4JZ3A

Crystal structure of the chicken c-src-sh3 domain intertwined dimer
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 6
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jz3A00
4OMMA 2H8HA 1OEBA 1K9AA 2RN8A 3REAB 1GFCA 2AKKA 2HSPA 1A0NB 2PNIA 4F17A 2L3QA 4RTXA 2KR3A 2JM9A 1T3LA 1JEGA 2DL4A 1QWFA 4RTZA 4QT7A 1N5ZA 2LJ0A 2AZSA 1GBRA 1JXOA 2X3XD 1GBQA 1RI9A 2DX1A 5L23A 2O88A 2DBKA 1I07A 3UATA 1M30A 3IQLA 1PWTA 2V1QA 1BB9A 4OMNA 2RNAA 2JM8A 1U06A 2CT3A 1NG2A 2DILA 1NEGA 1GRIA 2JW4A 1VYUA 1NEBA 2ED0A 2CUDA 4Z88A 2KXDA 5FW9A 2KEAA 2OI3A 1H92A 2J6FA 2RF0A 1NYFA 1PHTA 3UF4A 2EQIA 1MUZA 2EGEA 3JV3A 1X2KA 1U5SA 1E7OA 2KYMA 2KBTA 1AOJA 2JS2A 3VS4A 1K0XA 4AFQC 1UJ0A 5I11A 2KT1A 3A98A 3EGUA 2GNCA 1AZEA 3VS6A 1H3HA 1UJYA 1QKWA 3VS1A 5I22A 1SEMA 2L3SA 3O5ZA 2G6FX 4JJCA 2KNBB 2OAWA 2CDTA 1NM7A 2JS0A 5IH2A 2FRWA 3M0PA 2EGAA 2YDLA 1W6XA 3I5SA 2KRNA 1UTIA 4CC2A 3KFVA 2LJ1A 3PVQA 1G2BA 1UHCA 1GCQA 2CSQA 1PNJA 3H0FA 1QWEA 1SRLA 1ARKA 3H41A 4E6RA 2ROTA 2O31A 2CUBA 2YUNA 2EVRA 1OPKA 1WX6A 1AEYA 4OMQA 2KYBA 3EHRA 3I35A 3UA7A 2HBWA 2GTJA 2IIMA 1JU5C 2NWMA 1TUCA 2LP5A 1QLYA 5ECAA 4Z89A 1JO8A 1ZBJA 3EG0A 2J6OA 2NUZA 2ABLA 2BZYA 2YT6A 2ED1A 3R6NA 1X27A 5HCKA 4RTUA 1PKSA 2DRKA 4JJDA 5IXFA 2AKLA 2DLPA 4CC7A 2CSIA 3NPFA 3C0CA 2J06A 1OV3A 4HCKA 2DL7A 2XMFA 2KE9A 4ORZA 2P4RA 4IIMA 2D8HA 1K1ZA 3VS2A 4J9IA 2W10A 1WYXA 1CKAA 3H0HA 4HVVA 2M51A 1LCKA 3VS3A 1FMKA 5IHIA 1CKBA 2LMJA 5FWCA 4JZ4A 1M8MA 1SPKA 5FWBA 1X6BA 1M3AA 4FSSA 1YP5A 1E6GA 2RQVA 2LJ3A 4F14A 2V1RA 1I1JA 2ENMA 1WIEA 2DNUA 2EYYA 2J6KA 2QDLA 4OMLA 2DVJA 1I0CA 3RNJA 4AG2C 1MV0B 1WLPB 2A37A 2A28A 1AD5A 4DEYA 1M3BA 2C0IA 2PTKA 1KSWA 1U3OA 1VYTA 2FEIA 1NLPC 1WXUA 2GBQA 4LN2A 2FO0A 3M0TA 1E6HA 4EIKA 2FPFA 1Y57A 2ROLA 3M0QA 1S1NA 1ABOA 1WXBA 2OJ2A 2DMOA 5EC7A 1Z9ZA 1YNZA 2KGTA 2O9VA 1H8KA 2RQWA 1X43A 2MCNA 1AWOA 4LUDA 1UGVA 2EYZA 3NMZC 2C0TA 5GJVB 5IHNA 1PRMC 2DL3A 2BZ8A 3EG2A 4J9FA 3PVLA 4OMOA 1K4US 3NGPA 2K3BA 4R0KA 1V1CA 2DRMA 1FYNA 2L3PA 1NLOC 1VYVA 2JTEA 2B86A 2EKHA 3VS7A 1TG0A 2K6DA 2DM1A 1UECA 2DJQA 4M4ZA 2EYXA 1KJWA 2YUQA 2MIOA 2MOXA 4HVWA 4LUEA 2CH4W 2DE0X 3VRYA 4LNPA 1ABQA 2BZXA 1W1FA 2DF6A 1KIKA 1TUDA 2GQIA 1HJDA 3VRZA 1IO6A 4RTVA 2M0YA 2HCKA 2F2XA 4KRTA 2EBPA 2L0AA 1UG1A 2A36A 1GL5A 5IHKA 1AVZC 1AWXA 1SRMA 2RQTA 3UA6A 2LNHB 2A08A 1M3CA 2I0NA 1T0HA 2KXCA 2DA9A 4RTWA 3ULRB 1Y0MA 3H0IA 2F2WA 1CSKA 3CQTA 3M0SA 1ZX6A 4Z8AA 1X2QA 2O9SA 1G83A 3VS5A 2J05A 2W0ZA 1QCFA 4GBQA 1ZUUA 3LH5A 2HEQA 1Z9QA 1T0JA 3REBB 4RTYA 2JT4A 4ESRA 4HVUA 1T3SA 4IIOA 1GFDA 4WCIA 3TSWA 1JQQA 4ZNXA 2EW3A 2KRMA 3TVTA 3EG1A 1AWJA 2K79A 1B07A 1B3QA 4HXJA 2JMCA 2D0NA 1X6GA 2LQNA 4AG1C 4D8KA 4RUGA 2GGRA 4Y92A 4JJBA 2EPDA 1AZGB 2JMAA 2BTTA 5GJWB 4AFSC 1UHFA 1ZSGA 3M0UA 2SRCA 3SEMA 1UE9A 2J7IA 1J3TA 2YUOA 4GLMA 1OPLA 2KROA 1AWWA 3SHWA 1M27C 3THKA 2YUPA 4AFUC 1MV3A 4CC3A 2F2VA 4J9GA 1RLQC 2AK5A 3PE0A 5IXBA 2HDAA 2ESWA 2E5KA 1WXTA 1SHGA 2RMOA 1K0SA 2X3WD 3TSZA 2K2MA 3FJ5A 3ZL7C 1UUEA 4JZ3A 2KRSA 4F16A 2LZ6B 1OOTA 3QWYA 1YWPA 2CREA 1WDXA 2D8JA 2VVKA 2YSQA 2O2OA 4J9EA 2DYBA 1W70A 4A63B 1KFZA 3VS0A 1XOVA 4K11A 4AFZC 1PRLC 3RBBB 1EFNA 3I9QA 2EYWA 1SSHA 2L2PA 3NHNA 1VA7A 2FG0A 4JPBW 1GCPA 1K76A 2VKNA 1ZLMA 2RQRA 2KT8A 2AZVA 1PKTA 2DBMA 1UFFA 1WFWA 4J9BA 1BK2A 2EGCA 1RUWA 2PZ1A 2LCSA 2CT4A 2JXBA 2CH4A 4OMPA 4RTTA 1QKXA 2K7AA 3EG3A 3EHQA 2FRYA 2RQUA 3M0RA 1RLPC 1ZUYA 1YWOA 1BBZA 1JXMA 2DL8A 2SEMA 1NYGA 2VWFA 1X69A 2GTOA 1HSQA 2RPNA 4J9HA 1HD3A 4J9CA 2LX7A 4J9DA 4D8DA 2ECZA 2FPDA 3U23A 4X1VA 4LE9A 3GBQA 1GCQC 2LQWA 1YN8A 2FPEA 1SHFA 2DL5A 2D1XA 3I5RA 2C0OA 2K9GA 1UDLA 1WI7A 1BU1A 3QWXX 1ZUKA 4CC4B 1WA7A 1YCSB 4DEXA
chains in the Genus database with same CATH superfamily
4P5NA 2JN0A 2FL7A 3CCUT 4KUDK 1P92A 2YLCA 5LJ3d 2PNIA 2L3QA 2JM9A 3PTAA 2QGGA 2DL4A 4MMLA 4OGCA 2CP0A 2QQSA 2AZSA 3M5AA 3EFOA 3INZA 1GBQA 1RI9A 3EGXA 3CCSA 3IQLA 2V1QA 4NL2A 1VQNT 1Q95G 5KYYA 2JM8A 4M77E 1TS9A 1U06A 2DILA 1NEBA 2CUDA 3QSUA 2EIFA 5FW9A 1VQMQ 2KEAA 1YI2T 1M1FA 1VQ6T 2P0QA 4FYWB 4QQGA 1MUZA 1NJIU 1U5SA 1ACMB 1D0XA 2NLUA 2JS2A 4JRIA 3VS4A 5CKDA 1K0XA 1RACB 1Q86R 2GNCA 5D6XA 4WTOB 1VQMT 3M59A 3BE3A 1UJYA 3VS1A 1IHWA 5I22A 1SEMA 3O5ZA 2G6FX 2P0PA 1N9RA 2KNBB 5CKHA 2FRWA 2E64A 3MPUB 5GAOq 1JBMA 4M75B 1WHGA 4ZN3A 5KYNA 3NFCA 1VQKT 3RR6A 3OW2A 1W6XA 3I5SA 1WJRA 4GY5A 3VJPA 1UTIA 2LJ1A 2XDDA 1GCQA 1PNJA 1QWEA 3PIOA 4HKEA 4M75G 3JCMP 2O31A 4Q5WA 1VQKQ 3PGGA 4C0FA 4II1A 1FX7A 2EVRA 4F7UG 1AEYA 4OMQA 4C0DB 3OYHA 3CCQT 1Q82R 3CC7A 4M78E 2HBWA 3OSSC 1JU5C 2NWMA 1TUCA 2LP5A 3P8DA 5ECAA 5AT1B 3QJ6A 4QVCA 1Q81U 3QYGB 1VQNQ 2BZYA 3NTIA 3JB9J 2ED1A 4L6V5 4D6WA 1X27A 2ZGWA 5KYUB 2DTIA 5HCKA 1PKSA 3OYBA 2DRKA 3JCMc 4C92B 4M7AB 3OW2P 2DLPA 2O4XA 3L2QA 2Z0WA 2E1HA 1YJNQ 1VIEA 2FHDA 2XMFA 2CP3A 4ORZA 2LTOA 4MZMA 2P4RA 4HA8A 2RI2A 3CCMT 1W2BA 2BE7D 1K1ZA 3VS2A 4LDVA 4RMOA 3G71A 1M2VB 4FU6A 3OYFA 3X24B 4KGXB 3OS5A 3QO3A 5IHIA 5FLXE 5KYWA 4A4EA 4M7DG 1LNXA 5L8RE 4JZ4A 5FWBA 1X6BA 3QZ9B 1E6GA 4PNOA 2R57A 2RD1A 5DLOA 4F14A 2V1RA 1HK9A 4JS4A 4E7IA 1I1JA 2ENMA 2DNUA 1SG5A 3OYCA 7AT1B 2COWA 2YXYA 3G7ZA 4AG2C 1MV0B 2A37A 1FMWA 3EG9B 1YHQT 5A2QE 3M9QA 4CI0C 3CCUA 3CCRQ 2LQ8A 3CMEA 2PTKA 1VYTA 1U3OA 1TSFA 2FEIA 1HYOA 1S72Q 2QGFB 3GP8A 1WXUA 3OYNA 1K9MC 1E6HA 4EIKA 2ROLA 1WXBA 1MMGA 3RIRA 3EFOB 3X26B 1V29B 2YWWA 4BACA 2COZA 3H8ZA 4LUDA 1UGVA 1PRMC 3QKJA 4J9FA 4OMOA 4R56A 2Y90A 4B9XA 1M2OA 2WSEE 5KE3A 1GXIE 3MEAA 3QBYA 4L59A 2KDSA 1UECA 2AT1B 1KJWA 2YUQA 3OYKA 1WGSA 4LUEA 2DPPB 2E12A 2CH4W 4LNPA 3HPWA 4LDUA 3CCJT 1VQ9Q 1H3ZA 1MMNA 1KIKA 1TUDA 4ME7A 1QVFP 1YJ9A 2HCKA 1TTHB 1MMDA 2EBPA 2XDPA 2XK0A 5KYYB 2KSSA 1D1AA 3G71T 4C92A 4B9WA 2YRDA 3UA6A 2A08A 3PMTA 4PJNA 4E7HA 2JZ2A 4RTWA 4MDWA 4LXCA 1OX9A 1VQ7Q 5I2MA 3H0IA 1CSKA 3CQTA 1OZ2A 4FM4B 3OYDA 1KC8C 5GAN5 2XG8D 3TEEA 1WHKA 3JCMf 2LCLA 2L3RA 1VQ4T 2M9UA 2LT1A 3VS5A 1YHQA 4GBQA 2XHCA 2EJFA 3G1JA 3LH5A 1M1KU 4DQ2A 4M78D 4FSXA 4XTVA 1YCYA 3JRZA 2ZPFB 4C8QB 2DD5A 4HVUA 1KK7A 4IIOA 4Z02A 4A4GA 3DB4A 1VQPQ 2NYSA 3LYIA 1NBEB 1IGUA 2CZ1B 4OB1B 1X6GA 4M78A 3TCJA 1M1GA 3OQ5A 2GGRA 4OB2B 