4JZ5A

High-resolution structure of catalytic domain of endolysin ply40 from bacteriophage p40 of listeria monocytogenes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
GSHMMVLVLDISKWQPTVNYSGLKEDVGFVVIRSSNGTQKYDERLEQHAKGLDKVGMPFGLYHYALFEGGQDTINEANMLVSAYKKCRQLGAEPTFLFLDYEEVKLKSGNVVNECQRFIDHVKGQTGVKVGLYAGDSFWKTHDLDKVKHDLRWVARYGVDNGKPSTKPSIPYDLWQYTSKGRIKAIASPVDMNTCSSDILNKLKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of catalytic domain of endolysin Ply40
rcsb
source organism Listeria phage p40
molecule tags Hydrolase
molecule keywords Gp26
total genus 75
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jz5A00
3ZO9A 3HJEA 1UA3A 4LQ1A 4OOUA 1EDTA 1KWKA 2DDXA 1CXLA 4PMDA 2BY3A 4PTVA 1EA9C 1MYRA 1RH9A 2QPUA 3U7VA 3S2CA 1ISVA 3AIWA 2YIHA 3GH7A 9CGTA 1E4LA 2PWDA 3RPMA 5JUVA 1VJZA 1GQJA 1UQZA 1R7OA 1V03A 3B9DA 4BCEA 1EOMA 2ZUWA 3DYOA 3OA5A 3W82A 1B3WA 3SURA 3AXXA 3II1A 4GI6A 1UWRA 4LGXA 4W86A 1TUXA 1XSKA 4U5IA 1V02E 1C7SA 2G8ZA 3ALGA 1B30A 5A6JA 2WVTA 2YL8A 4AMCA 4LPCA 1CGTA 3SCOA 4ZEPA 2W66A 4JKLA 4PSPA 1X1NA 4DM2A 2WCAA 2D2OA 5I6SA 3UG4A 1G0CA 3ARVA 1EHAA 5EBAA 4AZHA 1QNQA 1AMYA 2FGLA 3VDBA 4PTWA 4JHZA 4UCFA 2BXYA 5FIPA 3WH7A 5BXTA 1HF6A 1R8LA 3OLEA 3CHFA 1DP0A 3W27A 4JFTA 2NT1A 1C8XA 1GW1A 1CDGA 1E4MM 4HU8A 1J0JA 1LL7A 3ARZA 4RL3A 1D7FA 2VTFA 2X05A 1BVNP 3B8SA 4D6JA 1HN1A 3VD4A 2W63A 1EH9A 4R27A 2PWHA 5I79A 4B15A 5BRPA 1OCQA 1BYDA 5M5DA 2WBGA 1V0MA 4H2CA 5M3WA 1J10A 3BMVA 1UH2A 4OUEA 5BYWA 4KWUA 5CG0A 2GK1B 4Q22A 3IK2A 1H09A 1GQKA 1S46A 4JL2A 2CKRA 1ZJAA 3GXIA 3AMCA 1YQ2A 5D9MA 1JYNA 2J25A 2FHFA 2YBTA 3D5HA 2CBUA 2WSPA 2WVUA 2GJPA 3UESA 1MVYA 3DHPA 1NOUA 1W2PA 4UFJA 3PZOA 4GQRA 2A3BA 3W28A 4MNKA 3AIRA 2D0FA 4AIUA 1CENA 4MB4A 1K9DA 1FP8A 1VFFA 1VF8A 2YL6A 3VM5A 3PZUA 1JZ2A 5EFFA 2W92A 1J0ZA 3A4WA 1DWFM 1Q6EA 4J3UA 1BAGA 1CIUA 2J7HA 4PUDA 4W7VA 1NWSA 3L4YA 4D6CA 4AISA 3A6OA 2GVYA 2PWEA 3VIKA 2C7FA 2JE8A 1ZBWA 1JZ5A 3W25A 2E9BA 3CMGA 3KE0A 2EO7A 5LA1A 4GO8A 5LA2A 1KB3A 1RP9A 2DGAA 4PRWA 1QW9A 1BHGA 3LPGA 2XGBA 2BHUA 3FAWA 1HNYA 4W8BA 5BROA 1KGWA 1J0HA 5CXPA 4PMZA 1V3MA 3CHCA 1V6WA 1VRXA 1Y7VA 5A8QA 5FOOA 2ZUSA 2QMKA 2E8YA 2WC7A 1PEZA 2EPOA 4TVUA 1EQCA 2O92A 2ZUVA 4S3KA 3M07A 2V3EA 4GXPA 1IZJA 3W53A 1W1TA 4P7NA 3QHNA 3BAKA 1UR9A 2YJQA 3DC0A 3ZIZA 3DYPA 1V0LA 1BSIA 4EKJA 4UTFA 2G4FA 4H8UA 2IXVA 5I5RA 3MMDA 3MSGA 3N15A 3EDJA 5CSYA 2YLLA 4D6IA 1G9HA 2XFRA 5M17A 3UG3A 2XTKA 5ABFB 1GOWA 4H41A 1W1PA 3DHUA 1JG9A 4N0RA 2XVKA 1D2KA 5CPSA 4PCSA 1XC6A 4W89A 2J47A 4MADA 3FN9A 4WSJA 2WMIB 4UQAA 4NSBA 4JAWA 2ZUTA 1QNRA 2CESA 3TP4A 3GXFA 1HL8A 1LJYA 4F66A 2UY4A 4P8UA 2G3IA 1QI0A 3ZSTA 3O6AA 5JIPA 4DM1A 1J11A 2VVSA 3T0BA 2JFEX 3PZMA 5E6YA 1WAWA 3WF1A 3F4VA 1HKIA 3VVGA 4PMOA 3KL0A 4PCTA 3EDFA 7A3HA 3ZT7A 3VGEA 1JYWA 3MMWA 1N82A 1E6ZA 3AIUA 3GM8A 4HMEA 4DWSB 2DPEA 2CHOA 1PPIA 1E6QM 3GXDA 2A3EA 2DT1A 1V3KA 3WNNA 3N9KA 1OGBA 3AHTA 4GKLA 1ECEA 1KFWA 4OKDA 4YHGA 2V3DA 4HMDA 5A2CA 3WDJA 1GORA 3BH4A 4IISA 5E0FA 1BG4A 1Z32X 1NWRA 3AS1A 4TX6A 1GQIA 2E9MA 2PWGA 1JFHA 4CD6A 3T2PA 2AOSA 3FXYA 2VR4A 2DQXA 3G6MA 4U33A 1XH0A 2XIBA 4QFUA 4JFUA 5BXSA 4H8HA 4MB5A 4OZOA 4XX6A 3WL1A 2X1IA 2YL9A 3ARTA 1M04A 5E09A 4WSKA 3WH9A 1WCGA 3VDHA 3AOFA 2DIEA 1R87A 1DWAM 3WDHA 2CKSA 2Q8XA 4PEEA 1HJSA 4ATWA 1H0GA 3OLDA 2VX6A 2WWDA 1WKYA 4F9DA 3RM4A 5A8NA 4W5UA 3AHZA 1KQZA 4GZIA 2OSXA 1UZ4A 1TFVA 3W38A 4LYPA 2X0YA 2PWFA 4W85A 4FLSA 1OD0A 1AQ0A 1PX4A 3PZIA 3MUAA 4HU0A 2FH8A 2G3JA 1H0IA 1WB0A 1H4PA 4MJ2A 1UKOA 3HMCA 1W9PA 1QBBA 4F8XA 1QNSA 2GFTA 4UQCA 4J3VA 4K68A 4XUYA 1OGGA 2GDVA 3BSGA 4B3LA 2VX7A 1E6RA 4FLOA 1WDPA 2J8GA 4MTVA 1CXFA 3W4RA 1O7AA 3NSNA 1E6SM 4J27A 1H41A 2A3CA 4CD5A 3ARQA 4WKFA 3WF2A 3WKZA 3ECQA 1W3HA 1G5AA 1PX8A 4MB3A 5D9NA 2XJ7A 4KH2A 4M81A 1EOKA 1CTNA 4JZ5A 4NZCA 1ZL1A 1BG9A 1UH4A 2VCAA 2J7EA 4YN5A 2EPNA 3OG2A 1UG6A 3ZJKA 5IFPA 3ZJ8A 1DWJM 3CUHA 4C7GA 1ISWA 3SCUA 3PZGA 2AMGA 4FF5A 1LWHA 3MUIA 4A3HA 2Y8KA 1JXJA 3WNPA 5HNNA 2JEQA 3B9AA 5D9PA 3OZOA 1GVIA 3N04A 5IHRA 1UR4A 3PZVA 1R86A 4GIAA 3RDKA 3WD2A 5JBDA 1GZJA 1K9TA 2DT2A 1LL6A 2Y2WA 3ARUA 4EANA 1UOKA 1OB0A 3VMNA 3EDKA 2J78A 2WWCA 5E9AA 1V08A 3ZSSA 3WH8A 4QLJA 3K8LA 1UR8A 4TTUA 2JF6A 2WM0A 2FH6A 3VIHA 1K9FA 4H04A 3L4XA 3MSDA 2C0HA 1I75A 3AYRA 2W62A 1DWGM 1OD8A 3L2MA 4P8VA 1AVAA 3AZTA 1G01A 3OLGA 4B3KA 3CZJA 1JFXA 2WAGA 2J7BA 1CGYA 1G1YA 4GINA 4J3WA 4X0NA 4PUEA 3CZLA 4PBGA 3U5YA 1W3LA 1BQCA 4MJ4A 1W1YA 4CU7A 3PZ9A 2O9PA 2XVNA 1BGGA 4LYRA 2YOCA 3MU7A 2ZUUA 1WDRA 4EE9A 4N42A 3ARXA 5EB8A 3ZR6A 2WCSA 2W91A 1XYFA 2WMKA 4AY1A 2EBNA 2D22A 2Y24A 4CCEA 3BGAA 3OIHA 3VMPA 1JI2A 2J8FA 3QGVA 5DO8A 3AXIA 3U57A 1BVZA 2DSUA 1GHSA 1H49A 4U3AA 5A6KA 3L4WA 4ZXLA 4CD8A 1RPKA 5D4YA 2VT0A 1XD1A 3WQ5A 5HXMA 4CU6A 2OLHA 3VDCA 1Q6GA 3AXHA 4XZBA 3VIPA 1ITXA 3IAQA 4W8AA 3CUJA 2O9OA 3TTYA 2UY3A 1MW2A 3HU7A 4NF7A 5DT5A 5BXPA 3CIVA 3MANA 2VZUA 4BQ2A 3WH6A 1NWTA 4MNJA 4TX8A 2PBOA 1WDSA 3WEZA 4HOXA 4A4AA 4GPNA 3WIJA 2ZWYA 1EXPA 3EMCA 4FMVA 1HIZA 4GZJA 5DMYA 5I77A 2EEXA 4UFMA 5AYBA 5ABHA 3VOCA 2YDSA 1BYBA 1E72M 2BHYA 3BXWA 3W24A 4CN4A 5CGTA 4E8DA 3UCQA 