;  5E8D A;  2BOU A;  2MGR A;  3OLT A;  2P3U A;  3QH0 A;  3V64 C;  4COX A;  1EBV A;  2ADX A;  1FE2 A;  5K0H B;  2XC0 L;  4ISH L;  1JBU L;  4Y6D B;  5L2Z L;  3LIW B;  3M37 L;  1Z6C A;  4RRW A;  1EPJ A;  1KSN B;  4X8V L;  2XBY L;  3LTF B;  2BQ6 A;  4M11 A;  1IOX A;  3ASI A;  2WPL E;  1PRH A;  1FSB A;  3CS7 L;  1IQL L;  2Y5G L;  3KL6 B;  2P3F L;  3LAQ A;  1KLO A;  3QCW A;  4NA9 L;  3H5C B;  5CIS A;  1EQG A;  5JBA E;  1XKB A;  3ZYI B;  2VVV L;  2UWL B;  4X8T L;  2J95 B;  2NPR A;  1IP0 A;  1ZAQ A;  3NJP C;  1APO A;  1UZQ A;  2KB9 A;  1FAX L;  5F19 A;  3FFG L;  2OYU P;  3TGF A;  1TPG A;  3F6U L;  1N1I A;  1AUT L;  3R05 A;  1PXX A;  1JV2 B;  2WPM E;  4BDW A;  5JB8 E;  1UZJ A;  3SOV A;  1IQG L;  2GD4 A;  1NQL B;  2KL7 A;  1F0R B;  4JZF L;  4Z0K B;  1J9C L;  5IKR A;  1ATB A;  2Q1J B;  4OTJ A;  1NFW B;  2CJI B;  1SZB A;  2WYJ B;  4BTU A;  4CUE A;  5JB9 E;  2J38 B;  1EAI C;  1IJQ A;  4JZE L;  2RHP A;  3BT1 A;  1JL9 A;  4RRZ A;  1Z6E L;  2WPI E;  3EGF A;  3N8W B;  2VH0 B;  5JVY A;  2FD6 A;  1HRE A;  1BF9 A;  1F7E A;  1HAE A;  3CEN L;  3V65 B;  1EPG A;  3C9A C;  1EQH A;  2VJ3 A;  4M10 A;  2VVC K;  2B7D L;  3DEM A;  4CSY A;  2EI6 B;  2WFT A;  3MDL A;  5KIR A;  4Y7B B;  4ISI L;  3TBD A;  2P26 A;  2P93 L;  5F1A A;  4TGF A;  1QFK L;  1L3Y A;  5CKN A;  1HRF A;  1PGE A;  2BQ7 A;  1IGZ A;  3BPS E;  3HPT A;  5L2Y L;  3NTG A;  5EGM B;  2VWN L;  2W3I B;  1CQE A;  3KQD L;  4Z6A L;  5CKM A;  5COX A;  3RR3 A;  1COU A;  2P3T A;  1W8B L;  4Y7A B;  4BTI A;  4D90 A;  1G1Q A;  2Y5H L;  3ENS A;  4ZXY L;  5JW1 A;  1MOX C;  1IOE L;  1U8C B;  1WHE A;  2WG3 C;  2Y82 B;  1EPI A;  1X7A L;  3U73 A;  4CUD A;  2VWL L;  1OB1 C;  5CKQ A;  4MMX B;  4YZU B;  2VVU L;  2PR3 B;  1KLJ L;  1K37 A;  3N8Y A;  1L5G B;  2FLR L;  1EZQ B;  3KQB L;  2K2T A;  3Q7D A;  2W2P E;  4JZD L;  3MQE A;  2F9B L;  5KN5 C;  1LMJ A;  2WYG B;  3TZI A;  1I0U A;  2XC4 L;  1CX2 A;  1PTH A;  3LN1 A;  1LPZ A;  2EI8 B;  4PH9 A;  2AYL A;  2TGF A;  4ZAE B;  4JYU L;  2OYE P;  3HS7 A;  1YO8 A;  2G00 L;  1KLI L;  2M74 A;  2YGP A;  3FCS B;  2P28 B;  2UWO B;  2WPK E;  2KV4 A;  4Y76 B;  1CCV A;  1GK5 A;  3FBY A;  1G2M B;  1ATD A;  5JBB E;  1IQF L;  4Y71 B;  1FJS L;  4Y79 B;  1K36 A;  2W2Q E;  2Y80 B;  1IQJ L;  2XBX L;  2XBW L;  2VH6 B;  5FDQ A;  2P94 L;  3NTB A;  3Q3K B;  1YUF A;  3N8W A;  2H9E L;  4AQT A;  4YT6 L;  1HT5 A;  1A3P A;  2UWP B;  4RRY A;  2BMG A;  1TLE A;  3TK6 B;  3PGH A; 
