4JZ3A

Crystal structure of the chicken c-src-sh3 domain intertwined dimer
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
b'MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 6
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jz3A00
3M0TA 4J9EA 1ABOA 1OV3A 4FSSA 1Z9ZA 2V1RA 3REBB 4OMMA 1NEGA 1SEMA 3IQLA 2E5KA 2C0OA 2DM1A 4RTXA 1X6BA 1PRMC 4AFQC 1J3TA 1H3HA 1AOJA 2DVJA 4CC2A 3UF4A 2HCKA 1JXMA 2KROA 2JTEA 1KJWA 1WXBA 2LZ6B 1I07A 5FWBA 3R6NA 1K4US 1GCQC 2X3XD 5GJVB 4A63B 2RF0A 1CKBA 2HBWA 1UE9A 2RMOA 2CT3A 1WIEA 1W6XA 2FPDA 1AWWA 4E6RA 4F17A 1TUDA 2NUZA 1VYTA 2KRMA 2L3PA 2DBMA 1KFZA 2W0ZA 1K1ZA 4OMLA 4AFZC 2OI3A 3TSWA 4LN2A 1PRLC 4JPBW 1H8KA 1Y57A 4AFUC 2YDLA 2MCNA 1ZUUA 1X27A 2RQUA 2ABLA 1B3QA 1U3OA 2ED0A 2W10A 5FW9A 2BZYA 1GRIA 2JW4A 2CREA 2FRYA 2FG0A 2J6FA 4HVVA 2A28A 2F2XA 2IIMA 2A08A 1WXUA 1HD3A 2EYZA 2FPFA 1W1FA 2AKLA 1NM7A 2ENMA 4JJDA 1UECA 1M3AA 2LJ0A 3EG3A 2B86A 1BB9A 2RPNA 4J9FA 1QKWA 2HDAA 1KIKA 2L3QA 4LUDA 1OPKA 2DRMA 3PVQA 2GTOA 1LCKA 3SEMA 1T0HA 3NPFA 4J9IA 5GJWB 5L23A 1GBRA 2SEMA 1X43A 3A98A 1JXOA 2EYXA 2JM9A 2PZ1A 1WYXA 3VRZA 4HCKA 2DLPA 2DL3A 3THKA 1WDXA 3H0HA 4J9CA 4EIKA 1GFDA 5FWCA 1MV0B 1YCSB 2LQNA 3I5RA 4JJCA 4JZ3A 2FO0A 4IIOA 2KT8A 4DEXA 5IHNA 4AG2C 4Z8AA 5IHIA 4F16A 2FEIA 1SHGA 2DL4A 2FRWA 2O9SA 1AZEA 4OMPA 2LMJA 2YUPA 4HVWA 5EC7A 2L0AA 2CSQA 3QWXX 4Y92A 3EG1A 1AWXA 1G83A 2O88A 2KYMA 2PTKA 1VA7A 3PVLA 2JS2A 1YN8A 3ZL7C 2C0TA 2HEQA 2JMAA 2DE0X 3VS6A 2CSIA 1WX6A 1NLPC 2AZVA 1VYUA 4LE9A 4GBQA 5HCKA 1KSWA 1SRMA 2J05A 1T3SA 2O9VA 1FMKA 4RTVA 2PNIA 2EKHA 2K6DA 2A36A 2KE9A 1GCPA 2A37A 4R0KA 2EYYA 4AFSC 1RLPC 4JZ4A 2OAWA 2RQVA 2P4RA 3U23A 1ABQA 1GFCA 2GBQA 1QWFA 3UA7A 4HXJA 1MV3A 2DF6A 2RQTA 1UDLA 3M0UA 4M4ZA 1IO6A 1N5ZA 4J9HA 1UGVA 1H92A 3M0PA 2JT4A 2QDLA 2JM8A 2YSQA 4IIMA 2CUDA 4X1VA 2KGTA 3TVTA 1M8MA 1X6GA 1E6HA 2BTTA 2YT6A 1A0NB 2BZ8A 1U5SA 1X2QA 1YWPA 5IXBA 1ZX6A 2XMFA 4D8KA 2AZSA 2MOXA 2KBTA 1ZUYA 3I5SA 2YUNA 1ZBJA 3H0IA 5I22A 1K9AA 1NYGA 2MIOA 2X3WD 1M3CA 2GGRA 1NEBA 3VS0A 2D1XA 3VS7A 3M0QA 2M51A 4GLMA 2EGEA 1WI7A 1EFNA 2CUBA 1FYNA 1UHCA 2KR3A 2DL5A 2EGAA 4J9BA 3I9QA 2K3BA 3LH5A 2RQWA 3FJ5A 2F2WA 4CC4B 1OOTA 1UJ0A 1QCFA 2DNUA 1SHFA 2DJQA 2KRSA 2ECZA 1X69A 1W70A 2KXDA 3RNJA 2CT4A 2KRNA 5IH2A 1U06A 1UJYA 1YWOA 3UATA 2O2OA 1I1JA 1GCQA 1JO8A 4RTZA 1WXTA 4J9DA 1X2KA 3TSZA 4KRTA 3EGUA 4ESRA 1BBZA 2F2VA 3PE0A 1V1CA 2J06A 1AEYA 2DBKA 2ROLA 3H0FA 2G6FX 1WFWA 1NYFA 2KXCA 4QT7A 1AZGB 4Z89A 2EVRA 2DRKA 1NG2A 2DX1A 2VVKA 2DA9A 1UTIA 1SSHA 1G2BA 1AD5A 4OMOA 2GTJA 2DYBA 1QLYA 1PKSA 1AVZC 3RBBB 1CKAA 1NLOC 2CH4A 1YP5A 1T0JA 2DL8A 1ZLMA 3EG2A 2EQIA 2ESWA 1UHFA 3C0CA 2LJ1A 1GL5A 1YNZA 2BZXA 2VKNA 1AWOA 2AKKA 1RUWA 2K7AA 2FPEA 3VS3A 2JS0A 3VS4A 2LJ3A 2OJ2A 1GBQA 1T3LA 1MUZA 2D8HA 3JV3A 1UG1A 2YUQA 2D0NA 4ZNXA 5I11A 3EHRA 2H8HA 1RLQC 1E7OA 2LP5A 1VYVA 4RTWA 2DL7A 3CQTA 4CC3A 1ARKA 1K0SA 4RTUA 1QWEA 3NMZC 1Z9QA 2ED1A 4K11A 4J9GA 2EYWA 1WA7A 2K79A 3M0SA 2LNHB 3I35A 2D8JA 3M0RA 4HVUA 4OMQA 2GNCA 1OEBA 2AK5A 2M0YA 1M3BA 1CSKA 3EHQA 2EW3A 2EBPA 4RTYA 1SPKA 2LCSA 4OMNA 3H41A 4RTTA 2HSPA 1UUEA 1SRLA 2DILA 3UA6A 3NHNA 4JJBA 1S1NA 2I0NA 5IXFA 1PKTA 1BU1A 1M30A 2RN8A 1ZUKA 4WCIA 3ULRB 2SRCA 1B07A 2CH4W 2L3SA 3GBQA 1E6GA 2LX7A 4LUEA 1PNJA 4F14A 2ROTA 3REAB 4ORZA 3VS1A 1RI9A 2KT1A 5IHKA 2L2PA 1WLPB 1OPLA 1JQQA 1XOVA 1HSQA 2JXBA 2O31A 4LNPA 2YUOA 1HJDA 3O5ZA 3KFVA 5ECAA 2KEAA 2J6OA 3NGPA 2VWFA 1M27C 1K0XA 2CDTA 4RUGA 1JEGA 4CC7A 1QKXA 1BK2A 1TUCA 2DMOA 3VRYA 2JMCA 1PHTA 1PWTA 2RNAA 2NWMA 1AWJA 2K2MA 4D8DA 2LQWA 2C0IA 4Z88A 2KYBA 2V1QA 2EGCA 3VS5A 2GQIA 1ZSGA 2KNBB 3SHWA 2J7IA 2EPDA 1TG0A 2J6KA 1I0CA 3VS2A 4AG1C 1Y0MA 3QWYA 2K9GA 1UFFA 1K76A 4DEYA 1JU5C 2RQRA 3EG0A
chains in the Genus database with same CATH superfamily
1PSFA 1KQSS 1OI1A 4F04B 1YJNT 2C0OA 4XU1A 1QVFP 5D7UA 4V2SA 4B6MA 1X6BA 1M1KC 3QYHB 2E1HA 1J3TA 4JRKA 1K73C 1FXXA 1K9MR 3UF4A 4C5EA 1JXMA 5LJ3g 2EKOA 2JTEA 4RCCA 1O75A 4M77C 3QDRB 3HRTA 1M4ZA 3OYEA 1VQPA 1K4US 5GJVB 3OYFA 3V7RA 4A63B 4ELZC 5LJ5g 4M7DC 3JRZA 4HCZA 4E6RA 2NYSA 4BY6B 1Y71A 1VYTA 3CBMA 3MEWA 5GAN4 2EQUA 2EQMA 2RH2A 2EYQA 4A4KA 2PUKB 4IUUA 4M78E 1ZHIA 1PRLC 3QZ9B 3G6EA 4AFUC 2HAXA 3OW2A 5CR2A 1SKUB 2ABLA 2EFIA 1D1AA 2ED0A 1IRXA 5FW9A 2CGHA 3JCMJ 2FRYA 5KCHA 4C5IA 4E7ZA 4LDYA 1W1FA 4M77E 3QSUA 4OGCA 3BDUA 3TREA 4F7UE 3JCMQ 1JJ2P 3OYHA 2RPNA 3GLXA 4M7DE 1N9RA 1YBYA 4Z02A 3A98A 3CC4A 4XTZA 2PZ1A 2KY9A 5CK9A 1NJIC 4J6WA 1N9SA 1WJSA 2MWPA 1G5VA 2COWA 2FZKB 1MV0B 4PJLA 1WZOA 2NLUA 4C8QD 4CRIA 2K57A 4AG2C 4Z8AA 1SHGA 3MKDA 1TXQA 4OMPA 1JB0E 1MMNA 2LMJA 3OSVA 2ZPIB 5EC7A 4FM4B 3FC3A 3QWXX 2RA2A 3TEEA 5M9OA 2CZ1B 5GMKi 1YN8A 1YJ9A 3FJPA 4LD6A 4IUTA 4C8QG 1VQ6T 3A5ZB 3QZ5B 1M2VB 5GAN3 2DE0X 1WX6A 1VYUA 4LE9A 5HCKA 1KSWA 2HL3A 4JS4A 2YWWA 2QQBA 5I2MA 1WPYA 3CCRA 3MP6A 5KYUA 2MF2A 4KH1B 2E5QA 4FT2A 2X4JA 1IGQA 4ANJA 3CCET 1RLPC 4JZ4A 2OAWA 2RQVA 3RMQA 3BY7A 4L6V5 1MV3A 4RKUE 2KQWA 1MGQA 1UDLA 2FZCB 1IO6A 3L42A 1N5ZA 4J9HA 1UGVA 1H92A 4RG8A 2DTIA 2JT4A 5D6YA 2R5MA 4FYVB 3GP8A 2YSQA 3A8GB 1Q81U 3TVTA 1FMVA 2LQKA 1RAEB 2ZGWA 3CXCP 1XTDA 1YWPA 1MMAA 3JCMg 2EJ9A 3RDVA 5AT1B 2KBTA 1YIJT 5FU7B 3CCVT 2LTOA 2RHYA 2F5KA 2QASA 2DZ9A 1VQMA 1K9AA 5FRMA 3JB9F 2X3WD 2YHTA 5GMKe 4MDWA 3VS7A 2E64A 3M0QA 3CCVQ 4FU6A 1VQ9A 1KHIA 2DTOA 3EFSA 1WI7A 5FU6B 1FYNA 2DL5A 3I9QA 2K3BA 3QDFA 5CIUA 2YRVA 4JLGA 2QI2A 3PMTA 4C0GA 1UJ0A 1QCFA 2M16A 5GAMe 2KRSA 2ECZA 2KXDA 2X4WA 2GF7A 2CT4A 2E6NA 4Q5WA 1U06A 1LPLA 4FL6A 2K5LA 2KSSA 2MK5A 1GCQA 3OYAA 4J9DA 1X2KA 3TSZA 2F2VA 3QJ6A 1BCOA 2KXCA 3CD6T 2EVRA 1UGRB 3R6OA 5GAMh 5CQYA 5HKCA 1UTIA 3I55T 3CMEQ 1G2BA 1Y96B 4J7IA 4IKFA 1PKSA 1VOMA 2Z0WA 4ZGEB 1R0CB 1YP5A 1T0JA 4XTYA 5GMKl 3PMIA 4KT0E 4BY6C 1YITA 3PT9A 2K2VA 3C0CA 3CCJT 1RUWA 4AMCA 1NZ9A 1QP3A 2FPEA 3F70A 5A2QE 4EPCA 2HBPA 1ZQ1A 1T3LA 2FHDA 1MUZA 2DKGA 5GAOm 1M2VA 1YCYA 3EHRA 5A0DA 1WHLA 1QVGA 4C5GA 1RABB 2DL7A 2JZ2A 2VC8A 3OYMA 2LQ8A 5GAN5 1UGQB 2DTHA 2DD5A 4PJJA 1VQ4A 1WHHA 4CC3A 4KUDK 1ARKA 4DA4A 3NTHA 3OS2A 1D09B 1Z9QA 3M0SA 2LNHB 3I35A 3M0RA 4M7DF 4OMQA 1HK9A 1VQ8A 1OEBA 1W4SA 2QQAA 