3A4AA 3OGVA 4NRRA 1B0IA 2EPMX 4BQ4A 3VMOA 1QW8A 1MFVA 4KGJA 4MAVA 1V3LA 4PMYA 1VB9A 4PN2A 4J28A 1W91A 4HZ6A 3BAWA 1WZLA 3W37A 4PMVA 3MO4A 4UFKA 3TTQA 3PZTA 1U30A 1UD4A 3WQ4A 1W3KA 3WQWA 2G41A 1XH2A 4RE4A 3THCA 1GOMA 3VO0A 1VFMA 2WVVB 1FHDA 1CYGA 5BRQA 5C8BB 3AMLA 3VILA 2ZX8A 2JALA 3NDYA 1UKSA 3FNDA 4FLQA 3A3HA 3F5KA 1E71M 1NARA 2VOTA 4V27A 3VM7A 1HJUA 4AZ6A 3HN3A 2WXDM 4PMQA 5A95A 3AISA 2PF0A 4IPLA 3WMCA 1CLVA 4C7DA 2VX4A 1XSIA 3GNPA 4DUXA 1SMAA 1XV8A 4Z2JA 2VX5A 3F5JA 4J3XA 2BY0A 2CXGA 3W6LA 8A3HA 3I3DA 4OBSA 3SCTA 1M01A 1XSJA 3WEOA 4TVCA 3RMEA 1TZ7A 1WZMA 2V3FA 2XWDA 3WUBA 1NQ6A 4L4PA 4TVDA 3BAJA 3RM8A 1CGXA 1KR0A 3SCVA 1E3ZA 1HX0A 4JKKA 2WANA 3WNOA 3WNMA 1NP0A 2G3MA 5ABEA 3M7SA 3W81A 1X6LA 2W61A 1KBKA 4AD2A 1KXHA 2GDUA 3TONA 1PZ3A 3PHAA 1BTCA 3WMSA 1ODZA 1V3HA 2V5CA 2WYSA 1VBUA 5I24A 2IUZA 1NOFA 4M8UA 1JZ6A 3ALFA 1E40A 3WBAA 4M56A 2ZXQA 1NOWA 5AC4A 1KQYA 1UWQA 1CGVA 4WKHA 5HPCA 2UWFA 3AICA 4U3CA 3WH5A 4B16A 2RGMA 1V0NA 2JIEA 5D8ZA 4XB3A 3POHA 4BS0A 2ZE0A 1FHLA 3M6DA 1EDQA 3WQ8A 3VINA 3WENA 4P7OA 2Z1KA 4IPNB 1W9DM 1B3VA 3CGTA 3ARRA 4KRUA 4Z2HA 6TAAA 3I3EA 4AZBA 1ISZA 3AHYA 4WF7A 2CYGA 4WLCA 1UD5A 2VMFA 3ARSA 1HVXA 2WZEA 3CLWA 3AMKA 2WBKA 3WELA 2D0HA 1E56A 3L4VA 3T08A 3WD0A 1V3IA 2DIJA 4M82A 3IJ9A 1LF1A 4MAZA 3ZT5A 2CPUA 1CZ1A 3L4TA 1ZJBA 1BGAA 2DT0A 2WVSA 3PBGA 4AZGA 1HT6A 1KGUA 4AWEA 3AZSA 4GO9A 1MQPA 1GOQA 4AZCA 1US3A 4QLKA 1CXHA 2FHBA 4X9YA 4D72A 1UWTA 2XFFA 2ZXAA 4P7LA 1HL9A 2A3AA 4D1JA 4GQQA 1V02A 1QBAA 1E5NA 3SUVA 1QI5A 3TA9A 1MFUA 4ATDA 4Y7EA 4DWSD 1PBGA 2RGLA 4D6GA 2ESCA 4AD5A 2BS9A 5BWFA 2VNCA 3VNYA 1C3FA 2W67A 1OINA 3AS0A 1EIBA 5A6BA 3L2LA 2X0HA 2ZX6A 1ESWA 3KL3A 1J01A 1HKKA 2WHMA 3JUGA 5A3HA 4P8WA 4FLRA 4AZ5A 2ZUMA 4RE3A 4WKAA 3VTRA 2EJ1A 4AEEA 1L8NA 1OGSA 1VEPA 4TTGA 4U2YA 4LYQA 1VENA 2FGZA 4D6EA 2DSKA 3LPFA 2YDQA 2BXZA 1EDGA 3NYDA 1KXQA 1E0VA 3E1F1 3BAXA 1R85A 3WUGA 3BAIA 4AYSA 2QPSA 2WK2A 3ZT6A 4BQ5A 1QI4A 1CBGA 2UY5A 1J12A 3BC9A 1R7AA 3GDBA 5AYIA 1GPFA 1PIFA 5BXRA 5A6MA 1UWIA 2CIPA 3RM9A 2Y4SA 1EO7A 3UETA 3ZM8A 3CO4A 4AXNA 7CGTA 2VZTA 5A1AA 1XD0A 1SMDA 5IXEA 1B9ZA 4AD4A 1UKTA 5A8PA 2PI6A 5CPTA 2ZOXA 2ZIDA 5CZKA 1UR2A 4AEFA 4P7RA 6CGTA 3ZJ7A 4PSRA 5A6AA 4QLLA 3WD4A 5AC5A 1HJXA 3MS8A 3LPPA 1IT0A 2VR5A 1E4NA 3WUEA 1QVBA 1E55A 2GJXA 2OSYA 1FP9A 2QLYA 1E6PA 3WDRA 3DECA 2VRJA 1ISYA 3NSXA 5D9OA 2FHCA 2QHAA 5D8WA 3WSUA 4HMCA 1AQHA 4W7WA 3A4XA 1E6NA 1QHZA 2WMFA 2CBJA 4CD7A 3ZOAA 1QHOA 3VIFA 1F4HA 3IJ8A 5FCZA 5FD0A 4QDMA 4J3SA 1J0YA 4PMNA 5GQBA 3VGBA 1TE1A 1GJWA 3VIJA 1HP4A 1SFSA 1WZKA 2BNJA 4GZEA 1CEOA 2WPGA 2YA2A 1UD6A 3AMDA 5DFAA 4PTMA 1UR0A 2ZXBA 3I3BA 1C7TA 3CH9A 3WFZA 1VJSA 4L4OA 1BYCA 4W7UA 4WIWA 3M46A 4F79A 2CITA 3RCNA 3GXMA 4HOWA 2HISA 3MUY1 3WDIA 2G3NA 3THDA 2VRQA 1UZ1A 3U7BA 3SIMA 4HP5A 1AQMA 4D6FA 3GH4A 3SCWA 3N17A 2VJXA 1UHVA 5GPRA 1G94A 1ZB5A 3KZSA 4CU8A 5ECUA 2J7GA 1GUVA 3N18A 1PZ2A 1JNEA 3RJXA 1CWYA 3CUGA 1B31A 5JIWA 2J77A 3AIQA 1NP2A 2GUYA 4XZWA 2WVVA 4AIOA 3CUFA 3PTQA 4W87A 1B3YA 1UD3A 4QCFA 4JKMA 4UNIA 4TXEA 2BVTA 1BF2A 2V5DA 3AYSA 3U5UA 1L0PA 1UKQA 2XM1A 4M1RA 4MPKA 3CHEA 1OM0A 1IV8A 5A6SA 1WDQA 3PN8A 2IXUA 1DTUA 4QAWA 5EMYA 4UR9A 2WHLA 2VQTA 3EDEA 4BA0A 2BV9A 1JYVA 4UZSA 3AHVA 4D1IA 2BVDA 2GK1A 3A47A 3CHDA 4BF7A 4M24A 4CCCA 3BAYA 2GSJA 2OSWA 5I2UA 2YL5A 1TG7A 1C93A 2BY1A 3EMQA 1E0WA 3UG5A 4KRTA 4D6HA 2A3HA 1LQ0A 3L4UA 4GI8A 4M29A 2VQUA 1UKPA 3QOKA 3WF0A 2XWEA 1A3HA 5E0CA 3CZ8A 1QNPA 2WSKA 5E70A 1WP6A 2E40A 5FKYA 4Z2IA 1PX3A 2J7CA 4PMUA 4V2XA 2X2YA 1A47A 1HJQA 3VPLA 2WW5A 1LG2A 3T09A 1H1NA 1DEDA 2WC4A 5EFDA 3WF3A 4AD3A 3VGDA 3AJ7A 3CZKA 3EMZA 2BVYA 1GQLA 5FL0A 4ZXOA 4AW7A 1MQQA 2O9RA 2OWWA 1HVQA 1C90A 3VD5A 2WMJA 3UERA 2EXOA 5CSUA 1SR0A 3WMBA 3POCA 1JF6A 3WF4A 2EPLX 3N12A 1C8YA 4H8VA 3CPUA 3VU2A 4ZE4A 4ZFMA 1KCKA 4CKQA 1B3XA 1LG1A 3ZR5A 1UA7A 3K8MA 3SUWA 1C92A 2V38A 4W5ZA 3WL0A 4S3JA 3QHOA 4AC1X 4ATLA 2BY2A 1TA3B 4HPGA 3CTTA 4CVUA 5CLTA 1KGXA 5CQ1A 3WFLA 4URIA 3EDDA 4MB1A 4HZ7A 2YLAA 4JFSA 4ACYA 1CGWA 1PAMA 2X8RA 4GI9A 3FW6A 2PB1A 1M7XA 3VX0A 1JDCA 1JAEA 5CLWA 4CVWA 3AFBA 2FDMA 5CPQA 1W9UA 3NJ3A 5ABGA 4DWSC 4JCLA 4DUWA 1FFQA 4PMRA 1TCMA 1KWGA 1MWOA 2XVGA 3SUTA 2OYLA 2E9LA 1EO5A 2XGIA 2EQDA 5GNXA 3SCNA 1I1XA 1QI2A 1ISXA 5C70A 3BLKA 4HTYA 4IM4A 1E1EA 2DH2A 1VEMA 1W9VA 5JBFA 3DYMA 3K8KA 3BCFA 3AIEA 1J0IA 4PYSA 4A3YA 1XGZA 1GHRA 1P6WA 3O9NA 3K4DA 2BHZA 1GOOA 3SUSA 4U31A 2Z1SA 2ZWZA 4YPJA 3AIVA 4ML4A 3RILA 2ZICA 1KXTA 5GNYA 3MUZ1 2Y8VA 4CN1A 5LYRA 2B31A 3WEMA 1ODUA 2NSXA 1E73M 4Z2LA 1E70M 2Y5EA 3IANA 5DF0A 1JZ8A 1XH1A 3QR3A 3SEPA 1K6AA 3PZNA 4HA3A 1F4AA 1FH9A 1E15A 3SCQA 1K9EA 4JFWA 3WY1A 1JNDA 1V6XA 4E4PA 2PC8A 1HP5A 4JHOA 5A6LA 2J4GA 2NT0A 2XG9A 2OWCA 2VUYA 4UFLA 3QHMA 3VIOA 1ITCA 2WLYA 4D71A 1FOBA 3RO8A 1JZ3A 3AI0A 3UEQA 3T2QA 1V6YA 3VD3A 3G6LA 2F61A 1MW1A 2VCBA 3WBEA 1JAKA 4UQEA 1TR1A 1C8QA 4UFHA 5F7UA 3GNOA 5I78A 4NRSA 3D3AA 1WE5A 1V6UA 5C71A 3GH5A 4ZE5A 1FH7A 4HOZA 5IHSA 4UFIA 3AQUA 3OGSA 4PTXA 5HBFA 4BQ3A 3W6MA 2D20A 2WCGA 2VZOA 3PZQA 3K1DA 3CUIA 3GZAA 3QOMA 2W5FA 4PMXA 2XVPA 2CHNA 2XFYA 4W88A 1E6XM 2XSBA 3AZRA 2CNCA 