3T9NA 2JMAA 1QVFA 4F7UB 3JCMJ 2JNGA 1YIJT 1ZSGA 4A54A 3M0UA 5LL6S 3CCVT 1I5OB 1C0MA 2J7IA 1OPLA 4ZGEB 4M78F 2KROA 1D09B 3S3NA 2QA4T 1AWWA 4N4IA 3THKA 1M27C 4PJMA 2HKQB 1MV3A 2F2VA 5KYXA 1NZ9A 3OBWA 3QG1A 4E7ZA 3A1PA 1K73U 4MZTA 3PE0A 3CCJA 1IRXA 2YLBA 2ESWA 2MI6A 3CMET 2BIVA 2LCCA 2OTLQ 4E7KA 1K9MU 2X3WD 3TSZA 2QA4A 3SB2A 3ZL7C 1UUEA 2NUPA 3CCET 4BY6B 2X51A 2PQWA 2HKNA 3BDLA 2YRCA 1WDXA 2PU9B 2HAXA 2QG9B 1OULA 4C5HA 1YITT 4OF1A 2DYBA 5FU7B 3VS0A 3JB9G 3QYHB 2EKOA 1XOVA 3NHNA 4M77A 2IPOB 3J7AF 1KD1C 1GCPA 3R6OA 3OYJA 3CPWP 1M5Q1 2KQWA 1KQ1A 2VKNA 2JUFA 3LH0A 4A53A 1SF9A 2DBMA 1WFWA 4J9BA 1BK2A 1BYMA 4QQ6A 4A4KA 2RJFA 4OP0A 3N5BB 2KVQG 3FIFA 3M0RA 1NJIR 3CBPA 2FZCB 4PJOB 2PVDB 2DL8A 3EAEA 5C6SA 4M7AF 3FJPA 1NJIC 2DVEA 3MEUA 4NOYA 4C92G 4J9CA 2QXFA 3U23A 3CMEQ 4X1VA 3JSCA 2OTJA 3OB9A 2K5IA 3CCLT 3L2RA 4DBQA 1MMAA 2DL5A 3I5RA 2K9GA 1D0ZA 2AIRB 1ZUKA 3Q1JA 2FZGB 4OMMA 1OEBA 4PJOC 3QXEB 2K2VA 2XI9A 4BI8B 2HSPA 4KBMB 4XU1A 1PSFA 4F17A 4C8QF 1T3LA 2RI3A 1VQ5T 1OU9A 3CD6A 4PJOE 1QWFA 5CKFA 1N5ZA 2LJ0A 1GBRA 3MKDA 1TOVA 3CPFA 2LRQA 1JXOA 2X3XD 4PLIA 1VQ8A 1VQ4Q 2VASA 5L23A 1W2BP 2DBKA 1I07A 4RKUE 3LWIA 3UATA 3OYYA 1PWTA 2RHIA 4OMNA 3RKXA 4XTZA 3CCMQ 4FYVB 4EMKC 4HCBA 2XU8A 1GRIA 1VQLA 2OI3A 1H92A 2J6FA 4IKFA 4M78B 2NUTA 3CC4T 3JV3A 1X2KA 3JCMe 5GANg 3CMAQ 5GAOl 2KYMA 2CZ7B 3MP8A 3FC3A 2V8JA 3L2VA 4AFQC 1UJ0A 2ZCFB 2R58A 3EGUA 2OTLA 3SFMA 4C8QE 2EFIA 1RABB 3I55T 5GAMf 3AT1B 2CDTA 4M75A 5IH2A 2QQRA 4XTXA 3ER0A 4PK4A 2KMTA 3HRSA 3HRTA 4OVAA 3PVQA 3TU4K 1G2BA 1UHCA 2CSQA 2DO3A 3MP1A 3H6ZA 4E6RA 3PT9A 3CCLA 1VQ8Q 2M02A 1ZSZC 5I21A 3E9FA 4DBRA 3H9NA 3VU3C 1WX6A 2MK5A 3EHRA 3I35A 3MO8A 4J83A 4HCZA 3JCMV 3UA7A 2GTJA 1QLYA 3G6ET 4OGEA 3NTHA 4Z89A 5CO7A 2ZPIB 3URGA 4HT9A 3EG0A 4WF2A 2J6OA 2Y4XA 2XKOC 1OQKA 3HP9A 4RTUA 3PNWC 5IXFA 4XQ3A 4AMCA 3A8OB 1M90U 1MGQA 2CSIA 3CC2Q 2K5LA 1N27A 4HCKA 1IHVA 2DL7A 4EMHA 4IIMA 3CCSQ 2D8HA 1N9SA 3HL8A 1UGQB 2KK4A 5A0LA 2W10A 1PG5B 1WJSA 3VUZA 1R0CB 4HVVA 2DZCA 1LCKA 3PMIA 1Y96A 1I8FA 1M8MA 1YP5A 5DY9A 4J6XA 2A7YA 2GFUA 1WHMA 1PCXA 2CP2A 2DKGA 1TUGB 3CD6Q 2MF2A 4KH0B 1QVFS 1ZA2B 2DXBA 2CKKA 2HL3A 5IT9E 2M16A 2RJCA 1M3BA 1KSWA 2CS7A 1EZZB 3S6WA 4E2FB 4LN2A 1KHIA 2BUDA 2MWOA 3M0QA 4C92D 3NTKA 2LDMA 4Y28E 2RHXA 1VQLT 1H8KA 5D6YA 2MCNA 5GJVB 5IHNA 3PVLA 5LJ5h 3CC2A 2QI2A 1RL2A 2E4HA 1ZQ1A 1FYNA 1KG1A 1VYVA 2B86A 1TG0A 4M75C 4M4ZA 3CCST 2MIOA 2MOXA 4C8QC 2RHZA 3EFRA 1YBYA 1WHLA 1IZ6A 1W1FA 4M77D 3C12A 3OSVA 1PM3A 4E7JA 1HJDA 4MDXA 5GAMd 1K9MR 4DOVA 3G4SQ 2FZKB 2L5QA 2E5QA 4JUVA 5GMKj 2CP5A 2EAYA 1YJWT 1KD1U 2LNHB 2XICA 2DA9A 2R5AA 2RO0A 3ULRB 1Y0MA 3RMQA 1KQSP 1BIBA 4KH1B 2JJ9A 4CRIA 1X2QA 3EGXB 5GANf 1G83A 2HSEB 2LC4A 2W0ZA 1VQLQ 4LDWA 4DBHA 3GNFB 5IAYA 1D3BB 4BB7A 1T3SA 2PVOB 3TSWA 1JQQA 3MEWA 4ZNXA 3CMAA 5LJ3j 3CPWA 3EG1A 3EH2A 1AWJA 2K79A 1B07A 3M54A 2JMCA 3VKIA 4M7DA 1DJ7B 3SEMA 4M7DF 1UE9A 4C8QG 4C5GA 4M7DB 4CC3A 3QJYA 3HFNA 4KUIA 5IXBA 2G3RA 2HDAA 1WHHA 1WXTA 5HK3A 1SHGA 1KC8R 1K0SA 3GNGA 3JCMW 3FJ5A 3OYAA 1SKUB 2KRSA 5LJ5e 1C1AA 4LDYA 1OOTA 1PD0A 1D1CA 4GLKA 5IN1A 5LJ3h 1U1TA 2D8JA 3KBGA 2YSQA 2O2OA 4E7SA 1W70A 5CR2A 1O75A 4M78G 1PRLC 5C0MA 1SSHA 4XTUA 4JPBW 3OYMA 2LQKA 4AT1B 1ZLMA 1VOMA 2AZVA 1PKTA 2MAMA 2DETA 1UFFA 3V7SA 3O8VA 1W4SA 2LCSA 2VC8A 4RTTA 4C5IA 2QEXT 1QKXA 2K7AA 3EHQA 2XDBA 1PSEA 4BE2A 2FRYA 4J6WA 2QYZA 2RQUA 3V8JA 3E19A 5GANd 1JXMA 2SEMA 2YHTA 1R8OB 4FT4A 4IUQA 3JCMX 2RPNA 1Q7YC 1JJ2A 1YJNA 1KQ2A 2DTHA 4JRKA 2LX7A 1G3WA 4X34A 4BD3A 4LE9A 1U8RA 1GCQC 3GF5A 1YITA 4N4HA 2HQHA 1SHFA 3DLLA 3EG9A 1UDLA 1YJ9T 4PFZA 1KD1R 1G8XA 4B6MA 1QCNA 3QWXX 1Q81R 4CC4B 1WPYA 2CYZB 4ELYC 3CCEA 1D3BA 4DEXA 3FB9A 2RN8A 1AT1B 2CZ0B 4DOWA 1GFCA 1A0NB 1VQ8T 2DJZA 4RTXA 2EWNA 2KR3A 5GANh 3CCJQ 1VQ9T 4O6JA 4QT7A 4M7AG 1WQWA 2KI7A 1R0BG 4JLIA 3E2UA 1BCOA 2DX1A 2KY9A 2O88A 1VQ7A 1RAHB 4VUBA 2KAFA 2FB7A 1JRIA 2ZZDA 1NE8A 5GAN4 2CT3A 2XIDA 4QW2A 5HY6A 1NG2A 5GAMj 1KQSA 2LX9A 1NEGA 1VYUA 2JW4A 1K73R 4RG2A 2VGNA 4F7UE 2RF0A 1PHTA 3FLGA 3MEVA 2HD0A 2IVWA 2RH2A 2EQIA 4BUGA 2F1LA 3JCMQ 1E7OA 2A3LA 2K4YA 3JCMg 5GANe 2QEXA 2OAUA 2KT1A 4L5GA 1KHCA 1EX4A 3LGLA 4N0AA 3TQ7P 1YJWQ 4JJCA 3V7RA 2DXUA 2OAWA 3CCEQ 2QQAA 2JS0A 3D7SB 5KYUA 1IXDA 3M0PA 2EGAA 2YDLA 3QZ5B 1Y07A 2KRNA 1VQPT 2XD0A 3I56A 1YJNT 2LT4A 3H0FA 1OU8A 2B8AA 2GFAA 1SRLA 1ARKA 5LJ3g 2ROTA 1Q82C 3META 2L89A 2LNVA 4FW2A 1VQ6Q 3A8GB 3VYHB 4JRQA 1OPKA 4BDZA 2AHJB 2IIMA 5FU6B 3CBOA 5CCAA 4BI4A 4XU3A 3OYEA 1ZBJA 3EH1A 2ABLA 3R6NA 1YHQQ 4NL3A 1IB8A 4F7UA 1Y96B 4FW1A 4JJDA 3VV0A 2AKLA 2FVUA 2P4TA 4O5VA 1Q7YU 3C0CA 2J06A 1OV3A 4IUUA 4PJOG 1LVKA 3WXMB 2KE9A 2FYKA 1Q81C 4QKUA 4LD9K 3S3OA 1YITQ 4J9IA 1FMVA 1WYXA 3M4GA 2D6FA 3H0HA 2E41A 5GAMe 1M9SA 3M53A 4OB3B 3QIIA 3VS3A 3CCQQ 1CKBA 1UB4A 4KGVB 3E9GA 1IREB 1M4ZA 2ATCB 2LMJA 5FWCA 3G4ST 1SPKA 2ZPEB 4FSSA 3MJXA 2LJ3A 3JB9H 4XTWA 4PJOF 1WIEA 2EYYA 2J6KA 2K57A 2QDLA 4OMLA 3FRNA 1I0CA 2H3JA 3RNJA 1WLPB 2A28A 3MHXA 2C0IA 1LJOA 3GPLA 2GBQA 2X9HA 3M0TA 4FT2A 4XTYA 3M58A 1RAEB 3CEYA 3J80E 1S1NA 4ELZC 4ZN1A 5GMKe 1Y71A 2O9VA 2RQWA 1X43A 3JCMb 4BDYA 1AWOA 5CK9A 2DEQA 1G3TA 1YI2A 1Q86C 1K4US 4HCCA 3NGPA 2K3BA 1BCMA 3BDUA 4C0ZA 2VV5A 2L3PA 1NLOC 3L1AA 2RI5A 3VS7A 2DM1A 2VGMA 2EYQA 4HVWA 5LJ5d 2E3HA 2K3XA 3DLMA 1QMCA 1VQ5Q 1NPPA 1QVPA 3VRZA 2X4XA 2JOYA 3CXCP 5GAN8 2HQXA 1KC8U 4C92F 2V26A 4MMKA 3LGFA 1RAGB 2BKDN 2F2XA 1QCOA 2L0AA 5HK0A 2V8IA 1UG1A 2A36A 3C95A 1GL5A 2DFUA 4R55A 1JB0E 3OA6A 9ATCB 1BI1A 1VQKA 1S72A 1UEBA 4XAXB 4DBFA 4A4FA 3A8LB 3L2UA 4PKCC 2VXFA 2X4WA 1N6AA 1X01A 5LJ3f 4FL6A 1ZX6A 3GOXA 3G6EQ 5FU6C 4Y91A 2QA4Q 1VQNA 3A5ZB 3CC4Q 1QP3A 2R5MA 1I5LA 2O9SA 2J05A 1FWZA 1QCFA 2RK2A 3JB9D 1ZUUA 2HEQA 5I2SA 1QQJA 1Z9QA 1T0JA 3REBB 3CXCS 1RAIB 4ESRA 1G3YA 2QTXA 4XU0A 3OYIA 1GFDA 3CCRT 2EQMA 2EW3A 3EGDB 4PFPA 1S72T 4C92C 5FRNA 4J7IA 2RM4A 3RKWA 3TVTA 2M1HA 4M77B 4HXJA 3LX7A 4AG1C 1VQOA 2E10A 4Y92A 1YJWA 1AZGB 1X6OA 3LW5E 5GJWB 2X4JA 3V8KA 2OTJT 2F5KA 2SRCA 3QDFA 1R77A 4M77F 3ZBDA 5KCOA 5GMKm 1J3TA 2YUOA 4GLMA 1V76A 4J7FA 3OS2A 5GAN7 2DERA 3VUBA 1M1KR 2RJDA 1TWBA 3SHWA 4AFUC 4J9GA 4M7DE 1RLQC 