1M3BA 4C92B 1YI2A 4DOVA 3M57A 1UUEA 2HSEB 4OP0A 1RAHB 3DKMA 5IXFA 2RHUA 3M53A 3CCSA 1ZUKA 2YLBA 4WCIA 3RMSA 3OY9A 5LL6S 2R5AA 3EFOB 3VUBA 2JVVA 2CH4W 1VQLT 4FW2A 1E6GA 2X51A 2LX7A 3CC7T 1PNJA 3MP8A 3EH2A 1WQWA 2M1HA 4KULA 5KYYB 2E6ZA 5LJ3f 3JB9D 1N8RU 2KT1A 3OYCA 5IHKA 4J6YA 1VQLQ 1OPLA 3S3NA 2OTLT 2O31A 2K3XA 3P8HA 4BDYA 4HCCA 1KQ2A 3TCJA 3GNFB 1VQ5T 2DFUA 2KEAA 5LJ5f 3G4ST 1VQKT 1K0XA 2CDTA 4QKUA 3C95A 1NPRA 2DMOA 2QAZA 3CPWA 3VRYA 1JBMA 2JMCA 2RNAA 4IUPA 3JB9G 3H6ZA 2K2MA 4D8DA 1VQ5Q 3CMAT 4FSXA 4JDSA 1VQKQ 2VYTA 1MNEA 2FB7A 5IN1A 3SHWA 1D1BA 2J6KA 3VKIA 2RO0A 2JOYA 4AG1C 1UFFA 1D0YA 3MJXA 2GFAA 1YHQT 3VRZA 3G71Q 1PD0A 1Q81C 2PVOB 1Z9ZA 3HRSA 3REBB 3IQLA 3L2WA 2PQWA 4RTXA 2QEXT 5HK3A 1PRMC 1QP2A 4AFQC 4TVRA 1WHJA 3J81E 3CCLA 1IHVA 1EZZB 1Y96A 1KQSA 4HT9A 3V8KA 1VQNT 5FU7C 3WVEB 2EWNA 1H3ZA 5I2SA 2XDDA 5FWBA 1YJWA 2CZ6B 2X3XD 2RF0A 1CKBA 3CCUT 2HBWA 1WIEA 1W6XA 5FRNA 2FPDA 2WSFE 1XNIA 2NUZA 1MHNA 5FU6C 5GANf 5J26A 1D0ZA 1LVKA 2DJZA 2KRMA 4QQGA 1Q7YU 1VUBA 3CCUQ 1KFZA 4C92G 2ZCFB 2A0FB 2AIRB 4AFZC 4Y28E 2X35A 1UGPB 3TSWA 2E10A 4LN2A 5FROA 1QVFS 1Q82R 1M1FA 2MCNA 1NE8A 1X27A 1C0MA 1MMDA 2BZYA 1GRIA 2FG0A 3C12A 4HVVA 2A28A 4JRPA 4EDUA 2F2XA 2A08A 1WXUA 2KAFA 2FPFA 4C0DB 4N0AC 2ENMA 3BE3A 4C92A 2E3IA 3EG3A 2B86A 4XQ3A 1BB9A 4J9FA 2HDAA 1KIKA 2CP5A 2L3QA 1BYMA 3PVQA 4E7HA 1G3WA 4IUVA 3SEMA 2XK0A 3NPFA 1OU9A 2R57A 5GJWB 5L23A 3CCQA 1GBRA 3EFOA 3JCMX 2HKQB 2SEMA 1QQJA 4HCKA 4PFZA 3THKA 2XI9A 5KYYA 4BI8B 1WDXA 3H0HA 4OB2B 2RM4A 5FWCA 1YCSB 3I5RA 4JJCA 3LYIA 1M8VA 1C1AA 4X9CA 2QDYB 3JCMf 4B9XA 4XU0A 2DETA 1Q82U 2DL4A 2FRWA 3EH1A 2O4XB 4X9DA 1TSFA 4HVWA 4BE1A 4E7JA 2L0AA 5HY6A 1IZ6A 3EG1A 8ATCB 3QJYA 4M78C 2PTKA 3ZBDA 4C0FA 4C8QB 3PVLA 2JS2A 3HSBA 2HEQA 4PJOB 3JCMV 1C6VX 2DXUA 2CSIA 2RHZA 1NLPC 3JCMb 1SRMA 2BE9B 3MP1A 2J05A 4OB1B 1M1GA 4M75B 1VQOA 2PNIA 2K6DA 1PM3A 4C92C 2A37A 1NBEB 4R0KA 2RHIA 1YJNA 3OYLA 4QVDA 3N5BB 2DYIA 2VGNA 3RERA 2GBQA 1QWFA 3UA7A 2DF6A 3CPWP 3CBOA 1N8RC 1VQPQ 5CKHA 1EIFA 2VV5A 3JCMc 1O9SA 2QQRA 3PNWC 4IUQA 4AT1B 2QDLA 1VIEA 2R58A 4HCBA 2YXYA 4X1VA 2KGTA 1X6GA 2OTJT 1ZSZB 4E7KA 2BZ8A 3A8OB 5CKDA 4JLIA 1KHCA 3GIBA 3NTKA 2KVQG 2XMFA 4MZMA 3FB9A 2PU9B 1WHMA 2OTJQ 4A4EA 1ZUYA 1ZBJA 3SFMA 5I22A 1RAGB 1D3BB 1OZ2A 2MIOA 4C92E 2EJFA 2D6FA 3AT1B 1QVPA 4R55A 4GLMA 1B7TA 4DQ2A 5GAN6 3OYIA 1EFNA 3QXEB 4J9BA 3C4SA 3LH5A 3OA6A 2V8IA 2F2WA 4FYYB 3O8VA 4B9WA 1OOTA 1G3SA 3L1AA 3GNGA 1EX4A 1RAFB 5IH2A 3CC4Q 3UATA 8AT1B 1BI0A 2O2OA 3V7SA 1JO8A 1WXTA 3EGUA 4ESRA 5I21A 4PJOD 3PE0A 1AEYA 2J06A 3CXCS 2X4YA 5KYWB 3EGDB 3ZEHA 3OMCA 2QA4A 1Q81R 3QYGB 4M75D 1M90U 2DRKA 1NG2A 2DX1A 2VVKA 4LDVA 4WTOB 1SSHA 3H8ZA 4A4GA 2GTJA 1BCMA 2DYBA 2XU8A 1QLYA 4ME7A 4XTVA 1Q7YC 4MDXA 4PJOG 1CKAA 2CH4A 3NFCA 1D1CA 2CP6A 1ZLMA 2EQIA 2ESWA 1UHFA 3P8DA 4X34A 4M75G 1KG1A 1YNZA 2BZXA 1M5Q1 2O4XA 3I56T 2E65A 4KBMB 5HK0A 3CCRQ 3VS3A 1KD1R 1VQ6A 2LJ3A 2FZGB 1WGSA 4ELYC 4C8QA 1GBQA 2D8HA 4PJOA 3I56Q 3OYKA 2YUQA 5C6SA 2ZZDA 4ZNXA 5I11A 2H8HA 1RLQC 1E7OA 1RACB 2QTVA 5LJ3e 3E19A 4M75A 3CCEA 2FYKA 4RTUA 2VUBA 3NMZC 2DAQA 3SB2A 5GMKj 4FW1A 2EIFA 1WA7A 3X24B 4HVUA 4PJMA 5LJ5e 3EHQA 2EBPA 3OBWA 4RTYA 3HP9A 3BW1A 4OMNA 4M7AF 3A8LB 3H41A 4RTTA 1SRLA 3NHNA 5LJ3h 4JJBA 4JS5A 4JUVA 1BU1A 5GAMj 2SRCA 3P8BB 2XDPA 3PIOA 1I8FA 4LDUA 2EAYA 1Q82C 2L3SA 2KK4A 2XIDA 3GBQA 2BUDA 5L8RE 1ZSZA 5GAN7 1WQ7A 2JUFA 4OGEA 1KD1U 5LJ5h 4JRQA 1YIJA 1RI9A 4QQDA 3CCVA 1WLPB 1XJWB 1HSQA 1S72T 4J5YA 1P92A 4C8QC 3O5ZA 5ECAA 1D3BA 5KYXB 2V26A 1JEGA 2IPOB 1S72Q 1QKXA 2Y90A 1PHTA 1PWTA 3HPWA 3CMET 2NWMA 4M75C 2DXBA 3MEVA 1WNLA 1X01A 4E47A 4IURA 5KE3A 1M9SA 1GXIE 2V1QA 2I2LA 3VS5A 1IHWA 1ZSGA 3OW2P 4II1A 3CBPA 2X9HA 1I0CA 2RI2A 1W2BA 1Y0MA 1QW1A 3MO8A 3QWYA 4DEYA 2RQRA 2LNVA 3EG0A 5FLXE 1ABOA 5GANe 1TOVA 4FSSA 4O6JA 4E7LA 2GFUA 3CD6A 5KYWA 3EGDA 1NEGA 4UC4A 1NPPA 2DXCA 2CZ0B 4PFOA 2DM1A 1PC0A 1YITQ 3I55A 1ZSZC 4M78F 3HTRA 3TQ7P 5KH6A 4C8QE 1AOJA 2DVJA 1QCOA 4PJOE 2BIVA 1N8RR 3JCMW 4CC2A 2LDMA 2HCKA 5GAMd 2HD0A 1OU8A 1KJWA 2RJCA 1WXBA 2LZ6B 3OS1A 4M75E 5GANh 1RADB 4PLIA 1R0BG 4M77F 2ZPFB 4QQ6A 3QKJA 1GCQC 4E7SA 1I81A 3CCJA 2E12A 2DXTA 4F7UF 1UE9A 3L2RA 4XTXA 3SDZA 1AWWA 4F17A 1TUDA 4FYXB 3OBYA 4BE0A 2O01E 2DBMA 3LGFA 3FRNA 2W0ZA 3CEYA 4OMLA 2OI3A 1H8KA 1YI2Q 1Y57A 3OYDA 3UWNA 2HL5C 4L5GA 1D0XA 2EQJA 3S3OA 2W10A 2ZPGB 1UEBA 2FVUA 3H9NA 3X28B 1M90C 2CREA 5KYNA 1VQ7T 1U8RA 4VUBA 1V76A 3QUIA 4XTWA 5CCAA 2AKLA 1NM7A 4JJDA 5CAIA 1UECA 2P0KA 3OYBA 2LJ0A 1QVFA 2WSCE 1VQ7Q 1LJOA 1VQLA 1R8OB 4LDWA 1OPKA 2DRMA 2GTOA 3CC7A 1LCKA 3V8JA 1T0HA 4J9IA 3JB9I 1JXOA 2EYXA 4FIBA 3JCMh 1F1BB 3OB9A 3RKXA 2DLPA 2F5TX 1IGUA 2MMPA 2OTLA 3RR6A 1WJQA 2MPXC 4EIKA 1OYXA 3G71T 1Q95G 1GFDA 2MI6A 2LQNA 1KC8U 1VQ5A 3PTAA 3WXMB 4ZGDB 4JZ3A 2FO0A 1PSEA 3G4SA 1VQKA 1Q7YR 5IAYA 2LRQA 2V8KA 1N27A 4L59A 1AT1B 2RHXA 2DZCA 3CMAA 3CC2T 2CSQA 2QGGA 1WHGA 4Y92A 2OX7A 4NL2A 1AWXA 3QPHA 2O88A 1H641 1VA7A 3Q1JA 4A4HA 3HFNA 3ZL7C 1UB4A 3DLLA 4PJNA 3VJPA 3RUXA 3CC2Q 4GBQA 3S6WA 4OB3B 1YHQA 2O9VA 4ATOA 2HKNA 4RTVA 2EKHA 2KE9A 2A36A 2RI5A 3OYNA 3VU3C 4AFSC 5AYFA 3T9NA 5C0MA 5CKFA 3U23A 1BI2A 1ABQA 2QEXA 3VV0A 4EMHA 2L89A 4N4HA 1KD1C 1YJWQ 4M4ZA 4OMFB 2PUOB 2LC4A 3M0PA 2PVGB 1VQNA 5GAOq 4EMKB 2JM8A 2QG9B 4J8OA 3E9FA 2M02A 2ATCB 2GCXA 1U1TA 4LDXA 2YT6A 1Y07A 1U5SA 3CCUA 1W2BP 2CYZB 4M7DD 2A3LA 1OX8A 4A4FA 2DEQA 2ZPEB 3I5SA 3GOXA 1TTHB 3M54A 1M3CA 5J3BA 2GGRA 1G3TA 1G3YA 3VS0A 2D1XA 5GAOr 2OAUA 2A7YA 3QG1A 2EGEA 4M7DG 2CUBA 1VIFA 2EGAA 3CPWS 1QVGP 2RQWA 3OMGA 1RL2A 3FJ5A 3BFMA 1SHFA 4BACA 1X69A 1OX9A 3RNJA 3CCQQ 2QYZA 1SSFA 1UJYA 4KGZB 2K5IA 3VYHB 4RTZA 4KRTA 2YRDA 4ZN1A 1V1CA 6AT1B 2CP3A 3CCMT 3HKSA 3LWHA 2ROLA 4J7FA 1K8AU 3JSCA 2G6FX 1WFWA 4KH0B 4QT7A 2H3EB 1LNXA 3UDCA 3D7SB 3HHTB 3SD4A 4Z89A 4PLLA 3CCMQ 2DA9A 2COZA 1U1SA 2QTXA 3UT1A 2IG0A 4DBFA 5GMKm 4PKCC 4OMOA 4C5HA 3ME9A 3S3MA 1OULA 3LW5E 1JJ2S 3CXCA 4YTLA 2DL8A 2CP2A 3LX7A 3EG2A 1ZA2B 2JN0A 5GAOp 1ACMB 2LJ1A 3GPLA 1GL5A 2VKNA 1VQPT 2P4TA 1VQOQ 4PNOA 2K7AA 2RJDA 1B34B 2JS0A 3FEOA 3VS4A 2KDSA 1YJNQ 3A1PA 9ATCB 2ZAEA 3V8LA 3JV3A 4E7IA 2RJFA 3RKYA 2LP5A 