3NDZA 1RP8A 3ARPA 4Z2KA 2ZX7A 1GOIA 2V3GA 2VCCA 1HJVA 4OOZA 3BLPX 1V6VA 1GONA 1E4IA 1GNXA 4WK9A 3FHQA 1OSEA 2XYLA 2CEQA 3OZPA 3UR8A 5CGMA 1E9LA 5I3DA 4ZENA 2ZX9A 4LXFA 3ZQ9A 2VURA 4OIFA 5A8OA 4JL1A 1JDDA 3AIBA 2QF8A 5TD4A 1V3JA 4U5KA 4HZ8A 3NCOA 1JZ4A 7TAAA 1VBRA 1UYQA 3NIYA 5M03A 1KCLA 2QMJA 4UOJA 3VIIA 3AS3A 3WD3A 1FA2A 1J9YA 2WLZA 2XUCA 4UZUA 5FL1A 3WNLA 4J7RA 1DWIM 1UQYA 1CGUA 1OWQA 2E0PA 3GTNA 3GBDA 4C7FA 5KZ6A 3VX1A 1LLOA 3MKKA 2X09A 1H3GA 2WC3A 4MDOA 2MANA 1BPLB 2VC9A 4WJXA 3VUPA 4OBRA 4AZIA 2WZIA 3VIGA 1VAHA 4W8LA 2D23A 3OLIA 2E3ZA 1XYZA 1J18A 1LWJA 1JDAA 1HKMA 4E2OA 5A94A 5I0DA 1Q6DA 3BMWA 3BSHA 4F9JA 5AY7A 3PTMA 3T2OA 2GJXB 3J7HA 1I1WA 1TVNA 4B9ZA 1H2JA 1TVPA 5E6ZA 2ZXDA 4MNMA 1MXDA 3FAXA 2GJRA 2W4XA 4CD4A 5KEZA 4FK9A 1NH6A 4JCMA 2XSAA 1UWUA 2WMHA 2J62A 2F8QA 5JBEA 2J7FA 2D3LA 1DWHM 3VGHA 2WNWA 4U2ZA 2EPKX 5A2BA 4E8CA 1MW3A 1BLIA 4OJYA 1FFRA 3K46A 4KMQA 4KGLA 1OBAA 1QHPA 3GYCA 1ZBVA 4NI3A 2XM2A 2O9TA 1GOKA 3LMYA 4ACZB 2WHJA 2ZUNA 2J75A 2E4TA 2NW0A 1SYTA 4P8XA 3VGFA 1B90A 1M03A 3ARYA 4CN6A 1HJWA 1OT2A 1TMQA 1UD2A 3KL5A 3WUFA 1DHKA 1OIFA 3GBEA 3APGA 3N11A 5CJ5A 1QNOA 3CBWA 1V0KA 1JZ7A 1JI1A 3EBVA 2VVNA 2YBUA 1J0KA 2AAAA 5I23A 1QOXA 2YDRA 4AD0A 4UQDA 3N13A 4DWSA 1GJUA 2XPKA 3AS2A 3CMJA 3RJYA 2D3NA 4Z2GA 3W26A 2F2HA 5ABFA 3MV11 1FH8A 3FY1A 1W9BM 2DEPA 3EYPA 1O6IA 1U33A 1HXJA 4H7VA 2CERA 1VEOA 4MNLA 3RIKA 3AROA 1ZU8A 3VGGA 2OWXA 1CXKA 4QP0A 4QCEA 2VL4A 2OYMA 4TUFA 1B1YA 1W32A 1EHNA 4W93A 1TA3A 3WDQA 3UR7A 3ARWA 2JEPA 4LX4A 2J7DA 4Q7NA 1KXVA 5A6BD 2CBVA 1H5VA 2E8ZA 1E3XA 3SUUA 5DEZA 1D3CA 5IFTA 3NSMA 5HPOA 2D0GA 3WDPP 1LL4A 1WO2A 2OYKA 2WZHA 1CXIA 2VZSA 5IDIA 2WKLA 1US2A 1JGIA 3OBAA 5A69A 3NUKA 4JFVA 5DT7A 1W9XA 2DH3A 2WB5A 4W84A 1XCXA 1PIGA 1GVYA 3KEHA 2CCRA 1E1FA 3AMGA 3VIMA 5GNZA 1QI3A 1W1VA 1NM9A 3WQ6A 1JD7A 2XIIA 3IAPA 3SCSA 1HKJA 3W0KA 1Q4NX 2BFGA 3LPOA 3WNKA 1CPUA 2QV4A 2JIWA 3OGRA 1CNVA 1W3JA 1PJ9A 1MXGA 2VZVA 1MQRA 4RE2A 1XRVA 1Q6CA 1BFNA 2J74A 2JF7A 4B9YA 1UUQA 4X0VA 3CZEA 4AIEA 1E43A 1UWSA 2XVLA 3PTKA 1KBBA 1EGZA 2WMGA 4EK7A 3K4AA 2DSZA 2WKGA 4AZCB 1CECA 2CETA 1YHTA 4IUGA 3ZMRA 5BCAA 3B9EA 1UH3A 6A3HA 1M53A 1E0XA 1XHGA 2ZX5A 1ZBCA 2XHYA 3VD7A 1BYAA 1WNOA 4R5EA 5A2AA 4UQBA 2CBIA 2PBGA 2VRKA 3MV01 4M80A 1JF5A 1CLXA 3TTOA 4J3TA 1VFOA 3GNRA 1B2YA 2C8NA 1JYXA 1RD6A 4TOQA 2UY2A 1ZS2A 2D1ZA 1IZKA 1OIMA 1CXEA 2TAAA 1U2YA 3WD1A 4JIEA 4P7QA 3VNZA 5LA0A 1H11A 4CUCA 3SCPA 2YA1A 3T0DA 3S6TA 1KR1A 4CCDA 5A8MA 3CZGA 3SCRA 4D6DA 1MW0A 2DSVA 1EQPA 1B3ZA 3WQVA 1JIBA 1VIWA 4CGTA 1WZAA 3N1AA 3F5LA 3VDAA 4MDPA 1JL8A 8CGTA 3MMUA 4AD1A 2DT3A 1OT1A 1GCYA 2D24A 4ACZA 1X6NA 3WN6A 1WPCA 2YA0A 3ZJ6A 2VI0A 1JD9A 3KWXA 4DUVA 2WHKA 1JXKA 3TTSA 4XV0A 1VFUA 3L4ZA 2DSWA 3TOPA 3FHAA 3T0AA 2WMIA 3O2LA 1C91A 3VD9A 3W29A 3AHXA 4HPHA 3OB8A 1ZBKA 4UOQA 1UR1A 2YKKA 4HA4A 3VKKA 1QPKA 1NWUA 3BCDA 5HDRA 4AZ7A 1Q6FA 2HVMA 4BZYA 2J79A 1E5JA 4V28A 4UOZA 3IJ7A 4UQ9A 4YHEA 2VO5A 4EAMA 5HOSA 1UD8A 1W2VA 4HA1A 1XCWA
chains in the Genus database with same CATH superfamily
2X7VA 4KEMA 1UA3A 4Y9NA 3LTSA 3GIYA 4K1GA 1VS1A 1FXQA 2QKFA 4FI4A 2QPUA 3SRDA 1I6NA 3V7PA 9CGTA 1MEWA 4H01A 1GQJA 4LBRA 1UQZA 1V03A 1DQUA 3GR8A 3OG3A 5I07A 4C6NA 2PTDA 4YXGA 4U5IA 1V02E 3C86A 2GUUA 1C7SA 3ALGA 4MZ8A 1NTHA 1PWMA 2VEFA 1CGTA 3SCOA 2JGQA 3BLLA 5FF0A 2Y7GA 2Q6ZA 3DFOA 5LNVA 1P7TA 1GVEA 1AMYA 2FGLA 4PB5A 4UCFA 5BXTA 3MHFA 4HN8A 4O54A 3CHFA 1DP0A 2BGQA 1N8IA 4KERA 1E4MM 2YCLB 1R9ZA 4O10A 3B8SA 1KBJA 4PUJA 3WLIA 3GNDA 4H9UA 4B15A 4L5ZA 3C4UA 1OFQA 1KRCC 4Z0SA 4KWUA 5CG0A 4Q22A 4JL2A 3GXIA 3AMCA 1YQ2A 2I5IA 2J25A 2CBUA 5TBOA 2G4JA 4DI8A 3WLOA 1NOUA 2D2JA 3WK1A 3PPHA 4XISA 3PZOA 1YXCA 1LM1A 3BARA 1EJWC 4DPPA 4LAOA 1IEVA 2V69A 1CENA 5EMJA 3XIMA 4FOJA 1VF8A 3VM5A 5EFFA 1ONEA 3SJNA 1E9IA 1DWFM 2Z27A 5MF5A 1BAGA 1CIUA 4CQAA 2HDJA 1DE5A 2J7HA 5LXXA 3KTXA 1NWSA 1XIGA 4EPDC 3A6OA 1LBMA 3OVRA 1U83A 4E2DA 1XUUA 3DFPA 3B8IA 5FSDC 1X7IA 4GO8A 2PSNA 5LA2A 1KB3A 3PJTA 1FWSA 1C29A 4XAGA 5EU9A 1V4YA 2A3LA 1QW9A 2CW6A 4B3ZA 2BHUA 4IPJA 3AC0A 4W8BA 4FP1A 1KGWA 4PL1A 2R1LA 2VHLA 2DUXA 2HTMA 3FS2A 3RLHA 3CHCA 4JTQA 1Y7VA 2E8YA 3FV9A 1EB3A 3Q4DA 1DIKA 1RZMA 3W72A 2PDQA 1A5NC 1XKYA 3M07A 2OOFA 1RPXA 5HR6A 1YPFA 2YJQA 4KCWA 3PWIA 3GQYA 1SO6A 1HGWA 4Z08A 2ZDSA 1BSIA 3WLNA 1S2UA 2J66A 2DIKA 2CZFA 1KFEA 3EWDA 4L6HA 5FJIA 3EDJA 5LIUX 2PDCA 2YLLA 3QKZA 1MEHA 3ABQA 2YYUA 4BR1A 2C18A 3F4NA 3FYPA 4X9SA 4TIMA 1DJWA 2HPIA 4BWLC 5CPSA 3EGJA 4W89A 4WSJA 4AWUA 4N7QA 3EA3A 1DL3A 3VKJA 1LJYA 2GGEA 3GVQA 4C1LA 3O6AA 1MO0A 5JIPA 5J5RA 4DM1A 1ICPA 4IZGA 3T0BA 4LUTB 4NILA 3W2NA 5E6YA 3LHTA 2PRMA 3A3XA 2QCDA 1SJDA 3PNZA 1HKIA 3CWNA 4PMOA 3RLVA 3KL0A 3DCPA 1JYWA 5HMSA 1LROA 4DZAA 2VD9A 5D02A 1E6ZA 3GM8A 4HMEA 4O1FA 1WXYA 3NL6A 3LRMA 4RW3A 2A3EA 2WZMA 4Q8PA 3RRAA 3W22A 3AHTA 4GKLA 1KFWA 4JGDA 3U48A 3BG3A 2GJLA 1QPQA 1QR7A 2DZAA 2Q02A 4IISA 1BG4A 1Z32X 4GNJA 4AX7A 4TX6A 1GQIA 1ZP3A 1EP3A 2NX9A 3T2PA 1HTIA 3M5ZA 4XSMA 2JKAA 3V16A 2PDKA 4MF4A 3WFAA 4JFUA 3G1SA 4NIRA 5G1YA 4EF8A 4MWAC 4GYPA 4S23A 2FB2A 3ZLHA 4MKVA 3PULA 1BKHA 2GZXA 3QTPA 1DWAM 2V63A 