4PJOA 1QP2A 2DAQA 5J3BA 1X75C 2PUKB 4EMKB 3M55A 1Y7XA 4F04B 4RCCA 1WNLA 3WVDB 2K2MA 3BW1A 4M77G 3LLRA 4JZ3A 1WJQA 3QWYA 1YWPA 2VVKA 5GAOm 4J9EA 3ZEHA 1BKBA 2DYIA 5KYWB 2HBPA 3CCVQ 4PJLA 2QQ9A 4K11A 4AFZC 3JAME 3OS0A 8ATCB 3RBBB 2L2PA 1B7TA 1VA7A 2FG0A 1VQPA 1K76A 3EGDA 3CCLQ 1NPRA 2RQRA 2ZAEA 2EQJA 2KT8A 5CKEA 4C8QA 3QPHA 3L2ZA 1VQ9A 2HL5C 3QUIA 5AYFA 3HFOA 2OTLT 2JXBA 3SD4A 5J26A 4BE1A 4BI3A 3CCQA 4C92E 3EG3A 3F70A 5EG2A 4ZTFA 1B34A 1U1SA 3I55A 1RLPC 1ZUYA 1UGPB 1YWOA 3I56Q 4OB0B 4C8QD 2COYA 4FIBA 1QW1A 1LPLA 4J9HA 4OMFB 3P8HA 2GQVA 1N8RR 3CPWS 2ECZA 4LD6A 2FPDA 3SWNA 2E6ZA 4N4GA 1VQ6A 4JDSA 3AHUA 4X9DA 5GAOr 1WHJA 1YN8A 3M57A 2FPEA 4PFOA 2D1XA 2VUBA 1WI7A 4KGZB 3SDZA 2DIQA 1BU1A 4TVRA 1WA7A 1ZSZB 2JTFA 1RAAB 2H8HA 1K9AA 2MYSA 3MP6A 3REAB 4ANJA 2AKKA 2RHUA 5GAOn 2P84A 3LWHA 4EPCA 5GAOp 3HRUA 1K8AC 3VYGA 1JEGA 4RTZA 1PC0A 5CIUA 3JCMh 2O4XB 4J6YA 4LDXA 3JB9I 5GAN6 5CKBA 2YRVA 4JS5A 3KXTA 1JJ2P 1M30A 2X4YA 3BY7A 1BB9A 2MWPA 3A8HB 2RNAA 3G71Q 1M1KC 1Q7YR 4IUPA 1BI2A 2ED0A 3DB3A 4UC4A 4Z88A 5LJ5j 2KXDA 4JLGA 1NYFA 1XNIA 2PUOB 1RI0A 4BY6C 1YJ9Q 1YFNA 2P0KA 3UF4A 1N8RU 1XQHA 3J81E 2EGEA 4KT0E 3GIBA 2RA2A 4FYXB 2KBTA 1AOJA 1AHJB 4F7UF 3OMGA 2IG0A 2A0FB 5I11A 1ZBXA 3A98A 5FU7C 1AZEA 1M8VA 3VS6A 3X28B 2RK1A 1I81A 1H3HA 1QKWA 1W2BS 4ATOA 3CBMA 3OYLA 2L3SA 4M7DD 3WVEB 4M75E 1RAFB 3G6EA 4QVDA 1NM7A 1N8RC 2O01E 3QDRB 1UGSB 3CC4A 3DKMA 2QASA 1C6VX 3RUXA 4CC2A 3KFVA 5FROA 2GCXA 4RCBA 4A4HA 3G4SA 1Q86U 4BE0A 2OX7A 2HQEA 4ZGDB 1VQOT 3H41A 2WSFE 2DEUA 1WZOA 4M77C 2CUBA 5A0DA 5LJ3e 2YUNA 5KYXB 2KYBA 1TH7A 3FDRA 4J8OA 1FXXA 2ZPGB 2EJ9A 3EFSA 2MMPA 4PJJA 1JO8A 2NUZA 1VQ5A 3CD6T 1MHNA 2QAZA 2YT6A 5A0GA 1SSFA 3I55Q 3C94A 3C4SA 4IURA 3GLXA 1G3SA 2VXEA 4HT8A 2QQBA 4CC7A 1QVGA 4E47A 3NPFA 4DA4A 1K8AR 2E65A 4KULA 3X25B 1IGQA 3RDVA 1Q82U 4JRPA 1CKAA 1XJWB 5J39A 1ZSZA 2CP6A 2M51A 3V8LA 3I56T 2RHYA 1FMKA 4ZGJB 2DD4A 5GAMg 3JB9F 5GMKh 2M0OA 1M3AA 2GF7A 2RQVA 3OYGA 1TXQA 2BE9B 4QVZA 3V7CA 5CVIA 2MPXC 4XK8E 3HTRA 3X20B 3RERA 2DVJA 4C5EA 5KE2A 1AD5A 3E1SA 2Y4YA 2C06A 4DEYA 3RKYA 2RB6A 1NLPC 2EJGA 1YIJA 2RJEA 2FO0A 5KH6A 3PIPA 2FPFA 3RESA 1Y57A 4M7AE 1BI3A 4E7LA 1ABOA 2OJ2A 3KUFA 2DMOA 3UDCA 5EC7A 5CAIA 1Z9ZA 1YNZA 2KGTA 2K3YA 2QTVA 1G5VA 8AT1B 2EYZA 3NMZC 2C0TA 2E70A 2DL3A 1MNDA 2BZ8A 3EG2A 2DZ9A 1VIFA 4R0KA 1V1CA 1VQ7T 3BFMA 2DRMA 3QHSA 3HSBA 3ME9A 5LJ5f 2JTEA 3OS1A 2F5TX 4EDUA 2EKHA 2K6DA 2DJQA 4M75F 2EYXA 3CC7Q 3ZFJA 2QK0A 2DIGA 2OTJQ 4N0AC 4J5YA 3S3MA 2DE0X 1BIAA 3VRYA 1ABQA 1OX8A 5HKCA 2BZXA 3PFSA 2DF6A 2WSCE 2GQIA 3CC7T 1IO6A 5CQYA 3RMSA 4RTVA 2M0YA 3CC2T 5LJ5g 4PJOD 5DM7R 4KRTA 2EQKA 3CCVA 5IHKA 1AVZC 1AWXA 1UGRB 1TU0B 2F69A 1SRMA 2RQTA 4EMGA 1M3CA 2I0NA 1T0HA 2KXCA 4PL6A 1EIFA 4FCYA 1YIJQ 1WQ7A 2D0QB 2F2WA 3M0SA 4MZPA 4Z8AA 1M2VA 5D6WA 3CMAT 2CGHA 3L42A 1M90R 4RG8A 2QDYB 2NUPB 2VYTA 4RTYA 5KCHA 2JT4A 3TREA 1VUBA 3UPUA 1M90C 3HHTB 4XU2A 2JTMA 4WCIA 4PLLA 3CCUQ 1ZHIA 4M7AC 2KRMA 5M9OA 3M4YA 3JCMd 1B3QA 2D0NA 2LQNA 4YTLA 2DXTA 3M56A 4RUGA 4D8KA 4JJBA 2EPDA 1LOJA 3MCAB 1XTDA 4EMKA 2BTTA 3A8MB 4M75D 4AFSC 1UHFA 2EQUA 1OZ3A 3ASKA 4M7DC 1B34B 5GMKl 2DTOA 4X9CA 2K5FA 3OBYA 5GAN2 2YUPA 1ZA1B 3UWNA 3P8BB 5GAMh 2AK5A 5GANj 2E5KA 5CQXA 2E3IA 2QEXQ 1VQ4A 2RMOA 1QVGS 2WACA 2PVGB 4IUVA 4F16A 2LZ6B 5D7UA 2CZ6B 4FYYB 3CCMA 1OI1A 2CREA 4NS5A 1PD1A 6AT1B 3CXCA 4A63B 1KFZA 3SWNC 3OY9A 2CP7A 4M7AD 5GAN3 3SWNB 2D9TA 1K8AU 1EFNA 3I9QA 2EYWA 2DK3A 2NUTB 2ZPHB 5FRMA 1KQSS 2HNIA 4C0GA 2V8KA 3CCRA 2VB6A 2I2LA 1QVGP 4M78C 2DXCA 4QQDA 3UT1A 5GMKi 2HMAA 1K73C 2ZPBB 2EGCA 4JJNK 1H641 1RUWA 2JVVA 2PZ1A 4M7AA 2CT4A 2CH4A 4OMPA 1I4K1 5DLQE 2HZYA 2L8DA 1D1BA 1JJ2S 3OW2S 2E6NA 1YI2Q 1BBZA 1VQMA 1NYGA 2VWFA 1X69A 4IUTA 1O9SA 2GTOA 1RADB 4C0DC 1HSQA 1MNEA 2H3EB 4ZTJA 1D0YA 2LVMA 1HD3A 4J9DA 1HXDA 4D8DA 3HKSA 1BI0A 3GBQA 1OYXA 1F1BB 1VQOQ 2LQWA 2X35A 2C0OA 3FEOA 3L2WA 4V2SA 3OMCA 1YCSB
chains in the Genus database with same CATH topology
4OMMA 2H8HA 1OEBA 1K9AA 2RN8A 3REAB 1GFCA 2AKKA 2HSPA 1A0NB 2PNIA 4F17A 2L3QA 4RTXA 2KR3A 2JM9A 1T3LA 1JEGA 2DL4A 1QWFA 4RTZA 4QT7A 1N5ZA 2LJ0A 2AZSA 1GBRA 1JXOA 2X3XD 1GBQA 1RI9A 2DX1A 5L23A 2O88A 2DBKA 1I07A 3UATA 1M30A 3IQLA 1PWTA 2V1QA 1BB9A 4OMNA 2RNAA 2JM8A 1U06A 2CT3A 1NG2A 2DILA 1NEGA 1GRIA 2JW4A 1VYUA 1NEBA 2ED0A 2CUDA 4Z88A 2KXDA 5FW9A 2KEAA 2OI3A 1H92A 2J6FA 2RF0A 1NYFA 1PHTA 3UF4A 2EQIA 1MUZA 2EGEA 3JV3A 1X2KA 1U5SA 1E7OA 2KYMA 2KBTA 1AOJA 2JS2A 3VS4A 1K0XA 4AFQC 1UJ0A 5I11A 2KT1A 3A98A 3EGUA 2GNCA 1AZEA 3VS6A 1H3HA 1UJYA 1QKWA 3VS1A 5I22A 1SEMA 2L3SA 3O5ZA 2G6FX 4JJCA 2KNBB 2OAWA 2CDTA 1NM7A 2JS0A 5IH2A 2FRWA 3M0PA 2EGAA 2YDLA 1W6XA 3I5SA 2KRNA 1UTIA 4CC2A 3KFVA 2LJ1A 3PVQA 1G2BA 1UHCA 1GCQA 2CSQA 1PNJA 3H0FA 1QWEA 1SRLA 1ARKA 3H41A 4E6RA 2ROTA 2O31A 2CUBA 2YUNA 2EVRA 1OPKA 1WX6A 1AEYA 4OMQA 2KYBA 3EHRA 3I35A 3UA7A 2HBWA 2GTJA 2IIMA 1JU5C 2NWMA 1TUCA 2LP5A 1QLYA 5ECAA 4Z89A 1JO8A 1ZBJA 3EG0A 2J6OA 2NUZA 2ABLA 2BZYA 2YT6A 2ED1A 3R6NA 1X27A 5HCKA 4RTUA 1PKSA 2DRKA 4JJDA 5IXFA 2AKLA 2DLPA 4CC7A 2CSIA 3NPFA 3C0CA 2J06A 1OV3A 4HCKA 2DL7A 2XMFA 2KE9A 4ORZA 2P4RA 4IIMA 2D8HA 1K1ZA 3VS2A 4J9IA 2W10A 1WYXA 1CKAA 3H0HA 4HVVA 2M51A 1LCKA 3VS3A 1FMKA 5IHIA 1CKBA 2LMJA 5FWCA 4JZ4A 1M8MA 1SPKA 5FWBA 1X6BA 1M3AA 4FSSA 1YP5A 1E6GA 2RQVA 2LJ3A 4F14A 2V1RA 1I1JA 2ENMA 1WIEA 2DNUA 2EYYA 2J6KA 2QDLA 4OMLA 2DVJA 1I0CA 3RNJA 4AG2C 1MV0B 1WLPB 2A37A 2A28A 1AD5A 4DEYA 1M3BA 2C0IA 2PTKA 1KSWA 1U3OA 1VYTA 2FEIA 1NLPC 1WXUA 2GBQA 4LN2A 2FO0A 3M0TA 1E6HA 4EIKA 2FPFA 1Y57A 2ROLA 3M0QA 1S1NA 1ABOA 1WXBA 2OJ2A 2DMOA 5EC7A 1Z9ZA 1YNZA 2KGTA 2O9VA 1H8KA 2RQWA 1X43A 2MCNA 1AWOA 4LUDA 1UGVA 2EYZA 3NMZC 2C0TA 5GJVB 5IHNA 1PRMC 2DL3A 2BZ8A 3EG2A 4J9FA 3PVLA 4OMOA 1K4US 3NGPA 2K3BA 4R0KA 1V1CA 2DRMA 1FYNA 2L3PA 1NLOC 1VYVA 2JTEA 2B86A 2EKHA 3VS7A 1TG0A 2K6DA 2DM1A 1UECA 2DJQA 4M4ZA 2EYXA 1KJWA 2YUQA 2MIOA 2MOXA 4HVWA 4LUEA 2CH4W 2DE0X 3VRYA 4LNPA 1ABQA 2BZXA 1W1FA 2DF6A 1KIKA 1TUDA 2GQIA 1HJDA 3VRZA 1IO6A 4RTVA 2M0YA 2HCKA 2F2XA 4KRTA 2EBPA 2L0AA 1UG1A 2A36A 1GL5A 5IHKA 1AVZC 1AWXA 1SRMA 2RQTA 3UA6A 2LNHB 2A08A 1M3CA 