4JZ3A

Crystal structure of the chicken c-src-sh3 domain intertwined dimer
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
molecule keywords Proto-oncogene tyrosine-protein kinase Src
molecule tags Signaling protein
source organism Gallus gallus
total genus 6
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jz3A00
2AKKA 2KE9A 1PHTA 2KRMA 4RUGA 2JW4A 1WDXA 2DM1A 2DMOA 1Y57A 4LUDA 1GRIA 2GNCA 2K2MA 1UDLA 1MUZA 2ED0A 5GJWB 1ZX6A 2YDLA 2EPDA 3LH5A 3VS3A 2PTKA 1ZUYA 2HEQA 2FPFA 2DL7A 4RTWA 2KGTA 1UUEA 2EYYA 2ROTA 1X43A 2B86A 3M0UA 1RLPC 4EIKA 2IIMA 2J06A 5IHIA 2F2XA 2BZ8A 2LJ3A 3H0HA 1UTIA 2AKLA 2X3XD 1X27A 1AD5A 2OI3A 1BBZA 1Z9QA 2KROA 2LNHB 3KFVA 1BB9A 1WIEA 3QWXX 3RNJA 1T3LA 1ZBJA 2KYBA 2RF0A 1GFDA 2DLPA 2DBKA 3TVTA 2NUZA 1WX6A 1YWPA 3H0FA 2CH4W 4OMNA 3I35A 1PKSA 1WXUA 1M30A 2W10A 1KSWA 2RNAA 2V1QA 1EFNA 3IQLA 3NGPA 2LQNA 3QWYA 4AFUC 2I0NA 2YUOA 4JJCA 1NM7A 2LZ6B 4Y92A 2K6DA 4IIOA 1I0CA 3VS0A 1KIKA 2A37A 4F16A 4E6RA 3C0CA 2K7AA 2OAWA 4J9BA 1WYXA 1KFZA 1Y0MA 2GQIA 1X6GA 3VRZA 1TG0A 2ABLA 1X6BA 2HDAA 2RN8A 5IXBA 1VYUA 1UECA 2YUNA 2K9GA 4OMPA 4AG1C 1OOTA 2KT8A 3PVQA 2FG0A 3A98A 1HD3A 2LJ0A 2O9VA 2J05A 3ZL7C 3I5RA 4ORZA 3VRYA 4AFZC 2KRNA 3M0RA 4FSSA 1BU1A 2KXDA 1K9AA 4CC4B 2D8JA 5FW9A 1YWOA 2EBPA 1JO8A 2K3BA 2GTJA 1BK2A 4QT7A 3RBBB 2DA9A 4J9EA 2EVRA 2H8HA 2OJ2A 2ROLA 2O9SA 4D8KA 1YP5A 2GBQA 1H92A 1AEYA 2O2OA 4D8DA 4J9GA 2MOXA 1H8KA 4J9CA 1ARKA 2GGRA 1J3TA 1K0XA 4M4ZA 2AK5A 2EW3A 1UFFA 2EYZA 4LE9A 5ECAA 2DBMA 1UE9A 2J6OA 2C0TA 4ESRA 4JZ3A 1W1FA 1AZEA 2XMFA 1OV3A 2CUBA 2JS0A 2KBTA 3NHNA 2PZ1A 2CT4A 3U23A 2PNIA 4KRTA 1GCQC 4RTZA 1K0SA 1WLPB 1VYVA 2AZVA 1PWTA 4CC7A 2HCKA 2SRCA 1X2KA 1B3QA 1G83A 1QCFA 2ECZA 2KRSA 1E6HA 3M0SA 2DL5A 2RQTA 1U06A 2DRMA 1YNZA 2CT3A 1FMKA 4K11A 1X69A 3M0PA 2DVJA 1MV3A 3SEMA 5FWBA 5FWCA 4HVVA 1S1NA 4AFQC 1AWOA 2JM8A 3SHWA 4GLMA 1UHCA 1QKWA 4Z89A 2YUPA 2VVKA 4OMQA 2DJQA 2F2VA 1PKTA 3R6NA 2FRYA 2FO0A 2L3SA 1PRMC 1VA7A 2C0IA 3O5ZA 2V1RA 2JXBA 4JJBA 1JXOA 2RQRA 5L23A 2O88A 1GFCA 3UF4A 4WCIA 1W6XA 1ZUKA 2C0OA 2DL3A 3I9QA 1WA7A 2KNBB 3VS7A 1NYFA 1ZLMA 1JU5C 4F17A 3UATA 1JEGA 2KEAA 2D8HA 1MV0B 2EGEA 2QDLA 3VS4A 1X2QA 2A36A 1SHGA 1AWJA 3UA6A 1TUCA 1QWFA 2ENMA 1KJWA 1OEBA 2FPEA 3EG2A 1YN8A 2P4RA 1U3OA 2LMJA 2LQWA 2KT1A 1CKBA 1SHFA 1WFWA 2HBWA 2DF6A 2LX7A 2L0AA 3VS2A 4CC2A 1ZUUA 1B07A 4JZ4A 4CC3A 3EG3A 1M8MA 4Z88A 5IH2A 2EQIA 2W0ZA 1E7OA 1PRLC 4A63B 1V1CA 1ZSGA 1NG2A 2MIOA 1K1ZA 1WXTA 2J7IA 2KR3A 2LJ1A 4AFSC 1H3HA 4IIMA 3PVLA 2YSQA 1AWXA 3M0TA 2G6FX 1IO6A 1A0NB 4RTUA 1OPKA 2RQWA 2SEMA 1SPKA 1XOVA 1HSQA 1HJDA 2RQUA 3TSZA 2D0NA 5HCKA 1PNJA 2BTTA 1T0HA 2LP5A 3EG0A 2F2WA 3PE0A 5GJVB 2RQVA 1N5ZA 2DILA 1M3BA 2EGAA 2JS2A 1SRLA 1TUDA 3REBB 1NEGA 1QLYA 1UGVA 2DX1A 1SRMA 1NLOC 1Z9ZA 2X3WD 1AOJA 1AWWA 4J9DA 3REAB 1LCKA 4RTTA 2L2PA 1VYTA 2L3QA 1ABQA 1UJ0A 5EC7A 4R0KA 5I11A 1I07A 2D1XA 2CUDA 2FEIA 2NWMA 3VS6A 2JMCA 2EKHA 4LUEA 1T0JA 1T3SA 2DYBA 2E5KA 1JQQA 2A28A 2AZSA 2DL4A 3CQTA 4RTVA 2BZXA 3VS1A 2J6FA 3ULRB 3NPFA 2JM9A 1GBRA 1WI7A 4F14A 4HVUA 4RTXA 1NEBA 4DEYA 2DRKA 2YT6A 2MCNA 3M0QA 4OMLA 1GCPA 1FYNA 1GCQA 3EHQA 4GBQA 1QWEA 3JV3A 2RPNA 3EG1A 1QKXA 2FRWA 3H41A 2A08A 1WXBA 2BZYA 2J6KA 2EYXA 1GBQA 2DL8A 5IHKA 4J9FA 3FJ5A 3TSWA 1UJYA 2HSPA 3EHRA 4HCKA 1NLPC 4Z8AA 3EGUA 1K76A 1I1JA 3H0IA 2M51A 1W70A 4AG2C 2ED1A 4ZNXA 2CH4A 2KYMA 2DNUA 2FPDA 2YUQA 4JJDA 2M0YA 4HVWA 1SSHA 1UHFA 2GTOA 1U5SA 3GBQA 2EGCA 2EYWA 1E6GA 2JTEA 2RMOA 4LN2A 1CKAA 1OPLA 5IXFA 1GL5A 2LCSA 2CSQA 1AVZC 4LNPA 4OMOA 4JPBW 1ABOA 4OMMA 1RUWA 2O31A 1SEMA 4RTYA 1AZGB 1UG1A 4J9HA 4J9IA 1M3AA 3NMZC 2VKNA 4X1VA 2CDTA 2VWFA 4HXJA 2CSIA 3UA7A 2ESWA 1JXMA 2CREA 2JT4A 1G2BA 2KXCA 1NYGA 4DEXA 1M27C 3I5SA 5IHNA 2K79A 1K4US 1RI9A 1YCSB 5I22A 1RLQC 2DE0X 2L3PA 3THKA 1M3CA 2JMAA 3VS5A 1CSKA
chains in the Genus database with same CATH superfamily
3JCMb 1IRXA 1BI2A 1QVFS 1M1KR 2JW4A 3BY7A 1WDXA 3LWHA 3CCUA 1NJIU 3CCQQ 2XK0A 1VOMA 2DMOA 1JRIA 1GRIA 3V8LA 1MUZA 2ED0A 4RG2A 3EFRA 5GJWB 3LH5A 3MPUB 3LYIA 1ZUYA 2HEQA 2FPFA 2LQKA 3QUIA 2DL7A 1WHLA 2WSCE 4RTWA 2MI6A 3VUZA 1ACMB 1YJWQ 3DB4A 1C6VX 2IIMA 5IHIA 1JJ2S 1PM3A 5FU7C 2VXFA 3M5AA 5LJ3h 5GAMe 4KULA 2X3XD 1X27A 1AD5A 1MMDA 4L59A 1ZSZB 5KE2A 1RAEB 3M58A 1GFDA 2DLPA 3DB3A 1OU8A 3JCMc 4EPCA 3HFNA 3M55A 1K9MU 2EWNA 1K73R 4PJOB 1IREB 5A0LA 3OBWA 5GANf 3M53A 3I35A 1XJWB 2EJGA 1KSWA 1YI2T 2WSEE 3OYIA 3NGPA 1NBEB 1ZQ1A 2XG8D 2E1HA 4Y92A 2OTLA 3VS0A 1IGQA 2CZ0B 4J9BA 3LWIA 3RIRA 3VU3C 2HL5C 3C95A 2BE7D 5CKEA 2CP0A 3P8HA 1VQPA 5C0MA 3CD6A 2O4XB 4EDUA 2IVWA 5FLXE 2E4HA 1YIJA 2HDAA 3A8GB 2DFUA 2RO0A 1LPLA 4AG1C 1BI0A 4E7LA 4EMKC 4JRPA 3CPWA 3RERA 5GMKi 2RB6A 1YI2A 1WJRA 2O9VA 3MP8A 5GAN2 2RHXA 1TWBA 4AFZC 2LCCA 1S72T 4M77B 1FMVA 4CRIA 5GAMd 1Q82U 3EFOA 2ZGWA 2COWA 5FW9A 2QTVA 3H9NA 2K3BA 4FT2A 3P8BB 4J9EA 2H8HA 2AIRB 2DETA 2OJ2A 2ROLA 2O9SA 3L2WA 4E7IA 4M75G 2AHJB 4D8DA 2EAYA 3TREA 3OW2P 1G3TA 1HK9A 1J3TA 4M4ZA 1K9MC 2EW3A 2X4YA 2RHIA 2DXCA 1VQLQ 3LGLA 2K57A 4C5EA 4E7KA 4E7JA 2QQ9A 1V29B 2CZ1B 1W1FA 1AZEA 2XMFA 4HKEA 4KUDK 2KBTA 1B34A 4J6XA 2PZ1A 1TSFA 3U23A 2X4XA 3ZFJA 2RK1A 3GF5A 4XU2A 4FCYA 1OYXA 1WJQA 1VQ6T 2R5AA 2H3EB 5KYXB 2AZVA 3UT1A 1IB8A 4MMLA 3CCJA 4J7IA 3RKWA 3M0SA 2RQTA 1U06A 3QIIA 2LX9A 1FMKA 1X69A 4M7AB 2DVJA 3HPWA 2JM8A 1VQMQ 5FU6C 4GLMA 1Q82C 5GAOq 1QKWA 2FZKB 4C0DB 1VQ6A 4OMQA 1VQKT 4RMOA 3EGXB 4B9XA 1D0YA 1PKTA 3AT1B 3R6NA 3OYYA 3OW2A 4ELZC 2L3SA 2OTJT 1PRMC 2FVUA 2C0IA 2V1RA 1FMWA 3UDCA 2O88A 1KD1R 1Y71A 1WJSA 2DL3A 1WA7A 1NYFA 4PLLA 2IPOB 1JU5C 1LNXA 4F17A 1XQHA 9ATCB 3CC2Q 2QEXT 1JEGA 3JCMV 1FXXA 1TUCA 1GXIE 2ENMA 3CCMQ 1U3OA 2LQWA 3T9NA 5GAMj 1M2VB 1WFWA 4CC2A 2LX7A 3RDVA 4JZ4A 1Q86R 2QASA 2CZ6B 2EQIA 2FZCB 2W0ZA 3M54A 2EJFA 4B6MA 1F1BB 1YHQT 1PSFA 1KHCA 4PK4A 1DJ7B 3SWNB 3CEYA 1MMNA 1G3YA 1IGUA 2EJ9A 1UGPB 2MF2A 3UWNA 3FEOA 3CC4A 2E64A 1YJ9T 1A0NB 1KC8U 4RTUA 1OPKA 4D6WA 2SEMA 3HTRA 1HSQA 1HJDA 2PUOB 2D0NA 2ZPBB 2FL7A 2E3HA 1PNJA 3CCVT 4C8QB 5CAIA 4X9DA 2K2VA 1T0HA 2F2WA 2EIFA 1VQ8Q 1VUBA 3SDZA 5GANg 2VYTA 3SD4A 3OYJA 1H3ZA 5LL6S 2NUTA 1SRLA 1TUDA 2DPPB 1NEGA 2QA4T 1QLYA 2EQUA 