4GUFA 2CKSA 2ICSA 1OFAA 5AC6A 4PEEA 4Q8NA 4IL0A 2PD9A 2PWVA 4HNUA 4ZTXA 3SECA 4IMCA 2C19A 2WWDA 3DDMA 3GDLA 5TF0A 1RK5A 3RM4A 3I6EA 5A8NA 3AHZA 1Y65A 1ELSA 1TFVA 3W38A 1YADA 2X0YA 1OD0A 2OT1A 2NX1A 2FH8A 1H0IA 3UZXA 1H4PA 5IDZA 1DIOA 2GL5A 4F8XA 3AXKA 4O1CA 3H2EA 1WXJA 3BSGA 4YCPA 4GGBA 3NPVA 3W4RA 2QVHA 4Z1CA 4QJ3B 3VNDA 1NDVA 3WF2A 5HQEA 5FJRA 3NTYA 1W3HA 3GU9A 2PTXA 4MJZA 4POCA 4LAZA 5FJJA 2XJ7A 4KH2A 2V9DA 3V1PA 2TYSA 3MBFA 2B0MA 4NZCA 1AL7A 1K8YA 4YN5A 4O11A 1XM3A 2EPNA 7ODCA 1G7UA 3LXBA 1O5XA 3G1VA 5TIMA 1JPKA 3L5LA 3N25A 3SCUA 3PZGA 2AMGA 3CPRA 3MUIA 1DJNA 1TV2A 2NWSA 1JXJA 3WNPA 2JEQA 4U10A 1WYIA 4R85A 3KCOA 3KZPA 4QITA 3EPMA 4J1OA 3RDKA 5JBDA 2DT2A 2Z4GA 3DH7A 1LL6A 4LVAA 3ARUA 1QK2A 4EANA 5CAKA 1ZAJA 2WWCA 5E9AA 4B5TA 1GKQA 4ZB5A 1EEXA 1UR8A 1TV5A 3TN4A 2JF6A 3UR5A 2QXWA 5KZEA 4ZCWA 1XICA 1RA5A 5LIXX 4O0ZA 2AAMA 3AYRA 3MJMA 4JIIX 1DWGM 3NG3A 3HV8A 3KBSA 1LRQA 1D3GA 4M6UA 5CG7A 3AZTA 4B3KA 3LHWA 5D05A 1XLMA 1JFXA 3CHVA 4GVGA 4S3CA 1XWYA 4X0NA 3RLGA 4PBGA 1W3LA 4NX0A 1F3XA 2Z6JA 2XH7A 1BQCA 2XFWA 3PZ9A 2XVNA 1BGGA 4LY4A 4LYRA 4IIEA 2V2HA 2ZUUA 4GCXA 2GSEA 1RQHA 3RO6A 2BWGA 4R7OA 2QCLA 1F3EA 4N42A 3ARXA 4MWAB 1JCMP 2PDFA 1XYFA 3B4UA 1NELA 4O1AA 3NURA 4LUYA 4I8YA 4AQLA 3W7EA 3BGAA 3OIHA 4K3ZA 1H7NA 3I7SA 2I9UA 1AFSA 3MCNA 4DBDA 1M3UA 3G1DA 2G37A 2CZEA 2PF8A 3L0GA 3TVAA 1JJKA 1VCGA 2ONEA 4U3AA 3WJYA 3C3UA 1RPKA 1XD1A 3DFHA 3GU2A 2NXIA 4XZBA 4Q6XA 3IAQA 2NLIA 1XLKA 5HINA 2O9OA 4M7SA 2UY3A 1MW2A 3HU7A 5BXPA 4ZOAA 1ZLPA 4I9AA 3IJLA 1A53A 4HCDA 4EF9A 3WIJA 3NZPA 3I68A 4JOMA 1HIZA 2O56A 1TPFA 5DMYA 5I77A 2EEXA 4JDBA 5ABHA 2ISDA 4UMCA 4RNHA 3ONCA 1T99A 1E72M 4ES4A 2TODA 3UWEA 3W24A 1SO3A 4CEXC 2OODA 1R3WA 3A4AA 3BW4A 3OGVA 4A3QA 4M1BA 3TJ4A 2EPMX 1J6OA 4G9PA 4K6AA 5C54A 4HMNA 2WJFA 1QW8A 4MUPA 4DVOA 4PMYA 1CX9A 4J28A 4HZ6A 1PDZA 1MUMA 1TX2A 3KDNA 3BAWA 1GK8A 1WZLA 1Q2RA 4PMVA 4UFKA 4MM1A 3W7QA 5C9XA 4AX6A 3B8VA 4RE4A 4DEFA 3VKDA 4AY7A 4B92A 2ACQA 5C8BB 5G4EA 3WJXA 3FNDA 4FLQA 4DJDA 3TQVA 3S9ZA 1K02A 3QGKC 1SZRA 3SW6A 1G69A 5A95A 1UWAA 3AISA 4E5TA 3F4CA 1KFLA 3LS9A 1XLAA 4L1WA 4A21A 2FZMA 4DUXA 1OFRA 3S5ZA 1WOBA 1XV8A 2ZC1A 3S1WA 1GYNA 3OTRA 4J3XA 2NV1A 3SGUA 5DBTA 4HYRA 1CCWB 3DI0A 3RMEA 3NM1A 1XIIA 3W2JA 2XZ7A 3P62A 1LQ2A 2Y62A 3BAJA 3ZVHA 1SR9A 3SCVA 1HX0A 4M5PA 3MP3A 2EAWA 4GBUA 1EWDA 3WNMA 3S5NA 3JVAA 2W61A 1V8EA 3QV6A 3TONA 1KTNA 3PHAA 1X39A 1CB2A 1WDDA 1VBUA 4H4IA 1NOFA 4PE8A 1VRDA 3ALFA 3WBAA 3W1UA 1TWSA 5XIAA 1UUMA 3R0UA 2Z1BA 5AC4A 3ITLA 3HQ1A 4WKHA 2WSRA 5HPCA 2UWFA 3FA4A 4R7JA 4B16A 4YTSA 2RGMA 1ME7A 4PTNA 3M6DA 3UWQA 5H8MA 2Z1KA 5FAGA 1W9DM 1FWTA 3CGTA 1EX5A 4QDPA 3TU9A 4QQ3A 1V5XA 3I3EA 1FDJA 4HSHA 4PA8A 2PP0A 3FA3A 4MGGA 3BVJA 1PV8A 3TYAA 1TZZA 5U4NA 3CLWA 3AMKA 2RDXA 1JGMA 1W5NA 2D0HA 3L4VA 5JVLA 2H9AB 2A1YA 4M82A 1F8IA 1LF1A 2CPUA 2XIOA 1ZP4A 1CZ1A 1ZJBA 1I2OA 2WVSA 1HO4A 1HT6A 3JU2A 3H22A 1VBGA 1EIXA 1MQPA 3BJSA 3EWYA 1UWTA 2ZXAA 4P7LA 2A3AA 4GQQA 1QBAA 5HWJA 3RCMA 5DRIA 4AD5A 2TRSA 3SFWA 4S3FA 4LVFA 1C3FA 3WBXA 4O1EA 5HULA 2NSOA 3N29A 1T8QA 4B5NA 4HU4A 3KL3A 3W7PA 3THQA 2OZ3A 4FLRA 4UTLA 4L7ZA 4X22A 1QOQA 3F2CA 3R4IA 4U2YA 5EY5A 3S2MA 4CNNA 3G1RA 1VENA 4DQWA 2DSKA 3LPFA 3TNBA 4QHRA 3NYDA 3CQKA 2P3EA 3WMLA 1KXQA 5FF2A 3U8GA 1R85A 2Y7DA 1XC4A 3KRUA 3IIOA 3BC9A 4EP8C 4GX8A 3BG9A 1Y5VA 5BXRA 3RM9A 2OLAA 6ENLA 1XJBA 5A1AA 2A7NA 1ENUA 3PPCA 2ZZ7A 1WUFA 3TH6A 4MKSA 2X1TA 4TO8A 4IFKA 4V33A 5CPTA 5FEZA 1X96A 3M0KA 5CZKA 4LAUA 3ID7A 4L4MA 2ZDRA 1UR3M 5AC5A 3MS8A 1P4CA 3LPPA 5FF7A 5CGQA 2VR5A 1I60A 3LI0A 3WUEA 3PBYA 3PBVA 4XKYB 2QLYA 3WDRA 3OODA 4HK7A 4FNSA 3IPWA 5CPLA 5U7SA 4AEOA 3MA8A 2R1NA 2OG9A 4HMCA 4JTHA 2CBJA 1XINA 3RK8A 1F4HA 4HK5A 5FCZA 3BTNA 1K8XA 2VD8A 1A0EA 1J5TA 4X60A 4I7WA 1TE1A 4DJFC 3VIJA 4S2CA 5BMWA 2R91A 3SADA 4GZEA 1CEOA 2WPGA 4IGNA 5DFAA 4PTMA 1UR0A 2ZXBA 3WFZA 3G18A 2PURA 5HAOA 5CBJA 1BYCA 3NGJA 1GVQA 3BWWA 1OC6A 1GEQA 1Z8AA 3TYZA 4GA8A 4C6JA 3ITTA 1QTWA 2HE5A 3MUY1 3WDIA 3THDA 1UZ1A 4WCJA 4HP5A 3Q94A 4D6FA 4GK8A 4XD6A 3SCWA 3QV9A 2OFJA 3N17A 2C1IA 3QSRA 1GUVA 2AQOA 4C6FA 1PZ2A 4ZO6A 3DKLA 3IJIA 2C91A 3DHDA 1CWYA 3D3FA 5JIWA 4LAKA 2C3ZA 3CUFA 5ENLA 3UU0A 4JKMA 4UNIA 3CT7A 1TVLA 3U5UA 1L0PA 4LCRA 1EF2A 4XK2A 4GH1A 1EZWA 2H90A 3W23A 2QV5A 4XVDA 1DTUA 3EXTA 3M7WA 4UR9A 5EMYA 4DAIA 4A22A 2RJGA 1JYVA 3E5BA 1PE1A 4M6PA 4BF7A 3HQOA 2ZKMX 1MZHA 3MY9A 1V6TA 3REQB 1JDEA 2YL5A 3N3MA 1C93A 1E0WA 4NX5A 2A3HA 1GTHA 1LQ0A 3L4UA 1SU5A 1XUZA 2KAUC 3QOKA 2XWEA 1LOQA 3KRZA 4GIRA 1A3HA 5KTLA 4O19A 5E0CA 3VC5A 4JHMA 1GPWA 3CZ8A 2WSKA 5E70A 1WP6A 2E77A 2HJPA 3GHUA 2F6UA 4PMUA 3RX2A 1DTNA 1H1NA 3VOGA 1SO5A 1XLGA 3AJ7A 3EMZA 4UXDA 1GQLA 1BF6A 1MQQA 4FR1A 5CAHA 2OWWA 3VD5A 2B7PA 2Z2AA 3P8JA 4GZ7A 5CSUA 4L56A 1SR0A 1VPXA 3H2AA 4A2RA 4ZQRA 4EPBC 5E9XA 2YPIA 1B3XA 2NUYA 4HSOA 3RF9A 4EXQA 4XZLX 3SUWA 4AY8A 1Q4WA 4W5ZA 1K7EA 2BY2A 3RUBL 3EZ4A 1TA3B 4KWSA 1OYBA 4MLJA 4LW7A 1TMLA 4CVUA 4URIA 3QKEA 4G56A 3EDDA 3UCDA 5I3HA 4GC4A 5C9ZA 4ZODA 3NA8A 1PAMA 1QPNA 2X8RA 3SBFA 3UZJA 1ADSA 3FW6A 3TN5A 3T7VA 3APTA 2FDMA 4I8DA 1V77A 1W9UA 6PTDA 2F38A 5KMYA 4GQBA 