4JZ5A

High-resolution structure of catalytic domain of endolysin ply40 from bacteriophage p40 of listeria monocytogenes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
GSHMMVLVLDISKWQPTVNYSGLKEDVGFVVIRSSNGTQKYDERLEQHAKGLDKVGMPFGLYHYALFEGGQDTINEANMLVSAYKKCRQLGAEPTFLFLDYEEVKLKSGNVVNECQRFIDHVKGQTGVKVGLYAGDSFWKTHDLDKVKHDLRWVARYGVDNGKPSTKPSIPYDLWQYTSKGRIKAIASPVDMNTCSSDILNKLKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of catalytic domain of endolysin Ply40
rcsb
source organism Listeria phage p40
molecule tags Hydrolase
molecule keywords Gp26
total genus 75
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jz5A00
3WELA 4CGTA 2OYMA 1OD0A 3RIKA 4AYSA 4GZIA 1UQZA 1FP9A 4AD3A 4H41A 2Y2WA 1VRXA 3CUFA 3BMVA 1NWTA 2FHCA 2YLLA 3L4WA 3WH5A 2ZOXA 4JFWA 4U2YA 3U7BA 2W61A 4D6EA 4W8BA 2WSPA 5DMYA 1J18A 2DEPA 5GNYA 3SCSA 4TVUA 4OUEA 2JEPA 4XV0A 4Q22A 1H09A 2D24A 3CO4A 5A2BA 1XYFA 4HZ7A 3SUTA 4GO8A 2G3NA 3AICA 2EPOA 2Q8XA 4HOWA 1RH9A 4MDPA 1UR8A 1GOWA 2WCSA 3VD7A 3GDBA 7A3HA 1W3JA 1WP6A 2NSXA 2DSKA 1VENA 3N12A 2EO7A 3CGTA 3RILA 3TONA 3VGGA 1HKIA 1E73M 3S6TA 1V6UA 2V3DA 1J9YA 1M04A 1MXGA 1FFQA 2XHYA 3B8SA 1J0HA 3EBVA 2YL9A 2XYLA 4F9DA 3MMWA 4NSBA 1HJVA 2VVNA 2ZUNA 1H49A 3U57A 3GZAA 1DHKA 1D3CA 2YJQA 2DT3A 4WIWA 1DWIM 4E8CA 4H8VA 4LYQA 1TFVA 1JL8A 1WDRA 2A3BA 3IJ8A 4PMZA 4OZOA 2A3CA 1UKQA 3WEOA 2ESCA 1E3ZA 3HMCA 2QHAA 4H7VA 5HOSA 4M8UA 2F8QA 4AZIA 4UFHA 3OLGA 2JFEX 4P8UA 1KGXA 1H0GA 4M29A 3MSGA 4UNIA 3BC9A 4P8WA 4GXPA 3SCOA 1JI2A 2DT2A 2ZUSA 2EEXA 4MAZA 3EMQA 4ZE5A 2XWDA 1B1YA 1EOKA 1ISWA 3T2QA 3M6DA 5FL1A 1UKOA 3KL3A 5ABFB 1CIUA 4UQDA 2G4FA 3ARVA 4ML4A 4N42A 2WVVB 4Y7EA 1VAHA 1E6ZA 2D22A 1BPLB 3VOCA 4ZENA 2OWXA 5A6BA 1TCMA 1AQHA 2X8RA 4PMXA 1UD6A 1CXIA 1V0NA 1GOQA 2DSZA 1R87A 7CGTA 3WH8A 2YA2A 4NRSA 4P7RA 2VCBA 1C8QA 5IHSA 3HU7A 4QAWA 4AIOA 4MB1A 3L4VA 4LXFA 3OZPA 1CGUA 4GI6A 4PYSA 3WD4A 2DPEA 1R7AA 1NWUA 1VFUA 3DHPA 2E8YA 4BQ4A 1K9DA 4CD4A 1HXJA 5CGMA 1C90A 2G3MA 4PMVA 1JNEA 5A8NA 5E0FA 1ZBVA 3KE0A 1XRVA 3FN9A 1HIZA 1H5VA 3F5LA 1A47A 4M1RA 1GHSA 2D0HA 2WYSA 5D9NA 2CESA 1L8NA 4DUXA 5GNZA 1A3HA 3A47A 1JXJA 2D0GA 3WSUA 2ZICA 1EDGA 1UA7A 2E0PA 2V5DA 1BQCA 1WO2A 5ABGA 3VIKA 1XHGA 3GXMA 1XH1A 3K8MA 4U5KA 3NDZA 2GJPA 2WKLA 4W86A 4JFUA 2G8ZA 5I6SA 3POCA 2JEQA 2J7EA 4MJ2A 4AWEA 3BCFA 4H8HA 1HVQA 2YKKA 4AIEA 3AYSA 1H11A 2YDQA 4IISA 4CCCA 2XM2A 3WDIA 3VM7A 4IPLA 1UKSA 3AMDA 1B31A 3W6LA 1QI3A 2PWHA 4OBSA 4ATWA 3O2LA 1JYVA 4EAMA 1E71M 3VUPA 2CHOA 1UH2A 1JZ4A 4WKHA 3WBAA 2BNJA 1ZU8A 3OLDA 3T2PA 4MJ4A 3W29A 1HP5A 3WQ5A 1JDCA 4Z2KA 4KH2A 4OBRA 2YOCA 5DT7A 4GKLA 2ZWZA 4WLCA 3ZT6A 3L2MA 1E0VA 3CZ8A 1V6XA 3TTQA 5BXRA 1OSEA 4UZUA 4E2OA 1UWSA 2XPKA 1GNXA 1U30A 2GUYA 4M81A 2O9PA 1JAKA 2WMFA 3NDYA 4UQ9A 1JZ5A 1K9TA 5CSUA 1E3XA 2CBVA 5DF0A 4CD5A 4HA4A 1BAGA 3AIBA 4LYRA 5FD0A 1PZ2A 1GHRA 3SCWA 2WVTA 1E5NA 2XIBA 3CZJA 4CU7A 1IZKA 3CLWA 5AYBA 3N13A 3GH5A 1UWIA 4P8VA 3WF2A 1QI4A 4MAVA 1LG1A 5I0DA 2V38A 3S2CA 4NI3A 1XCXA 1UHVA 3CUHA 2BHZA 1B90A 3F4VA 4QLJA 1RD6A 1QI0A 4X0VA 4F8XA 2NW0A 1B30A 2V5CA 3K8LA 1CYGA 3SEPA 1KFWA 2QLYA 1YHTA 1ZB5A 3QHMA 2J74A 4TTGA 2ZX6A 4HU8A 4UQCA 5IHRA 3IJ9A 1JZ3A 5CSYA 2FGZA 1XCWA 4P8XA 4JIEA 1AQMA 2WZIA 1BVNP 1DWAM 3MUAA 1ZJAA 4P7NA 3IANA 3VVGA 5FIPA 5JIPA 2DSWA 2PC8A 5D4YA 1GOOA 2GJXB 3B9DA 3ARUA 5JUVA 3CHFA 3VNYA 5GQBA 1BF2A 1FHDA 5M5DA 4J7RA 1OT2A 3PZGA 2DSUA 1EHNA 3GXIA 4D6DA 2Y4SA 4HMEA 2EQDA 3D3AA 3RCNA 3SCVA 3VIHA 2XGIA 2VCCA 4X9YA 2WW5A 2XM1A 5CPSA 2NT1A 1KGWA 1NH6A 3AROA 1WDSA 2CCRA 2YA1A 1ECEA 3IJ7A 3RM4A 2BY1A 4F79A 2XSAA 5HDRA 3AOFA 3UEQA 4D72A 4TX8A 2EPKX 4AEFA 1BG9A 3MKKA 4TXEA 4YHEA 4DUVA 3CTTA 1DWFM 1OCQA 3G6MA 1W9UA 1GOKA 2E8ZA 5FKYA 3PTMA 4D6HA 5I77A 4CUCA 1OT1A 5HNNA 1D7FA 1C8YA 1MXDA 3WNOA 2DT0A 3GBEA 4W5UA 3VGEA 1WKYA 1Q6DA 2E3ZA 3ALGA 5A8MA 1UH4A 2W67A 4PMQA 1WZKA 2F2HA 4JFSA 4GO9A 3ZSSA 2YBTA 3AXXA 2WXDM 3WIJA 5CPTA 2VT0A 3AIQA 2YL8A 2OWCA 1G1YA 3L2LA 3N9KA 1QNQA 5D9MA 2E4TA 2EBNA 2JALA 1EO5A 4AIUA 2UY3A 3ZR5A 4MB5A 1LJYA 3WD3A 1KWKA 5ECUA 4Q7NA 2BS9A 4PUEA 1G01A 3BAWA 1E6XM 1J11A 2CBIA 1RP9A 1ESWA 1W91A 4JZ5A 3UESA 2TAAA 3T0DA 3QHNA 2W5FA 3U5UA 2VTFA 1UR9A 1H4PA 1E1EA 4UFKA 5D9OA 1QI2A 3LPOA 4CN1A 3RMEA 4BQ5A 3W4RA 1E4MM 4JKLA 2VCAA 2X0HA 3TTYA 5A8PA 2YA0A 1BLIA 1NARA 4TX6A 4CVUA 1JZ8A 2J7BA 3CUJA 4DM1A 1JYNA 3MV01 1EIBA 4J3WA 3W26A 2BFGA 1NWSA 1BSIA 1J01A 2PBGA 2JE8A 3UCQA 4OIFA 4Z2IA 3THDA 3UR7A 1LF1A 1JD7A 2GFTA 4ACZB 1VBUA 5CPQA 4IPNB 4P7OA 5IXEA 4NRRA 1E1FA 3WL1A 3AHYA 3POHA 1Y7VA 1JZ7A 1J0ZA 3PZVA 4D1IA 3PTQA 4Z2HA 5F7UA 1XD1A 4XX6A 5A6LA 3PZTA 1V6VA 4CKQA 3ARYA 1PX8A 1BG4A 4DUWA 4LGXA 4AZCB 1ODZA 5CGTA 1C7TA 4HP5A 2J7DA 1WAWA 1MFVA 1E0XA 3WEZA 4W7VA 3AIEA 1UD4A 1Z32X 1CGXA 3NUKA 1J10A 1GQIA 3VIFA 3GH4A 4BQ2A 1JFXA 2UY4A 2DIEA 4W84A 1UR4A 1GUVA 5D8ZA 1RP8A 1B3VA 4ZEPA 1OINA 4PSRA 2FGLA 3CUIA 3FW6A 4OJYA 3AXIA 2O9TA 1HKMA 3AIRA 3L4TA 1UG6A 3PBGA 4MTVA 4GZEA 4MNJA 1HP4A 2VI0A 4PEEA 1GORA 2DH2A 4UOZA 3WMSA 4JKMA 3TA9A 1PZ3A 3OGVA 2J7CA 1W1PA 1US2A 1UZ1A 2VO5A 3PZUA 5BXTA 3VGDA 2OLHA 4W5ZA 2RGMA 5JBEA 2X2YA 2BXZA 1KBKA 