3A8MB 4FT4A 2AHJB 5GAOl 1K0SA 3MHXA 1QWEA 2HNIA 7AT1B 4N4GA 3G6ET 4K11A 2EYWA 3MEAA 1TUGB 3FDRA 3OS0A 2GNCA 4DBQA 2AK5A 3OYGA 1M90R 1CSKA 4C0ZA 2EW3A 2XG8D 4XTUA 3G6EQ 3E2UA 3HRUA 3PGGA 2HSPA 2C06A 1KC8C 2DILA 3UA6A 2ZPBB 2RN8A 4ZGJB 2OTJA 2D9TA 3ULRB 4EMKA 5CKEA 1QMCA 4LUEA 1KQSP 4F14A 2VXEA 5GAMg 3CC4T 3VS1A 4D6WA 1K9MU 5A0GA 2LT1A 2L2PA 3OS5A 1JQQA 2JXBA 4LNPA 2GQVA 1HJDA 1RAAB 1AHJB 5GAN2 1MMGA 2J6OA 3NGPA 4P5NA 4PK4A 1M27C 2VASA 1X75C 2LVMA 3WVDB 3L2UA 1BK2A 3QIIA 1PCXA 1TUCA 3MEUA 2QA4T 3MCAB 1BIBA 1AWJA 2DIQA 3C94A 3MPUB 3PIPA 2QXFA 5D6WA 3EFRA 2HQHA 4N4IA 1IXDA 5GAOn 4Z88A 2KYBA 2QA4Q 1YJ9T 4GY5A 2COYA 2V8JA 2KMTA 4NS5A 3JB9H 2J7IA 4BUGA 1TG0A 5CQXA 3RKWA 3OYJA 2XKOC 3VS2A 4BD3A 5GANg 2K9GA 1K76A 3M55A 3LGLA 1JU5C 1WJRA 3M0TA 3M9QA 3HL8A 1YJ9Q 4J9EA 2JTFA 3CCRT 1RAIB 1OV3A 2V1RA 4EMKC 4OMMA 1SEMA 2E5KA 4Y91A 2MAMA 3M4GA 5LJ3j 1Y7XA 2M9UA 4HA8A 3L2VA 2DK3A 2BE7D 2RI3A 1H3HA 1V29B 2JJ9A 2LX9A 3CPFA 4OF1A 5EG2A 2KROA 2E4HA 1M2OA 3INZA 1VQ6Q 5LJ5j 1I07A 5IT9E 3R6NA 4C0DC 3I56A 3KUFA 2RMOA 1TH7A 2CT3A 3L2ZA 3CCEQ 3OW2S 2XD0A 1Q86R 4BI3A 1B34A 1OQKA 2LCCA 3UPUA 1TWBA 2L3PA 2RJEA 1VQMT 4A53A 4NOYA 4ZTFA 4KUIA 1JRIA 1K1ZA 4GLKA 3LH0A 2NUTB 2CZ7B 4JPBW 1VQ9T 1VQMQ 2G3RA 1K8AC 2YDLA 1ZUUA 2RQUA 1B3QA 1FX7A 1U3OA 4FYWB 2Y4YA 4XAXB 2JW4A 1YFNA 2J6FA 3NTIA 4A54A 2DERA 2IIMA 1QCNA 1VQ9Q 1HD3A 2EYZA 4ZN3A 2E3HA 1M3AA 3QO3A 4MZPA 1I4K1 1YIJQ 4OB0B 3G1JA 2E70A 1QKWA 4PJOC 4LUDA 4DOWA 4M7AB 2B8AA 2WACA 1X43A 2LT4A 5LJ3d 2JM9A 1WYXA 1Q86U 2DL3A 1FWZA 1S72A 1TU0B 5GANj 3EGXB 4J9CA 5GMKh 2K5FA 5D6XA 5LJ5d 3SWNB 4DEXA 4IIOA 2KT8A 5IHNA 3EG9B 2K4YA 5IHIA 2WSEE 4F16A 5KCOA 2FEIA 5DY9A 2L5QA 3ASKA 3JAME 1YITT 2CP0A 2O9SA 1AZEA 4R56A 3CMEA 2YUPA 2D0QB 4MZTA 1G83A 2KYMA 2HMAA 1IB8A 4QVCA 1M1KR 2C0TA 1DJ7B 2JMAA 1K73R 3CD6Q 3VS6A 4CI0C 2AZVA 1BIAA 3JCMP 1T3SA 4QW2A 3I55Q 1FMKA 1GCPA 4E2FB 1OZ3A 2DD4A 3G7ZA 2EYYA 4FCYA 2AT1B 1I5LA 1VQ4T 4C92F 2P4RA 4MMLA 1X6OA 2F1LA 4BE2A 1SF9A 1GFCA 1HXDA 4HXJA 4HKEA 4O5VA 2K3YA 2RQTA 1G8XA 1K9MC 5GAN8 1KQ1A 3L2QA 3M0UA 1VQ4Q 1VQ8T 2QQ9A 3CCJQ 2H3JA 2RD1A 4RMOA 3PFSA 1YI2T 4RG2A 4M78B 2L8DA 1KC8R 4IIMA 2CUDA 4KGVB 1VQ8Q 1M8MA 3CCST 1E6HA 2BTTA 1A0NB 3V7CA 2MYSA 1X2QA 2HQXA 5IXBA 1ZX6A 4J83A 5GANd 1M1KU 3VUZA 4D8KA 2AZSA 3CCSQ 2MOXA 1K73U 2PVDB 2RK2A 4M77B 3JCMe 2YUNA 1N6AA 3LWIA 3H0IA 4M7AD 1NYGA 2ZPHB 4F7UB 2P84A 1NEBA 2XICA 3BDLA 5A0LA 2E41A 4XU2A 4M7DB 2M51A 4JRIA 3X26B 2XHCA 3E9GA 2NUTA 5CKBA 1BKBA 3J80E 1UHCA 2KR3A 4XU3A 2FL7A 3M56A 1VQ7A 4CC4B 2X4XA 3QBYA 1NJIR 4M7AG 5DM7R 2DNUA 1MNDA 3CC7Q 2DJQA 4RCBA 3FIFA 2XDBA 1PD1A 1W70A 2NUPB 2P0PA 4LXCA 2KRNA 2BKDN 3LLRA 1YWOA 1PG5B 2F69A 1I1JA 4KGXB 3GF5A 2CKKA 2VXFA 3M4YA 2OTLQ 4JJNK 4HT8A 1BBZA 2QQSA 1W2BS 2DBKA 3ER0A 5KYXA 2RK1A 3H0FA 2JNGA 3JB9J 1NYFA 3G4SQ 4M7AA 4EMGA 1ZA1B 1AZGB 5CVIA 3M58A 3URGA 2P0QA 4BB7A 3G71A 1AD5A 3CMAQ 2YLCA 3DLMA 1AVZC 3RBBB 2L3RA 4BI4A 3JCMd 3EGXA 3CCLT 1NLOC 3FLGA 2CP7A 3SWNA 1IREB 5GAMf 2QGFB 3EG9A 1QVGS 3CC2A 3CCLQ 1YJWT 1AWOA 2HQEA 1YHQQ 3ZFJA 1NJIU 3QHSA 4N0AA 1HYOA 2AKKA 4M78D 2DIGA 1JJ2A 2OJ2A 3KBGA 4PL6A 3X20B 1UG1A 2D0NA 2QEXQ 4DBHA 4ZTJA 1FMWA 3META 1R77A 1VYVA 4RTWA 1TS9A 3CQTA 1RI0A 2RB6A 5CO7A 4C92D 4M77D 3J7AF 2M0OA 1ZBXA 4M78G 3M59A 1VQNQ 1WHKA 2ED1A 4J9GA 1K8AR 2K79A 4MMKA 2EJGA 2D8JA 2QK0A 5DLQE 2JTMA 3VYGA 1Q86C 2HZYA 2M0YA 4M7AC 2DO3A 4J6XA 3X25B 1UGSB 4OVAA 1SPKA 5J39A 2LCSA 4M77G 2Y4XA 1S1NA 2I0NA 1PKTA 2IVWA 1M30A 4LD9K 4F7UG 2CS7A 1B07A 1LOJA 4M78A 1BI3A 2VB6A 2KI7A 3SWNC 3KXTA 3CCQT 3OYYA 1KK7A 3A8HB 1BI1A 2ROTA 3REAB 4ORZA 4BDZA 1I5OB 4DBRA 2VGMA 2DEUA 3DB3A 1XOVA 3E1SA 4M77A 2YUOA 3RIRA 3M5AA 3OQ5A 3KFVA 4F7UA 3OSSC 1SG5A 2VWFA 2EQKA 4C8QF 4RUGA 4PJOF 4CC7A 4M7DA 1XQHA 4PFPA 2MWOA 4M7AE 2LQWA 2C0IA 2DPPB 2YRCA 4XK8E 2DVEA 5DLOA 4M75F 3DB4A 2EGCA 2GQIA 2KNBB 4WF2A 2EPDA 2NUPA 4QVZA 3HFOA 2LCLA 3AHUA 3CCMA 3EAEA 5KE2A 5KYUB 4NL3A 3TU4K 1VQOT 3RESA
chains in the Genus database with same CATH topology
3M0TA 4J9EA 1ABOA 1OV3A 4FSSA 1Z9ZA 2V1RA 3REBB 4OMMA 1NEGA 1SEMA 3IQLA 2E5KA 2C0OA 2DM1A 4RTXA 1X6BA 1PRMC 4AFQC 1J3TA 1H3HA 1AOJA 2DVJA 4CC2A 3UF4A 2HCKA 1JXMA 2KROA 2JTEA 1KJWA 1WXBA 2LZ6B 1I07A 5FWBA 3R6NA 1K4US 1GCQC 2X3XD 5GJVB 4A63B 2RF0A 1CKBA 2HBWA 1UE9A 2RMOA 2CT3A 1WIEA 1W6XA 2FPDA 1AWWA 4E6RA 4F17A 1TUDA 2NUZA 1VYTA 2KRMA 2L3PA 2DBMA 1KFZA 2W0ZA 1K1ZA 4OMLA 4AFZC 2OI3A 3TSWA 4LN2A 1PRLC 4JPBW 1H8KA 1Y57A 4AFUC 2YDLA 2MCNA 1ZUUA 1X27A 2RQUA 2ABLA 1B3QA 1U3OA 2ED0A 2W10A 5FW9A 2BZYA 1GRIA 2JW4A 2CREA 2FRYA 2FG0A 2J6FA 4HVVA 2A28A 2F2XA 2IIMA 2A08A 1WXUA 1HD3A 2EYZA 2FPFA 1W1FA 2AKLA 1NM7A 2ENMA 4JJDA 1UECA 1M3AA 2LJ0A 3EG3A 2B86A 1BB9A 2RPNA 4J9FA 1QKWA 2HDAA 1KIKA 2L3QA 4LUDA 1OPKA 2DRMA 3PVQA 2GTOA 1LCKA 3SEMA 1T0HA 3NPFA 4J9IA 5GJWB 5L23A 1GBRA 2SEMA 1X43A 3A98A 1JXOA 2EYXA 2JM9A 2PZ1A 1WYXA 3VRZA 4HCKA 2DLPA 2DL3A 3THKA 1WDXA 3H0HA 4J9CA 4EIKA 1GFDA 5FWCA 1MV0B 1YCSB 2LQNA 3I5RA 4JJCA 4JZ3A 2FO0A 4IIOA 2KT8A 4DEXA 5IHNA 4AG2C 4Z8AA 5IHIA 4F16A 2FEIA 1SHGA 2DL4A 2FRWA 2O9SA 1AZEA 4OMPA 2LMJA 2YUPA 4HVWA 5EC7A 2L0AA 2CSQA 3QWXX 4Y92A 3EG1A 1AWXA 1G83A 2O88A 2KYMA 2PTKA 1VA7A 3PVLA 2JS2A 1YN8A 3ZL7C 2C0TA 2HEQA 2JMAA 2DE0X 3VS6A 2CSIA 1WX6A 1NLPC 2AZVA 1VYUA 4LE9A 4GBQA 5HCKA 1KSWA 1SRMA 2J05A 1T3SA 2O9VA 1FMKA 4RTVA 2PNIA 2EKHA 2K6DA 2A36A 2KE9A 1GCPA 2A37A 4R0KA 2EYYA 4AFSC 1RLPC 4JZ4A 2OAWA 2RQVA 2P4RA 3U23A 1ABQA 1GFCA 2GBQA 1QWFA 3UA7A 4HXJA 1MV3A 2DF6A 2RQTA 1UDLA 3M0UA 4M4ZA 1IO6A 1N5ZA 4J9HA 1UGVA 1H92A 3M0PA 2JT4A 2QDLA 2JM8A 2YSQA 4IIMA 2CUDA 4X1VA 2KGTA 3TVTA 1M8MA 1X6GA 1E6HA 2BTTA 2YT6A 1A0NB 2BZ8A 1U5SA 1X2QA 1YWPA 5IXBA 1ZX6A 2XMFA 4D8KA 2AZSA 2MOXA 2KBTA 1ZUYA 3I5SA 2YUNA 1ZBJA 3H0IA 5I22A 1K9AA 1NYGA 2MIOA 2X3WD 1M3CA 2GGRA 1NEBA 3VS0A 2D1XA 3VS7A 3M0QA 2M51A 4GLMA 2EGEA 1WI7A 1EFNA 2CUBA 1FYNA 1UHCA 2KR3A 2DL5A 2EGAA 4J9BA 3I9QA 2K3BA 3LH5A 2RQWA 3FJ5A 2F2WA 4CC4B 1OOTA 1UJ0A 1QCFA 2DNUA 1SHFA 2DJQA 2KRSA 2ECZA 1X69A 1W70A 2KXDA 3RNJA 2CT4A 2KRNA 5IH2A 1U06A 1UJYA 1YWOA 3UATA 2O2OA 1I1JA 1GCQA 1JO8A 4RTZA 1WXTA 4J9DA 1X2KA 3TSZA 