4DUWA 1JRCA 1MWOA 3TYEA 4F0HA 4O4WA 1TV3A 2Z2BA 2E9LA 3DFYA 3GZ3A 1VQTA 1I1XA 1JPDX 5C70A 5D33A 3LZ3A 4PZVA 4X2PA 1W9VA 4Q4MA 5HR7A 4GIEA 2DJLA 3HQPA 4Q4QA 3FEQA 3D6NA 4PYSA 4A3YA 1ZJIA 1X38A 3K4DA 1FY6A 3SUSA 1VFLA 2Z25A 4U31A 2Z1SA 4YPJA 4IMDA 4ML4A 1KXTA 3Q67A 3PS7A 4BHYA 1H7PA 2ZRUA 1ZGDA 4MWAE 2B31A 4RNFA 3SRFA 5C6MA 3DXIA 1AZ2A 4L80A 4K39A 4UWMA 3SGZA 3NPWA 4I7VA 3PZNA 1ONXA 1E15A 4NAEA 5C55A 1K9EA 4JFWA 2QR6A 4JHOA 3B8DA 2XG9A 2NT0A 2OWCA 2VUYA 1S2WA 3QHMA 1VHNA 4IGSA 1ITCA 2WLYA 3RO8A 1V6YA 3VD3A 1KO0A 4Z42C 2GGHA 2F61A 1Q8AA 4UQEA 2FFCA 2G5WA 4NRSA 3ZWTA 1MUCA 3ABZA 4HOZA 5IHSA 3CYVA 4IPIA 2YBVA 3AQUA 5EYWA 1RXOB 4BQ3A 2VFEA 2VZOA 3K1DA 3CUIA 1SW0A 2XVPA 2CHNA 3M9YA 4W88A 2CLFA 3B0YA 3W1NA 2VC5A 4C6DA 4LYKA 4Z2KA 2ZX7A 2ACUA 2V3GA 4OOZA 1V6VA 1GONA 1SVDA 1E4IA 4CNTA 2BB0A 5J04A 4JTAA 2QCNA 1A5CA 4LS0A 1OSEA 4GLEA 4ZENA 1RJPA 2ZX9A 1IGWA 4XVEA 1EYWA 2QF8A 1QFEA 4IIHA 4Z1BA 3TC6A 1VBRA 1UYQA 3NIYA 5M03A 4UOJA 3B4YA 3VIIA 3SSZA 3AS3A 1FA2A 3RX4A 1RBOB 4X63A 1VC4A 1DWIM 1UQYA 2E0PA 1T96A 4YLWA 4IXHA 2EKCA 3TQPA 5KZ6A 5ABTA 3CIWA 4P5UA 3PG8A 1H3GA 3U4FA 5FEWA 2WC3A 3LHUA 1U5HA 2VGBA 2ZRWA 4JY9A 3UW6A 3N34A 5FEPA 3VUPA 1W3IA 4K7VA 2WZIA 2J88A 1YPIA 1VAHA 2NV2A 3NVDA 1BQGA 2ZRYA 2E3ZA 7PTDA 3MCOA 3P3BA 4F9JA 2IW0A 4C6MA 2GJXB 2PDXA 1TSIA 1CLKA 2FJKA 5BOOA 1H2JA 3UZWA 4E3TA 3HPZA 4WOZA 3EKLA 4MNMA 3G1YA 4HBKA 1MXDA 1KCZA 3FAXA 3MPGA 5H8UA 4HGXA 1GYLA 1XP3A 2W4XA 5MKGA 3N2CA 5KEZA 4DO5A 3VK5A 2BOEX 3F4WA 1QPRA 3ZVIA 2D3LA 1TV4A 3VOIA 1DWHM 5EMMA 3LU2A 4U2ZA 4KBXA 2EPKX 3TKFA 1MW3A 3G1XA 2X16A 1BLIA 3H54A 1CT5A 4YTUA 2GQ8A 2NVCA 4KMQA 1QHPA 4JTCA 4O13A 5JH2A 4E4FA 2E4TA 4IF2A 1S2VA 1B90A 1M03A 5EMKA 1HJWA 3LTPA 1UD2A 3ABSA 1TJPA 3N11A 5C7HA 4XAZA 1QNOA 5CJ5A 3CBWA 1V0KA 5DN1A 2YB1A 2PDGA 1JZ7A 3EBVA 3MKVA 4F4RA 2ZZ4A 5I23A 1QOXA 2ON3A 3W1AA 1EBHA 1A49A 5LZLA 3WQPA 1KCXA 2F2HA 1GVFA 1FH8A 4PUKA 1W9BM 1W17A 1L9WA 4WJEA 3CB8A 1LTDA 3S5YA 1HXJA 2CERA 4LOCA 3UGRA 4MNLA 3RIKA 4JS3A 3AROA 1L6YA 4PULA 4KEVA 1CXKA 4L61A 4YS1A 1TWDA 1B1YA 1W32A 4A3UA 3U9IA 1UZHA 3UR7A 4R9XA 1UUOA 5A6BD 2E8ZA 1H5VA 3SUUA 5E1QA 1TJ2A 3LQLA 4JNZA 1XLCA 1P0EA 4GI4A 3BZJA 1YDNA 3QEZA 3TSBA 2OYKA 2WZHA 4DO7A 2JBMA 1G67A 4ZB0A 4LF2A 1TX0A 3PUEA 1JGIA 5HJYA 3NUKA 3VCCA 1W9XA 3PJWA 2WB5A 1PIGA 3KEHA 4XO6A 1R5YA 5BOEA 1PVNA 4O52A 4U4MA 4NY2A 1QI3A 4B2DA 3URAA 3IAPA 3SCSA 1Q4NX 3PPGA 3LPOA 5K4XA 4H8NA 5CZJA 1EA0A 2QV4A 2JIWA 3OGRA 1O95A 2I5QA 3FOKA 1HG3A 2Q8LA 1PJ9A 1MQRA 2IKHA 4RE2A 4C1KA 5EKYA 4B9YA 3CZEA 3QW3A 1UWSA 1GG1A 1R3TA 1KBBA 2WMGA 3RPDA 1XIBA 3PAOA 1F5ZA 3C2OA 3KOXA 1YHTA 4IUGA 2Z28A 4A6GA 4QM1A 1KM1A 5DBUA 3N9SA 3B9EA 1NFGA 3S46A 1E0XA 1XHGA 4IFOA 3VD7A 1BYAA 1WNOA 3GXPA 2NVDA 2CBIA 1AQFA 1YE6A 4M80A 1U1JA 1NDWA 1RVKA 2PDBA 3UNDA 3M0HA 4HNOA 4RUBA 4EAYA 4V15A 1Q3NA 1QO2A 3VZYA 3GWQA 4TOQA 4PBEA 2UY2A 1ZS2A 1YW1A 4GY7A 1CXEA 4NG3A 1OF8A 2TAAA 3WD1A 4JIEA 5LA0A 3FGCA 2DUAA 1ITQA 2XZ9A 4HU3A 3T0DA 3S6TA 1KR1A 1DIDA 3PP7A 3B8UA 4D6DA 1MW0A 1DJGA 2VWTA 2WNZA 1I4NA 1YNYA 1WZAA 1B57A 3EXSA 5I3IA 3TROA 1YBQA 1VGAA 1PXGA 2BBFA 1JL8A 4Q8QA 4P2VA 3W7HA 4ACZA 1X6NA 1H7WA 2A4AA 3PJUA 4LUSA 1WPCA 2YA0A 3GFYA 1JD9A 4F0LA 1AH3A 3TTSA 3AO0A 1F61A 2CLOA 4L4LA 3CMFA 4B5SA 1RY8A 2WMIA 3O2LA 2GDQA 1IT7A 3AHXA 3BQ6A 4WRHA 3EB4A 3OB8A 5HUOA 3QJAA 1ME8A 3A9IA 1KBIA 4UOQA 2H3BA 1RUSA 4HA4A 3G0SA 2ZE3A 1NWUA 5K9CA 2HVMA 1G7VA 2J79A 1TELA 3U4AA 3CIXA 4YHEA 4S3BA 1XBZA 4HA1A 4I9JA 2H9AA 3PY2A 2FFIA 3FLUA 3I7RA 3HJEA 4H6QA 4OOUA 1QPOA 3DG3A 1KWKA 3NL2A 1CXLA 4PMDA 2VENA 3TW9A 1EA9C 4JYFA 5KSWA 3LK6A 1EC8A 1G6CA 1TJRA 4J5NA 3O6CA 1E4LA 3LHZA 3GO2A 2Z26A 1R7OA 2ZUWA 3OA5A 1B3WA 5HATA 4XAPA 1JUKA 1UWRA 3S2JA 1DQWA 3CH0A 1ZCOA 4M3PA 4C6KA 5AYYA 1VD6A 3P0WA 4HPJA 2Y63A 2G8ZA 1B30A 4K1WA 5A6JA 3IUIA 1RBAA 4FB7A 4ZEPA 3UYCA 4PSPA 1PUDA 3I4EA 1QXLA 4I5RA 3UWYA 2WCAA 2D2OA 3IV8A 2QNEA 4DY1A 2QCGA 3KOWA 3QLLA 5EBAA 3I6TA 4FX8A 3P80A 4PTWA 5FIPA 3SY5A 4M7TA 3OLEA 4AVNA 4Z1AA 3W27A 3FYYA 2PGEA 1GW1A 3IRDA 3SQSA 1H5YA 3K4WA 4HYWA 2X05A 1BVNP 2IS7A 5CZSA 1WKDA 1OVDA 4D6JA 3W01A 3P6LA 1MXSA 3TK7A 2W63A 3VOHA 4R27A 3C2YA 1RR2A 5BRPA 3NQ6A 1OCQA 5M5DA 1UP0A 4IQLA 4H2CA 5G2IA 5M3WA 1J10A 3P67A 3S42A 3W86A 3BMVA 1UH2A 4OUEA 1QASA 2VEGA 2GK1B 1S46A 3KLLA 4CQ9A 2CKRA 4OTKA 2J9YA 1JYNA 3PFMA 4H6RA 2AL1A 3D5HA 3EWWA 3HFTA 3GRIA 1WOAA 1MVYA 4UR7A 2WQPA 4O18A 2P0IA 4DO6A 3W28A 4F40A 3AIRA 2CWNA 3TC7A 3FVMA 4BK9A 5KINA 3WQOA 4LVGA 1PKNA 2J9ZA 2YL6A 2V5LA 4LUJA 4FXSA 1Q6EA 4J3UA 1MRAA 3CQHA 3NL5A 4PUDA 1AL8A 4D6CA 4MFEA 4C5ZA 2C7FA 2JE8A 1ZBWA 3U3HA 3W25A 4Q8TA 1GEHA 1JQXA 2WM1A 3CMGA 1C9WA 3TJLA 3HB9A 1RP9A 4MY1A 5AN7A 3H4GA 1DJYA 3P14A 3O63A 3HPXA 3LPGA 3FAWA 2NVAA 4Q4KA 5LIWX 2HPMA 1KM3A 4RZ4A 4AHOA 4ERGA 4PMZA 1Z42A 3WLQA 3H8AA 2A21A 5A8QA 5FOOA 2QMKA 4Y9PA 2WC7A 1PEZA 5I3KA 3QPYA 1EQCA 3W7IA 4S3KA 1L6WA 4QE5A 3LHVA 2V3EA 4GXPA 5FI8A 3R12A 5LNWA 3QHNA 1UR9A 3DYPA 1V0LA 3N4AA 2V8ZA 4UTFA 3KBVA 2G4FA 5LXEA 3MB9A 4QAIA 4O4VA 4H7CA 5DMMA 5H6HA 4Y9MA 5EL1A 2PAJA 1VFHA 3UY7A 2GOUA 2ISSA 3PJXA 5LIKX 1OC5A 4KRZA 4W4QA 4WXZA 