2I0NA 1T0HA 2KXCA 2DA9A 4RTWA 3ULRB 1Y0MA 3H0IA 2F2WA 1CSKA 3CQTA 3M0SA 1ZX6A 4Z8AA 1X2QA 2O9SA 1G83A 3VS5A 2J05A 2W0ZA 1QCFA 4GBQA 1ZUUA 3LH5A 2HEQA 1Z9QA 1T0JA 3REBB 4RTYA 2JT4A 4ESRA 4HVUA 1T3SA 4IIOA 1GFDA 4WCIA 3TSWA 1JQQA 4ZNXA 2EW3A 2KRMA 3TVTA 3EG1A 1AWJA 2K79A 1B07A 1B3QA 4HXJA 2JMCA 2D0NA 1X6GA 2LQNA 4AG1C 4D8KA 4RUGA 2GGRA 4Y92A 4JJBA 2EPDA 1AZGB 2JMAA 2BTTA 5GJWB 4AFSC 1UHFA 1ZSGA 3M0UA 2SRCA 3SEMA 1UE9A 2J7IA 1J3TA 2YUOA 4GLMA 1OPLA 2KROA 1AWWA 3SHWA 1M27C 3THKA 2YUPA 4AFUC 1MV3A 4CC3A 2F2VA 4J9GA 1RLQC 2AK5A 3PE0A 5IXBA 2HDAA 2ESWA 2E5KA 1WXTA 1SHGA 2RMOA 1K0SA 2X3WD 3TSZA 2K2MA 3FJ5A 3ZL7C 1UUEA 4JZ3A 2KRSA 4F16A 2LZ6B 1OOTA 3QWYA 1YWPA 2CREA 1WDXA 2D8JA 2VVKA 2YSQA 2O2OA 4J9EA 2DYBA 1W70A 4A63B 1KFZA 3VS0A 1XOVA 4K11A 4AFZC 1PRLC 3RBBB 1EFNA 3I9QA 2EYWA 1SSHA 2L2PA 3NHNA 1VA7A 2FG0A 4JPBW 1GCPA 1K76A 2VKNA 1ZLMA 2RQRA 2KT8A 2AZVA 1PKTA 2DBMA 1UFFA 1WFWA 4J9BA 1BK2A 2EGCA 1RUWA 2PZ1A 2LCSA 2CT4A 2JXBA 2CH4A 4OMPA 4RTTA 1QKXA 2K7AA 3EG3A 3EHQA 2FRYA 2RQUA 3M0RA 1RLPC 1ZUYA 1YWOA 1BBZA 1JXMA 2DL8A 2SEMA 1NYGA 2VWFA 1X69A 2GTOA 1HSQA 2RPNA 4J9HA 1HD3A 4J9CA 2LX7A 4J9DA 4D8DA 2ECZA 2FPDA 3U23A 4X1VA 4LE9A 3GBQA 1GCQC 2LQWA 1YN8A 2FPEA 1SHFA 2DL5A 2D1XA 3I5RA 2C0OA 2K9GA 1UDLA 1WI7A 1BU1A 3QWXX 1ZUKA 4CC4B 1WA7A 1YCSB 4DEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMM A;  2H8H A;  1OEB A;  1K9A A;  2RN8 A;  3REA B;  1GFC A;  2AKK A;  2HSP A;  1A0N B;  2PNI A;  4F17 A;  2L3Q A;  4RTX A;  2KR3 A;  2JM9 A;  1T3L A;  1JEG A;  2DL4 A;  1QWF A;  4RTZ A;  4QT7 A;  1N5Z A;  2LJ0 A;  2AZS A;  1GBR A;  1JXO A;  2X3X D;  1GBQ A;  1RI9 A;  2DX1 A;  5L23 A;  2O88 A;  2DBK A;  1I07 A;  3UAT A;  1M30 A;  3IQL A;  1PWT A;  2V1Q A;  1BB9 A;  4OMN A;  2RNA A;  2JM8 A;  1U06 A;  2CT3 A;  1NG2 A;  2DIL A;  1NEG A;  1GRI A;  2JW4 A;  1VYU A;  1NEB A;  2ED0 A;  2CUD A;  4Z88 A;  2KXD A;  5FW9 A;  2KEA A;  2OI3 A;  1H92 A;  2J6F A;  2RF0 A;  1NYF A;  1PHT A;  3UF4 A;  2EQI A;  1MUZ A;  2EGE A;  3JV3 A;  1X2K A;  1U5S A;  1E7O A;  2KYM A;  2KBT A;  1AOJ A;  2JS2 A;  3VS4 A;  1K0X A;  4AFQ C;  1UJ0 A;  5I11 A;  2KT1 A;  3A98 A;  3EGU A;  2GNC A;  1AZE A;  3VS6 A;  1H3H A;  1UJY A;  1QKW A;  3VS1 A;  5I22 A;  1SEM A;  2L3S A;  3O5Z A;  2G6F X;  4JJC A;  2KNB B;  2OAW A;  2CDT A;  1NM7 A;  2JS0 A;  5IH2 A;  2FRW A;  3M0P A;  2EGA A;  2YDL A;  1W6X A;  3I5S A;  2KRN A;  1UTI A;  4CC2 A;  3KFV A;  2LJ1 A;  3PVQ A;  1G2B A;  1UHC A;  1GCQ A;  2CSQ A;  1PNJ A;  3H0F A;  1QWE A;  1SRL A;  1ARK A;  3H41 A;  4E6R A;  2ROT A;  2O31 A;  2CUB A;  2YUN A;  2EVR A;  1OPK A;  1WX6 A;  1AEY A;  4OMQ A;  2KYB A;  3EHR A;  3I35 A;  3UA7 A;  2HBW A;  2GTJ A;  2IIM A;  1JU5 C;  2NWM A;  1TUC A;  2LP5 A;  1QLY A;  5ECA A;  4Z89 A;  1JO8 A;  1ZBJ A;  3EG0 A;  2J6O A;  2NUZ A;  2ABL A;  2BZY A;  2YT6 A;  2ED1 A;  3R6N A;  1X27 A;  5HCK A;  4RTU A;  1PKS A;  2DRK A;  4JJD A;  5IXF A;  2AKL A;  2DLP A;  4CC7 A;  2CSI A;  3NPF A;  3C0C A;  2J06 A;  1OV3 A;  4HCK A;  2DL7 A;  2XMF A;  2KE9 A;  4ORZ A;  2P4R A;  4IIM A;  2D8H A;  1K1Z A;  3VS2 A;  4J9I A;  2W10 A;  1WYX A;  1CKA A;  3H0H A;  4HVV A;  2M51 A;  1LCK A;  3VS3 A;  1FMK A;  5IHI A;  1CKB A;  2LMJ A;  5FWC A;  4JZ4 A;  1M8M A;  1SPK A;  5FWB A;  1X6B A;  1M3A A;  4FSS A;  1YP5 A;  1E6G A;  2RQV A;  2LJ3 A;  4F14 A;  2V1R A;  1I1J A;  2ENM A;  1WIE A;  2DNU A;  2EYY A;  2J6K A;  2QDL A;  4OML A;  2DVJ A;  1I0C A;  3RNJ A;  4AG2 C;  1MV0 B;  1WLP B;  2A37 A;  2A28 A;  1AD5 A;  4DEY A;  1M3B A;  2C0I A;  2PTK A;  1KSW A;  1U3O A;  1VYT A;  2FEI A;  1NLP C;  1WXU A;  2GBQ A;  4LN2 A;  2FO0 A;  3M0T A;  1E6H A;  4EIK A;  2FPF A;  1Y57 A;  2ROL A;  3M0Q A;  1S1N A;  1ABO A;  1WXB A;  2OJ2 A;  2DMO A;  5EC7 A;  1Z9Z A;  1YNZ A;  2KGT A;  2O9V A;  1H8K A;  2RQW A;  1X43 A;  2MCN A;  1AWO A;  4LUD A;  1UGV A;  2EYZ A;  3NMZ C;  2C0T A;  5GJV B;  5IHN A;  1PRM C;  2DL3 A;  2BZ8 A;  3EG2 A;  4J9F A;  3PVL A;  4OMO A;  1K4U S;  3NGP A;  2K3B A;  4R0K A;  1V1C A;  2DRM A;  1FYN A;  2L3P A;  1NLO C;  1VYV A;  2JTE A;  2B86 A;  2EKH A;  3VS7 A;  1TG0 A;  2K6D A;  2DM1 A;  1UEC A;  2DJQ A;  4M4Z A;  2EYX A;  1KJW A;  2YUQ A;  2MIO A;  2MOX A;  4HVW A;  4LUE A;  2CH4 W;  2DE0 X;  3VRY A;  4LNP A;  1ABQ A;  2BZX A;  1W1F A;  2DF6 A;  1KIK A;  1TUD A;  2GQI A;  1HJD A;  3VRZ A;  1IO6 A;  4RTV A;  2M0Y A;  2HCK A;  2F2X A;  4KRT A;  2EBP A;  2L0A A;  1UG1 A;  2A36 A;  1GL5 A;  5IHK A;  1AVZ C;  1AWX A;  1SRM A;  2RQT A;  3UA6 A;  2LNH B;  2A08 A;  1M3C A;  2I0N A;  1T0H A;  2KXC A;  2DA9 A;  4RTW A;  3ULR B;  1Y0M A;  3H0I A;  2F2W A;  1CSK A;  3CQT A;  3M0S A;  1ZX6 A;  4Z8A A;  1X2Q A;  2O9S A;  1G83 A;  3VS5 A;  2J05 A;  2W0Z A;  1QCF A;  4GBQ A;  1ZUU A;  3LH5 A;  2HEQ A;  1Z9Q A;  1T0J A;  3REB B;  4RTY A;  2JT4 A;  4ESR A;  4HVU A;  1T3S A;  4IIO A;  1GFD A;  4WCI A;  3TSW A;  1JQQ A;  4ZNX A;  2EW3 A;  2KRM A;  3TVT A;  3EG1 A;  1AWJ A;  2K79 A;  1B07 A;  1B3Q A;  4HXJ A;  2JMC A;  2D0N A;  1X6G A;  2LQN A;  4AG1 C;  4D8K A;  4RUG A;  2GGR A;  4Y92 A;  4JJB A;  2EPD A;  1AZG B;  2JMA A;  2BTT A;  5GJW B;  4AFS C;  1UHF A;  1ZSG A;  3M0U A;  2SRC A;  3SEM A;  1UE9 A;  2J7I A;  1J3T A;  2YUO A;  4GLM A;  1OPL A;  2KRO A;  1AWW A;  3SHW A;  1M27 C;  3THK A;  2YUP A;  4AFU C;  1MV3 A;  4CC3 A;  2F2V A;  4J9G A;  1RLQ C;  2AK5 A;  3PE0 A;  5IXB A;  2HDA A;  2ESW A;  2E5K A;  1WXT A;  1SHG A;  2RMO A;  1K0S A;  2X3W D;  3TSZ A;  2K2M A;  3FJ5 A;  3ZL7 C;  1UUE A;  4JZ3 A;  2KRS A;  4F16 A;  2LZ6 B;  1OOT A;  3QWY A;  1YWP A;  2CRE A;  1WDX A;  2D8J A;  2VVK A;  2YSQ A;  2O2O A;  4J9E A;  2DYB A;  1W70 A;  4A63 B;  1KFZ A;  3VS0 A;  1XOV A;  4K11 A;  4AFZ C;  1PRL C;  3RBB B;  1EFN A;  3I9Q A;  2EYW A;  1SSH A;  2L2P A;  3NHN A;  1VA7 A;  2FG0 A;  4JPB W;  1GCP A;  1K76 A;  2VKN A;  1ZLM A;  2RQR A;  2KT8 A;  2AZV A;  1PKT A;  2DBM A;  1UFF A;  1WFW A;  4J9B A;  1BK2 A;  2EGC A;  1RUW A;  2PZ1 A;  2LCS A;  2CT4 A;  2JXB A;  2CH4 A;  4OMP A;  4RTT A;  1QKX A;  2K7A A;  3EG3 A;  3EHQ A;  2FRY A;  2RQU A;  3M0R A;  1RLP C;  1ZUY A;  1YWO A;  1BBZ A;  1JXM A;  2DL8 A;  2SEM A;  1NYG A;  2VWF A;  1X69 A;  2GTO A;  1HSQ A;  2RPN A;  4J9H A;  1HD3 A;  4J9C A;  2LX7 A;  4J9D A;  4D8D A;  2ECZ A;  2FPD A;  3U23 A;  4X1V A;  4LE9 A;  3GBQ A;  1GCQ C;  2LQW A;  1YN8 A;  2FPE A;  1SHF A;  2DL5 A;  2D1X A;  3I5R A;  2C0O A;  2K9G A;  1UDL A;  1WI7 A;  1BU1 A;  3QWX X;  1ZUK A;  4CC4 B;  1WA7 A;  1YCS B;  4DEX A; 