4KRTA 3EGUA 4ESRA 1BBZA 2F2VA 3PE0A 1V1CA 2J06A 1AEYA 2DBKA 2ROLA 3H0FA 2G6FX 1WFWA 1NYFA 2KXCA 4QT7A 1AZGB 4Z89A 2EVRA 2DRKA 1NG2A 2DX1A 2VVKA 2DA9A 1UTIA 1SSHA 1G2BA 1AD5A 4OMOA 2GTJA 2DYBA 1QLYA 1PKSA 1AVZC 3RBBB 1CKAA 1NLOC 2CH4A 1YP5A 1T0JA 2DL8A 1ZLMA 3EG2A 2EQIA 2ESWA 1UHFA 3C0CA 2LJ1A 1GL5A 1YNZA 2BZXA 2VKNA 1AWOA 2AKKA 1RUWA 2K7AA 2FPEA 3VS3A 2JS0A 3VS4A 2LJ3A 2OJ2A 1GBQA 1T3LA 1MUZA 2D8HA 3JV3A 1UG1A 2YUQA 2D0NA 4ZNXA 5I11A 3EHRA 2H8HA 1RLQC 1E7OA 2LP5A 1VYVA 4RTWA 2DL7A 3CQTA 4CC3A 1ARKA 1K0SA 4RTUA 1QWEA 3NMZC 1Z9QA 2ED1A 4K11A 4J9GA 2EYWA 1WA7A 2K79A 3M0SA 2LNHB 3I35A 2D8JA 3M0RA 4HVUA 4OMQA 2GNCA 1OEBA 2AK5A 2M0YA 1M3BA 1CSKA 3EHQA 2EW3A 2EBPA 4RTYA 1SPKA 2LCSA 4OMNA 3H41A 4RTTA 2HSPA 1UUEA 1SRLA 2DILA 3UA6A 3NHNA 4JJBA 1S1NA 2I0NA 5IXFA 1PKTA 1BU1A 1M30A 2RN8A 1ZUKA 4WCIA 3ULRB 2SRCA 1B07A 2CH4W 2L3SA 3GBQA 1E6GA 2LX7A 4LUEA 1PNJA 4F14A 2ROTA 3REAB 4ORZA 3VS1A 1RI9A 2KT1A 5IHKA 2L2PA 1WLPB 1OPLA 1JQQA 1XOVA 1HSQA 2JXBA 2O31A 4LNPA 2YUOA 1HJDA 3O5ZA 3KFVA 5ECAA 2KEAA 2J6OA 3NGPA 2VWFA 1M27C 1K0XA 2CDTA 4RUGA 1JEGA 4CC7A 1QKXA 1BK2A 1TUCA 2DMOA 3VRYA 2JMCA 1PHTA 1PWTA 2RNAA 2NWMA 1AWJA 2K2MA 4D8DA 2LQWA 2C0IA 4Z88A 2KYBA 2V1QA 2EGCA 3VS5A 2GQIA 1ZSGA 2KNBB 3SHWA 2J7IA 2EPDA 1TG0A 2J6KA 1I0CA 3VS2A 4AG1C 1Y0MA 3QWYA 2K9GA 1UFFA 1K76A 4DEYA 1JU5C 2RQRA 3EG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0T A;  4J9E A;  1ABO A;  1OV3 A;  4FSS A;  1Z9Z A;  2V1R A;  3REB B;  4OMM A;  1NEG A;  1SEM A;  3IQL A;  2E5K A;  2C0O A;  2DM1 A;  4RTX A;  1X6B A;  1PRM C;  4AFQ C;  1J3T A;  1H3H A;  1AOJ A;  2DVJ A;  4CC2 A;  3UF4 A;  2HCK A;  1JXM A;  2KRO A;  2JTE A;  1KJW A;  1WXB A;  2LZ6 B;  1I07 A;  5FWB A;  3R6N A;  1K4U S;  1GCQ C;  2X3X D;  5GJV B;  4A63 B;  2RF0 A;  1CKB A;  2HBW A;  1UE9 A;  2RMO A;  2CT3 A;  1WIE A;  1W6X A;  2FPD A;  1AWW A;  4E6R A;  4F17 A;  1TUD A;  2NUZ A;  1VYT A;  2KRM A;  2L3P A;  2DBM A;  1KFZ A;  2W0Z A;  1K1Z A;  4OML A;  4AFZ C;  2OI3 A;  3TSW A;  4LN2 A;  1PRL C;  4JPB W;  1H8K A;  1Y57 A;  4AFU C;  2YDL A;  2MCN A;  1ZUU A;  1X27 A;  2RQU A;  2ABL A;  1B3Q A;  1U3O A;  2ED0 A;  2W10 A;  5FW9 A;  2BZY A;  1GRI A;  2JW4 A;  2CRE A;  2FRY A;  2FG0 A;  2J6F A;  4HVV A;  2A28 A;  2F2X A;  2IIM A;  2A08 A;  1WXU A;  1HD3 A;  2EYZ A;  2FPF A;  1W1F A;  2AKL A;  1NM7 A;  2ENM A;  4JJD A;  1UEC A;  1M3A A;  2LJ0 A;  3EG3 A;  2B86 A;  1BB9 A;  2RPN A;  4J9F A;  1QKW A;  2HDA A;  1KIK A;  2L3Q A;  4LUD A;  1OPK A;  2DRM A;  3PVQ A;  2GTO A;  1LCK A;  3SEM A;  1T0H A;  3NPF A;  4J9I A;  5GJW B;  5L23 A;  1GBR A;  2SEM A;  1X43 A;  3A98 A;  1JXO A;  2EYX A;  2JM9 A;  2PZ1 A;  1WYX A;  3VRZ A;  4HCK A;  2DLP A;  2DL3 A;  3THK A;  1WDX A;  3H0H A;  4J9C A;  4EIK A;  1GFD A;  5FWC A;  1MV0 B;  1YCS B;  2LQN A;  3I5R A;  4JJC A;  4JZ3 A;  2FO0 A;  4IIO A;  2KT8 A;  4DEX A;  5IHN A;  4AG2 C;  4Z8A A;  5IHI A;  4F16 A;  2FEI A;  1SHG A;  2DL4 A;  2FRW A;  2O9S A;  1AZE A;  4OMP A;  2LMJ A;  2YUP A;  4HVW A;  5EC7 A;  2L0A A;  2CSQ A;  3QWX X;  4Y92 A;  3EG1 A;  1AWX A;  1G83 A;  2O88 A;  2KYM A;  2PTK A;  1VA7 A;  3PVL A;  2JS2 A;  1YN8 A;  3ZL7 C;  2C0T A;  2HEQ A;  2JMA A;  2DE0 X;  3VS6 A;  2CSI A;  1WX6 A;  1NLP C;  2AZV A;  1VYU A;  4LE9 A;  4GBQ A;  5HCK A;  1KSW A;  1SRM A;  2J05 A;  1T3S A;  2O9V A;  1FMK A;  4RTV A;  2PNI A;  2EKH A;  2K6D A;  2A36 A;  2KE9 A;  1GCP A;  2A37 A;  4R0K A;  2EYY A;  4AFS C;  1RLP C;  4JZ4 A;  2OAW A;  2RQV A;  2P4R A;  3U23 A;  1ABQ A;  1GFC A;  2GBQ A;  1QWF A;  3UA7 A;  4HXJ A;  1MV3 A;  2DF6 A;  2RQT A;  1UDL A;  3M0U A;  4M4Z A;  1IO6 A;  1N5Z A;  4J9H A;  1UGV A;  1H92 A;  3M0P A;  2JT4 A;  2QDL A;  2JM8 A;  2YSQ A;  4IIM A;  2CUD A;  4X1V A;  2KGT A;  3TVT A;  1M8M A;  1X6G A;  1E6H A;  2BTT A;  2YT6 A;  1A0N B;  2BZ8 A;  1U5S A;  1X2Q A;  1YWP A;  5IXB A;  1ZX6 A;  2XMF A;  4D8K A;  2AZS A;  2MOX A;  2KBT A;  1ZUY A;  3I5S A;  2YUN A;  1ZBJ A;  3H0I A;  5I22 A;  1K9A A;  1NYG A;  2MIO A;  2X3W D;  1M3C A;  2GGR A;  1NEB A;  3VS0 A;  2D1X A;  3VS7 A;  3M0Q A;  2M51 A;  4GLM A;  2EGE A;  1WI7 A;  1EFN A;  2CUB A;  1FYN A;  1UHC A;  2KR3 A;  2DL5 A;  2EGA A;  4J9B A;  3I9Q A;  2K3B A;  3LH5 A;  2RQW A;  3FJ5 A;  2F2W A;  4CC4 B;  1OOT A;  1UJ0 A;  1QCF A;  2DNU A;  1SHF A;  2DJQ A;  2KRS A;  2ECZ A;  1X69 A;  1W70 A;  2KXD A;  3RNJ A;  2CT4 A;  2KRN A;  5IH2 A;  1U06 A;  1UJY A;  1YWO A;  3UAT A;  2O2O A;  1I1J A;  1GCQ A;  1JO8 A;  4RTZ A;  1WXT A;  4J9D A;  1X2K A;  3TSZ A;  4KRT A;  3EGU A;  4ESR A;  1BBZ A;  2F2V A;  3PE0 A;  1V1C A;  2J06 A;  1AEY A;  2DBK A;  2ROL A;  3H0F A;  2G6F X;  1WFW A;  1NYF A;  2KXC A;  4QT7 A;  1AZG B;  4Z89 A;  2EVR A;  2DRK A;  1NG2 A;  2DX1 A;  2VVK A;  2DA9 A;  1UTI A;  1SSH A;  1G2B A;  1AD5 A;  4OMO A;  2GTJ A;  2DYB A;  1QLY A;  1PKS A;  1AVZ C;  3RBB B;  1CKA A;  1NLO C;  2CH4 A;  1YP5 A;  1T0J A;  2DL8 A;  1ZLM A;  3EG2 A;  2EQI A;  2ESW A;  1UHF A;  3C0C A;  2LJ1 A;  1GL5 A;  1YNZ A;  2BZX A;  2VKN A;  1AWO A;  2AKK A;  1RUW A;  2K7A A;  2FPE A;  3VS3 A;  2JS0 A;  3VS4 A;  2LJ3 A;  2OJ2 A;  1GBQ A;  1T3L A;  1MUZ A;  2D8H A;  3JV3 A;  1UG1 A;  2YUQ A;  2D0N A;  4ZNX A;  5I11 A;  3EHR A;  2H8H A;  1RLQ C;  1E7O A;  2LP5 A;  1VYV A;  4RTW A;  2DL7 A;  3CQT A;  4CC3 A;  1ARK A;  1K0S A;  4RTU A;  1QWE A;  3NMZ C;  1Z9Q A;  2ED1 A;  4K11 A;  4J9G A;  2EYW A;  1WA7 A;  2K79 A;  3M0S A;  2LNH B;  3I35 A;  2D8J A;  3M0R A;  4HVU A;  4OMQ A;  2GNC A;  1OEB A;  2AK5 A;  2M0Y A;  1M3B A;  1CSK A;  3EHQ A;  2EW3 A;  2EBP A;  4RTY A;  1SPK A;  2LCS A;  4OMN A;  3H41 A;  4RTT A;  2HSP A;  1UUE A;  1SRL A;  2DIL A;  3UA6 A;  3NHN A;  4JJB A;  1S1N A;  2I0N A;  5IXF A;  1PKT A;  1BU1 A;  1M30 A;  2RN8 A;  1ZUK A;  4WCI A;  3ULR B;  2SRC A;  1B07 A;  2CH4 W;  2L3S A;  3GBQ A;  1E6G A;  2LX7 A;  4LUE A;  1PNJ A;  4F14 A;  2ROT A;  3REA B;  4ORZ A;  3VS1 A;  1RI9 A;  2KT1 A;  5IHK A;  2L2P A;  1WLP B;  1OPL A;  1JQQ A;  1XOV A;  1HSQ A;  2JXB A;  2O31 A;  4LNP A;  2YUO A;  1HJD A;  3O5Z A;  3KFV A;  5ECA A;  2KEA A;  2J6O A;  3NGP A;  2VWF A;  1M27 C;  1K0X A;  2CDT A;  4RUG A;  1JEG A;  4CC7 A;  1QKX A;  1BK2 A;  1TUC A;  2DMO A;  3VRY A;  2JMC A;  1PHT A;  1PWT A;  2RNA A;  2NWM A;  1AWJ A;  2K2M A;  4D8D A;  2LQW A;  2C0I A;  4Z88 A;  2KYB A;  2V1Q A;  2EGC A;  3VS5 A;  2GQI A;  1ZSG A;  2KNB B;  3SHW A;  2J7I A;  2EPD A;  1TG0 A;  2J6K A;  1I0C A;  3VS2 A;  4AG1 C;  1Y0M A;  3QWY A;  2K9G A;  1UFF A;  1K76 A;  4DEY A;  1JU5 C;  2RQR A;  3EG0 A; 