3JZUA 3R0KA 1G4SA 5I7GA 1XC6A 4PCSA 4JNYA 3FN9A 4O0KA 4JAWA 1QNRA 2CESA 1JCYA 3GXFA 4UCGA 1QI0A 3ZSTA 3FGCB 4B5UA 4DXKA 3LM3A 3PZMA 4H19A 1LT7A 1EUNA 2F6XA 4L9YA 3ABXA 2I16A 2PP1A 3F4VA 4TV6A 4PCTA 3EDFA 5F4WA 3MMWA 2Q09A 1N82A 4DWSB 2DPEA 3UVAA 2X0SA 3AJXA 3AYTA 2HBVA 2P3ZA 3ZFHA 1E6QM 3UP8A 3LCLA 1GZGA 4HK6A 3L5MA 2DT1A 4X61A 4EIVA 1OGBA 4ZSTA 3VFLA 4MWAA 1K8CA 4FOKA 3PB2A 5A2CA 1N2VA 3WDJA 4PFMA 3LYEA 1NWRA 1KD0A 1SFJA 4CD6A 1JFHA 1GYMA 4QG8A 3GSMA 3KTCA 1BVWA 4ECLA 2DQXA 3CNYA 3TAKA 1XH0A 2XIBA 4QFUA 3TNOA 1DJHA 3M5XA 2R24A 4H8HA 1DHPA 4B4HA 3MP5A 1TPB1 4OZOA 1FDYA 3ARTA 4WSKA 1XCFA 3NQVA 3AOFA 2DIEA 1FXPA 1KTCA 3QSTA 4UC5A 2Z1VA 3S8HA 2FKPA 1TTPA 1MNSA 3HG5A 3QN3A 5C2CA 2OELA 1H0GA 4B5VA 2DZTA 1FWCC 2VC7A 4W5UA 1EJ7L 1KQZA 2OSXA 1YDYA 4WEVX 4QE1A 3PFRA 4PTDA 3MHUA 5IBXA 1AQ0A 4AWTA 1PX4A 1I0DA 2QT3A 3PZIA 4HU0A 2NQ9A 4LF1A 1MRQA 3HMCA 3KX6A 3H23A 3GVVA 4UQCA 4K68A 1E0TA 2GDVA 4F0KA 2WZTA 2O55A 3W84A 4DYKA 4MTVA 4GNKB 2P0OA 1E6SM 4M6QA 4HNVA 1J93A 1H41A 3UWZA 3H12A 2GGJA 3E74A 1EGVA 4NAEB 3ECQA 4LT9A 4HHLA 4OU1A 1EOKA 1I2QA 3R43A 2WQDA 1AH0A 1ZL1A 2FPTA 4MKNA 3HO8A 2IPJA 3S6OA 1UG6A 4GABA 4JDYA 1YKWA 4FF5A 1LWHA 4A3HA 4CEUC 1US0A 2Y8KA 4ICMA 2G50A 1M7JA 3B9AA 6ALDA 1RCOB 1GVIA 3Q58A 1OY0A 4V1YA 3UWVA 3PZVA 1R86A 1GZ1A 4QROA 1F73A 4G7FA 1S2TA 3B0PA 5FJUA 2PA6A 3NZ1A 5F2LA 4EPKA 3MVTA 2O0TA 1VCFA 3IACA 1OB0A 2C1HA 3EDKA 2J78A 2ZYFA 3SFKA 4IHCA 2ZQ0A 1F05A 4I90A 3ZSSA 4GOAA 3WH8A 1SW3A 4QLJA 3WZ0E 1A3XA 1O68A 2ZVIA 4TTUA 1XLDA 3GG0A 4H04A 3TMQA 2YW3A 1P7TB 4IIDA 2BMBA 1JQVA 2PDNA 2E1WA 4HYVA 3BURA 2CLMA 2OPJA 1R6WA 2RHGA 3CXOA 4P8VA 5I3GA 2EKGA 3G0UA 2WAGA 1LQAA 4GINA 3RCYA 1OX5A 4PUEA 3HG4A 1EJVC 3CZLA 2QDEA 2ACRA 4RNJA 1TV7A 4MJ4A 2O9PA 4O50A 3F03K 1OK6A 2DZWA 4LC8A 1OG0A 4LY8A 3PVFA 1AD4A 4EE9A 2ZRXA 2WCSA 3BK0A 2RAGA 2Y24A 1FWEC 1RSCA 3ES8A 3BDKA 4KWVA 1OC7A 3GHTA 1KM0A 3U57A 1E9ZB 4JTLA 3G0XA 1PO9A 5AVNA 2ACSA 5LGXA 3CV7A 4QJ4B 5A6KA 3SAZA 4ZXLA 5D2TA 4MG4A 2DZPA 3GNXA 2FZ9A 3B03A 4YWSA 1OX4A 3AXHA 4M19A 3VIPA 3M0YA 3CUJA 1B3OA 4IX0A 4WGHA 3TTYA 1TPEA 1E1CA 4BQ2A 4MNJA 4ICCX 1TR9A 3NQBA 2NQJA 1VJIA 4HOXA 4A4AA 2BLEA 1CW2A 5HNTA 4GZJA 4LUIA 1LRNA 3BANA 4G6CA 3VOCA 3ITVA 2YDSA 3L2IA 4OUIA 1DPMA 3BXWA 4CN4A 3F1QA 4E8DA 3TR9A 3IJDA 4ZFCA 1W1A1 3KFTA 4JYDA 4Q7BA 2BGNE 4WX2A 4LS1A 4NRRA 1B0IA 1TE6A 3UZYA 3EOSA 3QQWA 3EWXA 3VMOA 2Z7GA 3UD6A 1MFVA 4GVHA 2ZA3A 4GYFA 4MAVA 3SIZA 4PN2A 3DN5A 7ENLA 1QWKA 4KF1A 1H63A 3W37A 4KT2A 3TTQA 2J8TA 2HMCA 1LUCB 1UP2A 3THCA 1QWGA 2WVVB 3G3MA 2QUMA 4ZBCA 2PE4A 2QZRA 1R2RA 1ZFJA 5BRQA 4FIQA 2YR1A 2DV0A 3AMLA 4N9DA 3VILA 2JALA 3NDYA 1UKSA 4ZTYA 3A3HA 1NARA 3HA1A 3HQNA 3Q45A 1HJUA 3PM6A 1MEIA 2Z0IA 3OYZA 1GQNA 2V30A 3W70A 1WX0A 1CLVA 4C7DA 2SFPA 3GNPA 3F2BA 4RCXA 3S9YA 5JXQA 5GJPA 4Z2JA 1HW6A 1QJWA 4RK8A 2FIQA 5G1MA 3E0IA 2GQ3A 3W6LA 3RITA 2YDAA 8A3HA 4OBSA 3SCTA 1EPVA 3P0XA 3TV8A 5HUPA 4TVCA 2XWDA 3GFZA 2FLIA 1XISA 4C60A 1D9EA 1NQ6A 1KFKA 1XLFA 2PODA 3RM8A 1KR0A 1E3ZA 4UTUA 3LLDA 2G3MA 3BLIA 3UXLA 1ZNNA 4JTDA 3M7SA 1NFBA 1X6LA 1IWBA 3B06A 1HL2A 3PBWA 1AJ0A 2DZVA 2WYSA 2X2GA 9XIAA 3WLHA 1E40A 5G4WA 3PUDA 2ANUA 3H2CA 3QC0A 1XDLA 2OU4A 1CGVA 4U3CA 3C0LA 3INPA 5D8ZA 2Q3OA 3POHA 4AMAA 4I3GA 1LBLA 4JTUA 4IPNB 2OQLA 1O5RA 3LV6A 1B3VA 3UT0A 1U22A 4FHAA 6TAAA 1KM6A 4IMFA 3V35A 3DENA 3UJRA 2E6YA 3VE9A 2VEIA 1UD5A 2VMFA 3PBMA 4M0XA 1HVXA 4DYEA 3TX9A 2WBKA 3KBWA 3WELA 1NSJA 3IVSA 3T9PA 2H6RA 1XIEA 3ZT5A 4N9BA 4O12A 2WKJA 3PBGA 4QSFA 5CKSA 1KGUA 2C79A 4QLKA 4X9YA 2FHBA 4OE7A 4N6FA 4JNMA 1VYPX 3SSJA 1Q45A 1V02A 1E5NA 4PCFA 5AC8A 1QI5A 1MFUA 1LZOA 1AK5A 4PUNA 1VPQA 4DWSD 1PBGA 4D6GA 5JH1A 4JTIA 1TQXA 1XBVA 2W67A 3QW4B 5A6BA 2IQ0A 2HQAA 2HCVA 2ZX6A 3FJLA 1J01A 5G1TA 3V75A 4P8WA 5BRBA 4HCLA 1P0KA 4AZ5A 3W1PA 4GG9A 4RE3A 3T44A 1D8CA 2FVMA 1BTMA 3VA8A 1EJSC 4XBSA 4AEEA 4UTTA 2YXGA 1OGSA 1YMYA 3QZ6A 4GY0A 4H9ZA 4M6VA 4D6EA 4QBXA 1SO4A 2YDQA 2BXZA 3E1F1 3LCFA 1B4EA 4LUTA 3NQ8A 4AYSA 3LY0A 5J5DA 2XN1A 3ZT6A 3GDBA 3M41A 1TPDA 1RV8A 1MDRA 5I02A 4I6KA 1UWIA 2CIPA 2ZZ6A 4AXNA 3ZM8A 3CO4A 2VZTA 1OQFA 4LWWA 1UKTA 2DORA 1FCBA 3GDKA 1TJ0A 2Y7FA 3GU1A 4AEFA 4P7RA 3CTLA 3WD4A 4RV3A 4PGLA 3MI6A 5AVHA 2GJXA 1XL9A 3UA3A 4AVOA 2I5GA 2OSYA 2AMXA 2HWGA 3DECA 3STGA 2HXUA 5LGZA 2VRJA 3NSXA 1ZALA 5D9OA 2FHCA 2QHAA 5D8WA 5A6TC 3WSUA 4HNCA 3UJSA 4O1BA 2UV8G 3WLLA 1H60A 3DAQA 3EOUA 3ZOAA 3VIFA 5FD0A 4QDMA 2FMOA 1R9YA 2LLEA 3M16A 1OCJA 3MZNA 1GJWA 3P5YA 3TIMA 2UBPC 1UD6A 5J8LA 2YGYA 2QCEA 4L4OA 2J24A 5IM51 4QGCA 5AHLA 4HOWA 2G3NA 3KVMA 4L9ZA 3ISIX 4ZO7A 3U7BA 3MI2A 4AFYA 1NF0A 3SIMA 3TSDA 1AQMA 1J8VA 3GH4A 4NZ3A 3BGJA 1UHVA 2B7OA 1G94A 1ZB5A 3KZSA 5ECUA 2GGGA 2J7GA 2QUVA 4D8LA 4DB7A 3N18A 2FPYA 1FCVA 3RJXA 3URBA 3M43A 1A5UA 1B31A 5SWUA 2J77A 2XIQA 1JCLA 2QJHA 1M7PA 1NP2A 3LG3A 4J2PA 2BG5A 1B3YA 4QCFA 4CQ8A 2QCDB 3IJQA 2WJDA 5IOBA 3MSYA 3W1MA 4FIRA 1UC4A 1GW9A 5LKYA 3CYJA 1UB3A 4MPKA 3PN8A 1P43A 2WHLA 2VQTA 3EDEA 2PZNA 2HV5A 4UZSA 3AHVA 3A47A 1T8XA 3UJEA 2OQYA 4JIQA 3BAYA 2GSJA 2BOGX 5I2UA 4CNOA 1TG7A 2P10A 1S38A 4IQDA 4M29A 1O12A 1UKPA 1H7OA 4YCOA 3TXZA 3DFTA 