3RESA 5GAMh 1SRMA 4XK8E 2DVEA 1VQ5Q 4J9DA 3REAB 3OB9A 1K73U 4C0FA 4RTTA 5D7UA 2L3QA 2XU8A 3JSCA 1I07A 2CUDA 2NWMA 4JS4A 3JCMX 5D6YA 2E5KA 4PNOA 1VQOT 5J3BA 2BZXA 5KYYA 4F14A 3LH0A 3LW5E 4DEYA 1C0MA 1M1KC 1FYNA 4IUTA 1D09B 2EKOA 3QDRB 4GBQA 1OX8A 3EG9B 3JB9J 3JV3A 5LJ3e 2JVVA 1QKXA 2FRWA 4PL6A 4PFOA 4C92B 5GMKm 2EYXA 4BE2A 4C5HA 2DIQA 1R8OB 3JCMQ 1U1TA 3FRNA 4Q5WA 2K5LA 2HSPA 3SWNC 2ZZDA 1I1JA 3QXEB 2QQAA 3GIBA 1PD0A 3J81E 4AG2C 4M78B 4E2FB 1MNEA 2DNUA 1K73C 4M7DG 5KH6A 1OX9A 3BFMA 1UHFA 4C8QC 1ZA2B 2I2LA 2EGCA 3PIOA 2JTEA 2XIDA 3WVDB 1CKAA 2QQSA 5IXFA 2LDMA 3CPWS 1GL5A 1RAHB 1TS9A 5GAOr 1VQ4A 4JPBW 4TVRA 1ABOA 2RHUA 4OMMA 4F7UB 1KQ2A 4V2SA 2O31A 1AZGB 3QO3A 4RKUE 3OSSC 4PLIA 1M3AA 1BCOA 3NMZC 3C12A 2FZGB 4X1VA 3JB9G 2CSIA 3BDUA 5LJ3d 3V7RA 2CREA 2JT4A 1G2BA 2VC8A 4ZN1A 4BD3A 3OYNA 1QP3A 2DXBA 4PJJA 3L42A 5IHNA 1XTDA 4R56A 3THKA 3JCMW 5L8RE 2K5IA 2JMAA 1CSKA 2KRMA 3CCEA 2DM1A 1YCYA 4MDWA 1RACB 5GANe 1EX4A 1RAIB 1Y57A 2HKNA 4LUDA 4PFPA 5GAN8 3VUBA 1VQNA 2HL3A 3L2VA 3MEAA 3VS3A 4M75D 2PTKA 2HQEA 2EYYA 8AT1B 1YJNA 1X43A 1KD1U 2B86A 3M0UA 4C92C 4EIKA 2J06A 3EH1A 1Q81R 4M7DC 3G71Q 1UTIA 1D1AA 5HKCA 1EIFA 1UGSB 1BBZA 1Z9QA 3A5ZB 2KROA 5CK9A 3NTIA 1WIEA 3QWXX 3RNJA 1T3LA 1ZBJA 1S72Q 1M5Q1 5HY6A 5A2QE 2NUPA 4M78C 3CCRT 2DBKA 3TVTA 2KSSA 3P8DA 4FW1A 3H6ZA 1TOVA 2CH4W 3INZA 4OMNA 1KHIA 1PKSA 1Q86U 1WXUA 2FYKA 4OF1A 2V1QA 3OW2S 2QG9B 3IQLA 2LQNA 1OI1A 2ZPIB 4OP0A 2KMTA 5AYFA 1I0CA 1KIKA 1HXDA 3PNWC 3C0CA 2K7AA 2OAWA 3CMAQ 2E12A 1Y0MA 2GQIA 5KYWA 1X6GA 2FB7A 5GANd 4MDXA 3VRZA 1X6BA 4GLKA 1TXQA 2Y4YA 2KQWA 2K9GA 2DD5A 2YUNA 1OOTA 2KT8A 3HRUA 3V8JA 2V8IA 1HD3A 2J05A 5CKFA 1KD1C 4ORZA 2KRNA 3M0RA 5J26A 4FSSA 1ZA1B 4JDSA 3CCUT 3NTHA 4C0ZA 1K9AA 3L2QA 4CC4B 5GAOl 2MK5A 3JCMJ 4L5GA 2EBPA 3RBBB 1BK2A 3L1AA 2CYZB 5CVIA 4BI4A 4LDYA 1N9RA 3RKXA 2K3YA 2QK0A 4FSXA 2VGNA 1MNDA 2GGRA 1Q86C 1MMGA 1UE9A 4EMKA 1Y96B 2OTJQ 1VQ9A 2CT4A 4BE0A 5I2SA 2RI3A 5CCAA 5I21A 3S3MA 4RTZA 3JB9H 4IKFA 3X26B 1WLPB 4M75F 1OULA 2E70A 1PWTA 4FU6A 4A53A 5A0GA 3CPWP 3A8OB 1BIBA 1G83A 2QEXQ 2KRSA 2MWOA 1E6HA 2OTLT 2CT3A 4K11A 2H3JA 1ZBXA 3M0PA 1MV3A 1EZZB 3HFOA 2DTHA 1AWOA 3SHWA 1RAFB 5FROA 1VQPT 3CD6T 2EQKA 2LTOA 1YIJT 2YUPA 1YHQQ 2BIVA 5J39A 3R6OA 4XU0A 3O8VA 1I8FA 2DJQA 1WZOA 2F2VA 2FRYA 1YJ9Q 3VJPA 2QAZA 1RAGB 2D9TA 4M75E 2JXBA 4JJBA 3M56A 5L23A 1GFCA 3CCVQ 3X20B 4PFZA 2F5KA 3UF4A 1N6AA 1W6XA 2YRCA 1ZUKA 3L2UA 2C0OA 1WHKA 3QBYA 5GANj 5GAN3 2KNBB 4PJOG 2OX7A 4XQ3A 3CCSA 4BDYA 3EFSA 3ZBDA 3MP6A 3UATA 1R0CB 2KEAA 2EGEA 2QA4Q 1SHGA 4QVCA 2F1LA 3HHTB 4LXCA 2HBWA 2DF6A 3VS2A 4ZGJB 3I55Q 1PC0A 1M8MA 3MJXA 3OYBA 2QQRA 4A63B 1WXTA 3EFOB 4M75A 2EQMA 2QXFA 1VQOQ 2M02A 2KR3A 1H3HA 2YSQA 1AWXA 4MZPA 2RJDA 2LVMA 2EFIA 4WTOB 3OYFA 3CCJT 4M77G 1SPKA 2QGGA 2RQUA 4VUBA 5GANh 1TUGB 4M7DD 1Q81U 2LP5A 2RHZA 4KT0E 3V7SA 4RG8A 4LDUA 5DLOA 3PE0A 5LJ5g 1ZSZC 4LDWA 1B34B 4B9WA 3G71A 1MHNA 3HSBA 3LX7A 2HSEB 2BUDA 2X9HA 1G8XA 2L89A 2E5QA 4XTZA 3CMEA 1AWWA 4N0AC 3I56Q 1WHMA 4PJOC 3OYCA 3JB9D 3VS6A 2EKHA 1D3BA 2DYBA 1IXDA 2DZCA 3CQTA 3VS1A 1KQSP 4F04B 1WI7A 5HK0A 4HVUA 4RTXA 4JLIA 2B8AA 3HRSA 3PFSA 1GCPA 2PVDB 2X51A 1SG5A 1GCQA 1X6OA 3JRZA 2DTOA 4M7AG 5KYUA 2P84A 3EG1A 4JRQA 3H41A 4RCBA 2A08A 1N27A 1WHJA 3PTAA 5CQYA 4ELYC 1Q81C 2J6KA 4M77C 4NL2A 1YITQ 1PSEA 1N9SA 5IHKA 1VQ7Q 3D7SB 1D0XA 4QVZA 3TSWA 4DA4A 3META 3CC4T 1QVGP 1M4ZA 4KUIA 1K76A 1N8RR 5DY9A 2M51A 3CC7A 1W70A 1NE8A 3CCLA 4ME7A 4ZNXA 2FPDA 2RI2A 1D1CA 3E2UA 1R0BG 3OYGA 2WSFE 2ZPFB 2DJZA 4N4HA 2MPXC 4YTLA 4OGEA 1M1KU 1AT1B 4LN2A 3OQ5A 3KBGA 1KQSA 4JLGA 1QVPA 2CSQA 2QTXA 1RUWA 2ZPHB 4Y91A 3CCQA 4DOWA 2DEUA 4C5IA 1UG1A 3SWNA 3WXMB 4J9HA 4OB0B 2A3LA 4M7DF 4BACA 4N4IA 2YRDA 3ER0A 3JCMf 3OMGA 1YJWA 3V7CA 2RK2A 4M7AC 2K3XA 3J7AF 3I5SA 2R57A 2L3RA 4XAXB 2DE0X 2NUTB 3GP8A 4NL3A 3VS5A 1QVGA 4C8QG 2AKKA 1PD1A 3G6EQ 4C0DC 2KE9A 3G4SQ 1JB0E 5LJ5e 2GQVA 2L5QA 1RADB 4A54A 1ZX6A 2YDLA 3JB9F 2EPDA 2KGTA 2E6NA 2ROTA 1RLPC 3G7ZA 3L2RA 2P0QA 3H0HA 2AKLA 1X75C 5KYYB 5CIUA 4HT8A 1QP2A 4KH1B 2LNHB 4JRIA 3QSUA 3UPUA 2DTIA 2D0QB 3FIFA 2RF0A 4GY5A 3H8ZA 1BIAA 2HAXA 3WVEB 1G5VA 4NOYA 1LVKA 4IUPA 3OYAA 2E65A 1NJIR 1M30A 2W10A 1Q95G 3VV0A 1VQ4T 3M4GA 2YXYA 3QWYA 2I0NA 4JJCA 4FYVB 1NM7A 3FC3A 2K6DA 4IIOA 3I55A 3LGFA 4XTYA 4BI8B 4FIBA 4M7DA 4E6RA 4C92G 2YHTA 4XU3A 2VASA 4NS5A 1KFZA 3EGDA 5LJ5d 4HT9A 2XDDA 2RN8A 2YRVA 2X4WA 1UECA 2JTFA 2MMPA 3RMQA 2FG0A 1VQLA 4M78G 3ZL7C 2E41A 2EYQA 1K8AR 3VRYA 4IURA 3CCET 4DOVA 2KXDA 3URGA 4PJOD 2D8JA 2DIGA 2JNGA 3CBOA 1YWOA 4A4FA 1M90R 1VQNT 2GTJA 4QT7A 2DA9A 1FWZA 4BUGA 4HCCA 5IT9E 4D8KA 2CKKA 2GBQA 1YJNT 1KK7A 1VQPQ 1YFNA 1AEYA 3S3NA 4WF2A 2NLUA 4F7UG 1YIJQ 4J9GA 2MOXA 1H8KA 1UFFA 2EYZA 4LE9A 3TQ7P 3A8MB 4A4HA 1YI2Q 1WHGA 2PVGB 3QPHA 3QYGB 2J6OA 2M16A 4UC4A 3RUXA 4BY6B 5CKDA 4R55A 4ESRA 4JZ3A 1D0ZA 3GPLA 1OV3A 1QQJA 5IN1A 1VQMA 1W2BP 2A7YA 2F5TX 2VUBA 3X24B 1Q7YR 1K0SA 1HYOA 2GFAA 4M77D 4C0GA 3MHXA 2HCKA 2SRCA 1X2KA 5KCHA 2VGMA 1B3QA 3QG1A 1QCFA 3TEEA 4XTXA 3OS1A 1WQWA 5GAOn 1D1BA 2DRMA 1YNZA 4OB1B 4XU1A 2ZCFB 2OAUA 1YITA 2V8KA 3M9QA 5FWCA 1OZ3A 4HVVA 1S1NA 2HD0A 2XICA 1UHCA 2NUPB 3CC2A 4Z89A 2HKQB 3ZEHA 3OMCA 2CS7A 2VVKA 5C6SA 5LJ5f 2KY9A 4DBRA 3CCMA 2FO0A 2E3IA 4MMKA 2P4TA 3OA6A 2LT1A 2HQXA 3GLXA 2RD1A 1VQ8T 1Y07A 1VA7A 1M2OA 4L6V5 1VIFA 3JCMg 4WCIA 1SSFA 3VYHB 2KK4A 3LLRA 5FU7B 2M9UA 5LJ5j 3VS7A 4J83A 1W2BA 3EAEA 2LRQA 4Y28E 4MZMA 3OYLA 1UGQB 1VQ5T 1JBMA 5KYWB 3OY9A 2C06A 3HKSA 7AT1B 3EH2A 1VQ6Q 1MV0B 2QDLA 3VS4A 4M7AD 1AWJA 3UA6A 5AT1B 1QWFA 2FPEA 3EG2A 4OB3B 2LMJA 2KT1A 1H641 1SHFA 1VQ8A 4DQ2A 1VQ9T 4HCZA 4EMHA 4KH0B 2DD4A 3RKYA 3JCMP 4Z88A 4FL6A 4O6JA 1E7OA 4PJOF 3OS5A 4BY6C 1PRLC 1NG2A 2XI9A 1K1ZA 3X25B 1KQSS 2J7IA 3MP1A 4IIMA 3PVLA 1N8RC 5GMKl 3M0TA 1VQ5A 4IUVA 3G6EA 4LD9K 1X01A 2IG0A 3QHSA 3OYMA 3G4SA 3OSVA 4QQGA 1VQKQ 4P5NA 5LJ5h 3TSZA 5HCKA 3C4SA 2QI2A 2VXEA 3M4YA 4CI0C 3EG0A 1UB4A 5CKHA 1M8VA 4FM4B 2XKOC 4EMKB 4OGCA 5GJVB 3QJ6A 3E19A 1N5ZA 2DXUA 1M3BA 2JS2A 3V8KA 3REBB 1WPYA 1KG1A 1NLOC 1QVGS 1Z9ZA 3CC4Q 4PJOE 1LCKA 4M77F 2RJEA 4OVAA 4O5VA 1TU0B 3GOXA 1RI0A 1ABQA 5EC7A 2CP6A 2FEIA 