1UOKA 5AC4A 3VNZA 3OA5A 4UOQA 4KGJA 1AVAA 1V02A 3WUGA 1UD8A 3VX0A 4AMCA 4PCSA 1LQ0A 3IK2A 4J3TA 3AYRA 1MW3A 5EB8A 2VC9A 3BAYA 4V28A 3VIPA 2WAGA 1GJWA 4JHZA 1PX4A 5BROA 4EE9A 1X6NA 4Z2JA 1VBRA 4URIA 2IXUA 2D0FA 4W8LA 4E8DA 2GSJA 2XJ7A 3VO0A 5A6MA 1EDQA 1QNSA 4C7FA 3RM8A 1VIWA 4NF7A 4TTUA 4F9JA 1EQCA 3FAWA 4F66A 4AW7A 1GZJA 4HZ6A 1W1YA 1E6SM 1W9PA 5GNXA 1I75A 1CXEA 2ZIDA 5E0CA 4PMNA 1ZL1A 2VZOA 1J12A 4DWSC 2W66A 3BAXA 3N04A 1XYZA 4AD0A 1MYRA 3PZNA 4JHOA 3AHXA 2W91A 2JIWA 2XUCA 5A2CA 4PBGA 1MVYA 2FHBA 5KEZA 1V3HA 1TVNA 4AZBA 3M46A 1BGGA 3WEMA 4AD5A 1NOUA 1J0YA 8A3HA 4IM4A 1KXTA 3L4UA 5E6YA 4UFLA 5BYWA 1US3A 1IV8A 3RJYA 4MNKA 3EDJA 1TVPA 3DHUA 1G0CA 2OYKA 3W28A 1CXFA 3D5HA 3LPPA 3ECQA 1NP0A 1HX0A 3HN3A 3K4DA 2JF6A 1WZAA 4HZ8A 2QPUA 3AJ7A 3WQ8A 3BCDA 3WUFA 2GJXA 5BWFA 3NYDA 4W7WA 3WY1A 5LA2A 4D71A 1UKTA 2GK1A 3VD9A 4XB3A 4OOUA 4UR9A 3AMKA 1M53A 1B3YA 4JL2A 3SIMA 2XGBA 1JF6A 5BRQA 1GVYA 1KCLA 2Z1SA 4ATLA 1CLVA 3M7SA 1SYTA 1C3FA 2VRJA 4QLKA 4ACYA 4B9YA 2VQTA 2CKSA 1VJZA 1BHGA 4GZJA 1NOWA 4DWSB 1W1VA 1GQJA 4QP0A 2O9RA 1QW9A 4LYPA 2VZTA 2HISA 1PIFA 1CNVA 5E09A 1H2JA 3VIJA 1GOMA 4BS0A 4KRTA 3MUIA 1GQLA 3II1A 4LPCA 3BLKA 3PN8A 1XSJA 5D9PA 2VX7A 1PJ9A 4CU8A 4FF5A 1CENA 3AS1A 1W3KA 2UY2A 4EKJA 1EH9A 4S3JA 3ALFA 1TR1A 1CGTA 1B9ZA 1UWUA 4AISA 2BVYA 2J4GA 1LL4A 4AD4A 1AMYA 1TE1A 1WCGA 1E70M 3E1F1 4H8UA 4FLRA 1R7OA 4RL3A 3AIWA 1XH0A 3SCUA 2AMGA 2WM0A 3ZOAA 4PTMA 2C0HA 3CMJA 3W81A 3N15A 1QPKA 5E9AA 4CD6A 1LL6A 2ZX9A 4JCLA 1BYBA 2WVVA 3M07A 1E5JA 1VJSA 3ARSA 3K46A 1K9EA 3SCTA 2WMIA 3PHAA 2D1ZA 3L4ZA 3BGAA 3MMUA 2V3FA 3GYCA 1HT6A 1V3IA 1IZJA 4ATDA 3AIVA 3VDAA 3WH7A 2G3JA 3SCPA 1UR2A 2CPUA 4PTVA 1HJSA 4PTXA 4CD8A 1U2YA 4TVDA 3UG5A 5I5RA 4PMRA 3CH9A 1DEDA 2PWGA 1HL8A 2CITA 2ZXAA 3SCQA 2BV9A 4A3HA 2ZUUA 3FY1A 4R5EA 4FMVA 3WD0A 3THCA 4H04A 4WKAA 2GDVA 3VIOA 2VR4A 3U5YA 3MS8A 3ZM8A 5I24A 3APGA 1FA2A 2X1IA 4TOQA 2ZXBA 3ZO9A 2VX4A 1BGAA 4CN4A 5C70A 2VURA 4EANA 3WF3A 1CECA 4RE3A 1CEOA 4GQRA 2UY5A 2WMJA 2YL6A 3FHQA 3IAPA 1UH3A 1XC6A 5EBAA 4AZCA 1CGWA 1EA9C 1V6WA 2GVYA 5AY7A 4D6IA 4LQ1A 3W0KA 3EMZA 2F61A 2W62A 1PPIA 4XUYA 2E9MA 5FL0A 2WMKA 3LPGA 2XSBA 2ZE0A 2J79A 3DYOA 1QBAA 1CLXA 4A3YA 5IFPA 1CZ1A 4DWSD 1E40A 2W63A 4GIAA 1SMDA 2WBGA 3W6MA 1EXPA 3DC0A 3QR3A 1JD9A 2ZWYA 3WDRA 1WB0A 3B9AA 4W93A 2JIEA 2ZUWA 5TD4A 1QHPA 4WSKA 2CETA 5A8QA 1PEZA 1W9BM 4XZWA 1MQQA 4U3AA 3SCNA 3OG2A 4RE2A 3BAIA 4PMOA 1L0PA 2VX6A 3NIYA 2V3EA 3J7HA 5LA1A 4U33A 3OGRA 1C7SA 1R85A 1E4IA 5CG0A 5EFDA 1MQRA 4P7LA 5E6ZA 5A3HA 1JYWA 1QI5A 5C71A 4D1JA 3N1AA 2PWEA 1D2KA 3MU7A 2YDRA 2XFFA 2WHMA 3CHEA 3CZKA 9CGTA 4TUFA 1UKPA 2WMIB 5M3WA 2IUZA 1R86A 3AHVA 1Q6GA 4HMDA 3VMOA 1E55A 3T09A 2FDMA 1KXHA 4BA0A 1V3KA 2VNCA 2BY0A 1QHZA 2FH6A 1OGBA 6CGTA 1TZ7A 4J3UA 1XD0A 2CBUA 2WKGA 3AZTA 3W53A 1C91A 2Y8VA 3QGVA 3ZSTA 3A4AA 3ARXA 5JBDA 3VD5A 1WZMA 3WFLA 1V0LA 2VL4A 2ZXQA 3VIMA 1QHOA 3VINA 2WBKA 2VOTA 3GBDA 3ARTA 3ZMRA 2DT1A 4V2XA 2RGLA 3PZMA 2BY3A 1V02E 2NT0A 1HVXA 2WWCA 1HF6A 3AHZA 2VQUA 3PZQA 3ARRA 2HVMA 3MV11 2XFYA 3VGBA 1MFUA 2FHFA 3AS0A 3F5JA 3UG3A 1OIFA 1CGVA 2CEQA 2XVLA 3KZSA 4EK7A 5BXSA 4WF7A 1HL9A 2WWDA 3KL5A 4TVCA 2CXGA 3W24A 1G9HA 4KRUA 1W9VA 1UWRA 4U2ZA 1CDGA 1FH8A 3GTNA 4PN2A 4QFUA 5AC5A 5M03A 3RPMA 4CVWA 3MMDA 1CPUA 1JNDA 1OD8A 1KQZA 4GI9A 4J3VA 3AHTA 1HKJA 4AEEA 1TG7A 2BVTA 3VGFA 3WF1A 3AI0A 3AMGA 3UETA 4U5IA 3OZOA 1M01A 1HJQA 4MDOA 1NM9A 3JUGA 4A4AA 3ZR6A 4ACZA 1ODUA 2J47A 5A8OA 2XTKA 5CZKA 4M80A 4AD2A 1KR1A 5A6SA 2WVUA 2XG9A 3IAQA 1QBBA 2BY2A 1GJUA 5BCAA 3NSNA 2VRQA 3GNPA 3GNOA 2Y8KA 2ZX8A 2C8NA 1XSKA 1SFSA 1V03A 2D23A 2CYGA 3A4WA 2Z1KA 2CERA 1W3HA 1VF8A 1QNRA 4C7DA 4N0RA 1E6PA 1XH2A 4W85A 1N82A 2B31A 5A1AA 4B15A 1FP8A 1ZBKA 1UD2A 2VVSA 5A6KA 3BLPX 3VDBA 2ZXDA 2D2OA 4ZE4A 1E43A 1UR0A 5IDIA 1GVIA 4RE4A 4YHGA 4QLLA 1Q6EA 5JIWA 3F5KA 1ISYA 2EPNA 3WUEA 3GXDA 1MW0A 3FNDA 1W3LA 3VMNA 2G3IA 1M03A 1V3JA 1UWQA 2J62A 3VD3A 5EMYA 4AY1A 3AZSA 3BSHA 3N11A 3T0AA 1AQ0A 3TP4A 4PCTA 1I1XA 3WQWA 1E4LA 4YPJA 2GDUA 1FHLA 3AISA 4ZFMA 1V0MA 3VX1A 3W82A 3WD2A 1QNPA 4AC1X 3MANA 2EJ1A 1HNYA 1VFMA 3ZJ7A 1P6WA 3G6LA 2E9LA 3A4XA 1ISVA 4MB4A 3DYMA 3CUGA 4LX4A 2JF7A 4FK9A 3I3BA 1ZBWA 2W92A 7TAAA 4GI8A 4ZXOA 3WDQA 3KL0A 1ZBCA 1XV8A 4WKFA 1O7AA 3HJEA 4KWUA 5JBFA 1ISXA 1UA3A 1DWJM 2YDSA 4FLQA 2W4XA 1VB9A 3VPLA 4OKDA 1CXHA 3OLEA 2J7GA 1MWOA 2V3GA 4BCEA 3MUY1 3VIGA 1UYQA 1QW8A 3NSXA 2CNCA 5KZ6A 1V6YA 2OSXA 5DFAA 2BHYA 2BXYA 2XFRA 1UZ4A 3FAXA 4AZ6A 3ZT5A 4HPHA 1EDTA 4D6GA 1EO7A 3EYPA 3AMCA 1BYDA 5I3DA 1PBGA 3AXHA 3VD4A 1W9DM 1OIMA 1E56A 2WMHA 1KXVA 2EPLX 1DP0A 1XGZA 3BAJA 1UD3A 5A95A 1OGGA 2OSWA 3WKZA 4D6CA 5A69A 1QOXA 2O9OA 3ZJ6A 2GJRA 2PF0A 3SURA 2CKRA 3ZQ9A 1Q6FA 1V3LA 1FFRA 4OOZA 3WNPA 1UD5A 1M7XA 4B3KA 2XVKA 3SUVA 2CBJA 2E9BA 1KQYA 3OLIA 5DO8A 2FH8A 1R8LA 4J27A 1CWYA 5D8WA 4PSPA 2VZSA 6TAAA 5I2UA 2X09A 1HJWA 2WB5A 3VKKA 3ARWA 1LWJA 4B16A 3W37A 3WMBA 1E6NA 2WZHA 1V0KA 4YN5A 2J7HA 3FHAA 2YLAA 3TTOA 3WQ6A 1K6AA 3PTKA 3GM8A 3QOMA 2XVPA 1X6LA 2DH3A 4HA3A 1HJXA 1GPFA 3WH9A 4UQEA 1V3MA 3RDKA 1KBBA 4HMCA 4UFJA 3ZJKA 1B0IA 4PMUA 3SUSA 3W27A 1MW1A 