#chains in the Genus database with same CATH topology
 1PSF A;  1KQS S;  1OI1 A;  4F04 B;  1YJN T;  2C0O A;  4XU1 A;  1QVF P;  5D7U A;  4V2S A;  4B6M A;  1X6B A;  1M1K C;  3QYH B;  2E1H A;  1J3T A;  4JRK A;  1K73 C;  1FXX A;  1K9M R;  3UF4 A;  4C5E A;  1JXM A;  5LJ3 g;  2EKO A;  2JTE A;  4RCC A;  1O75 A;  4M77 C;  3QDR B;  3HRT A;  1M4Z A;  3OYE A;  1VQP A;  1K4U S;  5GJV B;  3OYF A;  3V7R A;  4A63 B;  4ELZ C;  5LJ5 g;  4M7D C;  3JRZ A;  4HCZ A;  4E6R A;  2NYS A;  4BY6 B;  1Y71 A;  1VYT A;  3CBM A;  3MEW A;  5GAN 4;  2EQU A;  2EQM A;  2RH2 A;  2EYQ A;  4A4K A;  2PUK B;  4IUU A;  4M78 E;  1ZHI A;  1PRL C;  3QZ9 B;  3G6E A;  4AFU C;  2HAX A;  3OW2 A;  5CR2 A;  1SKU B;  2ABL A;  2EFI A;  1D1A A;  2ED0 A;  1IRX A;  5FW9 A;  2CGH A;  3JCM J;  2FRY A;  5KCH A;  4C5I A;  4E7Z A;  4LDY A;  1W1F A;  4M77 E;  3QSU A;  4OGC A;  3BDU A;  3TRE A;  4F7U E;  3JCM Q;  1JJ2 P;  3OYH A;  2RPN A;  3GLX A;  4M7D E;  1N9R A;  1YBY A;  4Z02 A;  3A98 A;  3CC4 A;  4XTZ A;  2PZ1 A;  2KY9 A;  5CK9 A;  1NJI C;  4J6W A;  1N9S A;  1WJS A;  2MWP A;  1G5V A;  2COW A;  2FZK B;  1MV0 B;  4PJL A;  1WZO A;  2NLU A;  4C8Q D;  4CRI A;  2K57 A;  4AG2 C;  4Z8A A;  1SHG A;  3MKD A;  1TXQ A;  4OMP A;  1JB0 E;  1MMN A;  2LMJ A;  3OSV A;  2ZPI B;  5EC7 A;  4FM4 B;  3FC3 A;  3QWX X;  2RA2 A;  3TEE A;  5M9O A;  2CZ1 B;  5GMK i;  1YN8 A;  1YJ9 A;  3FJP A;  4LD6 A;  4IUT A;  4C8Q G;  1VQ6 T;  3A5Z B;  3QZ5 B;  1M2V B;  5GAN 3;  2DE0 X;  1WX6 A;  1VYU A;  4LE9 A;  5HCK A;  1KSW A;  2HL3 A;  4JS4 A;  2YWW A;  2QQB A;  5I2M A;  1WPY A;  3CCR A;  3MP6 A;  5KYU A;  2MF2 A;  4KH1 B;  2E5Q A;  4FT2 A;  2X4J A;  1IGQ A;  4ANJ A;  3CCE T;  1RLP C;  4JZ4 A;  2OAW A;  2RQV A;  3RMQ A;  3BY7 A;  4L6V 5;  1MV3 A;  4RKU E;  2KQW A;  1MGQ A;  1UDL A;  2FZC B;  1IO6 A;  3L42 A;  1N5Z A;  4J9H A;  1UGV A;  1H92 A;  4RG8 A;  2DTI A;  2JT4 A;  5D6Y A;  2R5M A;  4FYV B;  3GP8 A;  2YSQ A;  3A8G B;  1Q81 U;  3TVT A;  1FMV A;  2LQK A;  1RAE B;  2ZGW A;  3CXC P;  1XTD A;  1YWP A;  1MMA A;  3JCM g;  2EJ9 A;  3RDV A;  5AT1 B;  2KBT A;  1YIJ T;  5FU7 B;  3CCV T;  2LTO A;  2RHY A;  2F5K A;  2QAS A;  2DZ9 A;  1VQM A;  1K9A A;  5FRM A;  3JB9 F;  2X3W D;  2YHT A;  5GMK e;  4MDW A;  3VS7 A;  2E64 A;  3M0Q A;  3CCV Q;  4FU6 A;  1VQ9 A;  1KHI A;  2DTO A;  3EFS A;  1WI7 A;  5FU6 B;  1FYN A;  2DL5 A;  3I9Q A;  2K3B A;  3QDF A;  5CIU A;  2YRV A;  4JLG A;  2QI2 A;  3PMT A;  4C0G A;  1UJ0 A;  1QCF A;  2M16 A;  5GAM e;  2KRS A;  2ECZ A;  2KXD A;  2X4W A;  2GF7 A;  2CT4 A;  2E6N A;  4Q5W A;  1U06 A;  1LPL A;  4FL6 A;  2K5L A;  2KSS A;  2MK5 A;  1GCQ A;  3OYA A;  4J9D A;  1X2K A;  3TSZ A;  2F2V A;  3QJ6 A;  1BCO A;  2KXC A;  3CD6 T;  2EVR A;  1UGR B;  3R6O A;  5GAM h;  5CQY A;  5HKC A;  1UTI A;  3I55 T;  3CME Q;  1G2B A;  1Y96 B;  4J7I A;  4IKF A;  1PKS A;  1VOM A;  2Z0W A;  4ZGE B;  1R0C B;  1YP5 A;  1T0J A;  4XTY A;  5GMK l;  3PMI A;  4KT0 E;  4BY6 C;  1YIT A;  3PT9 A;  2K2V A;  3C0C A;  3CCJ T;  1RUW A;  4AMC A;  1NZ9 A;  1QP3 A;  2FPE A;  3F70 A;  5A2Q E;  4EPC A;  2HBP A;  1ZQ1 A;  1T3L A;  2FHD A;  1MUZ A;  2DKG A;  5GAO m;  1M2V A;  1YCY A;  3EHR A;  5A0D A;  1WHL A;  1QVG A;  4C5G A;  1RAB B;  2DL7 A;  2JZ2 A;  2VC8 A;  3OYM A;  2LQ8 A;  5GAN 5;  1UGQ B;  2DTH A;  2DD5 A;  4PJJ A;  1VQ4 A;  1WHH A;  4CC3 A;  4KUD K;  1ARK A;  4DA4 A;  3NTH A;  3OS2 A;  1D09 B;  1Z9Q A;  3M0S A;  2LNH B;  3I35 A;  3M0R A;  4M7D F;  4OMQ A;  1HK9 A;  1VQ8 A;  1OEB A;  1W4S A;  2QQA A;  1M3B A;  4C92 B;  1YI2 A;  4DOV A;  3M57 A;  1UUE A;  2HSE B;  4OP0 A;  1RAH B;  3DKM A;  5IXF A;  2RHU A;  3M53 A;  3CCS A;  1ZUK A;  2YLB A;  4WCI A;  3RMS A;  3OY9 A;  5LL6 S;  2R5A A;  3EFO B;  3VUB A;  2JVV A;  2CH4 W;  1VQL T;  4FW2 A;  1E6G A;  2X51 A;  2LX7 A;  3CC7 T;  1PNJ A;  3MP8 A;  3EH2 A;  1WQW A;  2M1H A;  4KUL A;  5KYY B;  2E6Z A;  5LJ3 f;  3JB9 D;  1N8R U;  2KT1 A;  3OYC A;  5IHK A;  4J6Y A;  1VQL Q;  1OPL A;  3S3N A;  2OTL T;  2O31 A;  2K3X A;  3P8H A;  4BDY A;  4HCC A;  1KQ2 A;  3TCJ A;  3GNF B;  1VQ5 T;  2DFU A;  2KEA A;  5LJ5 f;  3G4S T;  1VQK T;  1K0X A;  2CDT A;  4QKU A;  3C95 A;  1NPR A;  2DMO A;  2QAZ A;  3CPW A;  3VRY A;  1JBM A;  2JMC A;  2RNA A;  4IUP A;  3JB9 G;  3H6Z A;  2K2M A;  4D8D A;  1VQ5 Q;  3CMA T;  4FSX A;  4JDS A;  1VQK Q;  2VYT A;  1MNE A;  2FB7 A;  5IN1 A;  3SHW A;  1D1B A;  2J6K A;  3VKI A;  2RO0 A;  2JOY A;  4AG1 C;  1UFF A;  1D0Y A;  3MJX A;  2GFA A;  1YHQ T;  3VRZ A;  3G71 Q;  1PD0 A;  1Q81 C;  2PVO B;  1Z9Z A;  3HRS A;  3REB B;  3IQL A;  3L2W A;  2PQW A;  4RTX A;  2QEX T;  5HK3 A;  1PRM C;  1QP2 A;  4AFQ C;  4TVR A;  1WHJ A;  3J81 E;  3CCL A;  1IHV A;  1EZZ B;  1Y96 A;  1KQS A;  4HT9 A;  3V8K A;  1VQN T;  5FU7 C;  3WVE B;  2EWN A;  1H3Z A;  5I2S A;  2XDD A;  5FWB A;  1YJW A;  2CZ6 B;  2X3X D;  2RF0 A;  1CKB A;  3CCU T;  2HBW A;  1WIE A;  1W6X A;  5FRN A;  2FPD A;  2WSF E;  1XNI A;  2NUZ A;  1MHN A;  5FU6 C;  5GAN f;  5J26 A;  1D0Z A;  1LVK A;  2DJZ A;  2KRM A;  4QQG A;  1Q7Y U;  1VUB A;  3CCU Q;  1KFZ A;  4C92 G;  2ZCF B;  2A0F B;  2AIR B;  4AFZ C;  4Y28 E;  2X35 A;  1UGP B;  3TSW A;  2E10 A;  4LN2 A;  5FRO A;  1QVF S;  1Q82 R;  1M1F A;  2MCN A;  1NE8 A;  1X27 A;  1C0M A;  1MMD A;  2BZY A;  1GRI A;  2FG0 A;  3C12 A;  4HVV A;  2A28 A;  4JRP A;  4EDU A;  2F2X A;  2A08 A;  1WXU A;  2KAF A;  2FPF A;  4C0D B;  4N0A C;  2ENM A;  3BE3 A;  4C92 A;  2E3I A;  3EG3 A;  2B86 A;  4XQ3 A;  1BB9 A;  4J9F A;  2HDA A;  1KIK A;  2CP5 A;  2L3Q A;  1BYM A;  3PVQ A;  4E7H A;  1G3W A;  4IUV A;  3SEM