2D1XA 3SB2A 3DLLA 5EG2A 1MMAA 1KC8R 1P92A 1T0JA 2DAQA 4BE1A 1JQQA 2AZSA 4LD6A 3SFMA 4KGXB 4BB7A 3CCST 2J6FA 3ULRB 3NPFA 1G3SA 1BYMA 1NEBA 4C8QD 1IHVA 1ZSZA 2CGHA 1WHHA 3M0QA 4LDVA 1WNLA 1BKBA 2LNVA 2PQWA 4AMCA 1BI1A 2R58A 1OZ2A 2GFUA 2YWWA 4N0AA 1LJOA 1WXBA 4PJOA 4J8OA 3JB9I 1K8AU 1NPPA 4M77E 2BZYA 2PU9B 2V8JA 1M90U 4FYYB 5KCOA 4HCKA 4Z8AA 2DXTA 3EGUA 3H0IA 4J6WA 3JCMe 2ED1A 4PJMA 5FU6B 4M7AF 2CH4A 2KYMA 2O4XA 4N4GA 5CR2A 3MEVA 2M0YA 2E6ZA 2GF7A 3CBMA 1NJIC 1U5SA 3GBQA 2GCXA 2DKGA 4XTUA 4E7HA 2R5MA 2RMOA 3G71T 1OPLA 4A4GA 1WGSA 3MO8A 1RL2A 2K4YA 4J5YA 4ATOA 4M75B 4LNPA 4OMOA 4M77A 1Q7YU 3CMET 3MEUA 4LDXA 4RTYA 4C92D 4RCCA 2KI7A 2JZ2A 3OBYA 1W4SA 4J9IA 3RMSA 2VKNA 2CDTA 2VWFA 4QQDA 4J6YA 2L8DA 2ESWA 3L2ZA 3FLGA 4X34A 2KXCA 4M7AE 3FJPA 2WACA 2NYSA 4M78D 2K79A 1K8AC 3NFCA 1RI9A 1YCSB 3BDLA 5I22A 2L3PA 1G3WA 3KUFA 3A1PA 3QJYA 3QZ9B 1VQ4Q 1M90C 4AT1B 1PHTA 2COZA 3QYHB 3E9GA 4RUGA 1S72A 3CMAT 2DEQA 2M0OA 2GNCA 2K2MA 3JCMd 3PMIA 1LOJA 1UDLA 5KYXA 1WQ7A 1QMCA 1V76A 1UUEA 1PG5B 3CPFA 3F70A 2X4JA 3BW1A 1D3BB 2FHDA 3ME9A 1AHJB 2PVOB 2DYIA 2XD0A 2F2XA 2BZ8A 2LJ3A 5D6XA 2XDBA 3PIPA 1BCMA 2X35A 1QCNA 2OI3A 4C8QF 4M7AA 3CC7T 4EMGA 4BDZA 3CCLT 3KFVA 3HL8A 4XTVA 1BB9A 2EQJA 3CMAA 1Q7YC 2KYBA 5LJ3g 4MZTA 3CCEQ 1I5OB 2NUZA 1YBYA 2CZ7B 1WX6A 1YWPA 5KYUB 3H0FA 1VQNQ 2MYSA 3EGXA 2DO3A 4C5GA 3CXCP 1OU9A 1FX7A 3DLMA 3N5BB 2M1HA 4A4EA 1YJNQ 2RNAA 1EFNA 3PGGA 5GMKe 3OYEA 4AFUC 1I4K1 2YUOA 5M9OA 4JJNK 2LZ6B 3CCQT 2MAMA 1QVFP 4M75C 2RHYA 4FT4A 2A37A 4F16A 2XDPA 1M1GA 1SF9A 2HQHA 1TTHB 4QKUA 1WYXA 4ZTFA 1W2BS 5GAMf 3M59A 4DBHA 4C8QE 3QKJA 1YJWT 1TG0A 2ABLA 1TH7A 5IXBA 1VYUA 4II1A 1JJ2P 1VQKA 5GAN6 2ZAEA 4PJNA 4OMPA 3MKDA 3PVQA 1MGQA 4Z02A 1M2VA 3A98A 2LJ0A 3I5RA 2OTJA 3VYGA 2AT1B 1BU1A 4QVDA 4ZGEB 2DERA 4C92F 2RJCA 1JO8A 1I5LA 2EVRA 1NZ9A 3MEWA 3PMTA 5CO7A 3S6WA 1YP5A 3CCRQ 1H92A 4FW2A 3KXTA 2O2OA 1M1FA 3CXCA 2HZYA 2QEXA 4J9CA 1ARKA 2QGFB 4C8QA 5DM7R 1K0XA 2KDSA 4IUQA 2AK5A 4M78F 5ECAA 2DBMA 2P0PA 4ANJA 1KQ1A 2C0TA 3DKMA 1QVFA 2ATCB 2E10A 2CUBA 2JS0A 3NHNA 3OYDA 3OS2A 2DK3A 2PNIA 1R77A 4KRTA 1YHQA 1GCQC 3GNFB 1VYVA 4C92E 4CC7A 4F7UF 3J80E 2Z0WA 1YJ9A 5IAYA 1JJ2A 4M7DE 4X9CA 3OYKA 2ECZA 2DL5A 4KBMB 3I55T 2HBPA 3CCVA 4FYWB 1C1AA 1SKUB 1PCXA 3SEMA 2XHCA 4M78E 5FWBA 1VQ9Q 4AFQC 3CCUQ 2ZPGB 2CP2A 1XNIA 2JJ9A 2QA4A 4JRKA 3OS0A 3EG9A 1OQKA 1VIEA 2D6FA 3JCMh 1VQLT 4KGVB 5GAOm 5HK3A 2HMAA 5KE3A 2JOYA 2YLCA 1KC8C 4C92A 2VB6A 3O5ZA 1U1SA 1JXOA 4F7UE 2RQRA 2CP7A 3I9QA 2K5FA 1VQOA 4M7DB 3VKIA 5DLQE 1ZLMA 3QZ5B 1QW1A 3I56T 5GAN7 3EGDB 2JTMA 4JUVA 3QDFA 4M78A 3FB9A 2D8HA 3S3OA 3Q1JA 4FYXB 2F69A 1X2QA 2A36A 2ZPEB 4A4KA 1KJWA 1OEBA 1IHWA 4JS5A 1YN8A 2P4RA 1CKBA 1K9MR 2L0AA 2MWPA 4KGZB 1ZUUA 5FRNA 1B07A 3A8LB 4CC3A 2OTLQ 3EG3A 1VQMT 5IH2A 1QCOA 4PKCC 1V1CA 1ZSGA 2MIOA 3A8HB 4ZGDB 4E47A 4HCBA 4F7UA 2LJ1A 4AFSC 3CD6Q 3CCSQ 2LCLA 2G6FX 1IO6A 3I56A 1RAAB 2LT4A 5A0DA 2RQWA 1XOVA 2JUFA 4XTWA 1M9SA 5GMKj 5GAOp 2VV5A 2BTTA 3CBPA 1YITT 1VQ7T 4DBFA 2BE9B 2Y90A 5GAN5 3ASKA 2KAFA 2RQVA 2CP5A 3CC2T 1RABB 2DILA 2RH2A 2EGAA 3TU4K 3RR6A 1UGVA 2DX1A 4DBQA 2LQ8A 1Q82R 2X3WD 1AOJA 3CCMT 3HRTA 5FRMA 2L2PA 3E1SA 3C94A 1VYTA 5GAMg 1UJ0A 1ZHIA 4R0KA 5I11A 2COYA 2JMCA 2YLBA 4LUEA 4E7ZA 1T3SA 2A28A 1N8RU 1VQ7A 3MCAB 2DL4A 3JAME 4QQ6A 4RTVA 2JM9A 1GBRA 4OMFB 2QYZA 2KVQG 5GMKh 1O75A 2DRKA 3X28B 2YT6A 2MCNA 5KYNA 4ZN3A 1B7TA 4OMLA 3EHQA 3OYHA 5CQXA 3CMEQ 1QWEA 1NPRA 2RPNA 3CCJQ 1O9SA 2Y4XA 2JN0A 4HA8A 3AHUA 5I2MA 2DZ9A 1GBQA 2DL8A 4J9FA 3FJ5A 3HP9A 2V26A 2G3RA 3G6ET 4PJLA 1UJYA 3PT9A 3EHRA 1IZ6A 1NLPC 3G4ST 8ATCB 2RJFA 4OB2B 2BKDN 1I81A 2CP3A 4QW2A 2QDYB 2RI5A 2A0FB 2RM4A 3TCJA 5D6WA 2O01E 2YUQA 1Y7XA 4JJDA 5CKBA 4HVWA 3CCRA 1SSHA 2GTOA 3NTKA 2EYWA 1E6GA 5LJ3f 6AT1B 2LCSA 1AVZC 3E9FA 2P0KA 1U8RA 2LC4A 1SEMA 3FDRA 2QQBA 3CC7Q 3CCLQ 2PUKB 5LJ3j 3GNGA 5GAN4 4HXJA 4BI3A 3UA7A 1JXMA 1UGRB 4ZTJA 3CXCS 3BE3A 1UEBA 4E7SA 1NYGA 3G1JA 3M57A 4DEXA 1M27C 2RA2A 2HNIA 1K4US 1RLQC 4IUUA 1M3CA 1Y96A 1BI3A 4J7FA
chains in the Genus database with same CATH topology
2AKKA 2KE9A 1PHTA 2KRMA 4RUGA 2JW4A 1WDXA 2DM1A 2DMOA 1Y57A 4LUDA 1GRIA 2GNCA 2K2MA 1UDLA 1MUZA 2ED0A 5GJWB 1ZX6A 2YDLA 2EPDA 3LH5A 3VS3A 2PTKA 1ZUYA 2HEQA 2FPFA 2DL7A 4RTWA 2KGTA 1UUEA 2EYYA 2ROTA 1X43A 2B86A 3M0UA 1RLPC 4EIKA 2IIMA 2J06A 5IHIA 2F2XA 2BZ8A 2LJ3A 3H0HA 1UTIA 2AKLA 2X3XD 1X27A 1AD5A 2OI3A 1BBZA 1Z9QA 2KROA 2LNHB 3KFVA 1BB9A 1WIEA 3QWXX 3RNJA 1T3LA 1ZBJA 2KYBA 2RF0A 1GFDA 2DLPA 2DBKA 3TVTA 2NUZA 1WX6A 1YWPA 3H0FA 2CH4W 4OMNA 3I35A 1PKSA 1WXUA 1M30A 2W10A 1KSWA 2RNAA 2V1QA 1EFNA 3IQLA 3NGPA 2LQNA 3QWYA 4AFUC 2I0NA 2YUOA 4JJCA 1NM7A 2LZ6B 4Y92A 2K6DA 4IIOA 1I0CA 3VS0A 1KIKA 2A37A 4F16A 4E6RA 3C0CA 2K7AA 2OAWA 4J9BA 1WYXA 1KFZA 1Y0MA 2GQIA 1X6GA 3VRZA 1TG0A 2ABLA 1X6BA 2HDAA 2RN8A 5IXBA 1VYUA 1UECA 2YUNA 2K9GA 4OMPA 4AG1C 1OOTA 2KT8A 3PVQA 2FG0A 3A98A 1HD3A 2LJ0A 2O9VA 2J05A 3ZL7C 3I5RA 4ORZA 3VRYA 4AFZC 2KRNA 3M0RA 4FSSA 1BU1A 2KXDA 1K9AA 4CC4B 2D8JA 5FW9A 1YWOA 2EBPA 1JO8A 2K3BA 2GTJA 1BK2A 4QT7A 3RBBB 2DA9A 4J9EA 2EVRA 2H8HA 2OJ2A 2ROLA 2O9SA 4D8KA 1YP5A 2GBQA 1H92A 1AEYA 2O2OA 4D8DA 4J9GA 2MOXA 1H8KA 4J9CA 1ARKA 2GGRA 1J3TA 1K0XA 4M4ZA 2AK5A 2EW3A 1UFFA 2EYZA 4LE9A 5ECAA 2DBMA 1UE9A 2J6OA 2C0TA 4ESRA 4JZ3A 1W1FA 1AZEA 2XMFA 1OV3A 2CUBA 2JS0A 2KBTA 3NHNA 2PZ1A 2CT4A 3U23A 2PNIA 4KRTA 1GCQC 4RTZA 1K0SA 1WLPB 1VYVA 2AZVA 1PWTA 4CC7A 2HCKA 2SRCA 1X2KA 1B3QA 1G83A 1QCFA 2ECZA 2KRSA 1E6HA 3M0SA 2DL5A 2RQTA 1U06A 2DRMA 1YNZA 2CT3A 1FMKA 4K11A 1X69A 3M0PA 2DVJA 1MV3A 3SEMA 5FWBA 5FWCA 4HVVA 1S1NA 4AFQC 1AWOA 2JM8A 3SHWA 4GLMA 1UHCA 1QKWA 4Z89A 2YUPA 2VVKA 4OMQA 2DJQA 2F2VA 1PKTA 3R6NA 2FRYA 2FO0A 2L3SA 1PRMC 1VA7A 2C0IA 3O5ZA 2V1RA 2JXBA 4JJBA 1JXOA 2RQRA 5L23A 2O88A 1GFCA 3UF4A 4WCIA 1W6XA 1ZUKA 2C0OA 2DL3A 3I9QA 1WA7A 2KNBB 3VS7A 1NYFA 1ZLMA 1JU5C 4F17A 3UATA 1JEGA 2KEAA 2D8HA 1MV0B 2EGEA 2QDLA 3VS4A 1X2QA 2A36A 1SHGA 1AWJA 3UA6A 1TUCA 1QWFA 2ENMA 1KJWA 1OEBA 2FPEA 3EG2A 1YN8A 2P4RA 1U3OA 2LMJA 2LQWA 2KT1A 1CKBA 1SHFA 1WFWA 2HBWA 2DF6A 2LX7A 2L0AA 3VS2A 4CC2A 1ZUUA 1B07A 4JZ4A 4CC3A 3EG3A 1M8MA 4Z88A 