4H2CA 5A6JA 1W1TA 3VMPA 1KGUA 4UQAA 4BZYA 3TOPA 1RPKA 3WD1A 3DECA 3T0BA 3AIUA 5C8BB 1ZS2A 1VEMA 3WNKA 4JCMA 1H1NA 4QDMA 4PTWA 1E0WA 1IT0A 3WH6A 1LL7A 3SUWA 1EGZA 4X0NA 4B9ZA 3I3EA 4WJXA 1DWHM 2ZUVA 2Y24A 4GPNA 3K4AA 4M24A 4BQ3A 1C93A 4UCFA 3I3DA 2J25A 4Z2GA 1KXQA 4JKKA 1FH9A 1W9XA 3NCOA 2VZVA 5HPOA 6A3HA 1FOBA 3GXFA 2WLZA 2WC4A 1CXKA 5CLTA 2WC3A 1CBGA 2X05A 1EQPA 5M17A 1QNOA 1BTCA 4W8AA 1XSIA 2J7FA 3K1DA 1VEPA 4L4PA 3VILA 2WPGA 1ITCA 3UG4A 4V27A 1JI1A 3CHCA 2WCAA 5I23A 2DIJA 4XZBA 3U7VA 3K8KA 3MO4A 1GCYA 3WDJA 1KB3A 3CZEA 4CU6A 1JYXA 1QVBA 4B3LA 2OYLA 4C7GA 1WNOA 3CHDA 2WCGA 5IFTA 1W32A 3OIHA 2YL5A 1TMQA 4PMDA 1JGIA 2PB1A 1WDQA 5BRPA 1DWGM 4D6FA 1B3ZA 2WNWA 3FXYA 2QMJA 3WUBA 4AD1A 2XVGA 3PZOA 1U33A 1KR0A 2VX5A 1FH7A 4UZSA 2EXOA 1ZJBA 3AQUA 1VEOA 2J75A 3RJXA 3WQVA 3BAKA 1E9LA 4M82A 2XIIA 3WDPP 1ITXA 3EDKA 4UFIA 1VFFA 4PUDA 4MADA 3OBAA 3DYPA 2CHNA 3EMCA 4HPGA 5EFFA 1WE5A 2DGAA 4AZ5A 2DSVA 3VDHA 1LWHA 5LA0A 3WBEA 1BYCA 4MNMA 1JAEA 2J77A 1E72M 1F4AA 2XWEA 1UQYA 4D6JA 3OB8A 3WNLA 1KWGA 3WNNA 2D20A 1G5AA 4PMYA 2WVSA 5CQ1A 3W25A 1C92A 3CZLA 4QCFA 3AMLA 2A3AA 2WLYA 3AFBA 1B2YA 4AZHA 1OWQA 1H41A 4K68A 2PWDA 4HU0A 3A3HA 4ZXLA 1C8XA 2VJXA 1WDPA 3EDEA 3OGSA 1JZ6A 1F4HA 3N18A 5ABFA 3BMWA 3WQ4A 4M56A 1PAMA 3LPFA 2J8FA 5CLWA 1CXLA 4CD7A 1JF5A 2WMGA 3CMGA 4AZ7A 3CZGA 3O9NA 5LYRA 1I1WA 4W7UA 1CTNA 1B3WA 2VRKA 1OB0A 1JG9A 1GW1A 3N17A 5I78A 5FCZA 5BXPA 4NZCA 3GH7A 3WMCA 2E40A 2WHLA 2A3HA 2WC7A 4JL1A 1NQ6A 3ZJ8A 3CPUA 4R27A 5DEZA 1CGYA 1NOFA 3BH4A 3VIIA 2WANA 8CGTA 4P7QA 1GONA 3CBWA 2QF8A 1J0JA 1JIBA 3WF0A 1E4NA 2C7FA 2O92A 1V08A 4GINA 4AXNA 5AYIA 1E6RA 3L4XA 1W2VA 1G94A 1JZ2A 1B3XA 3SUUA 2GK1B 3SCRA 1TA3A 3VGHA 3VM5A 1HJUA 2WHJA 1NWRA 2UWFA 2AAAA 3ARZA 2CIPA 3CIVA 2BVDA 3KEHA 2OSYA 4WK9A 2ZUMA 1OM0A 4CN6A 3VDCA 3WFZA 3TTSA 3WF4A 1EHAA 1PX3A 3W38A 1EOMA 2VMFA 1JFHA 5GPRA 3UR8A 4PRWA 3RM9A 4J3SA 3AS3A 3NJ3A 4JFVA 5A6AA 3T08A 3KWXA 1E15A 5ABHA 2PBOA 1J0KA 4AZGA 2BHUA 4DWSA 3EDDA 1JXKA 3PZIA 4FLOA 2G41A 4IUGA 4S3KA 3AS2A 5A2AA 2WK2A 5HXMA 1K9FA 2D3LA 2ZUTA 3EDFA 1H0IA 1LG2A 2PWFA 2WZEA 1HN1A 1BFNA 1VFOA 4JAWA 2YBUA 2DDXA 5CXPA 4UTFA 2WHKA 5HPCA 1SMAA 2OWWA 1YQ2A 4BF7A 3VTRA 3O6AA 4J3XA 4U3CA 4W87A 4FLSA 5A6BD 1X1NA 1WZLA 3ARPA 4L4OA 1UUQA 3BXWA 1JDDA 4UOJA 1JDAA 4WSJA 2D3NA 3QOKA 4W89A 1WPCA 3RO8A 5I79A 3ZT7A 1J0IA 3NSMA 3WENA 3WNMA 3UERA 4HA1A 1BVZA 4MB3A 4QCEA 2DQXA 2IXVA 3T2OA 1ISZA 1S46A 5A94A 2YIHA 3WDHA 3A6OA 2QMKA 3BSGA 3LMYA 3L4YA 2J8GA 1SR0A 5HBFA 2XVNA 2EPMX 1UWTA 1Q6CA 4Z2LA 2QPSA 4MNLA 1DTUA 3PZ9A 4HTYA 4W88A 3MSDA 2A3EA 2Y5EA 4E4PA 3WN6A 2WSKA 4UQBA 1MW2A 3AZRA 5E70A 3GNRA 1W2PA 2PI6A 1KCKA 5CJ5A 3VU2A 2ZX7A 2AOSA 2ZX5A 4KGLA 3MUZ1 2QV4A 3WL0A 1HKKA 4JFTA 1TUXA 4U31A 2MANA 3QHOA 5DT5A 5ABEA 4UFMA 4HOXA 4HOZA 4CCEA 2VUYA 1PIGA 2X0YA 1GQKA 4DM2A 1LLOA 2VR5A 3ARQA 4GQQA 5FOOA 4J28A 4MPKA 3ZIZA 4CCDA 2J78A 1E6QM 1OBAA 1MQPA 1Q4NX 1NP2A 1GOIA 1H3GA 1OGSA 1TA3B 2VZUA 1UR1A 1BYAA 4KMQA 3B9EA 1O6IA
chains in the Genus database with same CATH superfamily
3EPMA 3WELA 5CZSA 4X9SA 3SJ3A 1U1JA 5AFDA 3FEMA 4AYSA 1UQZA 1GZGA 3WLRA 1XLAA 2QZRA 2Y2WA 1VRXA 4TV6A 1G7UA 3BMVA 1SW3A 3L4WA 3WH5A 3G2GA 3U7BA 2W61A 4W8BA 5FF0A 5DX7A 4TVUA 1EJWC 4OUEA 2JEPA 1AJZA 2PEVA 2D24A 1XYFA 3GFXA 3BARA 3I6EA 5H8PA 3PBMA 2Q8XA 3S46A 4B91A 2VHLA 1UR8A 2WCSA 3VD7A 2QJIA 3GDBA 5LKYA 1W3JA 1KTNA 1P4CA 3RILA 3L65A 4JX6A 5FF2A 4YJ5A 5FF7A 2XYLA 4F9DA 1HJVA 1H49A 3KHJA 5T9CE 2F7FA 2YJQA 5BU9A 1DWIM 3VC6A 5EL1A 5D38A 2A3BA 3IJ8A 4OZOA 1R2TA 2CLHA 1JULA 4Y9OA 2HSAA 3FJ4A 4I8YA 3B8VA 2A7NA 3HMCA 1LDCA 1V5XA 3P61A 2A21A 4YVVA 3KLKA 3H7RA 1KTCA 4IIBA 1PDYA 3M16A 1DJZA 3GD6A 4GIEA 3BC9A 1FDJA 2DT2A 2ZUSA 3R0DA 3TJLA 2XWDA 3B9OA 1N8FA 2OOFA 5FL1A 4AF0B 5ABFB 2G4FA 1SW7A 3UWZA 1A5NC 2WVVB 3E0VA 2NV9A 2D22A 1BPLB 2GUBA 1VIZA 2ZA1A 4GNJA 5E93A 2FYMA 1K77A 4C65A 5BRBA 4I90A 3V36A 2DSZA 4DAFA 5IBXA 4NZ1A 1KA9F 2YW4A 3WH8A 2YA2A 3UWEA 2YCLA 1C8QA 5IHSA 2VD9A 1CGUA 4PE8A 3WG6A 2E6YA 1A5SA 2CU0A 2OEMA 5AZ0A 1GPWA 1EA0A 7REQA 5CGMA 1WDWA 2G3MA 3SZ8A 1PKYA 3S5OA 5E0FA 3CM4A 1HIZA 1H5VA 3I7QA 4F0HA 1EPVA 1J5SA 2IW0A 3W2MA 3A47A 4YU1A 3FK4A 1T41A 1UA7A 4R9OA 3QRHA 2V5DA 3C2OA 3VIKA 3H2MA 4DLMA 3B0VC 3IJQA 4U5KA 4W9TA 1E51A 4TQTA 4DJEC 3R94A 4JFUA 5A5WA 2ZBTA 5LGXA 5H8UA 2YX0A 1YNPA 1HVQA 4QEEA 2PDUA 4OT7A 2Z00A 4AIEA 1XW8A 1F74A 3AYSA 2CWXA 4D8LA 3WDIA 3RPTA 1B31A 5CG7A 1J8VA 2QUNA 1Z44A 4OBSA 3VKCA 1FWAC 2C18A 4ATWA 1KFJA 4XZLX 3BCJA 3VUPA 2BNJA 3OLDA 3T2PA 1T99A 4O11A 4RDZA 1XIJA 1SO4A 4OBRA 3ZT6A 3P82A 3QZAA 4HNCA 4BJHA 1XIBA 3CZ8A 1XX1A 3RYSA 1REQB 4UZUA 4E2OA 3PBUA 3NZRA 2WMFA 3PWIA 4FIQA 3NDYA 3LEPA 2AL2A 4LBUA 1PTAA 1E3XA 2CBVA 5H6HA 2PWUA 4R9XA 3E9AA 3F4DA 1KW1A 5BOOA 2A6NA 1GHRA 3SCWA 2WVTA 4WEVX 3NO1A 2XIBA 1IZKA 3D6NA 4C1KA 3CLWA 1UWIA 5D32A 4DYEA 4LNCA 3E5BA 1LG1A 5AOUA 3S2CA 2ISVA 2ISSA 1EYEA 1FRBA 4E38A 4ZR8A 2BHZA 3F4VA 1LQAA 1RK6A 3MCOA 1UP3A 4X0VA 1WX0A 2OLAA 5TIMA 3ERPA 4F8XA 2V5CA 2RUSA 1CYGA 1K8XA 1KFWA 2ZRXA 3MQTA 3P2VA 3LM3A 1OVDA 4M6QA 5IHRA 1JZ3A 2JKPA 2Q71A 3GU2A 5F1UA 1XCWA 2YCKX 5FACA 