#chains in the Genus database with same CATH topology
 4P5N A;  2JN0 A;  2FL7 A;  3CCU T;  4KUD K;  1P92 A;  2YLC A;  5LJ3 d;  2PNI A;  2L3Q A;  2JM9 A;  3PTA A;  2QGG A;  2DL4 A;  4MML A;  4OGC A;  2CP0 A;  2QQS A;  2AZS A;  3M5A A;  3EFO A;  3INZ A;  1GBQ A;  1RI9 A;  3EGX A;  3CCS A;  3IQL A;  2V1Q A;  4NL2 A;  1VQN T;  1Q95 G;  5KYY A;  2JM8 A;  4M77 E;  1TS9 A;  1U06 A;  2DIL A;  1NEB A;  2CUD A;  3QSU A;  2EIF A;  5FW9 A;  1VQM Q;  2KEA A;  1YI2 T;  1M1F A;  1VQ6 T;  2P0Q A;  4FYW B;  4QQG A;  1MUZ A;  1NJI U;  1U5S A;  1ACM B;  1D0X A;  2NLU A;  2JS2 A;  4JRI A;  3VS4 A;  5CKD A;  1K0X A;  1RAC B;  1Q86 R;  2GNC A;  5D6X A;  4WTO B;  1VQM T;  3M59 A;  3BE3 A;  1UJY A;  3VS1 A;  1IHW A;  5I22 A;  1SEM A;  3O5Z A;  2G6F X;  2P0P A;  1N9R A;  2KNB B;  5CKH A;  2FRW A;  2E64 A;  3MPU B;  5GAO q;  1JBM A;  4M75 B;  1WHG A;  4ZN3 A;  5KYN A;  3NFC A;  1VQK T;  3RR6 A;  3OW2 A;  1W6X A;  3I5S A;  1WJR A;  4GY5 A;  3VJP A;  1UTI A;  2LJ1 A;  2XDD A;  1GCQ A;  1PNJ A;  1QWE A;  3PIO A;  4HKE A;  4M75 G;  3JCM P;  2O31 A;  4Q5W A;  1VQK Q;  3PGG A;  4C0F A;  4II1 A;  1FX7 A;  2EVR A;  4F7U G;  1AEY A;  4OMQ A;  4C0D B;  3OYH A;  3CCQ T;  1Q82 R;  3CC7 A;  4M78 E;  2HBW A;  3OSS C;  1JU5 C;  2NWM A;  1TUC A;  2LP5 A;  3P8D A;  5ECA A;  5AT1 B;  3QJ6 A;  4QVC A;  1Q81 U;  3QYG B;  1VQN Q;  2BZY A;  3NTI A;  3JB9 J;  2ED1 A;  4L6V 5;  4D6W A;  1X27 A;  2ZGW A;  5KYU B;  2DTI A;  5HCK A;  1PKS A;  3OYB A;  2DRK A;  3JCM c;  4C92 B;  4M7A B;  3OW2 P;  2DLP A;  2O4X A;  3L2Q A;  2Z0W A;  2E1H A;  1YJN Q;  1VIE A;  2FHD A;  2XMF A;  2CP3 A;  4ORZ A;  2LTO A;  4MZM A;  2P4R A;  4HA8 A;  2RI2 A;  3CCM T;  1W2B A;  2BE7 D;  1K1Z A;  3VS2 A;  4LDV A;  4RMO A;  3G71 A;  1M2V B;  4FU6 A;  3OYF A;  3X24 B;  4KGX B;  3OS5 A;  3QO3 A;  5IHI A;  5FLX E;  5KYW A;  4A4E A;  4M7D G;  1LNX A;  5L8R E;  4JZ4 A;  5FWB A;  1X6B A;  3QZ9 B;  1E6G A;  4PNO A;  2R57 A;  2RD1 A;  5DLO A;  4F14 A;  2V1R A;  1HK9 A;  4JS4 A;  4E7I A;  1I1J A;  2ENM A;  2DNU A;  1SG5 A;  3OYC A;  7AT1 B;  2COW A;  2YXY A;  3G7Z A;  4AG2 C;  1MV0 B;  2A37 A;  1FMW A;  3EG9 B;  1YHQ T;  5A2Q E;  3M9Q A;  4CI0 C;  3CCU A;  3CCR Q;  2LQ8 A;  3CME A;  2PTK A;  1VYT A;  1U3O A;  1TSF A;  2FEI A;  1HYO A;  1S72 Q;  2QGF B;  3GP8 A;  1WXU A;  3OYN A;  1K9M C;  1E6H A;  4EIK A;  2ROL A;  1WXB A;  1MMG A;  3RIR A;  3EFO B;  3X26 B;  1V29 B;  2YWW A;  4BAC A;  2COZ A;  3H8Z A;  4LUD A;  1UGV A;  1PRM C;  3QKJ A;  4J9F A;  4OMO A;  4R56 A;  2Y90 A;  4B9X A;  1M2O A;  2WSE E;  5KE3 A;  1GXI E;  3MEA A;  3QBY A;  4L59 A;  2KDS A;  1UEC A;  2AT1 B;  1KJW A;  2YUQ A;  3OYK A;  1WGS A;  4LUE A;  2DPP B;  2E12 A;  2CH4 W;  4LNP A;  3HPW A;  4LDU A;  3CCJ T;  1VQ9 Q;  1H3Z A;  1MMN A;  1KIK A;  1TUD A;  4ME7 A;  1QVF P;  1YJ9 A;  2HCK A;  1TTH B;  1MMD A;  2EBP A;  2XDP A;  2XK0 A;  5KYY B;  2KSS A;  1D1A A;  3G71 T;  4C92 A;  4B9W A;  2YRD A;  3UA6 A;  2A08 A;  3PMT A;  4PJN A;  4E7H A;  2JZ2 A;  4RTW A;  4MDW A;  4LXC A;  1OX9 A;  1VQ7 Q;  5I2M A;  3H0I A;  1CSK A;  3CQT A;  1OZ2 A;  4FM4 B;  3OYD A;  1KC8 C;  5GAN 5;  2XG8 D;  3TEE A;  1WHK A;  3JCM f;  2LCL A;  2L3R A;  1VQ4 T;  2M9U A;  2LT1 A;  3VS5 A;  1YHQ A;  4GBQ A;  2XHC A;  2EJF A;  3G1J A;  3LH5 A;  1M1K U;  4DQ2 A;  4M78 D;  4FSX A;  4XTV A;  1YCY A;  3JRZ A;  2ZPF B;  4C8Q B;  2DD5 A;  4HVU A;  1KK7 A;  4IIO A;  4Z02 A;  4A4G A;  3DB4 A;  1VQP Q;  2NYS A;  3LYI A;  1NBE B;  1IGU A;  2CZ1 B;  4OB1 B;  1X6G A;  4M78 A;  3TCJ A;  1M1G A;  3OQ5 A;  2GGR A;  4OB2 B;  3T9N A;  2JMA A;  1QVF A;  4F7U B;  3JCM J;  2JNG A;  1YIJ T;  1ZSG A;  4A54 A;  3M0U A;  5LL6 S;  3CCV T;  1I5O B;  1C0M A;  2J7I A;  1OPL A;  4ZGE B;  4M78 F;  2KRO A;  1D09 B;  3S3N A;  2QA4 T;  1AWW A;  4N4I A;  3THK A;  1M27 C;  4PJM A;  2HKQ B;  1MV3 A;  2F2V A;  5KYX A;  1NZ9 A;  3OBW A;  3QG1 A;  4E7Z A;  3A1P A;  1K73 U;  4MZT A;  3PE0 A;  3CCJ A;  1IRX A;  2YLB A;  2ESW A;  2MI6 A;  3CME T;  2BIV A;  2LCC A;  2OTL Q;  4E7K A;  1K9M U;  2X3W D;  3TSZ A;  2QA4 A;  3SB2 A;  3ZL7 C;  1UUE A;  2NUP A;  3CCE T;  4BY6 B;  2X51 A;  2PQW A;  2HKN A;  3BDL A;  2YRC A;  1WDX A;  2PU9 B;  2HAX A;  2QG9 B;  1OUL A;  4C5H A;  1YIT T;  4OF1 A;  2DYB A;  5FU7 B;  3VS0 A;  3JB9 G;  3QYH B;  2EKO A;  1XOV A;  3NHN A;  4M77 A;  2IPO B;  3J7A F;  1KD1 C;  1GCP A;  3R6O A;  3OYJ A;  3CPW P;  1M5Q 1;  2KQW A;  1KQ1 A;  2VKN A;  2JUF A;  3LH0 A;  4A53 A;  1SF9 A;  2DBM A;  1WFW A;  4J9B A;  1BK2 A;  1BYM A;  4QQ6 A;  4A4K A;  2RJF A;  4OP0 A;  3N5B B;  2KVQ G;  3FIF A;  3M0R A;  1NJI R;  3CBP A;  2FZC B;  4PJO B;  2PVD B;  2DL8 A;  3EAE A;  5C6S A;  4M7A F;  3FJP A;  1NJI C;  2DVE A;  3MEU A;  4NOY A;  4C92 G;  4J9C A;  2QXF A;  3U23 A;  3CME Q;  4X1V A;  3JSC A;  2OTJ A;  3OB9 A;  2K5I A;  3CCL T;  3L2R A;  4DBQ A;  1MMA A;  2DL5 A;  3I5R A;  2K9G A;  1D0Z A;  2AIR B;  1ZUK A;  3Q1J A;  2FZG B;  4OMM A;  1OEB A;  4PJO C;  3QXE B;  2K2V A;  2XI9 A;  4BI8 B;  2HSP A;  4KBM B;  4XU1 A;  1PSF A;  4F17 A;  4C8Q F;  1T3L A;  2RI3 A;  1VQ5 T;  1OU9 A;  3CD6 A;  4PJO E;  1QWF A;  5CKF A;  1N5Z A;  2LJ0 A;  1GBR A;  3MKD A;  1TOV A;  3CPF A;  2LRQ A;  1JXO A;  2X3X D;  4PLI A;  1VQ8 A;  1VQ4 Q;  2VAS A;  5L23 A;  1W2B P;  2DBK A;  1I07 A;  4RKU E;  3LWI A;  3UAT A;  3OYY A;  1PWT A;  2RHI A;  4OMN A;  3RKX A;  4XTZ A;  3CCM Q;  4FYV B;  4EMK C;  4HCB A;  2XU8 A;  1GRI A;  1VQL A;  2OI3 A;  1H92 A;  2J6F A;  4IKF A;  4M78 B;  2NUT A;  3CC4 T;  3JV3 A;  1X2K A;  3JCM e;  5GAN g;  3CMA Q;  5GAO