5IH2A 2EQIA 2W0ZA 1E7OA 1PRLC 4A63B 1V1CA 1ZSGA 1NG2A 2MIOA 1K1ZA 1WXTA 2J7IA 2KR3A 2LJ1A 4AFSC 1H3HA 4IIMA 3PVLA 2YSQA 1AWXA 3M0TA 2G6FX 1IO6A 1A0NB 4RTUA 1OPKA 2RQWA 2SEMA 1SPKA 1XOVA 1HSQA 1HJDA 2RQUA 3TSZA 2D0NA 5HCKA 1PNJA 2BTTA 1T0HA 2LP5A 3EG0A 2F2WA 3PE0A 5GJVB 2RQVA 1N5ZA 2DILA 1M3BA 2EGAA 2JS2A 1SRLA 1TUDA 3REBB 1NEGA 1QLYA 1UGVA 2DX1A 1SRMA 1NLOC 1Z9ZA 2X3WD 1AOJA 1AWWA 4J9DA 3REAB 1LCKA 4RTTA 2L2PA 1VYTA 2L3QA 1ABQA 1UJ0A 5EC7A 4R0KA 5I11A 1I07A 2D1XA 2CUDA 2FEIA 2NWMA 3VS6A 2JMCA 2EKHA 4LUEA 1T0JA 1T3SA 2DYBA 2E5KA 1JQQA 2A28A 2AZSA 2DL4A 3CQTA 4RTVA 2BZXA 3VS1A 2J6FA 3ULRB 3NPFA 2JM9A 1GBRA 1WI7A 4F14A 4HVUA 4RTXA 1NEBA 4DEYA 2DRKA 2YT6A 2MCNA 3M0QA 4OMLA 1GCPA 1FYNA 1GCQA 3EHQA 4GBQA 1QWEA 3JV3A 2RPNA 3EG1A 1QKXA 2FRWA 3H41A 2A08A 1WXBA 2BZYA 2J6KA 2EYXA 1GBQA 2DL8A 5IHKA 4J9FA 3FJ5A 3TSWA 1UJYA 2HSPA 3EHRA 4HCKA 1NLPC 4Z8AA 3EGUA 1K76A 1I1JA 3H0IA 2M51A 1W70A 4AG2C 2ED1A 4ZNXA 2CH4A 2KYMA 2DNUA 2FPDA 2YUQA 4JJDA 2M0YA 4HVWA 1SSHA 1UHFA 2GTOA 1U5SA 3GBQA 2EGCA 2EYWA 1E6GA 2JTEA 2RMOA 4LN2A 1CKAA 1OPLA 5IXFA 1GL5A 2LCSA 2CSQA 1AVZC 4LNPA 4OMOA 4JPBW 1ABOA 4OMMA 1RUWA 2O31A 1SEMA 4RTYA 1AZGB 1UG1A 4J9HA 4J9IA 1M3AA 3NMZC 2VKNA 4X1VA 2CDTA 2VWFA 4HXJA 2CSIA 3UA7A 2ESWA 1JXMA 2CREA 2JT4A 1G2BA 2KXCA 1NYGA 4DEXA 1M27C 3I5SA 5IHNA 2K79A 1K4US 1RI9A 1YCSB 5I22A 1RLQC 2DE0X 2L3PA 3THKA 1M3CA 2JMAA 3VS5A 1CSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKK A;  2KE9 A;  1PHT A;  2KRM A;  4RUG A;  2JW4 A;  1WDX A;  2DM1 A;  2DMO A;  1Y57 A;  4LUD A;  1GRI A;  2GNC A;  2K2M A;  1UDL A;  1MUZ A;  2ED0 A;  5GJW B;  1ZX6 A;  2YDL A;  2EPD A;  3LH5 A;  3VS3 A;  2PTK A;  1ZUY A;  2HEQ A;  2FPF A;  2DL7 A;  4RTW A;  2KGT A;  1UUE A;  2EYY A;  2ROT A;  1X43 A;  2B86 A;  3M0U A;  1RLP C;  4EIK A;  2IIM A;  2J06 A;  5IHI A;  2F2X A;  2BZ8 A;  2LJ3 A;  3H0H A;  1UTI A;  2AKL A;  2X3X D;  1X27 A;  1AD5 A;  2OI3 A;  1BBZ A;  1Z9Q A;  2KRO A;  2LNH B;  3KFV A;  1BB9 A;  1WIE A;  3QWX X;  3RNJ A;  1T3L A;  1ZBJ A;  2KYB A;  2RF0 A;  1GFD A;  2DLP A;  2DBK A;  3TVT A;  2NUZ A;  1WX6 A;  1YWP A;  3H0F A;  2CH4 W;  4OMN A;  3I35 A;  1PKS A;  1WXU A;  1M30 A;  2W10 A;  1KSW A;  2RNA A;  2V1Q A;  1EFN A;  3IQL A;  3NGP A;  2LQN A;  3QWY A;  4AFU C;  2I0N A;  2YUO A;  4JJC A;  1NM7 A;  2LZ6 B;  4Y92 A;  2K6D A;  4IIO A;  1I0C A;  3VS0 A;  1KIK A;  2A37 A;  4F16 A;  4E6R A;  3C0C A;  2K7A A;  2OAW A;  4J9B A;  1WYX A;  1KFZ A;  1Y0M A;  2GQI A;  1X6G A;  3VRZ A;  1TG0 A;  2ABL A;  1X6B A;  2HDA A;  2RN8 A;  5IXB A;  1VYU A;  1UEC A;  2YUN A;  2K9G A;  4OMP A;  4AG1 C;  1OOT A;  2KT8 A;  3PVQ A;  2FG0 A;  3A98 A;  1HD3 A;  2LJ0 A;  2O9V A;  2J05 A;  3ZL7 C;  3I5R A;  4ORZ A;  3VRY A;  4AFZ C;  2KRN A;  3M0R A;  4FSS A;  1BU1 A;  2KXD A;  1K9A A;  4CC4 B;  2D8J A;  5FW9 A;  1YWO A;  2EBP A;  1JO8 A;  2K3B A;  2GTJ A;  1BK2 A;  4QT7 A;  3RBB B;  2DA9 A;  4J9E A;  2EVR A;  2H8H A;  2OJ2 A;  2ROL A;  2O9S A;  4D8K A;  1YP5 A;  2GBQ A;  1H92 A;  1AEY A;  2O2O A;  4D8D A;  4J9G A;  2MOX A;  1H8K A;  4J9C A;  1ARK A;  2GGR A;  1J3T A;  1K0X A;  4M4Z A;  2AK5 A;  2EW3 A;  1UFF A;  2EYZ A;  4LE9 A;  5ECA A;  2DBM A;  1UE9 A;  2J6O A;  2C0T A;  4ESR A;  4JZ3 A;  1W1F A;  1AZE A;  2XMF A;  1OV3 A;  2CUB A;  2JS0 A;  2KBT A;  3NHN A;  2PZ1 A;  2CT4 A;  3U23 A;  2PNI A;  4KRT A;  1GCQ C;  4RTZ A;  1K0S A;  1WLP B;  1VYV A;  2AZV A;  1PWT A;  4CC7 A;  2HCK A;  2SRC A;  1X2K A;  1B3Q A;  1G83 A;  1QCF A;  2ECZ A;  2KRS A;  1E6H A;  3M0S A;  2DL5 A;  2RQT A;  1U06 A;  2DRM A;  1YNZ A;  2CT3 A;  1FMK A;  4K11 A;  1X69 A;  3M0P A;  2DVJ A;  1MV3 A;  3SEM A;  5FWB A;  5FWC A;  4HVV A;  1S1N A;  4AFQ C;  1AWO A;  2JM8 A;  3SHW A;  4GLM A;  1UHC A;  1QKW A;  4Z89 A;  2YUP A;  2VVK A;  4OMQ A;  2DJQ A;  2F2V A;  1PKT A;  3R6N A;  2FRY A;  2FO0 A;  2L3S A;  1PRM C;  1VA7 A;  2C0I A;  3O5Z A;  2V1R A;  2JXB A;  4JJB A;  1JXO A;  2RQR A;  5L23 A;  2O88 A;  1GFC A;  3UF4 A;  4WCI A;  1W6X A;  1ZUK A;  2C0O A;  2DL3 A;  3I9Q A;  1WA7 A;  2KNB B;  3VS7 A;  1NYF A;  1ZLM A;  1JU5 C;  4F17 A;  3UAT A;  1JEG A;  2KEA A;  2D8H A;  1MV0 B;  2EGE A;  2QDL A;  3VS4 A;  1X2Q A;  2A36 A;  1SHG A;  1AWJ A;  3UA6 A;  1TUC A;  1QWF A;  2ENM A;  1KJW A;  1OEB A;  2FPE A;  3EG2 A;  1YN8 A;  2P4R A;  1U3O A;  2LMJ A;  2LQW A;  2KT1 A;  1CKB A;  1SHF A;  1WFW A;  2HBW A;  2DF6 A;  2LX7 A;  2L0A A;  3VS2 A;  4CC2 A;  1ZUU A;  1B07 A;  4JZ4 A;  4CC3 A;  3EG3 A;  1M8M A;  4Z88 A;  5IH2 A;  2EQI A;  2W0Z A;  1E7O A;  1PRL C;  4A63 B;  1V1C A;  1ZSG A;  1NG2 A;  2MIO A;  1K1Z A;  1WXT A;  2J7I A;  2KR3 A;  2LJ1 A;  4AFS C;  1H3H A;  4IIM A;  3PVL A;  2YSQ A;  1AWX A;  3M0T A;  2G6F X;  1IO6 A;  1A0N B;  4RTU A;  1OPK A;  2RQW A;  2SEM A;  1SPK A;  1XOV A;  1HSQ A;  1HJD A;  2RQU A;  3TSZ A;  2D0N A;  5HCK A;  1PNJ A;  2BTT A;  1T0H A;  2LP5 A;  3EG0 A;  2F2W A;  3PE0 A;  5GJV B;  2RQV A;  1N5Z A;  2DIL A;  1M3B A;  2EGA A;  2JS2 A;  1SRL A;  1TUD A;  3REB B;  1NEG A;  1QLY A;  1UGV A;  2DX1 A;  1SRM A;  1NLO C;  1Z9Z A;  2X3W D;  1AOJ A;  1AWW A;  4J9D A;  3REA B;  1LCK A;  4RTT A;  2L2P A;  1VYT A;  2L3Q A;  1ABQ A;  1UJ0 A;  5EC7 A;  4R0K A;  5I11 A;  1I07 A;  2D1X A;  2CUD A;  2FEI A;  2NWM A;  3VS6 A;  2JMC A;  2EKH A;  4LUE A;  1T0J A;  1T3S A;  2DYB A;  2E5K A;  1JQQ A;  2A28 A;  2AZS A;  2DL4 A;  3CQT A;  4RTV A;  2BZX A;  3VS1 A;  2J6F A;  3ULR B;  3NPF A;  2JM9 A;  1GBR A;  1WI7 A;  4F14 A;  4HVU A;  4RTX A;  1NEB A;  4DEY A;  2DRK A;  2YT6 A;  2MCN A;  3M0Q A;  4OML A;  1GCP A;  1FYN A;  1GCQ A;  3EHQ A;  4GBQ A;  1QWE A;  3JV3 A;  2RPN A;  3EG1 A;  1QKX A;  2FRW A;  3H41 A;  2A08 A;  1WXB A;  2BZY A;  2J6K A;  2EYX A;  1GBQ A;  2DL8 A;  5IHK A;  4J9F A;  3FJ5 A;  3TSW A;  1UJY A;  2HSP A;  3EHR A;  4HCK A;  1NLP C;  4Z8A A;  3EGU A;  1K76 A;  1I1J A;  3H0I A;  2M51 A;  1W70 A;  4AG2 C;  2ED1 A;  4ZNX A;  2CH4 A;  2KYM A;  2DNU A;  2FPD A;  2YUQ A;  4JJD A;  2M0Y A;  4HVW A;  1SSH A;  1UHF A;  2GTO A;  1U5S A;  3GBQ A;  2EGC A;  2EYW A;  1E6G A;  2JTE A;  2RMO A;  4LN2 A;  1CKA A;  1OPL A;  5IXF A;  1GL5 A;  2LCS A;  2CSQ A;  1AVZ C;  4LNP A;  4OMO A;  4JPB W;  1ABO A;  4OMM A;  1RUW A;  2O31 A;  1SEM A;  4RTY A;  1AZG B;  1UG1 A;  4J9H A;  4J9I A;  1M3A A;  3NMZ C;  2VKN A;  4X1V A;  2CDT A;  2VWF A;  4HXJ A;  2CSI A;  3UA7 A;  2ESW A;  1JXM A;  2CRE A;  2JT4 A;  1G2B A;  2KXC A;  1NYG A;  4DEX A;  1M27 C;  3I5S A;  5IHN A;  2K79 A;  1K4U S;  1RI9 A;  1YCS B;  5I22 A;  1RLQ C;  2DE0 X;  2L3P A;  3THK A;  1M3C A;  2JMA A;  3VS5 A;  1CSK A; 