2CZEA 1BVNP 3MUAA 1Q2RA 3VVGA 5JIPA 1GVRA 4YXGA 1I8JA 3ARUA 2DZWA 4UXDA 1FHDA 5M5DA 2Z28A 3SQLA 1JPKA 4EWJA 2EQDA 3D3AA 2E6FA 3RCNA 3VIHA 3B0PA 3KBWA 5CPSA 1SO3A 1XYAA 3W7CA 1NH6A 1J5TA 2YA1A 3UWVA 4RJEA 3UPBA 1ECEA 2ANUA 1BEUA 4F79A 2XSAA 1WQ5A 3O63A 1R30A 3AOFA 3BVJA 2QCGA 3MKKA 3UT0A 3GZ3A 3IPWA 3BANA 4ZSTA 4PUUA 1A5UA 4XTIA 2GSHA 4KS0A 1W9UA 4PB3A 1NIUA 4WY0A 4HNNA 1THFD 5AYZA 3S3GA 5I77A 4YCOA 3FDGA 1OT1A 4LS2A 1TPUA 4REQA 1D7FA 1C8YA 1GOXA 4XISA 1F9CA 3VGEA 2NV1A 1H7WA 1WKYA 3W6YA 5HMFA 4O0QA 4PH6A 3W1UA 2HE5A 1Q6DA 4WCJA 1HFBA 1V6TA 4KBXA 2POTA 3WQEA 5A8MA 5F4SA 2W67A 3RLHA 1ZJIA 4XBSA 4JFSA 4GO9A 3E0FA 3AXXA 5LNSA 3T42A 3AIQA 1G1YA 3MPGA 1QNQA 1G7VA 2E4TA 4J9JA 2EBNA 4N02A 3UVAA 4AIUA 4FOJA 2OELA 3EA1A 4AHPA 1XDLA 4PFMA 2ACUA 3DKLA 3ZLGA 4JEJA 4Q7NA 2BS9A 1EJTC 2RDWA 5FESA 3BAWA 1E6XM 5HWMA 1ESWA 1W91A 1EP3A 4OU1A 2VTFA 4WOZA 1H4PA 3FDKA 1E1EA 4UFKA 5T9BG 1QI2A 4JIPA 4BQ5A 3W4RA 4C6FA 1XP3A 5A8PA 1VLWA 3B05A 5FSDC 3VE9A 2GJNA 1NARA 4CVUA 4UUIA 3K13A 3VNIA 1TWSA 3GG7A 2VC6A 1XLCA 3CUJA 3ITXA 1OG0A 2V63A 3INPA 2Q02A 2BFGA 1NWSA 1RJRA 3THDA 1LF1A 4HSHA 4DN1A 4MJMA 4IPNB 4F4RA 5IXEA 4NRRA 5F2MA 3WL1A 3C2EA 2IQTA 3POHA 4Z2HA 3WX7A 1MNSA 3PZTA 1L6GA 4CKQA 2NQLA 3IV8A 2IPFA 3QMTA 3NL5A 3DFNA 4IFKB 4AZCB 4O15A 1WAWA 1TJPA 4D2JA 1QMLA 3AIEA 3DESA 4QG8A 1CGXA 1JFXA 1YNQA 1QUMA 1QWKA 5AHFA 1Y5WA 5D8ZA 1ADSA 4ZEPA 1G4PA 1XKJA 4IFRA 3MUCA 3W1RA 3CUIA 3S6DA 1XI3A 1HKMA 3QQ1A 2NXIA 2Y0FA 1IWBA 4MTVA 4GZEA 5CJNA 2PDGA 3U4FA 1D9EA 3PG8A 4MNJA 4TMCA 5LHEA 4JQ1A 3VKJA 3WMSA 4US5D 3OGVA 4OV9A 5BXTA 2OLHA 3GKFA 3S9ZA 2GZXA 2BXZA 5DMMA 5AC4A 5IM51 3OA5A 4H3DA 4GI4A 1GYNA 5D05A 4KGJA 1UMLA 1AVAA 1UD8A 3EKZA 3T81A 4PCSA 3QPEA 1GJPA 3DFOA 3IK2A 3AYRA 2WAGA 4EE9A 3BGJA 4J5NA 1JCYA 4GNVA 3IV3A 3STCA 7TIMA 1EC8A 2IXUA 3C2RA 4E8DA 4GE8A 4J2PA 1QNSA 4C7FA 1LOSA 3RM8A 1VIWA 5LSMA 3N3MA 3W9ZA 3FAWA 2RFGA 1W9PA 3DEQA 5E0CA 1ZL1A 4A05A 4DWSC 1SSDA 2W66A 3N04A 5JVLA 2Y62A 3KRBA 2DVTA 4QNEA 4AD0A 1MYRA 1EBGA 3UGRA 3AHXA 3GXPA 1XYCA 5LIYX 3S5YA 2JIWA 3HPXA 4PBGA 1JRBA 4L1XA 3LBMA 1TVNA 1V77A 3WEMA 2G95A 4S3AA 1KFCA 1NOUA 1J0YA 2CZDA 3HGOA 3CQHA 1IV8A 3RJYA 3CYJA 4CQCA 4MNKA 3W83A 1G0CA 1H7XA 2WNNA 4DBDA 4H7ZA 3ZVIA 4Z1DA 4UIOA 2QF7A 1KFKA 2XH2A 1KRAC 2GJXA 3W3OA 1MMFA 4W7WA 3WY1A 5LA2A 4D71A 2VFGA 3G0XA 3VD9A 5D30A 4UR9A 3AMKA 4GXMA 1S1PA 2C0AA 3TYBA 3FIGA 3RO6A 3GAYA 5U7SA 3M7SA 3Q37A 2VRJA 4QLKA 4ACYA 1XIFA 3G5EA 1VJZA 4JTUA 4ZQOA 1HTIA 4KEMA 2O0TA 1R3YA 2O9RA 2PC4A 4B4FA 3B40A 3BLDA 3KCLA 3ABSA 3IJLA 3QW4B 3V35A 3MBFA 4H9XA 5D9PA 2VX7A 3NDOA 3WQFA 3UJSA 4I3GA 2UY2A 3UZJA 1UWUA 4AISA 4NZJA 1NFGA 2J4GA 1IIHA 2TYSA 4AD4A 1JCNA 1TE1A 1R9XA 4GFIA 4RL3A 3WFAA 3AIWA 1QO5A 2V5KA 1QWGA 4EPBC 3SQMA 3THUA 4GQ0A 1UPPA 3N15A 3O6CA 4CD6A 1LL6A 1E5JA 4ZO9A 2PU0A 1KLZA 3K46A 3DX5A 2QAFA 3BGAA 3MMUA 2V3FA 2Y5SA 1XLJA 1LT7A 4PBEA 1PWLA 3VDAA 4AC7C 2G3JA 3SCPA 3TQ0A 1ICPA 2CPUA 2RAGA 4CD8A 2E5BA 1U2YA 5AECA 2TMDA 2ZC1A 4OHQA 2CITA 2DUAA 2WSYA 1MO0A 4DWDA 4A3HA 3FY1A 4FMVA 3THCA 4H04A 4LANA 2PURA 4PRRA 3S1XA 3MS8A 2OO6A 1QRQA 2YCEA 2NUXA 3GQYA 2X1IA 4TOQA 1F6PA 3ZO9A 4CN4A 1Z48A 2XH4A 4LJ3A 4YTUA 3SGGA 4ZOEA 1CECA 1GTEA 3QQ0A 4HK7A 3V18A 1I2RA 2YL6A 4GUHA 2W62A 3ZXWA 4RZ5A 1PPIA 1L8PA 3NO5A 4YNGA 4IMGA 3QQWA 2XGZA 5EPDA 3TKFA 5D03A 1FY6A 1EBHA 4PGLA 1TJ2A 1XGEA 4QE5A 1FWDC 3GHRA 4JTHA 5IFPA 3EWBX 2W63A 3W6MA 1EXPA 3KOFA 5KZEA 3TW6A 4IIEA 3QR3A 3WDRA 3EA3A 2Z2AA 1NQKA 3LB0A 5TD4A 1DE5A 1O5KA 3SN1A 3F4NA 1OYAA 3GUGA 3FSUA 4JTIA 2P50A 4L5ZA 3VZXA 5A8QA 1EEPA 1OFRA 3E3HA 4H6RA 2JGQA 3OG2A 3BAIA 3LG3A 5EMJA 2QJJA 3U3HA 4C6BA 5HWJA 1F7BA 3MJMA 1PCWA 3J7HA 3QY8A 4WVXA 4DX3A 1LORA 2OZ0A 4DF0A 4U33A 3PJUA 1R85A 1MQRA 5A3HA 1GYLA 3SJNA 2XFFA 2WHMA 1FWEC 4CLMA 4AY8A 5M3WA 3QF0A 2IUZA 3AHVA 2ZZ3A 3ENLA 4BI5A 1Q6GA 1VPQA 3PBWA 3T09A 5LZLA 3B8IA 3VNJA 1K8CA 2PDXA 3IEBA 2BY0A 1FWJC 4MIMA 3KBVA 3S9YA 3KTSA 1TZ7A 2CBUA 3W53A 4MYXA 2Y8VA 4HYRA 2Y5JA 2IKHA 4CQBA 2Y63A 1OFOA 3VD5A 3WFLA 3LCXA 1GVFA 3FGCA 3T40A 1RVKA 3BLIA 3T0CA 1IWPA 4GQBA 4ROPA 3NGFA 3BLOA 3HURA 1J96A 2BY3A 1V02E 1HVXA 4XQ6A 3AO0A 3L2IA 3VK5A 4KWSA 2HVMA 1CT5A 3MV11 4Q33A 1BWKA 1MFUA 4GYKA 4Z17A 4IP5A 1EIXA 3G24A 5K9XA 1UASA 1ZCOA 2J13A 3CPRA 3EWWA 1DIOA 4TVCA 1G9HA 4KRUA 1FH8A 9XIMA 3MMDA 1QPNA 3JW7A 1JNDA 3C0QA 4JHMA 1TG7A 1V79A 3AI0A 3AMGA 3O16A 3HMJG 5BMXA 1RCXB 3OZOA 4O28A 3EWCA 3QKEA 2Z25A 4MY8A 2XTKA 4HIBA 3NXFA 1TRIA 1S2VA 5A6SA 3WBWA 5FAGA 3QTPA 2BY2A 2XZ7A 4H9UA 3GNOA 1Y5XA 3GRIA 5KZMA 1A0DA 1IQ8A 3DHDA 1V03A 2D23A 3CK5A 4G5DA 4C7DA 1XH2A 1K02A 2P10A 2NV2A 5A1AA 4NIRA 3VNKA 1MUWA 5AZ1A 4FX8A 2VVSA 2Z0IA 5A6KA 4RZ4A 3V1HA 2IKJA 4LCRA 2D2HA 4KFOA 4QX4A 5IDIA 4HJFA 1K4GA 3G18A 3IGXA 1Q6EA 2R14A 4Q8VA 3W7HA 3GXDA 3H23A 3DI0A 2GOKA 5DELA 3VI2A 3UR2A 1X39A 2PDHA 3QM3A 1V3JA 2J62A 5EMYA 1LZOA 3S1VA 3QSRA 3URAA 3BSHA 3N11A 1AQ0A 2OZTA 2NZLA 4PUNA 1I1XA 3MO7A 3TDFA 1E4LA 3E5PA 1FHLA 3AISA 1RLCL 3SQSA 2AQWA 3UY8A 3W82A 5K4ZA 4LY8A 1HNYA 1VFMA 4JD4A 1VH7A 2X1TA 2QGHA 1P6WA 3ABOA 3B3DA 4B3ZA 3A4XA 3R13A 1ISVA 3DYMA 2Z7KA 3ITOA 4GD0A 3GNDA 5KETA 