l;  2KYM A;  2CZ7 B;  3MP8 A;  3FC3 A;  2V8J A;  3L2V A;  4AFQ C;  1UJ0 A;  2ZCF B;  2R58 A;  3EGU A;  2OTL A;  3SFM A;  4C8Q E;  2EFI A;  1RAB B;  3I55 T;  5GAM f;  3AT1 B;  2CDT A;  4M75 A;  5IH2 A;  2QQR A;  4XTX A;  3ER0 A;  4PK4 A;  2KMT A;  3HRS A;  3HRT A;  4OVA A;  3PVQ A;  3TU4 K;  1G2B A;  1UHC A;  2CSQ A;  2DO3 A;  3MP1 A;  3H6Z A;  4E6R A;  3PT9 A;  3CCL A;  1VQ8 Q;  2M02 A;  1ZSZ C;  5I21 A;  3E9F A;  4DBR A;  3H9N A;  3VU3 C;  1WX6 A;  2MK5 A;  3EHR A;  3I35 A;  3MO8 A;  4J83 A;  4HCZ A;  3JCM V;  3UA7 A;  2GTJ A;  1QLY A;  3G6E T;  4OGE A;  3NTH A;  4Z89 A;  5CO7 A;  2ZPI B;  3URG A;  4HT9 A;  3EG0 A;  4WF2 A;  2J6O A;  2Y4X A;  2XKO C;  1OQK A;  3HP9 A;  4RTU A;  3PNW C;  5IXF A;  4XQ3 A;  4AMC A;  3A8O B;  1M90 U;  1MGQ A;  2CSI A;  3CC2 Q;  2K5L A;  1N27 A;  4HCK A;  1IHV A;  2DL7 A;  4EMH A;  4IIM A;  3CCS Q;  2D8H A;  1N9S A;  3HL8 A;  1UGQ B;  2KK4 A;  5A0L A;  2W10 A;  1PG5 B;  1WJS A;  3VUZ A;  1R0C B;  4HVV A;  2DZC A;  1LCK A;  3PMI A;  1Y96 A;  1I8F A;  1M8M A;  1YP5 A;  5DY9 A;  4J6X A;  2A7Y A;  2GFU A;  1WHM A;  1PCX A;  2CP2 A;  2DKG A;  1TUG B;  3CD6 Q;  2MF2 A;  4KH0 B;  1QVF S;  1ZA2 B;  2DXB A;  2CKK A;  2HL3 A;  5IT9 E;  2M16 A;  2RJC A;  1M3B A;  1KSW A;  2CS7 A;  1EZZ B;  3S6W A;  4E2F B;  4LN2 A;  1KHI A;  2BUD A;  2MWO A;  3M0Q A;  4C92 D;  3NTK A;  2LDM A;  4Y28 E;  2RHX A;  1VQL T;  1H8K A;  5D6Y A;  2MCN A;  5GJV B;  5IHN A;  3PVL A;  5LJ5 h;  3CC2 A;  2QI2 A;  1RL2 A;  2E4H A;  1ZQ1 A;  1FYN A;  1KG1 A;  1VYV A;  2B86 A;  1TG0 A;  4M75 C;  4M4Z A;  3CCS T;  2MIO A;  2MOX A;  4C8Q C;  2RHZ A;  3EFR A;  1YBY A;  1WHL A;  1IZ6 A;  1W1F A;  4M77 D;  3C12 A;  3OSV A;  1PM3 A;  4E7J A;  1HJD A;  4MDX A;  5GAM d;  1K9M R;  4DOV A;  3G4S Q;  2FZK B;  2L5Q A;  2E5Q A;  4JUV A;  5GMK j;  2CP5 A;  2EAY A;  1YJW T;  1KD1 U;  2LNH B;  2XIC A;  2DA9 A;  2R5A A;  2RO0 A;  3ULR B;  1Y0M A;  3RMQ A;  1KQS P;  1BIB A;  4KH1 B;  2JJ9 A;  4CRI A;  1X2Q A;  3EGX B;  5GAN f;  1G83 A;  2HSE B;  2LC4 A;  2W0Z A;  1VQL Q;  4LDW A;  4DBH A;  3GNF B;  5IAY A;  1D3B B;  4BB7 A;  1T3S A;  2PVO B;  3TSW A;  1JQQ A;  3MEW A;  4ZNX A;  3CMA A;  5LJ3 j;  3CPW A;  3EG1 A;  3EH2 A;  1AWJ A;  2K79 A;  1B07 A;  3M54 A;  2JMC A;  3VKI A;  4M7D A;  1DJ7 B;  3SEM A;  4M7D F;  1UE9 A;  4C8Q G;  4C5G A;  4M7D B;  4CC3 A;  3QJY A;  3HFN A;  4KUI A;  5IXB A;  2G3R A;  2HDA A;  1WHH A;  1WXT A;  5HK3 A;  1SHG A;  1KC8 R;  1K0S A;  3GNG A;  3JCM W;  3FJ5 A;  3OYA A;  1SKU B;  2KRS A;  5LJ5 e;  1C1A A;  4LDY A;  1OOT A;  1PD0 A;  1D1C A;  4GLK A;  5IN1 A;  5LJ3 h;  1U1T A;  2D8J A;  3KBG A;  2YSQ A;  2O2O A;  4E7S A;  1W70 A;  5CR2 A;  1O75 A;  4M78 G;  1PRL C;  5C0M A;  1SSH A;  4XTU A;  4JPB W;  3OYM A;  2LQK A;  4AT1 B;  1ZLM A;  1VOM A;  2AZV A;  1PKT A;  2MAM A;  2DET A;  1UFF A;  3V7S A;  3O8V A;  1W4S A;  2LCS A;  2VC8 A;  4RTT A;  4C5I A;  2QEX T;  1QKX A;  2K7A A;  3EHQ A;  2XDB A;  1PSE A;  4BE2 A;  2FRY A;  4J6W A;  2QYZ A;  2RQU A;  3V8J A;  3E19 A;  5GAN d;  1JXM A;  2SEM A;  2YHT A;  1R8O B;  4FT4 A;  4IUQ A;  3JCM X;  2RPN A;  1Q7Y C;  1JJ2 A;  1YJN A;  1KQ2 A;  2DTH A;  4JRK A;  2LX7 A;  1G3W A;  4X34 A;  4BD3 A;  4LE9 A;  1U8R A;  1GCQ C;  3GF5 A;  1YIT A;  4N4H A;  2HQH A;  1SHF A;  3DLL A;  3EG9 A;  1UDL A;  1YJ9 T;  4PFZ A;  1KD1 R;  1G8X A;  4B6M A;  1QCN A;  3QWX X;  1Q81 R;  4CC4 B;  1WPY A;  2CYZ B;  4ELY C;  3CCE A;  1D3B A;  4DEX A;  3FB9 A;  2RN8 A;  1AT1 B;  2CZ0 B;  4DOW A;  1GFC A;  1A0N B;  1VQ8 T;  2DJZ A;  4RTX A;  2EWN A;  2KR3 A;  5GAN h;  3CCJ Q;  1VQ9 T;  4O6J A;  4QT7 A;  4M7A G;  1WQW A;  2KI7 A;  1R0B G;  4JLI A;  3E2U A;  1BCO A;  2DX1 A;  2KY9 A;  2O88 A;  1VQ7 A;  1RAH B;  4VUB A;  2KAF A;  2FB7 A;  1JRI A;  2ZZD A;  1NE8 A;  5GAN 4;  2CT3 A;  2XID A;  4QW2 A;  5HY6 A;  1NG2 A;  5GAM j;  1KQS A;  2LX9 A;  1NEG A;  1VYU A;  2JW4 A;  1K73 R;  4RG2 A;  2VGN A;  4F7U E;  2RF0 A;  1PHT A;  3FLG A;  3MEV A;  2HD0 A;  2IVW A;  2RH2 A;  2EQI A;  4BUG A;  2F1L A;  3JCM Q;  1E7O A;  2A3L A;  2K4Y A;  3JCM g;  5GAN e;  2QEX A;  2OAU A;  2KT1 A;  4L5G A;  1KHC A;  1EX4 A;  3LGL A;  4N0A A;  3TQ7 P;  1YJW Q;  4JJC A;  3V7R A;  2DXU A;  2OAW A;  3CCE Q;  2QQA A;  2JS0 A;  3D7S B;  5KYU A;  1IXD A;  3M0P A;  2EGA A;  2YDL A;  3QZ5 B;  1Y07 A;  2KRN A;  1VQP T;  2XD0 A;  3I56 A;  1YJN T;  2LT4 A;  3H0F A;  1OU8 A;  2B8A A;  2GFA A;  1SRL A;  1ARK A;  5LJ3 g;  2ROT A;  1Q82 C;  3MET A;  2L89 A;  2LNV A;  4FW2 A;  1VQ6 Q;  3A8G B;  3VYH B;  4JRQ A;  1OPK A;  4BDZ A;  2AHJ B;  2IIM A;  5FU6 B;  3CBO A;  5CCA A;  4BI4 A;  4XU3 A;  3OYE A;  1ZBJ A;  3EH1 A;  2ABL A;  3R6N A;  1YHQ Q;  4NL3 A;  1IB8 A;  4F7U A;  1Y96 B;  4FW1 A;  4JJD A;  3VV0 A;  2AKL A;  2FVU A;  2P4T A;  4O5V A;  1Q7Y U;  3C0C A;  2J06 A;  1OV3 A;  4IUU A;  4PJO G;  1LVK A;  3WXM B;  2KE9 A;  2FYK A;  1Q81 C;  4QKU A;  4LD9 K;  3S3O A;  1YIT Q;  4J9I A;  1FMV A;  1WYX A;  3M4G A;  2D6F A;  3H0H A;  2E41 A;  5GAM e;  1M9S A;  3M53 A;  4OB3 B;  3QII A;  3VS3 A;  3CCQ Q;  1CKB A;  1UB4 A;  4KGV B;  3E9G A;  1IRE B;  1M4Z A;  2ATC B;  2LMJ A;  5FWC A;  3G4S T;  1SPK A;  2ZPE B;  4FSS A;  3MJX A;  2LJ3 A;  3JB9 H;  4XTW A;  4PJO F;  1WIE A;  2EYY A;  2J6K A;  2K57 A;  2QDL A;  4OML A;  3FRN A;  1I0C A;  2H3J A;  3RNJ A;  1WLP B;  2A28 A;  3MHX A;  2C0I A;  1LJO A;  3GPL A;  2GBQ A;  2X9H A;  3M0T A;  4FT2 A;  4XTY A;  3M58 A;  1RAE B;  3CEY A;  3J80 E;  1S1N A;  4ELZ C;  4ZN1 A;  5GMK e;  1Y71 A;  2O9V A;  2RQW A;  1X43 A;  3JCM b;  4BDY A;  1AWO A;  5CK9 A;  2DEQ A;  1G3T A;  1YI2 A;  1Q86 C;  1K4U S;  4HCC A;  3NGP A;  2K3B A;  1BCM A;  3BDU A;  4C0Z A;  2VV5 A;  2L3P A;  1NLO C;  3L1A A;  2RI5 A;  3VS7 A;  2DM1 A;  2VGM A;  2EYQ A;  4HVW A;  5LJ5 d;  2E3H A;  2K3X A;  3DLM A;  1QMC A;  1VQ5 Q;  1NPP A;  1QVP A;  3VRZ A;  2X4X A;  2JOY A;  3CXC P;  5GAN 8;  2HQX A;  1KC8 U;  4C92 F;  2V26 A;  4MMK A;  3LGF A;  1RAG B;  2BKD N;  2F2X A;  1QCO A;  2L0A A;  5HK0 A;  2V8I A;  1UG1 A;  2A36 