#chains in the Genus database with same CATH topology
 3JCM b;  1IRX A;  1BI2 A;  1QVF S;  1M1K R;  2JW4 A;  3BY7 A;  1WDX A;  3LWH A;  3CCU A;  1NJI U;  3CCQ Q;  2XK0 A;  1VOM A;  2DMO A;  1JRI A;  1GRI A;  3V8L A;  1MUZ A;  2ED0 A;  4RG2 A;  3EFR A;  5GJW B;  3LH5 A;  3MPU B;  3LYI A;  1ZUY A;  2HEQ A;  2FPF A;  2LQK A;  3QUI A;  2DL7 A;  1WHL A;  2WSC E;  4RTW A;  2MI6 A;  3VUZ A;  1ACM B;  1YJW Q;  3DB4 A;  1C6V X;  2IIM A;  5IHI A;  1JJ2 S;  1PM3 A;  5FU7 C;  2VXF A;  3M5A A;  5LJ3 h;  5GAM e;  4KUL A;  2X3X D;  1X27 A;  1AD5 A;  1MMD A;  4L59 A;  1ZSZ B;  5KE2 A;  1RAE B;  3M58 A;  1GFD A;  2DLP A;  3DB3 A;  1OU8 A;  3JCM c;  4EPC A;  3HFN A;  3M55 A;  1K9M U;  2EWN A;  1K73 R;  4PJO B;  1IRE B;  5A0L A;  3OBW A;  5GAN f;  3M53 A;  3I35 A;  1XJW B;  2EJG A;  1KSW A;  1YI2 T;  2WSE E;  3OYI A;  3NGP A;  1NBE B;  1ZQ1 A;  2XG8 D;  2E1H A;  4Y92 A;  2OTL A;  3VS0 A;  1IGQ A;  2CZ0 B;  4J9B A;  3LWI A;  3RIR A;  3VU3 C;  2HL5 C;  3C95 A;  2BE7 D;  5CKE A;  2CP0 A;  3P8H A;  1VQP A;  5C0M A;  3CD6 A;  2O4X B;  4EDU A;  2IVW A;  5FLX E;  2E4H A;  1YIJ A;  2HDA A;  3A8G B;  2DFU A;  2RO0 A;  1LPL A;  4AG1 C;  1BI0 A;  4E7L A;  4EMK C;  4JRP A;  3CPW A;  3RER A;  5GMK i;  2RB6 A;  1YI2 A;  1WJR A;  2O9V A;  3MP8 A;  5GAN 2;  2RHX A;  1TWB A;  4AFZ C;  2LCC A;  1S72 T;  4M77 B;  1FMV A;  4CRI A;  5GAM d;  1Q82 U;  3EFO A;  2ZGW A;  2COW A;  5FW9 A;  2QTV A;  3H9N A;  2K3B A;  4FT2 A;  3P8B B;  4J9E A;  2H8H A;  2AIR B;  2DET A;  2OJ2 A;  2ROL A;  2O9S A;  3L2W A;  4E7I A;  4M75 G;  2AHJ B;  4D8D A;  2EAY A;  3TRE A;  3OW2 P;  1G3T A;  1HK9 A;  1J3T A;  4M4Z A;  1K9M C;  2EW3 A;  2X4Y A;  2RHI A;  2DXC A;  1VQL Q;  3LGL A;  2K57 A;  4C5E A;  4E7K A;  4E7J A;  2QQ9 A;  1V29 B;  2CZ1 B;  1W1F A;  1AZE A;  2XMF A;  4HKE A;  4KUD K;  2KBT A;  1B34 A;  4J6X A;  2PZ1 A;  1TSF A;  3U23 A;  2X4X A;  3ZFJ A;  2RK1 A;  3GF5 A;  4XU2 A;  4FCY A;  1OYX A;  1WJQ A;  1VQ6 T;  2R5A A;  2H3E B;  5KYX B;  2AZV A;  3UT1 A;  1IB8 A;  4MML A;  3CCJ A;  4J7I A;  3RKW A;  3M0S A;  2RQT A;  1U06 A;  3QII A;  2LX9 A;  1FMK A;  1X69 A;  4M7A B;  2DVJ A;  3HPW A;  2JM8 A;  1VQM Q;  5FU6 C;  4GLM A;  1Q82 C;  5GAO q;  1QKW A;  2FZK B;  4C0D B;  1VQ6 A;  4OMQ A;  1VQK T;  4RMO A;  3EGX B;  4B9X A;  1D0Y A;  1PKT A;  3AT1 B;  3R6N A;  3OYY A;  3OW2 A;  4ELZ C;  2L3S A;  2OTJ T;  1PRM C;  2FVU A;  2C0I A;  2V1R A;  1FMW A;  3UDC A;  2O88 A;  1KD1 R;  1Y71 A;  1WJS A;  2DL3 A;  1WA7 A;  1NYF A;  4PLL A;  2IPO B;  1JU5 C;  1LNX A;  4F17 A;  1XQH A;  9ATC B;  3CC2 Q;  2QEX T;  1JEG A;  3JCM V;  1FXX A;  1TUC A;  1GXI E;  2ENM A;  3CCM Q;  1U3O A;  2LQW A;  3T9N A;  5GAM j;  1M2V B;  1WFW A;  4CC2 A;  2LX7 A;  3RDV A;  4JZ4 A;  1Q86 R;  2QAS A;  2CZ6 B;  2EQI A;  2FZC B;  2W0Z A;  3M54 A;  2EJF A;  4B6M A;  1F1B B;  1YHQ T;  1PSF A;  1KHC A;  4PK4 A;  1DJ7 B;  3SWN B;  3CEY A;  1MMN A;  1G3Y A;  1IGU A;  2EJ9 A;  1UGP B;  2MF2 A;  3UWN A;  3FEO A;  3CC4 A;  2E64 A;  1YJ9 T;  1A0N B;  1KC8 U;  4RTU A;  1OPK A;  4D6W A;  2SEM A;  3HTR A;  1HSQ A;  1HJD A;  2PUO B;  2D0N A;  2ZPB B;  2FL7 A;  2E3H A;  1PNJ A;  3CCV T;  4C8Q B;  5CAI A;  4X9D A;  2K2V A;  1T0H A;  2F2W A;  2EIF A;  1VQ8 Q;  1VUB A;  3SDZ A;  5GAN g;  2VYT A;  3SD4 A;  3OYJ A;  1H3Z A;  5LL6 S;  2NUT A;  1SRL A;  1TUD A;  2DPP B;  1NEG A;  2QA4 T;  1QLY A;  2EQU A;  3RES A;  5GAM h;  1SRM A;  4XK8 E;  2DVE A;  1VQ5 Q;  4J9D A;  3REA B;  3OB9 A;  1K73 U;  4C0F A;  4RTT A;  5D7U A;  2L3Q A;  2XU8 A;  3JSC A;  1I07 A;  2CUD A;  2NWM A;  4JS4 A;  3JCM X;  5D6Y A;  2E5K A;  4PNO A;  1VQO T;  5J3B A;  2BZX A;  5KYY A;  4F14 A;  3LH0 A;  3LW5 E;  4DEY A;  1C0M A;  1M1K C;  1FYN A;  4IUT A;  1D09 B;  2EKO A;  3QDR B;  4GBQ A;  1OX8 A;  3EG9 B;  3JB9 J;  3JV3 A;  5LJ3 e;  2JVV A;  1QKX A;  2FRW A;  4PL6 A;  4PFO A;  4C92 B;  5GMK m;  2EYX A;  4BE2 A;  4C5H A;  2DIQ A;  1R8O B;  3JCM Q;  1U1T A;  3FRN A;  4Q5W A;  2K5L A;  2HSP A;  3SWN C;  2ZZD A;  1I1J A;  3QXE B;  2QQA A;  3GIB A;  1PD0 A;  3J81 E;  4AG2 C;  4M78 B;  4E2F B;  1MNE A;  2DNU A;  1K73 C;  4M7D G;  5KH6 A;  1OX9 A;  3BFM A;  1UHF A;  4C8Q C;  1ZA2 B;  2I2L A;  2EGC A;  3PIO A;  2JTE A;  2XID A;  3WVD B;  1CKA A;  2QQS A;  5IXF A;  2LDM A;  3CPW S;  1GL5 A;  1RAH B;  1TS9 A;  5GAO r;  1VQ4 A;  4JPB W;  4TVR A;  1ABO A;  2RHU A;  4OMM A;  4F7U B;  1KQ2 A;  4V2S A;  2O31 A;  1AZG B;  3QO3 A;  4RKU E;  3OSS C;  4PLI A;  1M3A A;  1BCO A;  3NMZ C;  3C12 A;  2FZG B;  4X1V A;  3JB9 G;  2CSI A;  3BDU A;  5LJ3 d;  3V7R A;  2CRE A;  2JT4 A;  1G2B A;  2VC8 A;  4ZN1 A;  4BD3 A;  3OYN A;  1QP3 A;  2DXB A;  4PJJ A;  3L42 A;  5IHN A;  1XTD A;  4R56 A;  3THK A;  3JCM W;  5L8R E;  2K5I A;  2JMA A;  1CSK A;  2KRM A;  3CCE A;  2DM1 A;  1YCY A;  4MDW A;  1RAC B;  5GAN e;  1EX4 A;  1RAI B;  1Y57 A;  2HKN A;  4LUD A;  4PFP A;  5GAN 8;  3VUB A;  1VQN A;  2HL3 A;  3L2V A;  3MEA A;  3VS3 A;  4M75 D;  2PTK A;  2HQE A;  2EYY A;  8AT1 B;  1YJN A;  1X43 A;  1KD1 U;  2B86 A;  3M0U A;  4C92 C;  4EIK A;  2J06 A;  3EH1 A;  1Q81 R;  4M7D C;  3G71 Q;  1UTI A;  1D1A A;  5HKC A;  1EIF A;  1UGS B;  1BBZ A;  1Z9Q A;  3A5Z B;  2KRO A;  5CK9 A;  3NTI A;  1WIE A;  3QWX X;  3RNJ A;  1T3L A;  1ZBJ A;  1S72 Q;  1M5Q 1;  5HY6 A;  5A2Q E;  2NUP A;  4M78 C;  3CCR T;  2DBK A;  3TVT A;  2KSS A;  3P8D A;  4FW1 A;  3H6Z A;  1TOV A;  2CH4 W;  3INZ A;  4OMN A;  1KHI A;  1PKS A;  1Q86 U;  1WXU A;  2FYK A;  4OF1 A;  2V1Q A;  3OW2 S;  2QG9 B;  3IQL A;  