3PPFA 4LX4A 5CPLA 4CEXC 2V6AA 4O53A 3W1TA 7TAAA 4GCAA 4GI8A 4ZXOA 4KT2A 3HJEA 3RU6A 1BRLA 2R91A 4KWUA 5JBFA 2QCDB 3P0XA 2YBVA 3GR4A 4X60A 1V4YA 2YDSA 4Q4SA 1ZNNA 2W4XA 1MDLA 1CXHA 3VCCA 4GLEA 3KCOA 1OX6A 4BCEA 3VIGA 3O6YX 1UYQA 2BWGA 2CNCA 2D2GA 1TPEA 5DFAA 3CV1A 3F2DA 1OADA 3ITCA 3MP3A 3RR4A 4ROQA 3OZYA 4MZYA 3PANA 1EDTA 4LBSA 3ZT5A 4D6GA 1EO7A 3EYPA 4C60A 2H8ZA 3AXHA 1NF0A 1OIMA 2V5LA 1E56A 2WMHA 2X42A 3D0CA 1VBJA 1UD3A 4NASA 3V16A 4D6CA 4ZODA 3TW9A 4AH7A 1L2QA 4C6LA 2J6XA 3P80A 1UBPC 1QW7A 4B5UA 3GVQA 4M19A 4JY9A 4C6PA 4B3KA 3SUVA 2CBJA 2E9BA 1KQYA 1PL9A 2PCQA 2FH8A 1R8LA 4J27A 2X1RA 4PSPA 3H12A 2POZA 3CXOA 2REQB 3H24A 4IMDA 1TTIA 1WOAA 3UNTA 1AL7A 4B16A 2UBPC 5HJLA 3SY5A 1WXYA 3ATYA 4A8LA 5D2TA 2X0SA 1E0TA 4F48A 2BGNE 2YLAA 3TN4A 1LRNA 2V5BA 3OU8A 5BOEA 2B7QA 3WZ0E 4UTHA 4BFAA 3PTKA 4JDYA 3B4YA 4GUIA 3L5MA 4HA3A 2DH3A 1F76A 4UTMA 3A4JA 1KBBA 3EOOA 3GVVA 4UFJA 4PMUA 1REQA 1SVDA 1MW1A 1PUDA 4Q8PA 4C91A 1W1TA 3VMPA 1M68A 2V81A 3B0YA 2PD9A 2A4AA 3WD1A 3T0BA 1ZS2A 4S38A 2GWGA 1AW2A 1VEMA 2A1YA 3UCCA 4GHRA 2O7SA 2QJNA 4ILSA 3QMSA 1TX2A 3EX6A 3VUSA 3SUWA 3E74A 1BXNA 5F4WA 4XO7A 3T4CA 4WJXA 1DWHM 4IPJA 2YFOA 4Z2GA 4JQ4A 7XIMA 1KO0A 3Q4DA 4JKKA 1FH9A 4C6KA 1P7TB 2PZ0A 5HPOA 1FOBA 2A3LA 3TMLA 1Z69A 3KBJA 3WLQA 4PODA 1OZQA 4ORIA 1EB3A 4G8TA 4XZMX 3O8AA 5M17A 4BI6A 1NDYA 2NVCA 4QR6A 4XAFA 4WZHA 2V8ZA 1JPMA 1EJUC 3N9RA 3SECA 4FALA 4XZBA 4DF1A 3V7PA 4IG2B 3K8KA 1DQUA 4YWIA 1GCYA 4YVPA 3H22A 3CZEA 1QVBA 2I7GA 4B3LA 4QQ3A 1OG6A 4TU1A 1FKXA 5XINA 2YL5A 4PMDA 4LSBA 3TC6A 1DWGM 2WNWA 1A0EA 4DNMA 4QROA 5C9ZA 3UJFA 1QPOA 2IPWA 3LHYA 1KR0A 5CZ0A 3W73A 5TAOA 3L0KA 4LVAA 1BF6A 1ZJBA 1X7IA 3AQUA 3AUOA 4B5XA 3GK0A 3XINA 3W02A 2HDJA 3BAKA 3WDPP 4BR1A 2OT1A 4PUDA 3L0GA 4S3DA 4FA3A 4AWUA 1YMYA 5EFFA 4GISA 4DZAA 4AZ5A 4N9DA 4JTRA 4LAZA 2E09A 2IKGA 3VDHA 3GVGA 1FWNA 2PLCA 3TWAA 1EJVC 1F4AA 2Y61A 2XWEA 4E3VA 2PSNA 4PTNA 1KWGA 4D9PA 3WNNA 3RU8X 4IZGA 4E4FA 3NVTA 3W25A 3CZLA 1JCLA 3UPMA 4QCFA 4S3BA 3H53A 4CNSA 1Q45A 3MY9A 1H41A 3HO8A 1V7YA 3LDVA 3TK7A 4CEUC 3ITTA 1F4HA 1KM6A 1SZGA 4KPLA 5I3FA 1R6WA 1PAMA 3CIXA 3HFTA 4CD7A 4AZ7A 3CMGA 2WO5A 3CZGA 4RX0A 3OODA 5ENLA 4W7UA 1CTNA 5D04C 2V2DA 4AY7A 1OB0A 1JG9A 4PFHA 1OCBA 2HTMA 1QNVA 2W0UA 3GH7A 3FS2A 3N25A 2I17A 5I3HA 3MI6A 2PGWA 3H4WA 3N6HA 4JTEA 4JL1A 2OEJA 3NL2A 2FTPA 1NOFA 3VIIA 8CGTA 4IMEA 4P7QA 1ZAHA 3KVLA 1HO4A 1EPXA 4L61A 2QULA 3QZEA 4AXNA 5AYIA 3ITVA 1JZ2A 4ML9A 2PDJA 5AKQA 1T96A 1IEWA 4I5RA 2AAAA 4UTTC 4IF2A 3BLLA 3KEHA 3NGJA 1RD5A 4QRNA 1N55A 4GQGA 2PDPA 1EFZA 2ZUMA 4RV3A 1H63A 5K9CA 3Q2DA 1CLKA 3UZZA 3LLFA 4L9YA 4US6A 2ZADA 4S39A 2YXOA 4RCXA 3EXTA 4MZ8A 3QC0A 2GOUA 4AAJA 2VMFA 3B8TA 3SFKA 4HK5A 3TYCA 5GPRA 3PF3A 3IRSA 3PAOA 1DTNA 4J3SA 4Y9PA 4JFVA 5A6AA 2PBOA 1J0KA 2ON3A 3EDDA 1Q13A 2CW6A 4H9ZA 1H7NA 4IUGA 1POKA 3K5XA 5AVNA 1YPXA 5DRCA 3BW3A 1P0NA 5HXMA 1K9FA 3FLUA 2JKAA 5KINA 4YCPA 1R3WA 4EVZA 1BFNA 1LUCA 5F2GA 4JAWA 3W2NA 2CLFA 4HU4A 2A0NA 2DDXA 1IEIA 1SMAA 1RA5A 3MHFA 1YW1A 4AVOA 4BF7A 4ZB5A 4OVXA 4RNFA 1WZLA 3PSWA 4FHAA 1JDAA 3PB0A 4ZOAA 4WSJA 4W89A 1WPCA 3RO8A 1J0IA 4E5TA 4EXAA 1SUXA 3PAJA 3WENA 3WNMA 5FI8A 4G7EA 4QCEA 2DQXA 3KOWA 2IXVA 4V15A 3BZGA 3EAUA 2QDEA 3BSGA 3LMYA 3L4YA 3ZWSA 5HBFA 1GEHA 2EPMX 4JNZA 1DORA 3LCIA 3DXIA 4Z2LA 4ZMGA 2WQDA 1KC7A 3MSDA 5DBUA 5FJRA 3C86A 2A7PA 5E70A 2X1UA 1KCKA 5CJ5A 4XKYB 5FF3A 3NPVA 4JR5A 4QG9A 3H2NA 1TUXA 2YCJA 2PTWA 1XCFA 3W7KA 2X0YA 4V33A 3AXKA 1LLOA 8XIMA 2XISA 3FA4A 3TFXA 1Q65A 4CCDA 2INZA 2J78A 4BWLA 1E6QM 3E2VA 1H3GA 5CC5A 4LAUA 1YX1A 1NEYA 3L0NA 3W1MA 3W71A 2D69A 1FP9A 7REQB 1R38A 4PCFA 4AD3A 4AEOA 3CUFA 2VENA 1NWTA 2FHCA 2VDIA 1IWAA 4JFWA 4U2YA 1LM1A 4D6EA 5DMYA 1TV2A 4Q8OA 5BU6A 1H5YA 3LXBA 4OBTA 4HZ7A 3SO7A 3SUTA 3EWUA 4GO8A 2OXNA 4JNMA 4L1GA 5C9XA 3UZWA 7A3HA 1WP6A 2DSKA 4KESA 3N12A 2ASHA 2E6AA 3DFHA 4S3CA 3SW6A 3CGTA 4S2CA 3A9BA 1DJXA 1K8ZA 2V3DA 4N4QA 1OK6A 3NXLA 1FFQA 1P48A 3WQOA 1J0HA 3EBVA 3V5FA 5CAHA 3MMWA 2VVNA 2ZUNA 3CWOX 1YPIA 3GZAA 2DT3A 2FPTA 2X1SA 1GWJA 3LSBA 4XVEA 4H8VA 1YXCA 4LNYA 3GE7A 1RV8A 1JL8A 4PUKA 1WDRA 3FA5A 5B7YA 4PMZA 3I4KA 3T0TA 1SZNA 2ESCA 1NSJA 2REQA 3V5CA 4M8UA 2F8QA 3P93A 2B81A 1UCWA 3LN3A 1H0GA 2ZVIA 3G3DA 1SU5A 2QW5A 4GXPA 1JI2A 2CZ5A 4I8DA 1JCXA 4GXWA 3BOFA 3EMQA 4ZE5A 4QSHA 3APTA 1EOKA 1ISWA 3T2QA 1UKOA 3KL3A 4QE1A 3FYYA 3ARVA 4S3GA 4FI4A 3M0YA 1VAHA 3WK0A 2GGGA 3VOCA 4KF1A 4Y96A 1Z8AA 1IEVA 3CUXA 4LB3A 5DCBA 1WAUA 3NNTA 1UD6A 1CXIA 1ME7A 1V0NA 1GOQA 3HG3A 1ZP3A 4P7RA 2VCBA 3ZVHB 1PTGA 3AAMA 4S3FA 4QAWA 4MB1A 4C5YA 1IZCA 1R7AA 3KP1A 3DHPA 2IPJA 3KRUA 3FVDA 3PUDA 4CD4A 1IIGA 4PMVA 3W1XA 3ES7A 1XRVA 5K7JA 4KWWA 1A47A 4M1RA 3W07A 2WYSA 5CZJA 5GNZA 4TIMA 3QGKC 2ZICA 1RY8A 1BQCA 1WO2A 2GQAA 4GH1A 4O17A 5FJOA 5CPMA 4UR7A 3LSCA 2QCHA 1XDMA 4W86A 1KRCC 2JEQA 4MJ2A 4H8HA 3R8RA 4M7SA 1T40A 5SWUA 1B3OA 2BVWA 2VWTA 2XM2A 3VM7A 2P76A 3URNA 4M5PA 3PFRA 2PWHA 4TV5A 3MKVA 3FJLA 4PZVA 3HM7A 5AHMA 1UIPA 4Z0JA 2QDHA 1EJSC 4PRTA 1Q8JA 1UH2A 1FWBC 1ZU8A 1SFTA 4KH2A 1LCOA 5DT7A 4WLCA 3KDOA 3L2MA 1HUVA 3MI3A 3SBFA 4K39A 4FX6M 4FXJA 1V6XA 2QGYA 5LIXX 