2PCEA 4F3HA 3AAMA 1RHCA 4WZHA 4G1NA 4C6LA 4N2YA 3T0CA 2X2YA 4BI6A 2HNHA 1HJQA 3VPLA 2GWGA 2JGYA 3C52A 3NZQA 4JTEA 1IWAA 2BVYA 1UP3A 1HVQA 2WMJA 3N4EA 3NFUA 4LEFA 5AHNA 3VU2A 3CPUA 2EPHA 4ZE4A 1KCKA 2OEJA 3WJZA 4CKQA 3A3WA 3CV1A 3F4DA 3UWWA 3QHOA 4AC1X 3BICA 4PUUA 3KOYA 3KCLA 2BXVA 3UPBA 2A6LA 1KGXA 1A5SA 1SZNA 4GI9A 2CLPA 5REQA 3BOFA 3C5QA 3S5OA 1JDCA 1JAEA 1PTGA 4I9TA 5MKGB 1PYMA 3CC1A 3AUOA 4N4QA 3H4WA 5CPQA 2OCZA 5ABGA 4DWSC 5KZMA 3VABA 2GWNA 4PMRA 4ZQMA 3FFSA 2XVGA 3SUTA 3GYEA 4A29A 2DVUA 3L21A 3NO1A 5GNXA 4GC3A 2XGZA 5F2IA 4IICA 3BLDA 3BLKA 4HTYA 5KETA 1OYAA 1E1EA 1VEMA 4EWJA 5K2ZA 3GXNA 2E25A 3DYMA 3K8KA 1JCNA 1J0IA 4QJ5B 1XGZA 1P6WA 3TW7A 4HT3A 2BHZA 1GOOA 1OADA 2REQA 1NF7A 4OGZA 3QR1A 1SJBA 4C6CA 2BX7A 5A8GA 3RILA 3DG7A 2PTZA 3H26A 1OFPA 5GNYA 2C15A 5AKQA 2QIIA 4CN1A 1ODUA 4MYXA 5CJMA 3M1ZA 1EP2A 5AYZA 8RUCA 3QQ1A 3IANA 4GVIA 5DF0A 1JZ8A 3QR3A 1XBYA 4REQB 4BKNA 5FEXA 4HA3A 4D8AA 2P50A 2NLYA 1P6CA 5BMXA 4E4PA 2PC8A 1HP5A 2VFFA 1DXFA 3GFXA 3SY8A 3R11A 5RUBA 3KAOA 3IUHA 4IMAA 5DY2A 1A80A 1NVMA 2BTMA 3UR2A 2B7QA 1MW1A 4LBUA 1JAKA 3SZ8A 1TR1A 5CCZA 4GE8A 4UFHA 3WJWA 3CAWA 2EG6A 4GVFA 2A5HA 3TW6A 1WE5A 1V6UA 5C71A 3GH5A 3BW3A 2C13A 3UZZA 4WDTA 3W88A 3HGOA 4N4PA 3OGSA 1EZ2A 4PTXA 1GVRA 4DWDA 2D20A 4KFNA 1BXNA 4DIAA 3RGTA 3OOQA 3U2EA 2XFYA 4QG6A 1E6XM 2VM8A 3DEQA 1TREA 1IEIA 5ECVA 3STPA 4HD5A 3CEPA 1TPUA 1GOIA 6XIMA 2VCCA 5G2WA 2QJIA 1TMHA 1GNXA 4WK9A 2EG8A 2XYLA 2A85A 4N9CA 4E2BA 5CGMA 3W7OA 1E9LA 4YL2A 5I3DA 2X41A 1UZDA 4LXFA 3ZQ9A 5A8OA 3W73A 2YCKX 2CHRA 4U5KA 5AB3A 3NCOA 4XTIA 3HBLA 4PODA 1L2UA 1KCLA 2OLSA 3WD3A 3P74A 3L0NA 1J9YA 2Y89A 1HFBA 3BLEA 3SO7A 3M47A 5I00A 1CGUA 2QW5A 3EX4A 4N6EA 4BY3A 3GX9A 1LLOA 4X2RA 3TZFA 4KEUA 1XQKA 4WJXA 1P0BA 1OEPA 6REQB 4AZIA 3LGDA 2AL2B 2FZ8A 4IP5A 6TIMA 2E6AA 5CC7A 3NR0A 3O3RA 1J18A 3OEXA 3MI3A 2X30A 4QDWA 3BSHA 1V79A 3BV7A 5AY7A 5CZ0A 3QMSA 4OBTA 4S39A 2QS8A 3J7HA 4KESA 3GR7A 1TVPA 3C2VA 4FNTA 5F4XA 3QMTA 4KEZA 4JQ1A 1C8VA 3TYUA 3ITXA 3ES7A 1NH6A 3P2VA 2XSAA 4DJED 3R1ZA 3E2QA 2HK1A 3OA3A 3VGHA 2WNWA 1PKLA 4E8CA 2E68A 1FFRA 4K36A 3RYSA 3E2SA 3KHJA 2A6NA 1AG1O 3UFYA 2XH4A 3OYXA 2O9TA 3LMYA 4ACZB 1F76A 2ZUNA 5EMLA 2EF9A 2J75A 3F2DA 4CNUA 5M2FX 3QLDA 2REQB 2HVNA 2ZA2A 1WA3A 4QG9A 1ADOA 3JW7A 1Q13A 3KL5A 3BW2A 4EXBA 3C0QA 4F2TA 5JQ9A 3M0MA 3G24A 3OQ8A 4DBUA 5HK4A 2VVNA 1KFBA 2YBUA 4HQVA 4EXAA 2I1OA 3SI9A 3N13A 4DWSA 4FNRA 1WKFA 3WLMA 3CMJA 3RJYA 3OBKA 3OW1A 2ZZ3A 1YTDA 4OV4A 1TTJA 4Z2GA 4KWWA 4A3RA 1RCXB 5ABFA 2R6OA 3MV11 2FZBA 1NDYA 2DEPA 3LX9A 1W1B1 3LHYA 4NZ5A 1Z41A 2PC4A 2WPBA 3OHIA 1FWBC 3VGGA 1TV8A 4G7EA 3GTIA 1ZY9A 4QCEA 3R7MA 5CC5A 3WBYA 3TLQA 2OYMA 1C9DA 4QSHA 1EHNA 2HZGA 3WDQA 2JKEA 1JUBA 4ENLA 4F0MA 3DERA 3BG5A 3H24A 4Q7NA 1A0CA 4LX4A 1KXVA 2AKZA 1NAL1 3LNPA 3C3NA 3G1HA 5HPOA 3R25A 1LL4A 1WO2A 2A0NA 2OGJA 3V5OA 3IS4A 3P93A 4QJ1A 1US2A 2NQ5A 5HQLA 2WSYA 4AHPA 3CL6A 4DJDC 4GH3A 5DQPA 1W1VA 4S3EA 2PLJA 4BF9A 4NZ4A 4B5WA 3VNMA 1HKJA 1I8JA 1PYFA 3BE7A 3EAUA 3L12A 1W56A 3D46A 1CPUA 4UNKA 3MW7A 1W3JA 2WO5A 4UMAA 4OWGA 3NPUA 3QM3A 4NKCA 4PFHA 1UUQA 4X0VA 1A5BA 4RKAA 2DVTA 2KX9A 1PTDA 1YDOA 4LV4A 4EK7A 4JX6A 4F48A 3GG1A 3K4AA 2DSZA 3OO2A 2EGZA 4LAMA 4MOZA 1IEQA 1F6KA 3IV3A 3ZMRA 5BCAA 1V93A 1UH3A 4K8HA 4GQ0A 1ZBCA 2XHYA 3GTHA 1XKJA 3HGJA 5A2AA 4UQBA 3IGXA 2QAPA 4J3TA 2E09A 1OCNA 3GNRA 4Q6JA 1JYXA 3CM4A 4AUBA 3NQ2A 2VEMA 2WV8A 1H1ZA 2H8XA 1KM2A 3W7DA 3C56A 4CCDA 1I45A 3CZGA 2DSVA 1FWFC 4JTTA 3WQVA 1JIBA 5AECA 3W2MA 3EWZA 3N1AA 1XDJA 3F5LA 3E0FA 3EKGA 4MDPA 3MMUA 2B4GA 4AD1A 1EPXA 2DT3A 1K4GA 1GCYA 2D24A 4JTGA 2GOKA 5AHMA 1MUWA 1IXPA 2VI0A 3KWXA 2WHKA 5M1TA 3O16A 1S2AA 1YXDA 1TZ9A 1YTKA 3QH2A 3CQJA 2E5CA 2DSWA 4R33A 3T0AA 3M0IA 3S83A 1C91A 4ZVJA 4H3DA 3VD9A 1X98A 5F1UA 5CBBA 2ZA1A 3ZLFA 1UR1A 1ZZMA 4Q4SA 3VKKA 2Y6ZA 1O1ZA 4AZ7A 1J79A 2I57A 1E5JA 3VAVA 2DJXA 3EX3A 4UOZA 3IJ7A 5JU6A 3ANVA 1W5MA 4IMGA 4WOQA 5HOSA 4NNAA 3DU0A 1XCWA 1EH9A 4EACA 3ZO9A 1EXBA 4WY0A 4KQNA 2BY3A 4DO4A 4PTVA 1MYRA 1RH9A 3KVJA 3K2GA 3IARA 3AIWA 5C9WA 2P5NA 1UJQA 3MCMA 2YIHA 1T6MA 2GVGA 3RPMA 3WBWA 3FSTA 1VP5A 4BCEA 5LHEA 3NQEA 3W82A 4QEHA 3JRKA 3SURA 4XZIA 1M9HA 3M64A 1TUXA 2GVJA 4V1XA 4DJEC 3TLLA 1SM9A 1OZMA 3UF9A 4AMCA 4LPCA 3ERPA 4F0RA 5KITA 4NNBA 5HWMA 4JKLA 2QCCA 4IIGA 1X1NA 5DX7A 4DM2A 1EP1A 4AF0A 2PZ0A 4AIBA 4JIPA 2VDHA 3UG4A 1MMFA 1G0CA 3ARVA 1UPMB 3TCSA 4E2VA 3RU6A 3VDBA 3AU2A 1POJA 1DBTA 3G77A 1I0BA 3WH7A 3A5FA 4OECA 4JFTA 3BOLA 3ARZA 3W1XA 2VTFA 3Q37A 1J96A 1EFZA 2OGYA 1FWWA 1Q6OA 1S5MA 1HN1A 3ME3A 2QCMA 4UTMA 4S2BA 3MJYA 5I79A 1V0MA 3DFSA 3MC5A 2PU1A 5BYWA 3N2TA 3W1QA 3H7RA 1H09A 1GQKA 5C2XA 5CSRA 2QUNA 1SJAA 4ROQA 4GGHA 4H9XA 3STEA 2Z29A 3CS2A 5D9MA 2FHFA 2YBTA 2WVUA 2PDJA 2GJPA 1AW2A 5EBUA 1F3TA 1IT8A 3DHPA 3MKCA 4H9YA 3T07A 4Y2WA 1A5LC 4RDYA 2D0FA 3MMTA 4C6PA 1VFFA 2PMQA 3PZUA 1HKVA 1JZ2A 2W92A 3NQAA 1J0ZA 1JPIA 4ORIA 3C8FA 4PB4A 2KZHA 3LGGA 1RALA 2XH2A 1DXEA 1PSCA 4LB3A 2Q8ZA 3O1NA 1P48A 2YW4A 3HIJA 3PSVA 3L4YA 4TMBA 4GUHA 4DF0A 3BQ5A 3P84A 2HEJA 4Z1DA 4JICA 3GD6A 2PDIA 4Q33A 1JZ5A 3MBDA 5F4SA 3KE0A 2EO7A 3QR0A 1F07A 3BUVA 