#chains in the Genus database with same CATH topology
 2PUQ L;  1EGF A;  1ATA A;  4D0F A;  1YUK B;  2P95 L;  4MMZ B;  2I9B A;  3KRK A;  3P5B L;  2K2S B;  5IKQ A;  3LC5 B;  3ELA L;  1DIY A;  2BSF A;  3GIS X;  4BDX A;  1V3X B;  2BZ6 L;  2JKH L;  1PFX L;  2Y38 A;  1G2L B;  3LC3 B;  1HAF A;  3ZYJ B;  4ZH8 B;  1MQ5 L;  1YUG A;  3CA7 A;  3M36 L;  3CFW A;  2DDU A;  3HS5 A;  1LK9 A;  1XDT R;  2W86 A;  1EMO A;  1LPK A;  4X8S L;  2W2M E;  1WHF A;  1HX2 A;  1HJ7 A;  1IQN L;  3SW2 A;  2H9E C;  2I9A A;  1CEJ A;  2Y81 B;  4FM5 A;  3IJE B;  4RRX A;  1P0S L;  2P16 L;  3HO4 A;  2FLB L;  1ADX A;  1FF7 A;  1NPE B;  2FLG A;  3HS6 A;  4O02 B;  1FFM A;  2EI7 B;  4D0E A;  4BXS A;  4NG9 L;  1RFN B;  2WPH E;  1FAK L;  1W7X L;  5IKT A;  3GCW E;  1G1R A;  2BOK L;  3KQE L;  3NT1 A;  4NGA L;  1IQK L;  1HCG B;  1HT8 A;  4OTY A;  1NT0 A;  4RS0 A;  4G1M B;  1KKE A;  2Y7Z B;  4RUT A;  2BQW A;  2Y7X B;  2RNL A;  4E1G A;  3KCG L;  2HOR A;  2BO2 A;  4ZHA B;  1YGC L;  4A94 C;  3TH3 L;  3N8V A;  4XBM A;  3N8X A;  2BT7 A;  3QMO A;  1M1X B;  2WPJ E;  1G1S A;  3LTG D;  1F0S B;  1F7M A;  1NFU B;  1IQH L;  1KIG L;  2J34 B;  1DDX A;  3IIT B;  4XL1 A;  1UZP A;  1ATE A;  3LN0 A;  4BTT A;  4Z0L A;  1LQD A;  5L30 L;  4BXW A;  4X8U L;  1EMN A;  2YGO A;  3N8Z A;  4XLW A;  4A7I A;  3SOQ A;  3ZYG A;  1B9W A;  3HO5 A;  2J2U B;  4MMY B;  1C5M F;  1O5D L;  3BT2 A;  4CUF A;  1G1T A;  2MHP A;  4LMF A;  1UZK A;  3N8Y B;  1MQ6 L;  2FZZ L;  2BOH A;  3U7U G;  2W2O E;  4YT7 L;  2J94 B;  1CVU A;  3K9X A;  5JBC E;  3TK5 B;  1IQM L;  5IKV A;  1CCF A;  4JYV L;  3KQC L;  1APQ A;  1LPG A;  2BOX A;  1XFE A;  2W2N E;  3SOB B;  3POY A;  1NZI A;  2PHB B;  3KK6 A;  3HO3 A;  2XC5 L;  1N7D A;  3F1S B;  1DVA L;  5JVZ A;  1URK A;  1XKA L;  1IQI L;  1IVO C;  1WU1 B;  3OLU A;  2RA0 L;  2W26 B;  5I46 L;  1CVW L;  2P3F N;  2WFX B;  1P9J A;  4C16 A;  1TOZ A;  2W3K B;  4O1Z A;  1NFX B;  2WG4 B;  1IGX A;  2D1J B;  1HZ8 A;  1LMM A;  1EPH A;  3GCX E;  2MGP A;  4LOR A;  2Y5F L;  1U67 A;  1V1I A;  2VWO L;  1Q4G A;  2XBV L;  1DQB A;  4ZXX L;  2J4I B;  1NFY B;  4GU3 A;  1IQE L;  2VWM K;  6COX A;  1DX5 I;  5E8D A;  2BOU A;  2MGR A;  3OLT A;  2P3U A;  3QH0 A;  3V64 C;  4COX A;  1EBV A;  2ADX A;  1FE2 A;  5K0H