3HG5A 3KVMA 3W86A 4KFPA 3WLOA 5GJPA 5L6UA 1XUUA 2XPKA 1GNXA 1U30A 2GUYA 3VOJA 4BKNA 3QFWA 1PKMA 3W70A 1DL3A 2PP3A 1K9TA 1DHPA 5DF0A 2FZMA 3GDMA 5EU9A 4CD5A 3YPIA 3GDKA 4N6EA 2PPGA 3TFCA 3O6DA 5FD0A 3EGJA 1PYFA 1PZ2A 2OEKA 3TC3A 2DZVA 3WF2A 1A3WA 1XIDA 4X61A 2E68A 3EB2A 4IXXA 1XCXA 1I2NA 3CUHA 1YXDA 1QU4A 1PZ1A 4QLJA 4ECLA 2UZ9A 4XTDA 3SEPA 5F1VA 1AK5A 1MZHA 2EPHA 2J74A 4HU8A 4NX5A 1AFSA 3IJ9A 4WGXA 2DZBA 2FGZA 1A5OC 3TZNA 1AQMA 3PUGA 4NQ1A 2WZIA 2A2IA 4UTUA 4HPNA 3GHUA 1ZJAA 3O05A 5FIPA 1TPB1 4RE0A 4MSSA 2ACQA 2GJXB 1GTHA 5LHFA 3V4BA 3CHFA 2GL5A 4LALA 1LBFA 1QPRA 2DSUA 1GYMA 1SO6A 4D6DA 3AXMA 3M1ZA 5H1WA 4RW5A 4MFEA 4JTAA 3BGGA 1ZGDA 1KGWA 1QATA 1WDSA 3UCDA 5CPNA 2J24A 3P67A 3REQA 3SRHA 3S6OA 4D72A 4TXEA 4YHEA 4DUVA 2GQ9A 3O15A 1OCQA 3G6MA 4FOKA 4L64A 1GOKA 1ZP4A 2OB3A 4PMJA 4FNQA 4DPQA 4KQNA 4Q8NA 3EA2A 4DB7A 4F2BA 2INFA 4FXRA 3WK2A 4NAFA 1NFPA 1PKNA 3P14A 3IARA 3NPUA 2PFHA 4NJGA 3ALGA 4PMQA 2ZDRA 2Z6JA 2H9AB 2F2HA 1L6SA 4GA8A 3ZSSA 2YBTA 2WXDM 4AYGA 3WIJA 5CPTA 1RUSA 1Q7MA 2OWCA 4HN8A 1QTWA 3N9KA 1J6OA 4I7WA 2FJKA 4H83A 3NPXA 3HG4A 2Z24A 3EKLA 5FJPA 3NM1A 1LJYA 4F0LA 3C2FA 1KWKA 3LLDA 5H2ZA 3HPZA 8RUCA 5IOBA 2CBIA 1RP9A 3UESA 4JZ5A 2A79A 3W1AA 4Z1BA 3RX2A 2Z1BA 3LLXA 2NX3A 4HJWA 2TAAA 3TTEA 3T0DA 3QHNA 3U5UA 2ONEA 2J6VA 3GIYA 5D9OA 4I5UA 2FQIA 3G22A 4JKLA 2X0HA 3H7VA 1GG0A 3PP7A 4GUGA 3DFSA 4NY2A 4NUWA 2AKMA 1A0CA 2Q8LA 3LGEA 4DM1A 2DUXA 3EWYA 4DO4A 4DLFA 4MFDA 1BSIA 3LCWA 3HTWA 4RPPA 4HNOA 1JD7A 2GFTA 3ONCA 4JNYA 5LIKX 5DY2A 3VZYA 1DBTA 3AHYA 2Y7FA 1XPGA 1J0ZA 1YDYA 4PEKA 1NTHA 1R2SA 5F7UA 1ITUA 4IFOA 4GMEA 1V6VA 3FOKA 4JQAA 3S2LA 1PX8A 1BG4A 1F8MA 4DUWA 4LGXA 5B80A 1ODZA 3LHVA 1UC5A 2J7DA 4JTTA 3TWBA 3M47A 1E0XA 1F07A 2R6OA 3WEZA 3TAKA 3U2EA 3W85A 3NUKA 4GUJA 1V7AA 3W1PA 2INEA 1UR4A 2Z29A 1KNWA 4PCNA 1RP8A 1Q6RA 3SY1A 4F3HA 1OINA 5FEWA 3OP2A 4PSRA 2V2CA 3FW6A 2O9TA 2CLOA 2AQVA 2PDQA 2ICSA 3PBGA 2FPYA 2VI0A 5I3KA 4PA8A 1Z9AA 2J7CA 1W1PA 1XLFA 3VGDA 5IRPA 2RGMA 3T9PA 4UOQA 3WUGA 3TXVA 1DXFA 1LQ0A 1J6PA 4DI8A 4ERIA 3HOJA 1MW3A 3T6CA 1PCKA 4E2DA 5TF0A 4F2UA 2VEMA 1PX4A 1X6NA 2VYOA 1LOQA 4W8LA 2GSJA 1XM3A 1Q8AA 1EDQA 4NF7A 4TTUA 1O5QA 4JX5A 1EQCA 2VOMA 2Q8ZA 4MVAA 2F6UA 3CQ0A 5CJMA 3V0UA 1W1YA 4IH3A 1E6SM 3UNDA 1ONXA 1KM3A 2VZOA 3GW3A 1J12A 4ZQPA 3E0LA 2BODX 1RR2A 1XYZA 4AG0A 3NVDA 3W2KA 1K7XA 3VOIA 1TWZA 5A2CA 2FHBA 2DW6A 3W7NA 5HUOA 1H62A 4AZBA 5C2GA 2PDBA 2ZTJA 3LHWA 1FWTA 4AD5A 3N2OA 4I9MA 3BMXA 3SIZA 4FZIA 4IM4A 1WBJA 5HNUA 4DQWA 1DPMA 4QS6A 3W28A 3D5HA 3LPPA 3F4WA 1GKQA 3ECQA 1NP0A 3K4DA 2JF6A 3LBOA 4HZ8A 2QPUA 3AJ7A 3WQ8A 3RPDA 1X8FA 5BWFA 3B4UA 4EPEC 1XIIA 2F6XA 1G4SA 3UZ5A 2GK1A 3VOHA 4NP7A 1Q66A 3W22A 1EC7A 1RCQA 5XIMA 5BRQA 1GVYA 1KCLA 2Z1SA 3LV5A 1JUKA 5CZTA 4JQ3A 1X97A 1DXEA 3R43A 1SYTA 1C3FA 1Y65A 4JYEA 4KCTA 2YSWA 4REQB 2VQTA 2CKSA 1AA1B 1BHGA 3TYZA 4KIRA 3R5EA 1NOWA 5HJYA 3H8AA 5AHLA 1W1VA 3NEVA 4DO6A 1GQJA 1RSCA 3PUEA 2Y7GA 2VZTA 3IUDA 3VKDA 4FOUA 4NJKA 2V5JA 3Q45A 4BS0A 2JKEA 3E2RA 1GQLA 3II1A 3E96A 5C2CA 1P0KA 3MVTA 3BLKA 4IQDA 4EXBA 3LNMA 3QMRA 3M0ZA 4CU8A 3AS1A 1W3KA 3NAVA 1Q2SA 4L56A 1KRMA 1LWIA 3DI1A 3RITA 5HNRA 2FKPA 3KBNA 2BVYA 3NQ7A 2PTDA 1WDDA 4NYYA 1JJKA 3ATZA 1WCGA 3E1F1 3MMTA 3MW7A 3KBMA 2EG6A 3SCUA 2PTYA 2GUUA 1OFBA 1U5HA 3STGA 3RMJA 1QPKA 2GVGA 3UP8A 3SDOA 3W23A 5CKSA 2JGYA 1X96A 2X7WA 3CO8A 2WVVA 4JCLA 1KRBC 3ARSA 3SCTA 2WMIA 4CCZA 5MKGA 1HT6A 5KITA 1IZJA 3EKGA 5JH1A 4FXFA 3NG3A 1UR2A 5JMUA 4ZO6A 2SFPA 4PTXA 3RUBL 5HMDA 2F6KA 3N73A 3QV9A 3UG5A 5I5RA 4B2DA 3CH9A 1DEDA 1TTQA 2PUZA 4QSFA 3C0LA 3UW6A 3EX2A 3E49A 1DJGA 1SFLA 4WKAA 1A5CA 3VIOA 3U5YA 2VUNA 5I24A 1FA2A 3P8JA 2V67A 2ZXBA 4ALDA 1BGAA 1GT8A 1Q3NA 3WQDA 4EANA 5LXEA 3UA3A 5C54A 1CEOA 2UY5A 2XIJA 4R7OA 3IAPA 5EBAA 4DXVA 2GVYA 1V6WA 1F3XA 3W0KA 1P43A 4LRSA 3BOLA 5FL0A 4K8GA 2XSBA 2ZE0A 4HT3A 5TQLA 1O94A 4NJHA 1KFEA 1QBAA 1EJRC 3GYEA 4AMAA 4Z0SA 4DXXA 1KKRA 1DJNA 4JS3A 5C9UA 1AD1A 3UFYA 5AB3A 4BY3A 4DWSD 3MJYA 5REQB 1YRRA 1W5OA 4DHGA 4N4PA 2Y1HA 3B9AA 4W93A 2JIEA 1S38A 2FZNA 1XISA 2QDGA 1FDYA 4XIMA 4IHCA 1XUZA 1PEZA 4XZWA 4QG6A 1MQQA 3E0WA 3R79A 1MUMA 1U1HA 4RE2A 4PMOA 3S47A 1L0PA 1EX5A 4H9VA 2VX6A 5GVJA 1ELSA 2W79A 3VKAA 1KV5A 5LA1A 3ZS4A 2W3ZA 5EFDA 5E6ZA 1QI5A 1BQGA 3MI2A 4FNPA 2CFFA 1JUBA 3GDLA 1D2KA 2YDRA 3CZKA 2E67A 3OQ8A 1XBVA 4HMDA 1XLEA 3W7LA 2DZSA 1SQ7A 2OKTA 4DJDD 3V0TA 4H8NA 1H51A 1OGBA 1ZUAX 2BBFA 5AHEA 5BNKA 3AZTA 3NR0A 1C91A 4NX0A 3QGVA 1VP5A 1UPMB 4JTLA 2QUUA 3V75A 1LBMA 1XIEA 2VL4A 1DVJA 2TSYA 2VOTA 1J2WA 2NT0A 1HF6A 2VQUA 1G4TA 3CEPA 3PZQA 4GBUA 1A50A 4DBWA 3F5JA 3UG3A 3XISA 3NURA 1MEIA 3F2BA 3LCLA 2PDKA 1OIFA 2AL1A 3I6TA 1CGVA 3ZVHA 4GYFA 3M5XA 3CAQA 2WWDA 4NJJA 1NF7A 2B7PA 2CXGA 3UZXA 2AGTA 5E1QA 3RLVA 4U2ZA 1CDGA 1UZHA 4PN2A 5M03A 4J4KA 3DG7A 2R1MA 4LF1A 3WJYA 4PL1A 1TIWA 4IIDA 4KW2A 6ENLA 2VEPA 1KQZA 4GI9A 1HKJA 3RHGA 2PP1A 1PE1A 4U5IA 1HJQA 2W27A 1NM9A 3HFYA 7PTDA 3ZR6A 1ODUA 2J47A 5A8OA 5CZKA 4PL2A 1VLIA 4M80A 3HPAA 1KR1A 3LXAA 1VFHA 3B03A 1J93A 3D47A 3JVAA 3NSNA 3GNPA 1TTPA 3T7VA 2FPVA 4HSOA 4GK8A 2ZX8A 1XQLA 1RQBA 3A4WA 2Z1KA 5DQPA 3USBA 