A;  2XK0 A;  3NPF A;  1OU9 A;  2R57 A;  5GJW B;  5L23 A;  3CCQ A;  1GBR A;  3EFO A;  3JCM X;  2HKQ B;  2SEM A;  1QQJ A;  4HCK A;  4PFZ A;  3THK A;  2XI9 A;  5KYY A;  4BI8 B;  1WDX A;  3H0H A;  4OB2 B;  2RM4 A;  5FWC A;  1YCS B;  3I5R A;  4JJC A;  3LYI A;  1M8V A;  1C1A A;  4X9C A;  2QDY B;  3JCM f;  4B9X A;  4XU0 A;  2DET A;  1Q82 U;  2DL4 A;  2FRW A;  3EH1 A;  2O4X B;  4X9D A;  1TSF A;  4HVW A;  4BE1 A;  4E7J A;  2L0A A;  5HY6 A;  1IZ6 A;  3EG1 A;  8ATC B;  3QJY A;  4M78 C;  2PTK A;  3ZBD A;  4C0F A;  4C8Q B;  3PVL A;  2JS2 A;  3HSB A;  2HEQ A;  4PJO B;  3JCM V;  1C6V X;  2DXU A;  2CSI A;  2RHZ A;  1NLP C;  3JCM b;  1SRM A;  2BE9 B;  3MP1 A;  2J05 A;  4OB1 B;  1M1G A;  4M75 B;  1VQO A;  2PNI A;  2K6D A;  1PM3 A;  4C92 C;  2A37 A;  1NBE B;  4R0K A;  2RHI A;  1YJN A;  3OYL A;  4QVD A;  3N5B B;  2DYI A;  2VGN A;  3RER A;  2GBQ A;  1QWF A;  3UA7 A;  2DF6 A;  3CPW P;  3CBO A;  1N8R C;  1VQP Q;  5CKH A;  1EIF A;  2VV5 A;  3JCM c;  1O9S A;  2QQR A;  3PNW C;  4IUQ A;  4AT1 B;  2QDL A;  1VIE A;  2R58 A;  4HCB A;  2YXY A;  4X1V A;  2KGT A;  1X6G A;  2OTJ T;  1ZSZ B;  4E7K A;  2BZ8 A;  3A8O B;  5CKD A;  4JLI A;  1KHC A;  3GIB A;  3NTK A;  2KVQ G;  2XMF A;  4MZM A;  3FB9 A;  2PU9 B;  1WHM A;  2OTJ Q;  4A4E A;  1ZUY A;  1ZBJ A;  3SFM A;  5I22 A;  1RAG B;  1D3B B;  1OZ2 A;  2MIO A;  4C92 E;  2EJF A;  2D6F A;  3AT1 B;  1QVP A;  4R55 A;  4GLM A;  1B7T A;  4DQ2 A;  5GAN 6;  3OYI A;  1EFN A;  3QXE B;  4J9B A;  3C4S A;  3LH5 A;  3OA6 A;  2V8I A;  2F2W A;  4FYY B;  3O8V A;  4B9W A;  1OOT A;  1G3S A;  3L1A A;  3GNG A;  1EX4 A;  1RAF B;  5IH2 A;  3CC4 Q;  3UAT A;  8AT1 B;  1BI0 A;  2O2O A;  3V7S A;  1JO8 A;  1WXT A;  3EGU A;  4ESR A;  5I21 A;  4PJO D;  3PE0 A;  1AEY A;  2J06 A;  3CXC S;  2X4Y A;  5KYW B;  3EGD B;  3ZEH A;  3OMC A;  2QA4 A;  1Q81 R;  3QYG B;  4M75 D;  1M90 U;  2DRK A;  1NG2 A;  2DX1 A;  2VVK A;  4LDV A;  4WTO B;  1SSH A;  3H8Z A;  4A4G A;  2GTJ A;  1BCM A;  2DYB A;  2XU8 A;  1QLY A;  4ME7 A;  4XTV A;  1Q7Y C;  4MDX A;  4PJO G;  1CKA A;  2CH4 A;  3NFC A;  1D1C A;  2CP6 A;  1ZLM A;  2EQI A;  2ESW A;  1UHF A;  3P8D A;  4X34 A;  4M75 G;  1KG1 A;  1YNZ A;  2BZX A;  1M5Q 1;  2O4X A;  3I56 T;  2E65 A;  4KBM B;  5HK0 A;  3CCR Q;  3VS3 A;  1KD1 R;  1VQ6 A;  2LJ3 A;  2FZG B;  1WGS A;  4ELY C;  4C8Q A;  1GBQ A;  2D8H A;  4PJO A;  3I56 Q;  3OYK A;  2YUQ A;  5C6S A;  2ZZD A;  4ZNX A;  5I11 A;  2H8H A;  1RLQ C;  1E7O A;  1RAC B;  2QTV A;  5LJ3 e;  3E19 A;  4M75 A;  3CCE A;  2FYK A;  4RTU A;  2VUB A;  3NMZ C;  2DAQ A;  3SB2 A;  5GMK j;  4FW1 A;  2EIF A;  1WA7 A;  3X24 B;  4HVU A;  4PJM A;  5LJ5 e;  3EHQ A;  2EBP A;  3OBW A;  4RTY A;  3HP9 A;  3BW1 A;  4OMN A;  4M7A F;  3A8L B;  3H41 A;  4RTT A;  1SRL A;  3NHN A;  5LJ3 h;  4JJB A;  4JS5 A;  4JUV A;  1BU1 A;  5GAM j;  2SRC A;  3P8B B;  2XDP A;  3PIO A;  1I8F A;  4LDU A;  2EAY A;  1Q82 C;  2L3S A;  2KK4 A;  2XID A;  3GBQ A;  2BUD A;  5L8R E;  1ZSZ A;  5GAN 7;  1WQ7 A;  2JUF A;  4OGE A;  1KD1 U;  5LJ5 h;  4JRQ A;  1YIJ A;  1RI9 A;  4QQD A;  3CCV A;  1WLP B;  1XJW B;  1HSQ A;  1S72 T;  4J5Y A;  1P92 A;  4C8Q C;  3O5Z A;  5ECA A;  1D3B A;  5KYX B;  2V26 A;  1JEG A;  2IPO B;  1S72 Q;  1QKX A;  2Y90 A;  1PHT A;  1PWT A;  3HPW A;  3CME T;  2NWM A;  4M75 C;  2DXB A;  3MEV A;  1WNL A;  1X01 A;  4E47 A;  4IUR A;  5KE3 A;  1M9S A;  1GXI E;  2V1Q A;  2I2L A;  3VS5 A;  1IHW A;  1ZSG A;  3OW2 P;  4II1 A;  3CBP A;  2X9H A;  1I0C A;  2RI2 A;  1W2B A;  1Y0M A;  1QW1 A;  3MO8 A;  3QWY A;  4DEY A;  2RQR A;  2LNV A;  3EG0 A;  5FLX E;  1ABO A;  5GAN e;  1TOV A;  4FSS A;  4O6J A;  4E7L A;  2GFU A;  3CD6 A;  5KYW A;  3EGD A;  1NEG A;  4UC4 A;  1NPP A;  2DXC A;  2CZ0 B;  4PFO A;  2DM1 A;  1PC0 A;  1YIT Q;  3I55 A;  1ZSZ C;  4M78 F;  3HTR A;  3TQ7 P;  5KH6 A;  4C8Q E;  1AOJ A;  2DVJ A;  1QCO A;  4PJO E;  2BIV A;  1N8R R;  3JCM W;  4CC2 A;  2LDM A;  2HCK A;  5GAM d;  2HD0 A;  1OU8 A;  1KJW A;  2RJC A;  1WXB A;  2LZ6 B;  3OS1 A;  4M75 E;  5GAN h;  1RAD B;  4PLI A;  1R0B G;  4M77 F;  2ZPF B;  4QQ6 A;  3QKJ A;  1GCQ C;  4E7S A;  1I81 A;  3CCJ A;  2E12 A;  2DXT A;  4F7U F;  1UE9 A;  3L2R A;  4XTX A;  3SDZ A;  1AWW A;  4F17 A;  1TUD A;  4FYX B;  3OBY A;  4BE0 A;  2O01 E;  2DBM A;  3LGF A;  3FRN A;  2W0Z A;  3CEY A;  4OML A;  2OI3 A;  1H8K A;  1YI2 Q;  1Y57 A;  3OYD A;  3UWN A;  2HL5 C;  4L5G A;  1D0X A;  2EQJ A;  3S3O A;  2W10 A;  2ZPG B;  1UEB A;  2FVU A;  3H9N A;  3X28 B;  1M90 C;  2CRE A;  5KYN A;  1VQ7 T;  1U8R A;  4VUB A;  1V76 A;  3QUI A;  4XTW A;  5CCA A;  2AKL A;  1NM7 A;  4JJD A;  5CAI A;  1UEC A;  2P0K A;  3OYB A;  2LJ0 A;  1QVF A;  2WSC E;  1VQ7 Q;  1LJO A;  1VQL A;  1R8O B;  4LDW A;  1OPK A;  2DRM A;  2GTO A;  3CC7 A;  1LCK A;  3V8J A;  1T0H A;  4J9I A;  3JB9 I;  1JXO A;  2EYX A;  4FIB A;  3JCM h;  1F1B B;  3OB9 A;  3RKX A;  2DLP A;  2F5T X;  1IGU A;  2MMP A;  2OTL A;  3RR6 A;  1WJQ A;  2MPX C;  4EIK A;  1OYX A;  3G71 T;  1Q95 G;  1GFD A;  2MI6 A;  2LQN A;  1KC8 U;  1VQ5 A;  3PTA A;  3WXM B;  4ZGD B;  4JZ3 A;  2FO0 A;  1PSE A;  3G4S A;  1VQK A;  1Q7Y R;  5IAY A;  2LRQ A;  2V8K A;  1N27 A;  4L59 A;  1AT1 B;  2RHX A;  2DZC A;  3CMA A;  3CC2 T;  2CSQ A;  2QGG A;  1WHG A;  4Y92 A;  2OX7 A;  4NL2 A;  1AWX A;  3QPH A;  2O88 A;  1H64 1;  1VA7 A;  3Q1J A;  4A4H A;  3HFN A;  3ZL7 C;  1UB4 A;  3DLL A;  4PJN A;  3VJP A;  3RUX A;  3CC2 Q;  4GBQ A;  3S6W A;  4OB3 B;  1YHQ A;  2O9V A;  4ATO A;  2HKN A;  4RTV A;  2EKH A;  2KE9 A;  2A36 A;  2RI5 A;  3OYN A;  3VU3 C;  4AFS C;  5AYF A;  3T9N A;  5C0M A;  5CKF A;  3U23 A;  1BI2 A;  1ABQ A;  2QEX A;  3VV0 A;  4EMH A;  2L89 A;  4N4H A;  1KD1 C;  1YJW Q;  4M4Z A;  4OMF B;  2PUO B;  2LC4 A;  3M0P A;  2PVG B;  1VQN A;  5GAO q;  4EMK B;  2JM8 A;  2QG9 B;  4J8O A;  3E9F A;  2M02 A;  2ATC B;  2GCX A;  1U1T A;  4LDX A;  2YT6 A;  1Y07 A;  1U5S A;  3CCU A;  1W2B P;  2CYZ B;  4M7D D;  2A3L A;  1OX8 A;  4A4F A;  2DEQ A;  2ZPE B;  3I5S A;  3GOX A;  1TTH B;  3M54 A;  1M3C A;  5J3B A;  2GGR A;  1G3T A;  1G3Y A;  3VS0 A;  2D1X A;  5GAO r;  2OAU A;  