B;  2XC0 L;  4ISH L;  1JBU L;  4Y6D B;  5L2Z L;  3LIW B;  3M37 L;  1Z6C A;  4RRW A;  1EPJ A;  1KSN B;  4X8V L;  2XBY L;  3LTF B;  2BQ6 A;  4M11 A;  1IOX A;  3ASI A;  2WPL E;  1PRH A;  1FSB A;  3CS7 L;  1IQL L;  2Y5G L;  3KL6 B;  2P3F L;  3LAQ A;  1KLO A;  3QCW A;  4NA9 L;  3H5C B;  5CIS A;  1EQG A;  5JBA E;  1XKB A;  3ZYI B;  2VVV L;  2UWL B;  4X8T L;  2J95 B;  2NPR A;  1IP0 A;  1ZAQ A;  3NJP C;  1APO A;  1UZQ A;  2KB9 A;  1FAX L;  5F19 A;  3FFG L;  2OYU P;  3TGF A;  1TPG A;  3F6U L;  1N1I A;  1AUT L;  3R05 A;  1PXX A;  1JV2 B;  2WPM E;  4BDW A;  5JB8 E;  1UZJ A;  3SOV A;  1IQG L;  2GD4 A;  1NQL B;  2KL7 A;  1F0R B;  4JZF L;  4Z0K B;  1J9C L;  5IKR A;  1ATB A;  2Q1J B;  4OTJ A;  1NFW B;  2CJI B;  1SZB A;  2WYJ B;  4BTU A;  4CUE A;  5JB9 E;  2J38 B;  1EAI C;  1IJQ A;  4JZE L;  2RHP A;  3BT1 A;  1JL9 A;  4RRZ A;  1Z6E L;  2WPI E;  3EGF A;  3N8W B;  2VH0 B;  5JVY A;  2FD6 A;  1HRE A;  1BF9 A;  2WZP P;  1F7E A;  1HAE A;  3CEN L;  3V65 B;  1EPG A;  3C9A C;  2KNI A;  1EQH A;  2VJ3 A;  4M10 A;  2VVC K;  2B7D L;  3DEM A;  2JJL A;  4CSY A;  2EI6 B;  2WFT A;  3MDL A;  5KIR A;  4Y7B B;  4ISI L;  3TBD A;  1V1H A;  2P26 A;  2P93 L;  5F1A A;  4TGF A;  1QFK L;  1L3Y A;  4GU4 A;  5CKN A;  1HRF A;  1PGE A;  2BQ7 A;  1IGZ A;  3BPS E;  3HPT A;  5L2Y L;  3NTG A;  2VRS A;  5EGM B;  2VWN L;  2W3I B;  1CQE A;  3KQD L;  4Z6A L;  5CKM A;  5COX A;  3RR3 A;  1COU A;  2P3T A;  1W8B L;  4Y7A B;  4BTI A;  4D90 A;  1G1Q A;  2Y5H L;  3ENS A;  4ZXY L;  5JW1 A;  1MOX C;  1IOE L;  1QIU A;  1U8C B;  1WHE A;  2WG3 C;  2Y82 B;  1EPI A;  1X7A L;  3U73 A;  4CUD A;  2VWL L;  1OB1 C;  5CKQ A;  4MMX B;  4YZU B;  2VVU L;  3S6X A;  2PR3 B;  1KLJ L;  1K37 A;  3N8Y A;  1L5G B;  2FLR L;  1EZQ B;  3KQB L;  2K2T A;  3Q7D A;  2W2P E;  4JZD L;  3MQE A;  2F9B L;  5KN5 C;  1LMJ A;  2WYG B;  3TZI A;  1I0U A;  2XC4 L;  1CX2 A;  1PTH A;  3LN1 A;  1LPZ A;  2EI8 B;  4PH9 A;  2AYL A;  2TGF A;  4ZAE B;  4JYU L;  2OYE P;  2BT8 A;  3HS7 A;  1YO8 A;  2G00 L;  1KLI L;  2M74 A;  2YGP A;  3FCS B;  2P28 B;  2UWO B;  2WPK E;  2KV4 A;  4Y76 B;  1CCV A;  1GK5 A;  3FBY A;  1G2M B;  1ATD A;  5JBB E;  2YGQ A;  1IQF L;  4Y71 B;  1FJS L;  4Y79 B;  1K36 A;  2HOX A;  2W2Q E;  2Y80 B;  1IQJ L;  2XBX L;  2XBW L;  2VH6 B;  5FDQ A;  2P94 L;  3NTB A;  3Q3K B;  1YUF A;  3N8W A;  2H9E L;  4AQT A;  4YT6 L;  1HT5 A;  1A3P A;  2UWP B;  4RRY A;  2BMG A;  1TLE A;  3TK6 B;  3PGH A; 