1DJXA 4AU0A 1SUXA 2ALRA 3LI1A 5F2GA 1BHGA 2XGBA 4QRNA 1PZ0A 5CJNA 4G8TA 1V3MA 2YZ5A 1IE7C 1J6PA 1VRXA 3M0JA 5D09A 4I5XA 4LS2A 3WQDA 2VFIA 3G3DA 3SGGA 4TVUA 2O92A 2ZUVA 4ORMA 4NNCA 3NWRA 1T7LA 8TIMA 3W53A 2XISA 1B54A 3BAKA 3DC0A 5C9RA 3W85A 3ZIZA 3WX7A 1YE4A 2NXHA 2QPXA 4H8UA 2IXVA 3V36A 1IXQA 2FMNA 3N15A 3T4WA 5CSYA 3GDRA 5HANA 3WJSA 3R13A 3UG3A 2WNNA 3QGAC 1W1PA 3DHUA 1OABA 1JG9A 4N0RA 2XVKA 3E5PA 1D2KA 4KIEA 2J47A 2OQHA 4HJWA 2WMIB 4NSBA 2ZUTA 3A23A 3LDVA 2HVOA 2OJPA 4G2DA 2UY4A 2G3IA 1WV2A 4H9MA 7TIMA 1TPH1 1P0DA 3HF3A 1SZGA 1WAWA 3VVGA 1UBSA 3ZT7A 4IOTA 1N55A 1IYXA 2F84A 4FXFA 4RZBA 3AIUA 2O4MA 1O60A 3O15A 4ZQOA 2CHOA 4BI5A 3TSMA 3GXDA 2CLIA 1TRIA 3M0ZA 1V3KA 5FF4A 1MSSA 1SSDA 3N9KA 5HMEA 1ECEA 3USBA 4OKDA 1SGJA 2QF7A 1F8MA 2V3DA 3LA4A 2E28A 5E0FA 1DJQA 3THUA 4NUWA 2PWGA 2GJNA 1Y8BA 2VR4A 4JTJA 4Q8WA 2OKOA 3G6MA 4JYEA 4ZOBA 4MB5A 3AALA 2NV9A 3UY8A 3WL1A 2FTYA 3EWUA 5T9BG 1XIFA 3WH9A 1WCGA 1QRQA 3CLMA 4NJHA 2NZLA 3GHRA 3VDHA 4DX3A 3BSMA 3WDHA 1K7XA 4GFIA 3B0UX 3S2LA 2QVNA 4NL1A 3OLDA 4LRTA 2VX6A 4QXIA 1FVPA 1WKYA 3THAA 4F9DA 2H3DA 1YTEA 1XF0A 1UZ4A 4LYPA 4W85A 3HFYA 4KS0A 1N7KA 1UBPC 2G3JA 3GAYA 3RMJA 2QIWA 4MJ2A 1UKOA 4EOUA 4C6OA 5C5YA 4FF7A 1W9PA 1QNSA 1M6JA 4KPLA 3B05A 3E3HA 4XUYA 4IGHA 1IEWA 2P8BA 1E6RA 4FLOA 3W00A 2PGFA 1CXFA 1O7AA 3NSNA 1YNQA 2ODOA 1EJTC 4J27A 4A05A 1BWKA 4C6BA 2OT0A 3ARQA 4GKTA 3KS6A 5GVJA 1PX8A 3QV7A 4MB3A 5D9NA 3U0HA 3A5VA 2NQLA 2OO0A 3IVUA 5BU9A 2EHHA 4M81A 1CTNA 4JTRA 4JZ5A 1UIPA 1BG9A 1UH4A 3NNTA 2VCAA 2J7EA 4Q4RA 5DCDA 3ELFA 3ZJKA 3ZJ8A 5D2WA 1WBJA 3CUHA 2ASHA 2AQWA 4QISA 2DUZA 4C7GA 4B91A 4IFRA 1LBFA 1X8CA 4O53A 1EEPA 1OJXA 4QX4A 3ATZA 4BI7A 3UXKA 2HRWA 5D9PA 1Z3NA 3OZOA 2TMDA 2BZNA 5IHRA 3WK2A 3H55A 5F1VA 2VWSA 1KKOA 1LYXA 3U2OA 1YLVA 1QDSA 1JCJA 1P6BA 1K1DA 1GZJA 1K9TA 1Z44A 1MI3A 2Y2WA 2VEKA 1P5BA 2V67A 2NQHA 3VMNA 4B4FA 1NDZA 5AC7A 2OZ8A 4HJFA 1V08A 1PIIA 3W3OA 1ONRA 4KFOA 4Z1YA 4GISA 3VIHA 3H70A 2XU2A 4H6KA 4GWEA 5D03A 3VI2A 3AU6A 3L4XA 5BU6A 1I75A 2HE8A 1GT8A 3CL7A 1X97A 1OD8A 3OJGA 5DCBA 2QDGA 1Q6RA 3VKBA 4DZIA 3KTSA 3OLGA 4MY9A 4EVZA 4DJFA 3IIZA 4J3WA 1G1YA 1FCUA 2IMRA 4JN6A 1ICQA 4PCPA 3LXCA 1SPQA 1ML1A 5H8PA 4CU7A 4MHBA 1OF6A 2C16A 2YOCA 3MU7A 2TPSA 4PC8A 3L68A 2CZVA 2Z7KA 3S6DA 5EB8A 1F6PA 4FPSA 3QMRA 1VBHA 2WMKA 2VUNA 2ADAA 2F6KA 2INZA 2P1FA 4GXMA 3R8HA 5FA5A 3ZYZA 1Q6LA 2IPGA 4GJIA 3VMPA 2A2IA 1GOXA 1G4PA 4KW2A 3W7JA 3YPIA 1BVZA 2DSUA 1H49A 4HPXA 4XG1A 3P60A 5D4YA 1DJIA 2D69A 1Q85A 4FOUA 4CU6A 2GUBA 3VDCA 1Q6GA 3U2ZA 2F7FA 4NXSA 5D37A 1ITXA 4W8AA 5I3FA 4NF7A 3CIVA 2DQWA 3MANA 2VZUA 3WH6A 3V0UA 2R8WA 1NWTA 4TX8A 2PBOA 1WDSA 4LJ3A 3WEZA 3HV9A 4J4KA 2ZWYA 4N02A 1EXPA 4I7UA 2E67A 4CLMA 5AYBA 3DX5A 4Z0JA 1BYBA 1XPYA 3HOJA 2BHYA 3VZXA 3JR2A 1OK4A 4UTHA 3UCQA 4NP7A 3W76A 3IJ6A 3GDTA 2Z2UA 1YRRA 3VYLA 3VOJA 1S2CA 1V3LA 3IK4A 1KKRA 4TR9A 5EGRA 1JPHA 4ZOCA 5G2HA 1YPXA 3PZTA 1U30A 1UD4A 2HNEA 2INFA 4K7YA 3WQWA 5FSEC 2QJJA 1GWJA 4IP4A 1GOMA 1KRAC 3VO0A 4L65A 3VOFA 1CYGA 2DW6A 4M51A 1ZUAX 3NEHA 1KRMA 3W7CA 3GHSA 5HJLA 2PDUA 1E71M 4FXJA 2VGIA 2VOTA 4MYAA 1E51A 1IWPA 2QULA 3VM7A 4AZ6A 4NZ1A 1JCTA 4PMQA 1I9CB 4IPLA 3WMCA 2FPVA 1RK6A 2G97A 1XSIA 4H83A 5HMDA 5AZ1A 3L23A 2VX5A 3F5JA 3P8IA 4INFA 4LUSB 3T4CA 2CXGA 5REQB 2X1RA 4CNPA 1WXZA 2J6VA 1TZ7A 1WZMA 5HMFA 1KRBC 3IWPA 4TVDA 2QDHA 3H4XA 1CGXA 2Q3RA 2CWXA 1UMYA 1NP0A 5ABEA 2XINA 3W81A 4JXCA 1KBKA 2PLKA 1KXHA 3NXLA 2YXXA 3VE7A 1PZ3A 3RAOA 1BTCA 1FRBA 4EPEC 1ODZA 1V3HA 3W2UA 3LEPA 5I24A 2IUZA 3R8GA 4CQBA 1O5QA 4M56A 3K13A 3KVLA 4PH6A 2BODX 1NOWA 4JR5A 3EEZA 3S1UA 3VUSA 3AICA 4JEJA 4MVAA 5DELA 3WH5A 5AFDA 1V0NA 1UPPA 4BS0A 4X3ZA 2YCIX 3ZLGA 1REQA 3WQ8A 4E4UA 1XRFA 1F6YA 1UOZA 1AMKA 1W8GA 4IJRA 2FVLA 3ARRA 4HB7A 4Z2HA 2Y88A 3EOEA 1P1XA 4Q3MA 1PZ1A 1TWIA 4UUIA 3SN1A 2ZZ2A 3AHYA 4IG2A 4FX6M 4WF7A 4WLCA 2GGIA 4DLFA 2WJEA 3KLKA 3ARSA 1MNZA 1ZPTA 4Q4OA 4K8EA 1TKKA 1IR1A 3WD0A 1V3IA 2YYTA 3IJ9A 4LRSA 1L6SA 2GLKA 2OXNA 4AG0A 4MAZA 3LRLA 2VYOA 3R2GA 3L4TA 4QS6A 2DT0A 1TYGA 4RV8A 3NOYA 3ATYA 4AWEA 1DOSA 1GOQA 1CXHA 2XFFA 4UBPC 3G22A 4S3AA 1HL9A 4D1JA 1Y5WA 2I9EA 1BWLA 2OZTA 3TA9A 3B97A 3BOXA 2RGLA 3ITYA 2ESCA 1HO1A 5TAOA 3DG6A 3E0VA 2BS9A 3QZEA 5BWFA 3BCJA 4HVXA 1RJQA 2VNCA 3VNYA 5B7ZA 2Q71A 1OINA 1EIBA 2P76A 3MP4A 3O8AA 4Q4PA 3W02A 2VGGA 9RUBA 5T9CE 1HKKA 4XTDA 1XG4A 2WHMA 3U6WA 3JUGA 1IXOA 5A3HA 4O0QA 5FF3A 5B7YA 2ZUMA 4WKAA 1IGSA 5AHFA 5H2ZA 1L8NA 3LMZA 4DZHA 4KCVA 4TTGA 2OOGA 2FVKA 2D73A 4JQ3A 1Q6QA 2VELA 1W5QA 2QAFA 2FGZA 1UIOA 3MUCA 4RX0A 1ICSA 1EDGA 2OB3A 3STCA 4C5YA 5GJNA 3WUGA 3BAIA 5BOFA 2QPSA 2V68A 1CBGA 1J12A 4ZMGA 2PDMA 1PIFA 3D0CA 2Y4SA 5PTDA 1F3WA 1EO7A 1DYSA 4DNHA 1ECQA 7CGTA 4Q32A 3M5VA 1QNVA 4IT1A 1SZFA 1W5PA 5IXEA 1B9ZA 4AD4A 3PG9A 3GY1A 3QPEA 3USZA 2IPWA 5D2YA 3HPAA 2ZOXA 3B8WA 1UR2A 3SQMA 4ZSUA 1VYRA 4PSRA 4QLLA 4JD4A 3WK3A 3C2RA 1E4NA 1M1BA 1QVBA 3ORWA 1E55A 2AQVA 2IKJA 3UPWA 1XYAA 1E6PA 2NX3A 3VNKA 1K3UA 3A4XA 1E6NA 2WMFA 4CD7A 1Q8JA 3OZYA 3IJ8A 3W7RA 4J3SA 3W07A 4R7WA 1Y0EA 3HPSA 3VGBA 5GQBA 1K03A 3ANYA 1HP4A 4Z17A 1SFSA 5BW6A 1M5WA 4KCUA 2BNJA 3V0SA <