2LQN A;  1OI1 A;  2ZPI B;  4OP0 A;  2KMT A;  5AYF A;  1I0C A;  1KIK A;  1HXD A;  3PNW C;  3C0C A;  2K7A A;  2OAW A;  3CMA Q;  2E12 A;  1Y0M A;  2GQI A;  5KYW A;  1X6G A;  2FB7 A;  5GAN d;  4MDX A;  3VRZ A;  1X6B A;  4GLK A;  1TXQ A;  2Y4Y A;  2KQW A;  2K9G A;  2DD5 A;  2YUN A;  1OOT A;  2KT8 A;  3HRU A;  3V8J A;  2V8I A;  1HD3 A;  2J05 A;  5CKF A;  1KD1 C;  4ORZ A;  2KRN A;  3M0R A;  5J26 A;  4FSS A;  1ZA1 B;  4JDS A;  3CCU T;  3NTH A;  4C0Z A;  1K9A A;  3L2Q A;  4CC4 B;  5GAO l;  2MK5 A;  3JCM J;  4L5G A;  2EBP A;  3RBB B;  1BK2 A;  3L1A A;  2CYZ B;  5CVI A;  4BI4 A;  4LDY A;  1N9R A;  3RKX A;  2K3Y A;  2QK0 A;  4FSX A;  2VGN A;  1MND A;  2GGR A;  1Q86 C;  1MMG A;  1UE9 A;  4EMK A;  1Y96 B;  2OTJ Q;  1VQ9 A;  2CT4 A;  4BE0 A;  5I2S A;  2RI3 A;  5CCA A;  5I21 A;  3S3M A;  4RTZ A;  3JB9 H;  4IKF A;  3X26 B;  1WLP B;  4M75 F;  1OUL A;  2E70 A;  1PWT A;  4FU6 A;  4A53 A;  5A0G A;  3CPW P;  3A8O B;  1BIB A;  1G83 A;  2QEX Q;  2KRS A;  2MWO A;  1E6H A;  2OTL T;  2CT3 A;  4K11 A;  2H3J A;  1ZBX A;  3M0P A;  1MV3 A;  1EZZ B;  3HFO A;  2DTH A;  1AWO A;  3SHW A;  1RAF B;  5FRO A;  1VQP T;  3CD6 T;  2EQK A;  2LTO A;  1YIJ T;  2YUP A;  1YHQ Q;  2BIV A;  5J39 A;  3R6O A;  4XU0 A;  3O8V A;  1I8F A;  2DJQ A;  1WZO A;  2F2V A;  2FRY A;  1YJ9 Q;  3VJP A;  2QAZ A;  1RAG B;  2D9T A;  4M75 E;  2JXB A;  4JJB A;  3M56 A;  5L23 A;  1GFC A;  3CCV Q;  3X20 B;  4PFZ A;  2F5K A;  3UF4 A;  1N6A A;  1W6X A;  2YRC A;  1ZUK A;  3L2U A;  2C0O A;  1WHK A;  3QBY A;  5GAN j;  5GAN 3;  2KNB B;  4PJO G;  2OX7 A;  4XQ3 A;  3CCS A;  4BDY A;  3EFS A;  3ZBD A;  3MP6 A;  3UAT A;  1R0C B;  2KEA A;  2EGE A;  2QA4 Q;  1SHG A;  4QVC A;  2F1L A;  3HHT B;  4LXC A;  2HBW A;  2DF6 A;  3VS2 A;  4ZGJ B;  3I55 Q;  1PC0 A;  1M8M A;  3MJX A;  3OYB A;  2QQR A;  4A63 B;  1WXT A;  3EFO B;  4M75 A;  2EQM A;  2QXF A;  1VQO Q;  2M02 A;  2KR3 A;  1H3H A;  2YSQ A;  1AWX A;  4MZP A;  2RJD A;  2LVM A;  2EFI A;  4WTO B;  3OYF A;  3CCJ T;  4M77 G;  1SPK A;  2QGG A;  2RQU A;  4VUB A;  5GAN h;  1TUG B;  4M7D D;  1Q81 U;  2LP5 A;  2RHZ A;  4KT0 E;  3V7S A;  4RG8 A;  4LDU A;  5DLO A;  3PE0 A;  5LJ5 g;  1ZSZ C;  4LDW A;  1B34 B;  4B9W A;  3G71 A;  1MHN A;  3HSB A;  3LX7 A;  2HSE B;  2BUD A;  2X9H A;  1G8X A;  2L89 A;  2E5Q A;  4XTZ A;  3CME A;  1AWW A;  4N0A C;  3I56 Q;  1WHM A;  4PJO C;  3OYC A;  3JB9 D;  3VS6 A;  2EKH A;  1D3B A;  2DYB A;  1IXD A;  2DZC A;  3CQT A;  3VS1 A;  1KQS P;  4F04 B;  1WI7 A;  5HK0 A;  4HVU A;  4RTX A;  4JLI A;  2B8A A;  3HRS A;  3PFS A;  1GCP A;  2PVD B;  2X51 A;  1SG5 A;  1GCQ A;  1X6O A;  3JRZ A;  2DTO A;  4M7A G;  5KYU A;  2P84 A;  3EG1 A;  4JRQ A;  3H41 A;  4RCB A;  2A08 A;  1N27 A;  1WHJ A;  3PTA A;  5CQY A;  4ELY C;  1Q81 C;  2J6K A;  4M77 C;  4NL2 A;  1YIT Q;  1PSE A;  1N9S A;  5IHK A;  1VQ7 Q;  3D7S B;  1D0X A;  4QVZ A;  3TSW A;  4DA4 A;  3MET A;  3CC4 T;  1QVG P;  1M4Z A;  4KUI A;  1K76 A;  1N8R R;  5DY9 A;  2M51 A;  3CC7 A;  1W70 A;  1NE8 A;  3CCL A;  4ME7 A;  4ZNX A;  2FPD A;  2RI2 A;  1D1C A;  3E2U A;  1R0B G;  3OYG A;  2WSF E;  2ZPF B;  2DJZ A;  4N4H A;  2MPX C;  4YTL A;  4OGE A;  1M1K U;  1AT1 B;  4LN2 A;  3OQ5 A;  3KBG A;  1KQS A;  4JLG A;  1QVP A;  2CSQ A;  2QTX A;  1RUW A;  2ZPH B;  4Y91 A;  3CCQ A;  4DOW A;  2DEU A;  4C5I A;  1UG1 A;  3SWN A;  3WXM B;  4J9H A;  4OB0 B;  2A3L A;  4M7D F;  4BAC A;  4N4I A;  2YRD A;  3ER0 A;  3JCM f;  3OMG A;  1YJW A;  3V7C A;  2RK2 A;  4M7A C;  2K3X A;  3J7A F;  3I5S A;  2R57 A;  2L3R A;  4XAX B;  2DE0 X;  2NUT B;  3GP8 A;  4NL3 A;  3VS5 A;  1QVG A;  4C8Q G;  2AKK A;  1PD1 A;  3G6E Q;  4C0D C;  2KE9 A;  3G4S Q;  1JB0 E;  5LJ5 e;  2GQV A;  2L5Q A;  1RAD B;  4A54 A;  1ZX6 A;  2YDL A;  3JB9 F;  2EPD A;  2KGT A;  2E6N A;  2ROT A;  1RLP C;  3G7Z A;  3L2R A;  2P0Q A;  3H0H A;  2AKL A;  1X75 C;  5KYY B;  5CIU A;  4HT8 A;  1QP2 A;  4KH1 B;  2LNH B;  4JRI A;  3QSU A;  3UPU A;  2DTI A;  2D0Q B;  3FIF A;  2RF0 A;  4GY5 A;  3H8Z A;  1BIA A;  2HAX A;  3WVE B;  1G5V A;  4NOY A;  1LVK A;  4IUP A;  3OYA A;  2E65 A;  1NJI R;  1M30 A;  2W10 A;  1Q95 G;  3VV0 A;  1VQ4 T;  3M4G A;  2YXY A;  3QWY A;  2I0N A;  4JJC A;  4FYV B;  1NM7 A;  3FC3 A;  2K6D A;  4IIO A;  3I55 A;  3LGF A;  4XTY A;  4BI8 B;  4FIB A;  4M7D A;  4E6R A;  4C92 G;  2YHT A;  4XU3 A;  2VAS A;  4NS5 A;  1KFZ A;  3EGD A;  5LJ5 d;  4HT9 A;  2XDD A;  2RN8 A;  2YRV A;  2X4W A;  1UEC A;  2JTF A;  2MMP A;  3RMQ A;  2FG0 A;  1VQL A;  4M78 G;  3ZL7 C;  2E41 A;  2EYQ A;  1K8A R;  3VRY A;  4IUR A;  3CCE T;  4DOV A;  2KXD A;  3URG A;  4PJO D;  2D8J A;  2DIG A;  2JNG A;  3CBO A;  1YWO A;  4A4F A;  1M90 R;  1VQN T;  2GTJ A;  4QT7 A;  2DA9 A;  1FWZ A;  4BUG A;  4HCC A;  5IT9 E;  4D8K A;  2CKK A;  2GBQ A;  1YJN T;  1KK7 A;  1VQP Q;  1YFN A;  1AEY A;  3S3N A;  4WF2 A;  2NLU A;  4F7U G;  1YIJ Q;  4J9G A;  2MOX A;  1H8K A;  1UFF A;  2EYZ A;  4LE9 A;  3TQ7 P;  3A8M B;  4A4H A;  1YI2 Q;  1WHG A;  2PVG B;  3QPH A;  3QYG B;  2J6O A;  2M16 A;  4UC4 A;  3RUX A;  4BY6 B;  5CKD A;  4R55 A;  4ESR A;  4JZ3 A;  1D0Z A;  3GPL A;  1OV3 A;  1QQJ A;  5IN1 A;  1VQM A;  1W2B P;  2A7Y A;  2F5T X;  2VUB A;  3X24 B;  1Q7Y R;  1K0S A;  1HYO A;  2GFA A;  4M77 D;  4C0G A;  3MHX A;  2HCK A;  2SRC A;  1X2K A;  5KCH A;  2VGM A;  1B3Q A;  3QG1 A;  1QCF A;  3TEE A;  4XTX A;  3OS1 A;  1WQW A;  5GAO n;  1D1B A;  2DRM A;  1YNZ A;  4OB1 B;  4XU1 A;  2ZCF B;  2OAU A;  1YIT A;  2V8K A;  3M9Q A;  5FWC A;  1OZ3 A;  4HVV A;  1S1N A;  2HD0 A;  2XIC A;  1UHC A;  2NUP B;  3CC2 A;  4Z89 A;  2HKQ B;  3ZEH A;  3OMC A;  2CS7 A;  2VVK A;  5C6S A;  5LJ5 f;  2KY9 A;  4DBR A;  3CCM A;  2FO0 A;  2E3I A;  4MMK A;  2P4T A;  3OA6 A;  2LT1 A;  2HQX A;  3GLX A;  2RD1 A;  1VQ8 T;  1Y07 A;  1VA7 A;  1M2O A;  4L6V 5;  1VIF A;  3JCM g;  4WCI A;  1SSF A;  3VYH B;  2KK4 A;  3LLR A;  5FU7 B;  2M9U A;  5LJ5 j;  3VS7 A;  4J83 A;  1W2B A;  3EAE A;  2LRQ A;  4Y28 E;  4MZM A;  3OYL A;  1UGQ B;  1VQ5 T;  1JBM A;  5KYW B;  3OY9 A;  2C06 A;  3HKS A;  7AT1 B;  3EH2 A;  1VQ6 Q;  1MV0 B;  2QDL A;  3VS4 A;  4M7A D;  1AWJ A;  3UA6 A;  5AT1 B;  1QWF A;  2FPE A;  3EG2 A;  4OB3 B;  2LMJ A;  2KT1 A;  1H64 1;  1SHF A;  1VQ8 A;  4DQ2 A;  1VQ9 T;  4HCZ A;  4EMH A;  4KH0 B;  2DD4 A;  3RKY A;  3JCM P;  4Z88 A;  4FL6 A;  4O6J A;  1E7O A;  4PJO F;  3OS5 A;  4BY6 C;  1PRL C;  1NG2 A;  2XI9 A;  1K1Z A;  3X25 B;  1KQS S;  2J7I A;  3MP1 A;  4IIM A;  3PVL A;  1N8R C;  5GMK l;  3M0T A;  1VQ5 A;  4IUV A;  3G6E A;  4LD9 K;  1X01 A;  2IG0 A;  3QHS A;  3OYM A;  3G4S A;  3OSV A;  4QQG A;  1VQK Q;  4P5N A;  5LJ5 h;  3TSZ A;  5HCK A;  3C4S A;  2QI2 A;  2VXE A;  3M4Y A;  4CI0 C;  3EG0 A;  1UB4 A;  5CKH A;  1M8V A;  4FM4 B;  2XKO C;  4EMK B;  4OGC A;  5GJV B;  3QJ6 A;  3E19 A;  1N5Z A;  2DXU A;  1M3B A;  2JS2 A;  3V8K A;  3REB B;  1WPY A;  1KG1 A;  1NLO C;  1QVG S;  1Z9Z A;  3CC4 Q;  4PJO E;  1LCK A;  4M77 F;  2RJE A;  4OVA A;  4O5V A;  1TU0 B;  3GOX A;  1RI0 A;  1ABQ A;  5EC7 A;  2CP6 A;  2FEI A;  2D1X A;  3SB2 A;  3DLL A;  5EG2 A;  1MMA A;  1KC8 R;  1P92 A;  1T0J A;  2DAQ A;  4BE1 A;  1JQQ A;  2AZS A;  4LD6 A;  3SFM A;  4KGX B;  4BB7 A;  3CCS T;  2J6F A;  3ULR B;  3NPF A;  1G3S A;  1BYM A;  1NEB A;  4C8Q D;  1IHV A;  1ZSZ A;  2CGH A;  1WHH A;  3M0Q A;  4LDV A;  1WNL A;  1BKB A;  2LNV A;  2PQW A;  4AMC A;  1BI1 A;  2R58 A;  1OZ2 A;  2GFU A;  2YWW A;  4N0A A;  1LJO A;  1WXB A;  4PJO A;  4J8O A;  3JB9 I;  1K8A U;  1NPP A;  4M77 E;  2BZY A;  2PU9 B;  2V8J A;  1M90 U;  4FYY B;  5KCO A;  4HCK A;  4Z8A A;  2DXT A;  3EGU A;  3H0I A;  4J6W A;  3JCM e;  2ED1 A;  4PJM A;  5FU6 B;  4M7A F;  2CH4 A;  2KYM A;  2O4X A;  4N4G A;  5CR2 A;  3MEV A;  2M0Y A;  2E6Z A;  2GF7 A;  3CBM A;  1NJI C;  1U5S A;  3GBQ A;  2GCX A;  2DKG A;  4XTU A;  4E7H A;  2R5M A;  2RMO A;  3G71 T;  1OPL A;  4A4G A;  1WGS A;  3MO8 A;  1RL2 A;  2K4Y A;  4J5Y A;  4ATO A;  4M75 B;  4LNP A;  4OMO A;  4M77 A;  1Q7Y U;  3CME T;  3MEU A;  4LDX A;  4RTY A;  4C92 D;  4RCC A;  2KI7 A;  2JZ2 A;  3OBY A;  1W4S A;  4J9I A;  3RMS A;  2VKN A;  2CDT A;  2VWF A;  4QQD A;  4J6Y A;  2L8D A;  2ESW A;  3L2Z A;  3FLG A;  4X34 A;  2KXC A;  4M7A E;  3FJP A;  2WAC A;  2NYS A;  4M78 D;  2K79 A;  1K8A C;  3NFC A;  1RI9 A;  1YCS B;  3BDL A;  5I22 A;  2L3P A;  1G3W A;  3KUF A;  3A1P A;  3QJY A;  3QZ9 B;  1VQ4 Q;  1M90 C;  4AT1 B;  1PHT A;  2COZ A;  3QYH B;  3E9G A;  4RUG A;  1S72 A;  3CMA T;  2DEQ A;  2M0O A;  2GNC A;  2K2M A;  3JCM d;  3PMI A;  1LOJ A;  1UDL A;  5KYX A;  1WQ7 A;  1QMC A;  1V76 A;  1UUE A;  1PG5 B;  3CPF A;  3F70 A;  2X4J A;  3BW1 A;  1D3B B;  2FHD A;  3ME9 A;  1AHJ B;  2PVO B;  2DYI A;  2XD0 A;  2F2X A;  2BZ8 A;  2LJ3 A;  5D6X A;  2XDB A;  3PIP A;  1BCM A;  2X35 A;  1QCN A;  2OI3 A;  4C8Q F;  4M7A A;  3CC7 T;  4EMG A;  4BDZ A;  3CCL T;  3KFV A;  3HL8 A;  4XTV A;  1BB9 A;  2EQJ A;  3CMA A;  1Q7Y C;  2KYB A;  5LJ3 g;  4MZT A;  3CCE Q;  1I5O B;  2NUZ A;  1YBY A;  2CZ7 B;  1WX6 A;  1YWP A;  5KYU B;  3H0F A;  1VQN Q;  2MYS A;  3EGX A;  2DO3 A;  4C5G A;  3CXC P;  1OU9 A;  1FX7 A;  3DLM A;  3N5B B;  2M1H A;  4A4E A;  1YJN Q;  2RNA A;  1EFN A;  3PGG A;  5GMK e;  3OYE A;  4AFU C;  1I4K 1;  2YUO A;  5M9O A;  4JJN K;  2LZ6 B;  3CCQ T;  2MAM A;  1QVF P;  4M75 C;  2RHY A;  4FT4 A;  2A37 A;  4F16 A;  2XDP A;  1M1G A;  1SF9 A;  2HQH A;  1TTH B;  4QKU A;  1WYX A;  4ZTF A;  1W2B S;  5GAM f;  3M59 A;  4DBH A;  4C8Q E;  3QKJ A;  1YJW T;  1TG0 A;  2ABL A;  1TH7 A;  5IXB A;  1VYU A;  4II1 A;  1JJ2 P;  1VQK A;  5GAN 6;  2ZAE A;  4PJN A;  4OMP A;  3MKD A;  3PVQ A;  1MGQ A;  4Z02 A;  1M2V A;  3A98 A;  2LJ0 A;  3I5R A;  2OTJ A;  3VYG A;  2AT1 B;  1BU1 A;  4QVD A;  4ZGE B;  2DER A;  4C92 F;  2RJC A;  1JO8 A;  1I5L A;  2EVR A;  1NZ9 A;  3MEW A;  3PMT A;  5CO7 A;  3S6W A;  1YP5 A;  3CCR Q;  1H92 A;  4FW2 A;  3KXT A;  2O2O A;  1M1F A;  3CXC A;  2HZY A;  2QEX A;  4J9C A;  1ARK A;  2QGF B;  4C8Q A;  5DM7 R;  1K0X A;  2KDS A;  4IUQ A;  2AK5 A;  4M78 F;  5ECA A;  2DBM A;  2P0P A;  4ANJ A;  1KQ1 A;  2C0T A;  3DKM A;  1QVF A;  2ATC B;  2E10 A;  2CUB A;  2JS0 A;  3NHN A;  3OYD A;  3OS2 A;  2DK3 A;  2PNI A;  1R77 A;  4KRT A;  1YHQ A;  1GCQ C;  3GNF B;  1VYV A;  4C92 E;  4CC7 A;  4F7U F;  3J80 E;  2Z0W A;  1YJ9 A;  5IAY A;  1JJ2 A;  4M7D E;  4X9C A;  3OYK A;  2ECZ A;  2DL5 A;  4KBM B;  3I55 T;  2HBP A;  3CCV A;  4FYW B;  1C1A A;  1SKU B;  1PCX A;  3SEM A;  2XHC A;  4M78 E;  5FWB A;  1VQ9 Q;  4AFQ C;  3CCU Q;  2ZPG B;  2CP2 A;  1XNI A;  2JJ9 A;  2QA4 A;  4JRK A;  3OS0 A;  3EG9 A;  1OQK A;  1VIE A;  2D6F A;  3JCM h;  1VQL T;  4KGV B;  5GAO m;  5HK3 A;  2HMA A;  5KE3 A;  2JOY A;  2YLC A;  1KC8 C;  4C92 A;  2VB6 A;  3O5Z A;  1U1S A;  1JXO A;  4F7U E;  2RQR A;  2CP7 A;  3I9Q A;  2K5F A;  1VQO A;  4M7D B;  3VKI A;  5DLQ E;  1ZLM A;  3QZ5 B;  1QW1 A;  3I56 T;  5GAN 7;  3EGD B;  2JTM A;  4JUV A;  3QDF A;  4M78 A;  3FB9 A;  2D8H A;  3S3O A;  3Q1J A;  4FYX B;  2F69 A;  1X2Q A;  2A36 A;  2ZPE B;  4A4K A;  1KJW A;  1OEB A;  1IHW A;  4JS5 A;  1YN8 A;  2P4R A;  1CKB A;  1K9M R;  2L0A A;  2MWP A;  4KGZ B;  1ZUU A;  5FRN A;  1B07 A;  3A8L B;  4CC3 A;  2OTL Q;  3EG3 A;  1VQM T;  5IH2 A;  1QCO A;  4PKC C;  1V1C A;  1ZSG A;  2MIO A;  3A8H B;  4ZGD B;  4E47 A;  4HCB A;  4F7U A;  2LJ1 A;  4AFS C;  3CD6 Q;  3CCS Q;  2LCL A;  2G6F X;  1IO6 A;  3I56 A;  1RAA B;  2LT4 A;  5A0D A;  2RQW A;  1XOV A;  2JUF A;  4XTW A;  1M9S A;  5GMK j;  5GAO p;  2VV5 A;  2BTT A;  3CBP A;  1YIT T;  1VQ7 T;  4DBF A;  2BE9 B;  2Y90 A;  5GAN 5;  3ASK A;  2KAF A;  2RQV A;  2CP5 A;  3CC2 T;  1RAB B;  2DIL A;  2RH2 A;  2EGA A;  3TU4 K;  3RR6 A;  1UGV A;  2DX1 A;  4DBQ A;  2LQ8 A;  1Q82 R;  2X3W D;  1AOJ A;  3CCM T;  3HRT A;  5FRM A;  2L2P A;  3E1S A;  3C94 A;  1VYT A;  5GAM g;  1UJ0 A;  1ZHI A;  4R0K A;  5I11 A;  2COY A;  2JMC A;  2YLB A;  4LUE A;  4E7Z A;  1T3S A;  2A28 A;  1N8R U;  1VQ7 A;  3MCA B;  2DL4 A;  3JAM E;  4QQ6 A;  4RTV A;  2JM9 A;  1GBR A;  4OMF B;  2QYZ A;  2KVQ G;  5GMK h;  1O75 A;  2DRK A;  3X28 B;  2YT6 A;  2MCN A;  5KYN A;  4ZN3 A;  1B7T A;  4OML A;  3EHQ A;  3OYH A;  5CQX A;  3CME Q;  1QWE A;  1NPR A;  2RPN A;  3CCJ Q;  1O9S A;  2Y4X A;  2JN0 A;  4HA8 A;  3AHU A;  5I2M A;  2DZ9 A;  1GBQ A;  2DL8 A;  4J9F A;  3FJ5 A;  3HP9 A;  2V26 A;  2G3R A;  3G6E T;  4PJL A;  1UJY A;  3PT9 A;  3EHR A;  1IZ6 A;  1NLP C;  3G4S T;  8ATC B;  2RJF A;  4OB2 B;  2BKD N;  1I81 A;  2CP3 A;  4QW2 A;  2QDY B;  2RI5 A;  2A0F B;  2RM4 A;  3TCJ A;  5D6W A;  2O01 E;  2YUQ A;  1Y7X A;  4JJD A;  5CKB A;  4HVW A;  3CCR A;  1SSH A;  2GTO A;  3NTK A;  2EYW A;  1E6G A;  5LJ3 f;  6AT1 B;  2LCS A;  1AVZ C;  3E9F A;  2P0K A;  1U8R A;  2LC4 A;  1SEM A;  3FDR A;  2QQB A;  3CC7 Q;  3CCL Q;  2PUK B;  5LJ3 j;  3GNG A;  5GAN 4;  4HXJ A;  4BI3 A;  3UA7 A;  1JXM A;  1UGR B;  4ZTJ A;  3CXC S;  3BE3 A;  1UEB A;  4E7S A;  1NYG A;  3G1J A;  3M57 A;  4DEX A;  1M27 C;  2RA2 A;  2HNI A;  1K4U S;  1RLQ C;  4IUU A;  1M3C A;  1Y96 A;  1BI3 A;  4J7F A; 