#chains in the Genus database with same CATH homology
 2PUQ L;  1EGF A;  1ATA A;  4D0F A;  1YUK B;  2P95 L;  4MMZ B;  2I9B A;  3KRK A;  3P5B L;  2K2S B;  5IKQ A;  3LC5 B;  3ELA L;  1DIY A;  3GIS X;  4BDX A;  1V3X B;  2BZ6 L;  2JKH L;  1PFX L;  2Y38 A;  1G2L B;  3LC3 B;  1HAF A;  3ZYJ B;  4ZH8 B;  1MQ5 L;  1YUG A;  3CA7 A;  3M36 L;  3CFW A;  2DDU A;  3HS5 A;  1XDT R;  2W86 A;  1EMO A;  1LPK A;  4X8S L;  2W2M E;  1WHF A;  1HX2 A;  1HJ7 A;  1IQN L;  3SW2 A;  2H9E C;  2I9A A;  1CEJ A;  2Y81 B;  4FM5 A;  3IJE B;  4RRX A;  1P0S L;  2P16 L;  3HO4 A;  2FLB L;  1ADX A;  1FF7 A;  1NPE B;  2FLG A;  3HS6 A;  4O02 B;  1FFM A;  2EI7 B;  4D0E A;  4BXS A;  4NG9 L;  1RFN B;  2WPH E;  1FAK L;  1W7X L;  5IKT A;  3GCW E;  1G1R A;  2BOK L;  3KQE L;  3NT1 A;  4NGA L;  1IQK L;  1HCG B;  1HT8 A;  4OTY A;  1NT0 A;  4RS0 A;  4G1M B;  2Y7Z B;  4RUT A;  2BQW A;  2Y7X B;  2RNL A;  4E1G A;  3KCG L;  2BO2 A;  4ZHA B;  1YGC L;  4A94 C;  3TH3 L;  3N8V A;  4XBM A;  3N8X A;  3QMO A;  1M1X B;  2WPJ E;  1G1S A;  3LTG D;  1F0S B;  1F7M A;  1NFU B;  1IQH L;  1KIG L;  2J34 B;  1DDX A;  3IIT B;  4XL1 A;  1UZP A;  1ATE A;  3LN0 A;  4BTT A;  4Z0L A;  1LQD A;  5L30 L;  4BXW A;  4X8U L;  1EMN A;  2YGO A;  3N8Z A;  4XLW A;  4A7I A;  3SOQ A;  3ZYG A;  1B9W A;  3HO5 A;  2J2U B;  4MMY B;  1C5M F;  1O5D L;  3BT2 A;  4CUF A;  1G1T A;  2MHP A;  4LMF A;  1UZK A;  3N8Y B;  1MQ6 L;  2FZZ L;  2BOH A;  3U7U G;  2W2O E;  4YT7 L;  2J94 B;  1CVU A;  3K9X A;  5JBC E;  3TK5 B;  1IQM L;  5IKV A;  1CCF A;  4JYV L;  3KQC L;  1APQ A;  1LPG A;  2BOX A;  1XFE A;  2W2N E;  3SOB B;  3POY A;  1NZI A;  2PHB B;  3KK6 A;  3HO3 A;  2XC5 L;  1N7D A;  3F1S B;  1DVA L;  5JVZ A;  1URK A;  1XKA L;  1IQI L;  1IVO C;  1WU1 B;  3OLU A;  2RA0 L;  2W26 B;  5I46 L;  1CVW L;  2P3F N;  2WFX B;  1P9J A;  4C16 A;  1TOZ A;  2W3K B;  4O1Z A;  1NFX B;  2WG4 B;  1IGX A;  2D1J B;  1HZ8 A;  1LMM A;  1EPH A;  3GCX E;  2MGP A;  4LOR A;  2Y5F L;  1U67 A;  2VWO L;  1Q4G A;  2XBV L;  1DQB A;  4ZXX L;  2J4I B;  1NFY B;  1IQE L;  2VWM K;  6COX A;  1DX5 I;  5E8D A;  2BOU A;  2MGR A;  3OLT A;  2P3U A;  3QH0 A;  3V64 C;  4COX A;  1EBV A;  2ADX A;  1FE2 A;  5K0H B;  2XC0 L;  4ISH L;  1JBU L;  4Y6D B;  5L2Z L;  3LIW B;  3M37 L;  1Z6C A;  4RRW A;  1EPJ A;  1KSN B;  4X8V L;  2XBY L;  3LTF B;  2BQ6 A;  4M11 A;  1IOX A;  3ASI A;  2WPL E;  1PRH A;  1FSB A;  3CS7 L;  1IQL L;  2Y5G L;  3KL6 B;  2P3F L;  3LAQ A;  1KLO A;  3QCW A;  4NA9 L;  3H5C B;  5CIS A;  1EQG A;  5JBA E;  1XKB A;  3ZYI B;  2VVV L;  2UWL B;  4X8T L;  2J95 B;  2NPR A;  1IP0 A;  1ZAQ A;  3NJP C;  1APO A;  1UZQ A;  2KB9 A;  1FAX L;  5F19 A;  3FFG L;  2OYU P;  3TGF A;  1TPG A;  3F6U L;  1N1I A;  1AUT L;  3R05 A;  1PXX A;  1JV2 B;  2WPM E;  4BDW A;  5JB8 E;  1UZJ A;  3SOV A;  1IQG L;  2GD4 A;  1NQL B;  2KL7 A;  1F0R B;  4JZF L;  4Z0K B;  1J9C L;  5IKR A;  1ATB A;  2Q1J B;  4OTJ A;  1NFW B;  2CJI B;  1SZB A;  2WYJ B;  4BTU A;  4CUE A;  5JB9 E;  2J38 B;  1EAI C;  1IJQ A;  4JZE L;  2RHP A;  3BT1 A;  1JL9 A;  4RRZ A;  1Z6E L;  2WPI E;  3EGF A;  3N8W B;  2VH0 B;  5JVY A;  2FD6 A;  1HRE A;  1BF9 A;  2WZP P;  1F7E A;  1HAE A;  3CEN L;  3V65 B;  1EPG A;  3C9A C;  2KNI A;  1EQH A;  2VJ3 A;  4M10 A;  2VVC K;  2B7D L;  3DEM A;  4CSY A;  2EI6 B;  2WFT A;  3MDL A;  5KIR A;  4Y7B B;  4ISI L;  3TBD A;  2P26 A;  2P93 L;  5F1A A;  4TGF A;  1QFK L;  1L3Y A;  5CKN A;  1HRF A;  1PGE A;  2BQ7 A;  1IGZ A;  3BPS E;  3HPT A;  5L2Y L;  3NTG A;  5EGM B;  2VWN L;  2W3I B;  1CQE A;  3KQD L;  4Z6A L;  5CKM A;  5COX A;  3RR3 A;  1COU A;  2P3T A;  1W8B L;  4Y7A B;  4BTI A;  4D90 A;  1G1Q A;  2Y5H L;  3ENS A;  4ZXY L;  5JW1 A;  1MOX C;  1IOE L;  1U8C B;  1WHE A;  2WG3 C;  2Y82 B;  1EPI A;  1X7A L;  3U73 A;  4CUD A;  2VWL L;  1OB1 C;  5CKQ A;  4MMX B;  4YZU B;  2VVU L;  3S6X A;  2PR3 B;  1KLJ L;  1K37 A;  3N8Y A;  1L5G B;  2FLR L;  1EZQ B;  3KQB L;  2K2T A;  3Q7D A;  2W2P E;  4JZD L;  3MQE A;  2F9B L;  5KN5 C;  1LMJ A;  2WYG B;  3TZI A;  1I0U A;  2XC4 L;  1CX2 A;  1PTH A;  3LN1 A;  1LPZ A;  2EI8 B;  4PH9 A;  2AYL A;  2TGF A;  4ZAE B;  4JYU L;  2OYE P;  3HS7 A;  1YO8 A;  2G00 L;  1KLI L;  2M74 A;  2YGP A;  3FCS B;  2P28 B;  2UWO B;  2WPK E;  2KV4 A;  4Y76 B;  1CCV A;  1GK5 A;  3FBY A;  1G2M B;  1ATD A;  5JBB E;  2YGQ A;  1IQF L;  4Y71 B;  1FJS L;  4Y79 B;  1K36 A;  2W2Q E;  2Y80 B;  1IQJ L;  2XBX L;  2XBW L;  2VH6 B;  5FDQ A;  2P94 L;  3NTB A;  3Q3K B;  1YUF A;  3N8W A;  2H9E L;  4AQT A;  4YT6 L;  1HT5 A;  1A3P A;  2UWP B;  4RRY A;  2BMG A;  1TLE A;  3TK6 B;  3PGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...