A;  3C95 A;  1GL5 A;  2DFU A;  4R55 A;  1JB0 E;  3OA6 A;  9ATC B;  1BI1 A;  1VQK A;  1S72 A;  1UEB A;  4XAX B;  4DBF A;  4A4F A;  3A8L B;  3L2U A;  4PKC C;  2VXF A;  2X4W A;  1N6A A;  1X01 A;  5LJ3 f;  4FL6 A;  1ZX6 A;  3GOX A;  3G6E Q;  5FU6 C;  4Y91 A;  2QA4 Q;  1VQN A;  3A5Z B;  3CC4 Q;  1QP3 A;  2R5M A;  1I5L A;  2O9S A;  2J05 A;  1FWZ A;  1QCF A;  2RK2 A;  3JB9 D;  1ZUU A;  2HEQ A;  5I2S A;  1QQJ A;  1Z9Q A;  1T0J A;  3REB B;  3CXC S;  1RAI B;  4ESR A;  1G3Y A;  2QTX A;  4XU0 A;  3OYI A;  1GFD A;  3CCR T;  2EQM A;  2EW3 A;  3EGD B;  4PFP A;  1S72 T;  4C92 C;  5FRN A;  4J7I A;  2RM4 A;  3RKW A;  3TVT A;  2M1H A;  4M77 B;  4HXJ A;  3LX7 A;  4AG1 C;  1VQO A;  2E10 A;  4Y92 A;  1YJW A;  1AZG B;  1X6O A;  3LW5 E;  5GJW B;  2X4J A;  3V8K A;  2OTJ T;  2F5K A;  2SRC A;  3QDF A;  1R77 A;  4M77 F;  3ZBD A;  5KCO A;  5GMK m;  1J3T A;  2YUO A;  4GLM A;  1V76 A;  4J7F A;  3OS2 A;  5GAN 7;  2DER A;  3VUB A;  1M1K R;  2RJD A;  1TWB A;  3SHW A;  4AFU C;  4J9G A;  4M7D E;  1RLQ C;  4PJO A;  1QP2 A;  2DAQ A;  5J3B A;  1X75 C;  2PUK B;  4EMK B;  3M55 A;  1Y7X A;  4F04 B;  4RCC A;  1WNL A;  3WVD B;  2K2M A;  3BW1 A;  4M77 G;  3LLR A;  4JZ3 A;  1WJQ A;  3QWY A;  1YWP A;  2VVK A;  5GAO m;  4J9E A;  3ZEH A;  1BKB A;  2DYI A;  5KYW B;  2HBP A;  3CCV Q;  4PJL A;  2QQ9 A;  4K11 A;  4AFZ C;  3JAM E;  3OS0 A;  8ATC B;  3RBB B;  2L2P A;  1B7T A;  1VA7 A;  2FG0 A;  1VQP A;  1K76 A;  3EGD A;  3CCL Q;  1NPR A;  2RQR A;  2ZAE A;  2EQJ A;  2KT8 A;  5CKE A;  4C8Q A;  3QPH A;  3L2Z A;  1VQ9 A;  2HL5 C;  3QUI A;  5AYF A;  3HFO A;  2OTL T;  2JXB A;  3SD4 A;  5J26 A;  4BE1 A;  4BI3 A;  3CCQ A;  4C92 E;  3EG3 A;  3F70 A;  5EG2 A;  4ZTF A;  1B34 A;  1U1S A;  3I55 A;  1RLP C;  1ZUY A;  1UGP B;  1YWO A;  3I56 Q;  4OB0 B;  4C8Q D;  2COY A;  4FIB A;  1QW1 A;  1LPL A;  4J9H A;  4OMF B;  3P8H A;  2GQV A;  1N8R R;  3CPW S;  2ECZ A;  4LD6 A;  2FPD A;  3SWN A;  2E6Z A;  4N4G A;  1VQ6 A;  4JDS A;  3AHU A;  4X9D A;  5GAO r;  1WHJ A;  1YN8 A;  3M57 A;  2FPE A;  4PFO A;  2D1X A;  2VUB A;  1WI7 A;  4KGZ B;  3SDZ A;  2DIQ A;  1BU1 A;  4TVR A;  1WA7 A;  1ZSZ B;  2JTF A;  1RAA B;  2H8H A;  1K9A A;  2MYS A;  3MP6 A;  3REA B;  4ANJ A;  2AKK A;  2RHU A;  5GAO n;  2P84 A;  3LWH A;  4EPC A;  5GAO p;  3HRU A;  1K8A C;  3VYG A;  1JEG A;  4RTZ A;  1PC0 A;  5CIU A;  3JCM h;  2O4X B;  4J6Y A;  4LDX A;  3JB9 I;  5GAN 6;  5CKB A;  2YRV A;  4JS5 A;  3KXT A;  1JJ2 P;  1M30 A;  2X4Y A;  3BY7 A;  1BB9 A;  2MWP A;  3A8H B;  2RNA A;  3G71 Q;  1M1K C;  1Q7Y R;  4IUP A;  1BI2 A;  2ED0 A;  3DB3 A;  4UC4 A;  4Z88 A;  5LJ5 j;  2KXD A;  4JLG A;  1NYF A;  1XNI A;  2PUO B;  1RI0 A;  4BY6 C;  1YJ9 Q;  1YFN A;  2P0K A;  3UF4 A;  1N8R U;  1XQH A;  3J81 E;  2EGE A;  4KT0 E;  3GIB A;  2RA2 A;  4FYX B;  2KBT A;  1AOJ A;  1AHJ B;  4F7U F;  3OMG A;  2IG0 A;  2A0F B;  5I11 A;  1ZBX A;  3A98 A;  5FU7 C;  1AZE A;  1M8V A;  3VS6 A;  3X28 B;  2RK1 A;  1I81 A;  1H3H A;  1QKW A;  1W2B S;  4ATO A;  3CBM A;  3OYL A;  2L3S A;  4M7D D;  3WVE B;  4M75 E;  1RAF B;  3G6E A;  4QVD A;  1NM7 A;  1N8R C;  2O01 E;  3QDR B;  1UGS B;  3CC4 A;  3DKM A;  2QAS A;  1C6V X;  3RUX A;  4CC2 A;  3KFV A;  5FRO A;  2GCX A;  4RCB A;  4A4H A;  3G4S A;  1Q86 U;  4BE0 A;  2OX7 A;  2HQE A;  4ZGD B;  1VQO T;  3H41 A;  2WSF E;  2DEU A;  1WZO A;  4M77 C;  2CUB A;  5A0D A;  5LJ3 e;  2YUN A;  5KYX B;  2KYB A;  1TH7 A;  3FDR A;  4J8O A;  1FXX A;  2ZPG B;  2EJ9 A;  3EFS A;  2MMP A;  4PJJ A;  1JO8 A;  2NUZ A;  1VQ5 A;  3CD6 T;  1MHN A;  2QAZ A;  2YT6 A;  5A0G A;  1SSF A;  3I55 Q;  3C94 A;  3C4S A;  4IUR A;  3GLX A;  1G3S A;  2VXE A;  4HT8 A;  2QQB A;  4CC7 A;  1QVG A;  4E47 A;  3NPF A;  4DA4 A;  1K8A R;  2E65 A;  4KUL A;  3X25 B;  1IGQ A;  3RDV A;  1Q82 U;  4JRP A;  1CKA A;  1XJW B;  5J39 A;  1ZSZ A;  2CP6 A;  2M51 A;  3V8L A;  3I56 T;  2RHY A;  1FMK A;  4ZGJ B;  2DD4 A;  5GAM g;  3JB9 F;  5GMK h;  2M0O A;  1M3A A;  2GF7 A;  2RQV A;  3OYG A;  1TXQ A;  2BE9 B;  4QVZ A;  3V7C A;  5CVI A;  2MPX C;  4XK8 E;  3HTR A;  3X20 B;  3RER A;  2DVJ A;  4C5E A;  5KE2 A;  1AD5 A;  3E1S A;  2Y4Y A;  2C06 A;  4DEY A;  3RKY A;  2RB6 A;  1NLP C;  2EJG A;  1YIJ A;  2RJE A;  2FO0 A;  5KH6 A;  3PIP A;  2FPF A;  3RES A;  1Y57 A;  4M7A E;  1BI3 A;  4E7L A;  1ABO A;  2OJ2 A;  3KUF A;  2DMO A;  3UDC A;  5EC7 A;  5CAI A;  1Z9Z A;  1YNZ A;  2KGT A;  2K3Y A;  2QTV A;  1G5V A;  8AT1 B;  2EYZ A;  3NMZ C;  2C0T A;  2E70 A;  2DL3 A;  1MND A;  2BZ8 A;  3EG2 A;  2DZ9 A;  1VIF A;  4R0K A;  1V1C A;  1VQ7 T;  3BFM A;  2DRM A;  3QHS A;  3HSB A;  3ME9 A;  5LJ5 f;  2JTE A;  3OS1 A;  2F5T X;  4EDU A;  2EKH A;  2K6D A;  2DJQ A;  4M75 F;  2EYX A;  3CC7 Q;  3ZFJ A;  2QK0 A;  2DIG A;  2OTJ Q;  4N0A C;  4J5Y A;  3S3M A;  2DE0 X;  1BIA A;  3VRY A;  1ABQ A;  1OX8 A;  5HKC A;  2BZX A;  3PFS A;  2DF6 A;  2WSC E;  2GQI A;  3CC7 T;  1IO6 A;  5CQY A;  3RMS A;  4RTV A;  2M0Y A;  3CC2 T;  5LJ5 g;  4PJO D;  5DM7 R;  4KRT A;  2EQK A;  3CCV A;  5IHK A;  1AVZ C;  1AWX A;  1UGR B;  1TU0 B;  2F69 A;  1SRM A;  2RQT A;  4EMG A;  1M3C A;  2I0N A;  1T0H A;  2KXC A;  4PL6 A;  1EIF A;  4FCY A;  1YIJ Q;  1WQ7 A;  2D0Q B;  2F2W A;  3M0S A;  4MZP A;  4Z8A A;  1M2V A;  5D6W A;  3CMA T;  2CGH A;  3L42 A;  1M90 R;  4RG8 A;  2QDY B;  2NUP B;  2VYT A;  4RTY A;  5KCH A;  2JT4 A;  3TRE A;  1VUB A;  3UPU A;  1M90 C;  3HHT B;  4XU2 A;  2JTM A;  4WCI A;  4PLL A;  3CCU Q;  1ZHI A;  4M7A C;  2KRM A;  5M9O A;  3M4Y A;  3JCM d;  1B3Q A;  2D0N A;  2LQN A;  4YTL A;  2DXT A;  3M56 A;  4RUG A;  4D8K A;  4JJB A;  2EPD A;  1LOJ A;  3MCA B;  1XTD A;  4EMK A;  2BTT A;  3A8M B;  4M75 D;  4AFS C;  1UHF A;  2EQU A;  1OZ3 A;  3ASK A;  4M7D C;  1B34 B;  5GMK l;  2DTO A;  4X9C A;  2K5F A;  3OBY A;  5GAN 2;  2YUP A;  1ZA1 B;  3UWN A;  3P8B B;  5GAM h;  2AK5 A;  5GAN j;  2E5K A;  5CQX A;  2E3I A;  2QEX Q;  1VQ4 A;  2RMO A;  1QVG S;  2WAC A;  2PVG B;  4IUV A;  4F16 A;  2LZ6 B;  5D7U A;  2CZ6 B;  4FYY B;  3CCM A;  1OI1 A;  2CRE A;  4NS5 A;  1PD1 A;  6AT1 B;  3CXC A;  4A63 B;  1KFZ A;  3SWN C;  3OY9 A;  2CP7 A;  4M7A D;  5GAN 3;  3SWN B;  2D9T A;  1K8A U;  1EFN A;  3I9Q A;  2EYW A;  2DK3 A;  2NUT B;  2ZPH B;  5FRM A;  1KQS S;  2HNI A;  4C0G A;  2V8K A;  3CCR A;  2VB6 A;  2I2L A;  1QVG P;  4M78 C;  2DXC A;  4QQD A;  3UT1 A;  5GMK i;  2HMA A;  1K73 C;  2ZPB B;  2EGC A;  4JJN K;  1H64 1;  1RUW A;  2JVV A;  2PZ1 A;  4M7A A;  2CT4 A;  2CH4 A;  4OMP A;  1I4K 1;  5DLQ E;  2HZY A;  2L8D A;  1D1B A;  1JJ2 S;  3OW2 S;  2E6N A;  1YI2 Q;  1BBZ A;  1VQM A;  1NYG A;  2VWF A;  1X69 A;  4IUT A;  1O9S A;  2GTO A;  1RAD B;  4C0D C;  1HSQ A;  1MNE A;  2H3E B;  4ZTJ A;  1D0Y A;  2LVM A;  1HD3 A;  4J9D A;  1HXD A;  4D8D A;  3HKS A;  1BI0 A;  3GBQ A;  1OYX A;  1F1B B;  1VQO Q;  2LQW A;  2X35 A;  2C0O A;  3FEO A;  3L2W A;  4V2S A;  3OMC A;  1YCS B; 