#chains in the Genus database with same CATH homology
 2AKK A;  2KE9 A;  1PHT A;  2KRM A;  4RUG A;  2JW4 A;  1WDX A;  2DM1 A;  2DMO A;  1Y57 A;  4LUD A;  1GRI A;  2GNC A;  2K2M A;  1UDL A;  1MUZ A;  2ED0 A;  5GJW B;  1ZX6 A;  2YDL A;  2EPD A;  3LH5 A;  3VS3 A;  2PTK A;  1ZUY A;  2HEQ A;  2FPF A;  2DL7 A;  4RTW A;  2KGT A;  1UUE A;  2EYY A;  2ROT A;  1X43 A;  2B86 A;  3M0U A;  1RLP C;  4EIK A;  2IIM A;  2J06 A;  5IHI A;  2F2X A;  2BZ8 A;  2LJ3 A;  3H0H A;  1UTI A;  2AKL A;  2X3X D;  1X27 A;  1AD5 A;  2OI3 A;  1BBZ A;  1Z9Q A;  2KRO A;  2LNH B;  3KFV A;  1BB9 A;  1WIE A;  3QWX X;  3RNJ A;  1T3L A;  1ZBJ A;  2KYB A;  2RF0 A;  1GFD A;  2DLP A;  2DBK A;  3TVT A;  2NUZ A;  1WX6 A;  1YWP A;  3H0F A;  2CH4 W;  4OMN A;  3I35 A;  1PKS A;  1WXU A;  1M30 A;  2W10 A;  1KSW A;  2RNA A;  2V1Q A;  1EFN A;  3IQL A;  3NGP A;  2LQN A;  3QWY A;  4AFU C;  2I0N A;  2YUO A;  4JJC A;  1NM7 A;  2LZ6 B;  4Y92 A;  2K6D A;  4IIO A;  1I0C A;  3VS0 A;  1KIK A;  2A37 A;  4F16 A;  4E6R A;  3C0C A;  2K7A A;  2OAW A;  4J9B A;  1WYX A;  1KFZ A;  1Y0M A;  2GQI A;  1X6G A;  3VRZ A;  1TG0 A;  2ABL A;  1X6B A;  2HDA A;  2RN8 A;  5IXB A;  1VYU A;  1UEC A;  2YUN A;  2K9G A;  4OMP A;  4AG1 C;  1OOT A;  2KT8 A;  3PVQ A;  2FG0 A;  3A98 A;  1HD3 A;  2LJ0 A;  2O9V A;  2J05 A;  3ZL7 C;  3I5R A;  4ORZ A;  3VRY A;  4AFZ C;  2KRN A;  3M0R A;  4FSS A;  1BU1 A;  2KXD A;  1K9A A;  4CC4 B;  2D8J A;  5FW9 A;  1YWO A;  2EBP A;  1JO8 A;  2K3B A;  2GTJ A;  1BK2 A;  4QT7 A;  3RBB B;  2DA9 A;  4J9E A;  2EVR A;  2H8H A;  2OJ2 A;  2ROL A;  2O9S A;  4D8K A;  1YP5 A;  2GBQ A;  1H92 A;  1AEY A;  2O2O A;  4D8D A;  4J9G A;  2MOX A;  1H8K A;  4J9C A;  1ARK A;  2GGR A;  1J3T A;  1K0X A;  4M4Z A;  2AK5 A;  2EW3 A;  1UFF A;  2EYZ A;  4LE9 A;  5ECA A;  2DBM A;  1UE9 A;  2J6O A;  2C0T A;  4ESR A;  4JZ3 A;  1W1F A;  1AZE A;  2XMF A;  1OV3 A;  2CUB A;  2JS0 A;  2KBT A;  3NHN A;  2PZ1 A;  2CT4 A;  3U23 A;  2PNI A;  4KRT A;  1GCQ C;  4RTZ A;  1K0S A;  1WLP B;  1VYV A;  2AZV A;  1PWT A;  4CC7 A;  2HCK A;  2SRC A;  1X2K A;  1B3Q A;  1G83 A;  1QCF A;  2ECZ A;  2KRS A;  1E6H A;  3M0S A;  2DL5 A;  2RQT A;  1U06 A;  2DRM A;  1YNZ A;  2CT3 A;  1FMK A;  4K11 A;  1X69 A;  3M0P A;  2DVJ A;  1MV3 A;  3SEM A;  5FWB A;  5FWC A;  4HVV A;  1S1N A;  4AFQ C;  1AWO A;  2JM8 A;  3SHW A;  4GLM A;  1UHC A;  1QKW A;  4Z89 A;  2YUP A;  2VVK A;  4OMQ A;  2DJQ A;  2F2V A;  1PKT A;  3R6N A;  2FRY A;  2FO0 A;  2L3S A;  1PRM C;  1VA7 A;  2C0I A;  3O5Z A;  2V1R A;  2JXB A;  4JJB A;  1JXO A;  2RQR A;  5L23 A;  2O88 A;  1GFC A;  3UF4 A;  4WCI A;  1W6X A;  1ZUK A;  2C0O A;  2DL3 A;  3I9Q A;  1WA7 A;  2KNB B;  3VS7 A;  1NYF A;  1ZLM A;  1JU5 C;  4F17 A;  3UAT A;  1JEG A;  2KEA A;  2D8H A;  1MV0 B;  2EGE A;  2QDL A;  3VS4 A;  1X2Q A;  2A36 A;  1SHG A;  1AWJ A;  3UA6 A;  1TUC A;  1QWF A;  2ENM A;  1KJW A;  1OEB A;  2FPE A;  3EG2 A;  1YN8 A;  2P4R A;  1U3O A;  2LMJ A;  2LQW A;  2KT1 A;  1CKB A;  1SHF A;  1WFW A;  2HBW A;  2DF6 A;  2LX7 A;  2L0A A;  3VS2 A;  4CC2 A;  1ZUU A;  1B07 A;  4JZ4 A;  4CC3 A;  3EG3 A;  1M8M A;  4Z88 A;  5IH2 A;  2EQI A;  2W0Z A;  1E7O A;  1PRL C;  4A63 B;  1V1C A;  1ZSG A;  1NG2 A;  2MIO A;  1K1Z A;  1WXT A;  2J7I A;  2KR3 A;  2LJ1 A;  4AFS C;  1H3H A;  4IIM A;  3PVL A;  2YSQ A;  1AWX A;  3M0T A;  2G6F X;  1IO6 A;  1A0N B;  4RTU A;  1OPK A;  2RQW A;  2SEM A;  1SPK A;  1XOV A;  1HSQ A;  1HJD A;  2RQU A;  3TSZ A;  2D0N A;  5HCK A;  1PNJ A;  2BTT A;  1T0H A;  2LP5 A;  3EG0 A;  2F2W A;  3PE0 A;  5GJV B;  2RQV A;  1N5Z A;  2DIL A;  1M3B A;  2EGA A;  2JS2 A;  1SRL A;  1TUD A;  3REB B;  1NEG A;  1QLY A;  1UGV A;  2DX1 A;  1SRM A;  1NLO C;  1Z9Z A;  2X3W D;  1AOJ A;  1AWW A;  4J9D A;  3REA B;  1LCK A;  4RTT A;  2L2P A;  1VYT A;  2L3Q A;  1ABQ A;  1UJ0 A;  5EC7 A;  4R0K A;  5I11 A;  1I07 A;  2D1X A;  2CUD A;  2FEI A;  2NWM A;  3VS6 A;  2JMC A;  2EKH A;  4LUE A;  1T0J A;  1T3S A;  2DYB A;  2E5K A;  1JQQ A;  2A28 A;  2AZS A;  2DL4 A;  3CQT A;  4RTV A;  2BZX A;  3VS1 A;  2J6F A;  3ULR B;  3NPF A;  2JM9 A;  1GBR A;  1WI7 A;  4F14 A;  4HVU A;  4RTX A;  1NEB A;  4DEY A;  2DRK A;  2YT6 A;  2MCN A;  3M0Q A;  4OML A;  1GCP A;  1FYN A;  1GCQ A;  3EHQ A;  4GBQ A;  1QWE A;  3JV3 A;  2RPN A;  3EG1 A;  1QKX A;  2FRW A;  3H41 A;  2A08 A;  1WXB A;  2BZY A;  2J6K A;  2EYX A;  1GBQ A;  2DL8 A;  5IHK A;  4J9F A;  3FJ5 A;  3TSW A;  1UJY A;  2HSP A;  3EHR A;  4HCK A;  1NLP C;  4Z8A A;  3EGU A;  1K76 A;  1I1J A;  3H0I A;  2M51 A;  1W70 A;  4AG2 C;  2ED1 A;  4ZNX A;  2CH4 A;  2KYM A;  2DNU A;  2FPD A;  2YUQ A;  4JJD A;  2M0Y A;  4HVW A;  1SSH A;  1UHF A;  2GTO A;  1U5S A;  3GBQ A;  2EGC A;  2EYW A;  1E6G A;  2JTE A;  2RMO A;  4LN2 A;  1CKA A;  1OPL A;  5IXF A;  1GL5 A;  2LCS A;  2CSQ A;  1AVZ C;  4LNP A;  4OMO A;  4JPB W;  1ABO A;  4OMM A;  1RUW A;  2O31 A;  1SEM A;  4RTY A;  1AZG B;  1UG1 A;  4J9H A;  4J9I A;  1M3A A;  3NMZ C;  2VKN A;  4X1V A;  2CDT A;  2VWF A;  4HXJ A;  2CSI A;  3UA7 A;  2ESW A;  1JXM A;  2CRE A;  2JT4 A;  1G2B A;  2KXC A;  1NYG A;  4DEX A;  1M27 C;  3I5S A;  5IHN A;  2K79 A;  1K4U S;  1RI9 A;  1YCS B;  5I22 A;  1RLQ C;  2DE0 X;  2L3P A;  3THK A;  1M3C A;  2JMA A;  3VS5 A;  1CSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...