2A7Y A;  3QG1 A;  2EGE A;  4M7D G;  2CUB A;  1VIF A;  2EGA A;  3CPW S;  1QVG P;  2RQW A;  3OMG A;  1RL2 A;  3FJ5 A;  3BFM A;  1SHF A;  4BAC A;  1X69 A;  1OX9 A;  3RNJ A;  3CCQ Q;  2QYZ A;  1SSF A;  1UJY A;  4KGZ B;  2K5I A;  3VYH B;  4RTZ A;  4KRT A;  2YRD A;  4ZN1 A;  1V1C A;  6AT1 B;  2CP3 A;  3CCM T;  3HKS A;  3LWH A;  2ROL A;  4J7F A;  1K8A U;  3JSC A;  2G6F X;  1WFW A;  4KH0 B;  4QT7 A;  2H3E B;  1LNX A;  3UDC A;  3D7S B;  3HHT B;  3SD4 A;  4Z89 A;  4PLL A;  3CCM Q;  2DA9 A;  2COZ A;  1U1S A;  2QTX A;  3UT1 A;  2IG0 A;  4DBF A;  5GMK m;  4PKC C;  4OMO A;  4C5H A;  3ME9 A;  3S3M A;  1OUL A;  3LW5 E;  1JJ2 S;  3CXC A;  4YTL A;  2DL8 A;  2CP2 A;  3LX7 A;  3EG2 A;  1ZA2 B;  2JN0 A;  5GAO p;  1ACM B;  2LJ1 A;  3GPL A;  1GL5 A;  2VKN A;  1VQP T;  2P4T A;  1VQO Q;  4PNO A;  2K7A A;  2RJD A;  1B34 B;  2JS0 A;  3FEO A;  3VS4 A;  2KDS A;  1YJN Q;  3A1P A;  9ATC B;  2ZAE A;  3V8L A;  3JV3 A;  4E7I A;  2RJF A;  3RKY A;  2LP5 A;  3A8M B;  4FT4 A;  2AHJ B;  5GAO l;  1K0S A;  3MHX A;  1QWE A;  2HNI A;  7AT1 B;  4N4G A;  3G6E T;  4K11 A;  2EYW A;  3MEA A;  1TUG B;  3FDR A;  3OS0 A;  2GNC A;  4DBQ A;  2AK5 A;  3OYG A;  1M90 R;  1CSK A;  4C0Z A;  2EW3 A;  2XG8 D;  4XTU A;  3G6E Q;  3E2U A;  3HRU A;  3PGG A;  2HSP A;  2C06 A;  1KC8 C;  2DIL A;  3UA6 A;  2ZPB B;  2RN8 A;  4ZGJ B;  2OTJ A;  2D9T A;  3ULR B;  4EMK A;  5CKE A;  1QMC A;  4LUE A;  1KQS P;  4F14 A;  2VXE A;  5GAM g;  3CC4 T;  3VS1 A;  4D6W A;  1K9M U;  5A0G A;  2LT1 A;  2L2P A;  3OS5 A;  1JQQ A;  2JXB A;  4LNP A;  2GQV A;  1HJD A;  1RAA B;  1AHJ B;  5GAN 2;  1MMG A;  2J6O A;  3NGP A;  4P5N A;  4PK4 A;  1M27 C;  2VAS A;  1X75 C;  2LVM A;  3WVD B;  3L2U A;  1BK2 A;  3QII A;  1PCX A;  1TUC A;  3MEU A;  2QA4 T;  3MCA B;  1BIB A;  1AWJ A;  2DIQ A;  3C94 A;  3MPU B;  3PIP A;  2QXF A;  5D6W A;  3EFR A;  2HQH A;  4N4I A;  1IXD A;  5GAO n;  4Z88 A;  2KYB A;  2QA4 Q;  1YJ9 T;  4GY5 A;  2COY A;  2V8J A;  2KMT A;  4NS5 A;  3JB9 H;  2J7I A;  4BUG A;  1TG0 A;  5CQX A;  3RKW A;  3OYJ A;  2XKO C;  3VS2 A;  4BD3 A;  5GAN g;  2K9G A;  1K76 A;  3M55 A;  3LGL A;  1JU5 C;  1WJR A;  3M0T A;  3M9Q A;  3HL8 A;  1YJ9 Q;  4J9E A;  2JTF A;  3CCR T;  1RAI B;  1OV3 A;  2V1R A;  4EMK C;  4OMM A;  1SEM A;  2E5K A;  4Y91 A;  2MAM A;  3M4G A;  5LJ3 j;  1Y7X A;  2M9U A;  4HA8 A;  3L2V A;  2DK3 A;  2BE7 D;  2RI3 A;  1H3H A;  1V29 B;  2JJ9 A;  2LX9 A;  3CPF A;  4OF1 A;  5EG2 A;  2KRO A;  2E4H A;  1M2O A;  3INZ A;  1VQ6 Q;  5LJ5 j;  1I07 A;  5IT9 E;  3R6N A;  4C0D C;  3I56 A;  3KUF A;  2RMO A;  1TH7 A;  2CT3 A;  3L2Z A;  3CCE Q;  3OW2 S;  2XD0 A;  1Q86 R;  4BI3 A;  1B34 A;  1OQK A;  2LCC A;  3UPU A;  1TWB A;  2L3P A;  2RJE A;  1VQM T;  4A53 A;  4NOY A;  4ZTF A;  4KUI A;  1JRI A;  1K1Z A;  4GLK A;  3LH0 A;  2NUT B;  2CZ7 B;  4JPB W;  1VQ9 T;  1VQM Q;  2G3R A;  1K8A C;  2YDL A;  1ZUU A;  2RQU A;  1B3Q A;  1FX7 A;  1U3O A;  4FYW B;  2Y4Y A;  4XAX B;  2JW4 A;  1YFN A;  2J6F A;  3NTI A;  4A54 A;  2DER A;  2IIM A;  1QCN A;  1VQ9 Q;  1HD3 A;  2EYZ A;  4ZN3 A;  2E3H A;  1M3A A;  3QO3 A;  4MZP A;  1I4K 1;  1YIJ Q;  4OB0 B;  3G1J A;  2E70 A;  1QKW A;  4PJO C;  4LUD A;  4DOW A;  4M7A B;  2B8A A;  2WAC A;  1X43 A;  2LT4 A;  5LJ3 d;  2JM9 A;  1WYX A;  1Q86 U;  2DL3 A;  1FWZ A;  1S72 A;  1TU0 B;  5GAN j;  3EGX B;  4J9C A;  5GMK h;  2K5F A;  5D6X A;  5LJ5 d;  3SWN B;  4DEX A;  4IIO A;  2KT8 A;  5IHN A;  3EG9 B;  2K4Y A;  5IHI A;  2WSE E;  4F16 A;  5KCO A;  2FEI A;  5DY9 A;  2L5Q A;  3ASK A;  3JAM E;  1YIT T;  2CP0 A;  2O9S A;  1AZE A;  4R56 A;  3CME A;  2YUP A;  2D0Q B;  4MZT A;  1G83 A;  2KYM A;  2HMA A;  1IB8 A;  4QVC A;  1M1K R;  2C0T A;  1DJ7 B;  2JMA A;  1K73 R;  3CD6 Q;  3VS6 A;  4CI0 C;  2AZV A;  1BIA A;  3JCM P;  1T3S A;  4QW2 A;  3I55 Q;  1FMK A;  1GCP A;  4E2F B;  1OZ3 A;  2DD4 A;  3G7Z A;  2EYY A;  4FCY A;  2AT1 B;  1I5L A;  1VQ4 T;  4C92 F;  2P4R A;  4MML A;  1X6O A;  2F1L A;  4BE2 A;  1SF9 A;  1GFC A;  1HXD A;  4HXJ A;  4HKE A;  4O5V A;  2K3Y A;  2RQT A;  1G8X A;  1K9M C;  5GAN 8;  1KQ1 A;  3L2Q A;  3M0U A;  1VQ4 Q;  1VQ8 T;  2QQ9 A;  3CCJ Q;  2H3J A;  2RD1 A;  4RMO A;  3PFS A;  1YI2 T;  4RG2 A;  4M78 B;  2L8D A;  1KC8 R;  4IIM A;  2CUD A;  4KGV B;  1VQ8 Q;  1M8M A;  3CCS T;  1E6H A;  2BTT A;  1A0N B;  3V7C A;  2MYS A;  1X2Q A;  2HQX A;  5IXB A;  1ZX6 A;  4J83 A;  5GAN d;  1M1K U;  3VUZ A;  4D8K A;  2AZS A;  3CCS Q;  2MOX A;  1K73 U;  2PVD B;  2RK2 A;  4M77 B;  3JCM e;  2YUN A;  1N6A A;  3LWI A;  3H0I A;  4M7A D;  1NYG A;  2ZPH B;  4F7U B;  2P84 A;  1NEB A;  2XIC A;  3BDL A;  5A0L A;  2E41 A;  4XU2 A;  4M7D B;  2M51 A;  4JRI A;  3X26 B;  2XHC A;  3E9G A;  2NUT A;  5CKB A;  1BKB A;  3J80 E;  1UHC A;  2KR3 A;  4XU3 A;  2FL7 A;  3M56 A;  1VQ7 A;  4CC4 B;  2X4X A;  3QBY A;  1NJI R;  4M7A G;  5DM7 R;  2DNU A;  1MND A;  3CC7 Q;  2DJQ A;  4RCB A;  3FIF A;  2XDB A;  1PD1 A;  1W70 A;  2NUP B;  2P0P A;  4LXC A;  2KRN A;  2BKD N;  3LLR A;  1YWO A;  1PG5 B;  2F69 A;  1I1J A;  4KGX B;  3GF5 A;  2CKK A;  2VXF A;  3M4Y A;  2OTL Q;  4JJN K;  4HT8 A;  1BBZ A;  2QQS A;  1W2B S;  2DBK A;  3ER0 A;  5KYX A;  2RK1 A;  3H0F A;  2JNG A;  3JB9 J;  1NYF A;  3G4S Q;  4M7A A;  4EMG A;  1ZA1 B;  1AZG B;  5CVI A;  3M58 A;  3URG A;  2P0Q A;  4BB7 A;  3G71 A;  1AD5 A;  3CMA Q;  2YLC A;  3DLM A;  1AVZ C;  3RBB B;  2L3R A;  4BI4 A;  3JCM d;  3EGX A;  3CCL T;  1NLO C;  3FLG A;  2CP7 A;  3SWN A;  1IRE B;  5GAM f;  2QGF B;  3EG9 A;  1QVG S;  3CC2 A;  3CCL Q;  1YJW T;  1AWO A;  2HQE A;  1YHQ Q;  3ZFJ A;  1NJI U;  3QHS A;  4N0A A;  1HYO A;  2AKK A;  4M78 D;  2DIG A;  1JJ2 A;  2OJ2 A;  3KBG A;  4PL6 A;  3X20 B;  1UG1 A;  2D0N A;  2QEX Q;  4DBH A;  4ZTJ A;  1FMW A;  3MET A;  1R77 A;  1VYV A;  4RTW A;  1TS9 A;  3CQT A;  1RI0 A;  2RB6 A;  5CO7 A;  4C92 D;  4M77 D;  3J7A F;  2M0O A;  1ZBX A;  4M78 G;  3M59 A;  1VQN Q;  1WHK A;  2ED1 A;  4J9G A;  1K8A R;  2K79 A;  4MMK A;  2EJG A;  2D8J A;  2QK0 A;  5DLQ E;  2JTM A;  3VYG A;  1Q86 C;  2HZY A;  2M0Y A;  4M7A C;  2DO3 A;  4J6X A;  3X25 B;  1UGS B;  4OVA A;  1SPK A;  5J39 A;  2LCS A;  4M77 G;  2Y4X A;  1S1N A;  2I0N A;  1PKT A;  2IVW A;  1M30 A;  4LD9 K;  4F7U G;  2CS7 A;  1B07 A;  1LOJ A;  4M78 A;  1BI3 A;  2VB6 A;  2KI7 A;  3SWN C;  3KXT A;  3CCQ T;  3OYY A;  1KK7 A;  3A8H B;  1BI1 A;  2ROT A;  3REA B;  4ORZ A;  4BDZ A;  1I5O B;  4DBR A;  2VGM A;  2DEU A;  3DB3 A;  1XOV A;  3E1S A;  4M77 A;  2YUO A;  3RIR A;  3M5A A;  3OQ5 A;  3KFV A;  4F7U A;  3OSS C;  1SG5 A;  2VWF A;  2EQK A;  4C8Q F;  4RUG A;  4PJO F;  4CC7 A;  4M7D A;  1XQH A;  4PFP A;  2MWO A;  4M7A E;  2LQW A;  2C0I A;  2DPP B;  2YRC A;  4XK8 E;  2DVE A;  5DLO A;  4M75 F;  3DB4 A;  2EGC A;  2GQI A;  2KNB B;  4WF2 A;  2EPD A;  2NUP A;  4QVZ A;  3HFO A;  2LCL A;  3AHU A;  3CCM A;  3EAE A;  5KE2 A;  5KYU B;  4NL3 A;  3TU4 K;  1VQO T;  3RES A; 