3MCMA 1W3HA 3HG2A 1QNRA 4N0RA 3WLLA 1N82A 4QBXA 4V1XA 3QLLA 1FP8A 1UD2A 1UP0A 2HK0A 3BLPX 2D2OA 4JBRA 2G4JA 4NAEB 1E43A 3QR0A 1GQNA 1GVIA 4YHGA 3FKRA 1S5WA 5HA7A 5JIWA 3F5KA 1ISYA 2QT3A 1YE4A 4GKTA 1WYIA 4C6NA 1ZLPA 3KTXA 4IGHA 1XIHA 4C1NA 2A5HA 3FNDA 3HQNA 1O68A 5HMEA 1UWQA 2QDDA 3VD3A 2Y7DA 4S3EA 4AY1A 1PHQA 5JXQA 3PY2A 5DMNA 1LOLA 1FWIC 3AZSA 1LQ2A 1TKKA 3TN6A 3TP4A 4KEVA 3THQA 3WQWA 3KOXA 2GDUA 4KETA 4ZFMA 4AXKA 1OX5A 1QNPA 4AC1X 3ITGA 1AL8A 2WJFA 2R9RA 3ZJ7A 2VXNA 4OWGA 1FDZA 2IS7A 2P0IA 3PFMA 1W6TA 5BMWA 5HWNA 3CUGA 3R10A 3NQDA 3CL6A 4FK9A 3OBKA 1QFEA 1ZBWA 3I65A 3SRDA 3GHSA 3DDMA 3GC2A 4XD6A 3OQEA 3KS6A 5DN1A 3GFYA 3O1NA 2CZFA 1XV8A 3G1DA 4L1WA 1PYMA 2OU4A 3PPHA 1ISXA 1FWWA 2GVEA 2CC0A 3CUZA 1UA3A 2XIMA 3U2ZA 1UB3A 3Q67A 1O60A 5C2XA 3OLEA 3VOGA 1MWOA 1A5KC 3MUY1 1HG3A 2VM8A 3TX9A 4I7UA 3UJ2A 3WQCA 4H7CA 1V6YA 2BOGX 2BXYA 3AWOA 1EWDA 1ZPTA 6TIMA 4Q4KA 5CSSA 5DANA 3L9CA 3T55A 1EL3A 3LTPA 4WRHA 4IXHA 3VD4A 2V9DA 4GIYA 3PSVA 1WUEA 1ZAIA 1FCBA 2EPLX 1DP0A 1X98A 1XGZA 3IVTA 2PLMA 3ZJ6A 5HATA 2GJRA 3SURA 4J3ZA 1XC4A 3NQVA 3C61A 1UJPA 1XS2A 1KBIA 3OLIA 1MEHA 1CWYA 1M1BA 5D8WA 5AYYA 3PVFA 3PJWA 5I2UA 1HJWA 3M0LA 1LWJA 2R1PA 1E6NA 3M6YA 3S8HA 4IL0A 1WXJA 5EMLA 2ZZ7A 4IGMA 3W1QA 3OHMB 2VGGA 2J7HA 1Y5VA 3BK0A 3WQ6A 3KP0A 1K6AA 3DFTA 3GM8A 2XVPA 4Q4QA 4HHLA 1HJXA 1GPFA 3WH9A 3I4EA 4O50A 4QGCA 1XXXA 1I2QA 3RDKA 4HVXA 3RAOA 1Q7QA 1B0IA 4KFNA 1ZCCA 3R1ZA 4UQAA 5C9WA 1T8QA 4MWAB 4UTWC 2ZZ5A 2PS2A 3ZR4A 3WNKA 1Z3NA 3JRKA 1H1NA 1E0WA 2ZRUA 1F6YA 3M0XA 4C6JA 4X0NA 3SRFA 3I3EA 4XBKA 1W56A 2QCMA 2ZUVA 4GPNA 1YADA 1C93A 1WV2A 3TUUA 4LW7A 1W5NA 2HS8A 1A3XA 1W31A 3CYVA 4ASTA 1CB7B 5GJMA 6A3HA 6XIAA 6REQB 3T44A 2WC4A 4R34A 3CTLA 1EQPA 4JEQA 4JN7A 2R94A 1J2BA 4W8AA 1XSIA 3VNMA 1ITCA 2Y6ZA 3RK8A 4CNOA 3OHIA 1JI1A 3CHCA 3KWSA 2BSLA 4NILA 3WLKX 5I23A 3IJIA 3W88A 2R1NA 3U7VA 2XU2A 2QJMA 4IICA 1TTJA 3WDJA 1JYXA 1SZRA 4A29A 5I02A 2Y70A 4DO7A 4C7GA 5IFTA 4WY0F 2YR1A 1P1MA 1JGIA 2NX9A 4CNTA 3EOUA 4LVGA 5BRPA 2R1LA 3A12A 3C6CA 4LU0A 1IT7A 3IACA 2QMJA 3WLIA 3R8GA 2V0TA 4RZ6A 2QNEA 4GX8A 3DGRA 1N8WA 4H6KA 1V93A 2EXOA 4RKAA 4MKNA 5CCZA 3UF9A 3S9IA 1L6WA 3GTFA 4BK9A 2YDAA 3AYVA 3WQVA 5FJJA 3FSTA 3A3XA 1ITXA 3CC1A 3K2GA 4MADA 4YL2A 3DYPA 3C4UA 3CASA 3LHUA 1W1B1 1KM2A 1LWHA 5LA0A 2ALRA 4PUJA 3RR1A 4MNMA 1JAEA 1KBJA 1BKHA 3BLEA 3OB8A 1Q85A 2D20A 2IMRA 2WVSA 3QN3A 2YPIA 2GDQA 4JQ2A 3AMLA 1PB0A 2A3AA 2WLYA 1B2YA 1H61A 4JIHA 4HU0A 3HQOA 5JQ9A 4MMWA 1D3GA 3WBXA 5FJIA 4ENLA 1R9ZA 2NVAA 3NO3A 5AHNA 4UR8A 3GG0A 1FHVA 3B0XA 2BB0A 4HKPA 3WQ4A 3QTGA 3LCHA 1SFJA 3LPFA 2J8FA 1CXLA 2IQDA 5LYRA 2FZBA 4IPPA 2E1WA 3FJ6A 2WZMA 1TV3A 3QPZA 2VP8A 3N17A 3UQNA 1KCXA 4R7WA 3WO8A 3CMFA 2WHLA 2QXWA 1A80A 5M2FX 3FXGA 2WQPA 1ZSXA 4KWVA 5D2WA 2WANA 4EAYA 2ADAA 3GIPA 4IQLA 5MHBA 4XVDA 3JU2A 5LGZA 5LNUA 1E4NA 3W72A 5AHIA 4NL1A 3L4XA 1W2VA 1G67A 2J88A 1Q4WA 2WNZA 4BF9A 1TA3A 3GWQA 4WJ8A 3VM5A 2B0MA 4YLWA 1W5QA 2R24A 3CIVA 4G1KA 4H01A 4WK9A 4LUTA 1F3WA 1M7PA 1EZWA 1PXGA 3URBA 3TTSA 3WF4A 4U28A 3W38A 3UY7A 1PHWA 3G1RA 3H70A 3DBNA 1U22A 4I9AA 3BJFA 3OVQA 1EF2A 3NQMA 4FNTA 1DJIA 4PRWA 4KCVA 3H4GA 2ZCGA 1GG1A 4DXKA 3QLDA 4L80A 5BWAA 5ABHA 3RN6A 4AZGA 2BHUA 3QEZA 1JXKA 3C3NA 4XZHA 1R3VA 1XG3A 4S3KA 3AS2A 5A2AA 5C7VA 3A5VA 2GQ8A 3W00A 3MT1A 2YXXA 2FFCA 4LVDA 1H0IA 2E5DA 2WZEA 3NWRA 1E1CA 3IGUA 2Z1VA 1PV8A 4Q7IA 3GVWA 5HPCA 2OPJA 3I7RA 3VTRA 1A5MC 4U3CA 2FB2A 2BG5A 3KVJA 2ZE3A 4Y9AA 3ARPA 1UUQA 3BXWA 4LB4A 1XGDA 4IOTA 4LUYA 2PTXA 4UOJA 1KM4A 1S3HA 2Z1XA 2C1IA 3DU0A 4M7TA 4YTTA 1WXZA 3E02A 4LBRA 1Q6QA 4FSAA 4CQ9A 3UERA 2G5WA 3CH0A 4MB3A 1OFAA 1OYBA 2YIHA 3WDHA 3A6OA 2QMKA 4WX2A 1L6FA 4L4MA 2XVNA 4HHPA 1UWTA 1Q6CA 1JEZA 2VD8A 1DJYA 2QPSA 4FIRA 1FXPA 3F1QA 2HZGA 3TH6A 2WSKA 4F0KA 4G56A 3BL3A 5D02A 1RA0A 3DENA 1SSGA 3VU2A 3UWWA 2ZX7A 2ZX5A 4IG2A 4KGLA 1TPH1 1WKFA 3WL0A 1HKKA 4IX0A 4JFTA 4U31A 3TE9A 3C52A 1X1ZA 4HOZA 2VUYA 4GY7A 1QJWA 1ONWA 3AYTA 3ARQA 4GQQA 4O4VA 1ME8A 4G1NA 1BXCA 2ZZ4A 3M5ZA 1HZYA 3R25A 1MQPA 3L21A 1Q4NX 4JN8A 4B5TA 1OGSA 3S1GA 1UR1A 2O55A 1PVNA 4J35A 4CGTA 5G4HC 1O1HA 2OYMA 3W7QA 4TMBA 1OD0A 4XK2A 4GZIA 3OVGA 3CS2A 4AQLA 4HCLA 2BOFX 4H41A 3ORWA 3TU9A 4RV8A 3H7UA 2YLLA 4O0KA 3P5ZA 1XIGA 4Q4PA 1BKSA 1J18A 2RHGA 5GNYA 3MZ2A 1U5VA 1W3IA 4Q22A 2G37A 5EGRA 1H09A 5A2BA 2VC7A 4DPPA 1GVSA 2YGYA 4FF7A 3AJXA 2EPOA 3W7EA 2DP3A 4HOWA 4MDPA 3IK4A 2FZ8A 2YZRA 4V1YA 3DC8A 2CLPA 2P0OA 2EO7A 1C8VA 4OQVA 3WJSA 3TONA 3VGGA 1HKIA 2DZXA 3NL3A 1E73M 3S6TA 1V6UA 4UWMA 1J9YA 1MXGA 3B8SA 2YL9A 1XLBA 4O52A 2PLJA 4GY0A 3U57A 2FVMA 4BHYA 1DHKA 3LHZA 3NM3A 4FNRA 4HCDA 1TFVA 3ISIX 2DUZA 1R3SA 2A3CA 1UKQA 3TQKA 2CWNA 1TV4A 1IE7C 3TR2A 3W1NA 3M64A 1KGXA 4R7JA 2HBXA 3MSGA 1K8YA 4P8WA 3N2TA 2BDQA 1OFEA 2HV5A 2EEXA 4MAZA 1BRLB 4MGGA 4UTIA 1CIUA 4UQDA 2OFJA 2DFAA 5H8MA 3WQGA 4N42A 1OABA 4QM1A 4Y7EA 4D8ZA 1C9DA 2XFWA 3UXIA 4ZENA 2OWXA 4LCQA 5A6BA 1TCMA 1AQHA 4DY1A 2DQWA 2X8RA 4M51A 4PMXA 3L66A 1KV8A 3WLJA 2WSQA 4NRSA 1YBQB 2PLKA 4O19A 3UZYA 3CB3A 3HU7A 4P2VA 3L4VA 4LXFA 4RXFA 4GI6A 2DPEA 2NQ9A 5G1YA 3W7GA 4DRSA 3HQPA 2E8YA 4B5VA 3MDUA 1HXJA 