#chains in the Genus database with same CATH homology
 4OMM A;  2H8H A;  1OEB A;  1K9A A;  2RN8 A;  3REA B;  1GFC A;  2AKK A;  2HSP A;  1A0N B;  2PNI A;  4F17 A;  2L3Q A;  4RTX A;  2KR3 A;  2JM9 A;  1T3L A;  1JEG A;  2DL4 A;  1QWF A;  4RTZ A;  4QT7 A;  1N5Z A;  2LJ0 A;  2AZS A;  1GBR A;  1JXO A;  2X3X D;  1GBQ A;  1RI9 A;  2DX1 A;  5L23 A;  2O88 A;  2DBK A;  1I07 A;  3UAT A;  1M30 A;  3IQL A;  1PWT A;  2V1Q A;  1BB9 A;  4OMN A;  2RNA A;  2JM8 A;  1U06 A;  2CT3 A;  1NG2 A;  2DIL A;  1NEG A;  1GRI A;  2JW4 A;  1VYU A;  1NEB A;  2ED0 A;  2CUD A;  4Z88 A;  2KXD A;  5FW9 A;  2KEA A;  2OI3 A;  1H92 A;  2J6F A;  2RF0 A;  1NYF A;  1PHT A;  3UF4 A;  2EQI A;  1MUZ A;  2EGE A;  3JV3 A;  1X2K A;  1U5S A;  1E7O A;  2KYM A;  2KBT A;  1AOJ A;  2JS2 A;  3VS4 A;  1K0X A;  4AFQ C;  1UJ0 A;  5I11 A;  2KT1 A;  3A98 A;  3EGU A;  2GNC A;  1AZE A;  3VS6 A;  1H3H A;  1UJY A;  1QKW A;  3VS1 A;  5I22 A;  1SEM A;  2L3S A;  3O5Z A;  2G6F X;  4JJC A;  2KNB B;  2OAW A;  2CDT A;  1NM7 A;  2JS0 A;  5IH2 A;  2FRW A;  3M0P A;  2EGA A;  2YDL A;  1W6X A;  3I5S A;  2KRN A;  1UTI A;  4CC2 A;  3KFV A;  2LJ1 A;  3PVQ A;  1G2B A;  1UHC A;  1GCQ A;  2CSQ A;  1PNJ A;  3H0F A;  1QWE A;  1SRL A;  1ARK A;  3H41 A;  4E6R A;  2ROT A;  2O31 A;  2CUB A;  2YUN A;  2EVR A;  1OPK A;  1WX6 A;  1AEY A;  4OMQ A;  2KYB A;  3EHR A;  3I35 A;  3UA7 A;  2HBW A;  2GTJ A;  2IIM A;  1JU5 C;  2NWM A;  1TUC A;  2LP5 A;  1QLY A;  5ECA A;  4Z89 A;  1JO8 A;  1ZBJ A;  3EG0 A;  2J6O A;  2NUZ A;  2ABL A;  2BZY A;  2YT6 A;  2ED1 A;  3R6N A;  1X27 A;  5HCK A;  4RTU A;  1PKS A;  2DRK A;  4JJD A;  5IXF A;  2AKL A;  2DLP A;  4CC7 A;  2CSI A;  3NPF A;  3C0C A;  2J06 A;  1OV3 A;  4HCK A;  2DL7 A;  2XMF A;  2KE9 A;  4ORZ A;  2P4R A;  4IIM A;  2D8H A;  1K1Z A;  3VS2 A;  4J9I A;  2W10 A;  1WYX A;  1CKA A;  3H0H A;  4HVV A;  2M51 A;  1LCK A;  3VS3 A;  1FMK A;  5IHI A;  1CKB A;  2LMJ A;  5FWC A;  4JZ4 A;  1M8M A;  1SPK A;  5FWB A;  1X6B A;  1M3A A;  4FSS A;  1YP5 A;  1E6G A;  2RQV A;  2LJ3 A;  4F14 A;  2V1R A;  1I1J A;  2ENM A;  1WIE A;  2DNU A;  2EYY A;  2J6K A;  2QDL A;  4OML A;  2DVJ A;  1I0C A;  3RNJ A;  4AG2 C;  1MV0 B;  1WLP B;  2A37 A;  2A28 A;  1AD5 A;  4DEY A;  1M3B A;  2C0I A;  2PTK A;  1KSW A;  1U3O A;  1VYT A;  2FEI A;  1NLP C;  1WXU A;  2GBQ A;  4LN2 A;  2FO0 A;  3M0T A;  1E6H A;  4EIK A;  2FPF A;  1Y57 A;  2ROL A;  3M0Q A;  1S1N A;  1ABO A;  1WXB A;  2OJ2 A;  2DMO A;  5EC7 A;  1Z9Z A;  1YNZ A;  2KGT A;  2O9V A;  1H8K A;  2RQW A;  1X43 A;  2MCN A;  1AWO A;  4LUD A;  1UGV A;  2EYZ A;  3NMZ C;  2C0T A;  5GJV B;  5IHN A;  1PRM C;  2DL3 A;  2BZ8 A;  3EG2 A;  4J9F A;  3PVL A;  4OMO A;  1K4U S;  3NGP A;  2K3B A;  4R0K A;  1V1C A;  2DRM A;  1FYN A;  2L3P A;  1NLO C;  1VYV A;  2JTE A;  2B86 A;  2EKH A;  3VS7 A;  1TG0 A;  2K6D A;  2DM1 A;  1UEC A;  2DJQ A;  4M4Z A;  2EYX A;  1KJW A;  2YUQ A;  2MIO A;  2MOX A;  4HVW A;  4LUE A;  2CH4 W;  2DE0 X;  3VRY A;  4LNP A;  1ABQ A;  2BZX A;  1W1F A;  2DF6 A;  1KIK A;  1TUD A;  2GQI A;  1HJD A;  3VRZ A;  1IO6 A;  4RTV A;  2M0Y A;  2HCK A;  2F2X A;  4KRT A;  2EBP A;  2L0A A;  1UG1 A;  2A36 A;  1GL5 A;  5IHK A;  1AVZ C;  1AWX A;  1SRM A;  2RQT A;  3UA6 A;  2LNH B;  2A08 A;  1M3C A;  2I0N A;  1T0H A;  2KXC A;  2DA9 A;  4RTW A;  3ULR B;  1Y0M A;  3H0I A;  2F2W A;  1CSK A;  3CQT A;  3M0S A;  1ZX6 A;  4Z8A A;  1X2Q A;  2O9S A;  1G83 A;  3VS5 A;  2J05 A;  2W0Z A;  1QCF A;  4GBQ A;  1ZUU A;  3LH5 A;  2HEQ A;  1Z9Q A;  1T0J A;  3REB B;  4RTY A;  2JT4 A;  4ESR A;  4HVU A;  1T3S A;  4IIO A;  1GFD A;  4WCI A;  3TSW A;  1JQQ A;  4ZNX A;  2EW3 A;  2KRM A;  3TVT A;  3EG1 A;  1AWJ A;  2K79 A;  1B07 A;  1B3Q A;  4HXJ A;  2JMC A;  2D0N A;  1X6G A;  2LQN A;  4AG1 C;  4D8K A;  4RUG A;  2GGR A;  4Y92 A;  4JJB A;  2EPD A;  1AZG B;  2JMA A;  2BTT A;  5GJW B;  4AFS C;  1UHF A;  1ZSG A;  3M0U A;  2SRC A;  3SEM A;  1UE9 A;  2J7I A;  1J3T A;  2YUO A;  4GLM A;  1OPL A;  2KRO A;  1AWW A;  3SHW A;  1M27 C;  3THK A;  2YUP A;  4AFU C;  1MV3 A;  4CC3 A;  2F2V A;  4J9G A;  1RLQ C;  2AK5 A;  3PE0 A;  5IXB A;  2HDA A;  2ESW A;  2E5K A;  1WXT A;  1SHG A;  2RMO A;  1K0S A;  2X3W D;  3TSZ A;  2K2M A;  3FJ5 A;  3ZL7 C;  1UUE A;  4JZ3 A;  2KRS A;  4F16 A;  2LZ6 B;  1OOT A;  3QWY A;  1YWP A;  2CRE A;  1WDX A;  2D8J A;  2VVK A;  2YSQ A;  2O2O A;  4J9E A;  2DYB A;  1W70 A;  4A63 B;  1KFZ A;  3VS0 A;  1XOV A;  4K11 A;  4AFZ C;  1PRL C;  3RBB B;  1EFN A;  3I9Q A;  2EYW A;  1SSH A;  2L2P A;  3NHN A;  1VA7 A;  2FG0 A;  4JPB W;  1GCP A;  1K76 A;  2VKN A;  1ZLM A;  2RQR A;  2KT8 A;  2AZV A;  1PKT A;  2DBM A;  1UFF A;  1WFW A;  4J9B A;  1BK2 A;  2EGC A;  1RUW A;  2PZ1 A;  2LCS A;  2CT4 A;  2JXB A;  2CH4 A;  4OMP A;  4RTT A;  1QKX A;  2K7A A;  3EG3 A;  3EHQ A;  2FRY A;  2RQU A;  3M0R A;  1RLP C;  1ZUY A;  1YWO A;  1BBZ A;  1JXM A;  2DL8 A;  2SEM A;  1NYG A;  2VWF A;  1X69 A;  2GTO A;  1HSQ A;  2RPN A;  4J9H A;  1HD3 A;  4J9C A;  2LX7 A;  4J9D A;  4D8D A;  2ECZ A;  2FPD A;  3U23 A;  4X1V A;  4LE9 A;  3GBQ A;  1GCQ C;  2LQW A;  1YN8 A;  2FPE A;  1SHF A;  2DL5 A;  2D1X A;  3I5R A;  2C0O A;  2K9G A;  1UDL A;  1WI7 A;  1BU1 A;  3QWX X;  1ZUK A;  4CC4 B;  1WA7 A;  1YCS B;  4DEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...