#chains in the Genus database with same CATH homology
 3M0T A;  4J9E A;  1ABO A;  1OV3 A;  4FSS A;  1Z9Z A;  2V1R A;  3REB B;  4OMM A;  1NEG A;  1SEM A;  3IQL A;  2E5K A;  2C0O A;  2DM1 A;  4RTX A;  1X6B A;  1PRM C;  4AFQ C;  1J3T A;  1H3H A;  1AOJ A;  2DVJ A;  4CC2 A;  3UF4 A;  2HCK A;  1JXM A;  2KRO A;  2JTE A;  1KJW A;  1WXB A;  2LZ6 B;  1I07 A;  5FWB A;  3R6N A;  1K4U S;  1GCQ C;  2X3X D;  5GJV B;  4A63 B;  2RF0 A;  1CKB A;  2HBW A;  1UE9 A;  2RMO A;  2CT3 A;  1WIE A;  1W6X A;  2FPD A;  1AWW A;  4E6R A;  4F17 A;  1TUD A;  2NUZ A;  1VYT A;  2KRM A;  2L3P A;  2DBM A;  1KFZ A;  2W0Z A;  1K1Z A;  4OML A;  4AFZ C;  2OI3 A;  3TSW A;  4LN2 A;  1PRL C;  4JPB W;  1H8K A;  1Y57 A;  4AFU C;  2YDL A;  2MCN A;  1ZUU A;  1X27 A;  2RQU A;  2ABL A;  1B3Q A;  1U3O A;  2ED0 A;  2W10 A;  5FW9 A;  2BZY A;  1GRI A;  2JW4 A;  2CRE A;  2FRY A;  2FG0 A;  2J6F A;  4HVV A;  2A28 A;  2F2X A;  2IIM A;  2A08 A;  1WXU A;  1HD3 A;  2EYZ A;  2FPF A;  1W1F A;  2AKL A;  1NM7 A;  2ENM A;  4JJD A;  1UEC A;  1M3A A;  2LJ0 A;  3EG3 A;  2B86 A;  1BB9 A;  2RPN A;  4J9F A;  1QKW A;  2HDA A;  1KIK A;  2L3Q A;  4LUD A;  1OPK A;  2DRM A;  3PVQ A;  2GTO A;  1LCK A;  3SEM A;  1T0H A;  3NPF A;  4J9I A;  5GJW B;  5L23 A;  1GBR A;  2SEM A;  1X43 A;  3A98 A;  1JXO A;  2EYX A;  2JM9 A;  2PZ1 A;  1WYX A;  3VRZ A;  4HCK A;  2DLP A;  2DL3 A;  3THK A;  1WDX A;  3H0H A;  4J9C A;  4EIK A;  1GFD A;  5FWC A;  1MV0 B;  1YCS B;  2LQN A;  3I5R A;  4JJC A;  4JZ3 A;  2FO0 A;  4IIO A;  2KT8 A;  4DEX A;  5IHN A;  4AG2 C;  4Z8A A;  5IHI A;  4F16 A;  2FEI A;  1SHG A;  2DL4 A;  2FRW A;  2O9S A;  1AZE A;  4OMP A;  2LMJ A;  2YUP A;  4HVW A;  5EC7 A;  2L0A A;  2CSQ A;  3QWX X;  4Y92 A;  3EG1 A;  1AWX A;  1G83 A;  2O88 A;  2KYM A;  2PTK A;  1VA7 A;  3PVL A;  2JS2 A;  1YN8 A;  3ZL7 C;  2C0T A;  2HEQ A;  2JMA A;  2DE0 X;  3VS6 A;  2CSI A;  1WX6 A;  1NLP C;  2AZV A;  1VYU A;  4LE9 A;  4GBQ A;  5HCK A;  1KSW A;  1SRM A;  2J05 A;  1T3S A;  2O9V A;  1FMK A;  4RTV A;  2PNI A;  2EKH A;  2K6D A;  2A36 A;  2KE9 A;  1GCP A;  2A37 A;  4R0K A;  2EYY A;  4AFS C;  1RLP C;  4JZ4 A;  2OAW A;  2RQV A;  2P4R A;  3U23 A;  1ABQ A;  1GFC A;  2GBQ A;  1QWF A;  3UA7 A;  4HXJ A;  1MV3 A;  2DF6 A;  2RQT A;  1UDL A;  3M0U A;  4M4Z A;  1IO6 A;  1N5Z A;  4J9H A;  1UGV A;  1H92 A;  3M0P A;  2JT4 A;  2QDL A;  2JM8 A;  2YSQ A;  4IIM A;  2CUD A;  4X1V A;  2KGT A;  3TVT A;  1M8M A;  1X6G A;  1E6H A;  2BTT A;  2YT6 A;  1A0N B;  2BZ8 A;  1U5S A;  1X2Q A;  1YWP A;  5IXB A;  1ZX6 A;  2XMF A;  4D8K A;  2AZS A;  2MOX A;  2KBT A;  1ZUY A;  3I5S A;  2YUN A;  1ZBJ A;  3H0I A;  5I22 A;  1K9A A;  1NYG A;  2MIO A;  2X3W D;  1M3C A;  2GGR A;  1NEB A;  3VS0 A;  2D1X A;  3VS7 A;  3M0Q A;  2M51 A;  4GLM A;  2EGE A;  1WI7 A;  1EFN A;  2CUB A;  1FYN A;  1UHC A;  2KR3 A;  2DL5 A;  2EGA A;  4J9B A;  3I9Q A;  2K3B A;  3LH5 A;  2RQW A;  3FJ5 A;  2F2W A;  4CC4 B;  1OOT A;  1UJ0 A;  1QCF A;  2DNU A;  1SHF A;  2DJQ A;  2KRS A;  2ECZ A;  1X69 A;  1W70 A;  2KXD A;  3RNJ A;  2CT4 A;  2KRN A;  5IH2 A;  1U06 A;  1UJY A;  1YWO A;  3UAT A;  2O2O A;  1I1J A;  1GCQ A;  1JO8 A;  4RTZ A;  1WXT A;  4J9D A;  1X2K A;  3TSZ A;  4KRT A;  3EGU A;  4ESR A;  1BBZ A;  2F2V A;  3PE0 A;  1V1C A;  2J06 A;  1AEY A;  2DBK A;  2ROL A;  3H0F A;  2G6F X;  1WFW A;  1NYF A;  2KXC A;  4QT7 A;  1AZG B;  4Z89 A;  2EVR A;  2DRK A;  1NG2 A;  2DX1 A;  2VVK A;  2DA9 A;  1UTI A;  1SSH A;  1G2B A;  1AD5 A;  4OMO A;  2GTJ A;  2DYB A;  1QLY A;  1PKS A;  1AVZ C;  3RBB B;  1CKA A;  1NLO C;  2CH4 A;  1YP5 A;  1T0J A;  2DL8 A;  1ZLM A;  3EG2 A;  2EQI A;  2ESW A;  1UHF A;  3C0C A;  2LJ1 A;  1GL5 A;  1YNZ A;  2BZX A;  2VKN A;  1AWO A;  2AKK A;  1RUW A;  2K7A A;  2FPE A;  3VS3 A;  2JS0 A;  3VS4 A;  2LJ3 A;  2OJ2 A;  1GBQ A;  1T3L A;  1MUZ A;  2D8H A;  3JV3 A;  1UG1 A;  2YUQ A;  2D0N A;  4ZNX A;  5I11 A;  3EHR A;  2H8H A;  1RLQ C;  1E7O A;  2LP5 A;  1VYV A;  4RTW A;  2DL7 A;  3CQT A;  4CC3 A;  1ARK A;  1K0S A;  4RTU A;  1QWE A;  3NMZ C;  1Z9Q A;  2ED1 A;  4K11 A;  4J9G A;  2EYW A;  1WA7 A;  2K79 A;  3M0S A;  2LNH B;  3I35 A;  2D8J A;  3M0R A;  4HVU A;  4OMQ A;  2GNC A;  1OEB A;  2AK5 A;  2M0Y A;  1M3B A;  1CSK A;  3EHQ A;  2EW3 A;  2EBP A;  4RTY A;  1SPK A;  2LCS A;  4OMN A;  3H41 A;  4RTT A;  2HSP A;  1UUE A;  1SRL A;  2DIL A;  3UA6 A;  3NHN A;  4JJB A;  1S1N A;  2I0N A;  5IXF A;  1PKT A;  1BU1 A;  1M30 A;  2RN8 A;  1ZUK A;  4WCI A;  3ULR B;  2SRC A;  1B07 A;  2CH4 W;  2L3S A;  3GBQ A;  1E6G A;  2LX7 A;  4LUE A;  1PNJ A;  4F14 A;  2ROT A;  3REA B;  4ORZ A;  3VS1 A;  1RI9 A;  2KT1 A;  5IHK A;  2L2P A;  1WLP B;  1OPL A;  1JQQ A;  1XOV A;  1HSQ A;  2JXB A;  2O31 A;  4LNP A;  2YUO A;  1HJD A;  3O5Z A;  3KFV A;  5ECA A;  2KEA A;  2J6O A;  3NGP A;  2VWF A;  1M27 C;  1K0X A;  2CDT A;  4RUG A;  1JEG A;  4CC7 A;  1QKX A;  1BK2 A;  1TUC A;  2DMO A;  3VRY A;  2JMC A;  1PHT A;  1PWT A;  2RNA A;  2NWM A;  1AWJ A;  2K2M A;  4D8D A;  2LQW A;  2C0I A;  4Z88 A;  2KYB A;  2V1Q A;  2EGC A;  3VS5 A;  2GQI A;  1ZSG A;  2KNB B;  3SHW A;  2J7I A;  2EPD A;  1TG0 A;  2J6K A;  1I0C A;  3VS2 A;  4AG1 C;  1Y0M A;  3QWY A;  2K9G A;  1UFF A;  1K76 A;  4DEY A;  1JU5 C;  2RQR A;  3EG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...