1IR1A 1C90A 3OYXA 4R33A 3BPWA 1JUEA 4X2RA 1ZBVA 5DMLA 3KE0A 1C9WA 3W2JA 2HPMA 1L9WA 1PDZA 3F5LA 5D9NA 3U6WA 3B0UX 2CESA 1A3HA 1O4UA 3TJIA 1RCOB 1IEXA 5LXXA 2D0GA 3WSUA 4LRTA 1EDGA 2E0PA 4LAOA 1XHGA 3O0KA 2VWSA 3GXMA 3WJXA 1XRFA 3L7RA 2GJPA 2WKLA 2G8ZA 3O07A 4IMFA 3USZA 4H9MA 4AWEA 3BCFA 4LT9A 2YKKA 2NXHA 4MUPA 3MZNA 1FWSA 2O56A 1H1ZA 4XG1A 4I7VA 3UJEA 3SSZA 5CC3A 2YDQA 4UNKA 4IISA 4CCCA 4ZFCA 3S2NA 4IPLA 1UKSA 2PTZA 3GB6A 2I14A 2DORA 1FCQA 4NAFB 2J9ZA 5A6TC 3LV6A 1JYVA 4EAMA 2ACRA 1OZMA 3NEHA 5HR6A 4WKHA 4Z1CA 1X1OA 5CC7A 1HP5A 3WQ5A 1JDCA 2Z4GA 3EX1A 2X41A 4GKLA 1UOZA 2X30A 1DQXA 4H2HA 5C6MA 3PWGA 3TTQA 5BXRA 1PZ0A 4HBKA 1OSEA 3C5QA 4O13A 3LNPA 1UWSA 4M81A 5EBUA 1JAKA 1OJXA 1UZDA 1SZEA 3G1XA 4UQ9A 4YYCA 3FYPA 3U2OA 6XIMA 5CSUA 2GQ3A 3S1UA 1NELA 2QPXA 3AIBA 2VEGA 4E2BA 4W4QA 4DIAA 1RZMA 3W84A 2FJUB 4PR4A 1E5NA 3CZJA 4CU7A 3VC5A 5AYBA 3N13A 3GH5A 4O57A 2GSEA 1QI4A 1RBAA 4MAVA 4NI3A 4UTTA 1XLDA 1UHVA 3LU2A 6PTDA 3W76A 3GSMA 4Q3MA 4N9CA 4L6OA 1QI0A 1VFSA 2E1DA 2KZHA 2J66A 2NW0A 2CXEA 3K8LA 1RBOB 1YHTA 1ZB5A 2OZ3A 3QHMA 1RAKA 4UQCA 4EF8A 3UWYA 4DZIA 4P8XA 4XAYA 2X40A 1XRTA 1DE6A 3GC5A 2Q3OA 3TSMA 2Z6IA 3A3WA 5D4YA 3B9DA 4NT0A 5JUVA 3EOEA 3KX6A 4XD4A 1TIMA 5GQBA 1BF2A 2G3FA 3QZ6A 3PZGA 1EHNA 3GXIA 1RXOB 1QPQA 3CQJA 4PUWA 3H2CA 3SCVA 3B8UA 4X9YA 5IDZA 4QEHA 2XM1A 4N2YA 4US5A 3AROA 4HU3A 2CCRA 3RM4A 4Y2WA 3NQCA 5HDRA 2CLKA 2EPKX 3OO2A 4WUIA 4AEFA 1BG9A 2V69A 3LGGA 2DY3A 3GC4A 2C14A 1EGVA 3EWXA 4ADUA 4U4MA 3W75A 5FKYA 1FKWA 2DU2A 3SR7A 2DVUA 4MWAC 1SJCA 1AH4A 1P5BA 2HRWA 5HNNA 4ZTYA 1MXDA 5CBIA 2ACSA 4GOAA 2DT0A 3GBEA 4F2TA 4W5UA 3MYOA 1WKEA 2BGSA 3W7JA 3EPNA 1UH4A 1OYCA 1WZKA 4DVOA 2QCCA 3MP4A 2VFIA 3G1YA 4N9EA 4RW3A 4GBDA 4O18A 4DJEA 1GW9A 2KAUC 4LS1A 4QISA 5D9MA 3A5FA 4C90A 2ISDA 1EO5A 2RJGA 2UY3A 2HE8A 4MB5A 3BURA 1P1XA 3WD3A 1F5ZA 3LUTA 5ECUA 2RDUA 1K03A 4CQ8A 1G01A 1J11A 1TV5A 2QQ6A 3GY1A 1MXSA 4G9PA 2WPBA 2W5FA 4IIGA 2QR6A 3BOXA 4GGHA 1F61A 1MRAA 3LPOA 3E6EA 3TTYA 3HV9A 5G4EA 4C1LA 4ZQCA 2QCNA 1EP2A 2YA0A 4JX4A 4TX6A 5T8GA 2J7BA 1WA3A 3MV01 4Q7BA 4J3WA 3W26A 2PBGA 1IXPA 4Q4OA 3TQPA 4Z2IA 3LYEA 3UR7A 5CBBA 1VBUA 4P7OA 3BW2A 1E1FA 4IQEA 1JZ7A 2GGJA 4D1IA 3RX3A 2C79A 3PTQA 3GTHA 1XD1A 5A6LA 3STFA 5D2VA 2WKJA 1I6NA 2YW3A 5CGTA 2ZA2A 3OEXA 1MSSA 1SJDA 1MFVA 2QVNA 3BLFA 5REQA 1BVWA 4EOUA 1Z32X 1J10A 1GQIA 1LLWA 3GH4A 3M0IA 1L6YA 2UY4A 2DIEA 2GJLA 4W84A 8TIMA 1GUVA 1VBHA 4GC4A 2P1FA 2FGLA 4OJYA 3AXIA 2HK1A 4DBEA 4FNSA 4XZNX 5DBTA 4K38A 2DH2A 1UR3M 3ME3A 2PWVA 1CI1A 3EWZA 1UZ1A 3LERA 3GU9A 2VGFA 2X2YA 1KBKA 3VNZA 4GRSA 3FV9A 4JTKA 3MP5A 2F38A 1AW5A 3S5SA 2ZYFA 3MHUA 2V82A 4O54A 3VIPA 1NJJA 5BROA 3ZYZA 4URIA 1TX0A 2D0FA 4O1EA 3VO0A 5A6MA 1W1IE 4L9XA 3W7MA 1YE6A 1TQXA 4F66A 3LS9A 2MNRA 2H6RA 1GZJA 3HBLA 5GNXA 3GAKA 4QITA 1I75A 1CXEA 2ZIDA 2C71A 3TCSA 3BAXA 4FB7A 1CCWB 3PZNA 4JHOA 3LQGA 1OC6A 5C7HA 3V3WA 2XUCA 4H6QA 1YNYA 5KEZA 1V3HA 4C6CA 1YDNA 3M46A 4DELA 1BGGA 1T5AA 3U48A 4P61A 8A3HA 2A85A 4AF0A 3L4UA 1S1RA 2HEJA 3VYLA 4UFLA 3L67A 4ZA0A 3DHUA 2I5GA 1CXFA 3LBCA 5HK4A 1ADOA 2E28A 3HN3A 3I6RA 1P0BA 3LZ5A 1WZAA 3WUFA 1FQ0A 2VFHA 3GTIA 1AODA 1LT8A 4CQAA 4NVTA 4UTKA 2ZVRA 3LGDA 5C0QA 3IIZA 3NQ2A 1TZ9A 3IJ6A 3BUVA 4I9TA 4OOUA 3JZUA 1W54A 1M53A 4O10A 1ALDA 1B3YA 4JL2A 6REQA 3QYQA 3SIMA 4ATLA 1M65A 3R58A 1CLVA 3C2YA 4IMAA 4IUOA 5HAOA 3IGHX 4GZJA 3BDKA 3LCGA 1XLLA 2PRHA 1F05A 1WUFA 4QTGA 2ZRVA 4LYPA 4AHQA 4LEFA 3B8WA 1PIFA 1CNVA 1H2JA 4UNLA 4A2RA 4DAIA 1GOMA 4KRTA 4Q8MA 3MVIA 5I3GA 3IUHA 2WZTA 3PN8A 1XSJA 2OQYA 3TC7A 3EEZA 2OOGA 3RG6A 4EKJA 4O1AA 2QAPA 3ALFA 1YTDA 4JPGA 3TR9A 1LL4A 2HXUA 1AMYA 3WCZA 3CWHA 1E70M 4H8UA 4FLRA 3CV2A 1R7OA 3SADA 2BX7A 3DCPA 3T4WA 2WM0A 3ZOAA 4MWAE 4PTMA 2C0HA 3CMJA 3W81A 2BZNA 2OLSA 2GVJA 5E9AA 5I07A 3UR5A 3WLHA 4JIRA 3SAZA 4F40A 3M07A 4RXGA 2W9MA 1R5YA 4QJ4B 3L4ZA 4FNUA 3A21A 1V3IA 4OUIA 3AIVA 4QIUA 3WH7A 3L23A 4OV4A 3VOFA 4ZGYA 2NUWA 3CAKA 5FF4A 2PWGA 1HL2A 1HL8A 4NXKA 3S4TA 2BV9A 3WLTA 4KERA 4R5EA 5HQEA 4JGDA 3NQBA 2VR4A 1L2UA 4EIVA 3I10A 2XH7A 2HMCA 3ZM8A 1CX9A 1YXYA 4TO8A 1IGWA 4XD3A 2VURA 2J9YA 3GLCA 3WF3A 2Q3RA 1QASA 4RE3A 2ISWA 3R8HA 2WMJA 3UJRA 1UH3A 1EA9C 4D6IA 4LQ1A 4PTDA 1OX4B 2F61A 3GDRA 3CNYA 4XUYA 3P6LA 1XLHA 2E9MA 2WMKA 3SN0A 5M1TA 4O12A 2FDSA 3DYOA 2DIKA 1CLXA 3GKAA 3UA4A 3N4FA 1JPDX 1EYWA 4A3YA 2A7RA 4LVBA 3HIJA 4HYWA 1CZ1A 1E40A 4QJ1A 4HNTA 4I6VA 4GIAA 2WBGA 5C55A 1JD9A 4BWLC 1WB0A 3HQ1A 1ONEA 2FIQA 2ZUWA 2G50A 3MC5A 3R11A 4ZQRA 4GGBA 2HNHA 4WSKA 3PJTA 1I60A 2X2GA 4E0CA 1W9BM 1NVMA 3GDTA 3V0SA 3SN4A 5D37A 1V51A 4XAZA 4ERAA 1N7KA 1OC7A 2EAWA 4RNHA 1W1A1 5EKYA 3GR8A 4ZO8A 3S0CA 3IVSA 5FAJA 3OGRA 5EYWA 1E4IA 5CG0A 4P5UA 5C71A 5FEPA 3N1AA 3KAOA 3STEA 9CGTA 4YS1A 1A5BA 4TUFA 1UKPA 3T8QA 2WMIB 5HR7A 3AU6A 3IUIA 3EPOA 4C1NB 3PWAA 1ADDA 4WDXA 1KXHA 3GXNA 4BA0A 1RJQA 4POCA 1S5VA 2CLMA 2QUVA 3B97A 2VNCA 3STPA 3UPWA 4ICMA 2FH6A 6CGTA 2Y85A 4J3UA 2PCEA 1EKOA 5MKGB 2PE4A 4LEQA 7ODCA 1SO5A 3A4AA 3ARXA 4WR3A 5JBDA 2I57A 3H2EA 1V0LA 3PBYA 3VIMA 2TPSA 1TMHA 4MG4A 3GBDA 4X2PA 4V2XA 4NZ5A 3ABQA 1UIOA 3H55A 4ZO7A 1OF8A 3PZMA 2XN0A <