4JZ5A

High-resolution structure of catalytic domain of endolysin ply40 from bacteriophage p40 of listeria monocytogenes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
GSHMMVLVLDISKWQPTVNYSGLKEDVGFVVIRSSNGTQKYDERLEQHAKGLDKVGMPFGLYHYALFEGGQDTINEANMLVSAYKKCRQLGAEPTFLFLDYEEVKLKSGNVVNECQRFIDHVKGQTGVKVGLYAGDSFWKTHDLDKVKHDLRWVARYGVDNGKPSTKPSIPYDLWQYTSKGRIKAIASPVDMNTCSSDILNKLKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of catalytic domain of endolysin Ply40
rcsb
source organism Listeria phage p40
molecule tags Hydrolase
molecule keywords Gp26
total genus 75
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jz5A00
5DMYA 1GOIA 3WNPA 2CEQA 4TTGA 1BYDA 1TG7A 3O6AA 2OYKA 3GTNA 3VNYA 1G5AA 2VZSA 1NOFA 1MVYA 1ZBVA 2YBUA 2PC8A 4M24A 3RM9A 3WIJA 1FHDA 3WNKA 3WH7A 2VURA 1R7AA 1JZ6A 1QPKA 4JKLA 2VR5A 1H49A 2XGIA 3S6TA 3VIKA 4GO9A 3THDA 1LJYA 2FGLA 2ZXQA 3BAWA 3BLKA 5E09A 4UZUA 4WSKA 5I0DA 4CCCA 3QHOA 3SUVA 2CBJA 1JYNA 2IUZA 4MAVA 2BHYA 4P8WA 2WKGA 2W4XA 4J27A 2A3HA 2Y4SA 3OIHA 5LYRA 1CXIA 4JZ5A 1H4PA 1XSJA 1AMYA 3T2PA 4E8DA 4H8VA 2JF6A 5D9OA 3RPMA 2EPMX 1QNRA 1K9EA 2VVNA 5ABFB 4E2OA 2W61A 1MQPA 4U5IA 1E6PA 2PWFA 3PZOA 5IHRA 2BHUA 4PUDA 2ZX6A 1PJ9A 3VKKA 4HOWA 3ALGA 2XYLA 2AOSA 4P8VA 4DWSD 2UY2A 2YA2A 1HJSA 2A3AA 2XUCA 3EMZA 4AZ6A 4MNLA 1UD4A 4TOQA 4KMQA 1NWUA 1TCMA 1LG1A 2WC7A 4RE2A 3VDHA 1V6XA 4TXEA 4LXFA 5LA1A 2DT0A 3VGEA 4U5KA 1C3FA 4MDPA 2BY3A 1CEOA 1JDDA 2IXVA 1KXVA 2WCAA 3DECA 2TAAA 3ARXA 1GQIA 2WMIA 3LPPA 5DT7A 2CBIA 5E9AA 5BRQA 2C8NA 2EPLX 1LG2A 1HXJA 4U2ZA 3EDFA 4D6GA 1UR0A 4UFLA 4Z2LA 4UTFA 2ZXDA 4AZHA 2WSKA 3VDAA 4U2YA 2XFYA 4XX6A 4ATLA 1VIWA 1WZLA 2Z1SA 2OYMA 3BAIA 1H3GA 5IFTA 1SMAA 3MU7A 4MB5A 1H2JA 2Y8KA 3KL0A 1E5NA 6CGTA 3QR3A 1UQZA 4UOZA 4W8BA 4JFWA 1KCKA 1JYWA 1EA9C 4RE3A 1K9FA 1C92A 1ISVA 3PZGA 1JNEA 5CSUA 2WB5A 4TVDA 2YBTA 1LL6A 1EO7A 3ALFA 1FH7A 2QPSA 1EDTA 3W24A 3OB8A 3CZLA 1GVIA 4A3HA 2GJXB 4HZ6A 4EK7A 2WXDM 4QCFA 5BXPA 1HL9A 2GJRA 2XVNA 4CCEA 4UFJA 4XZBA 3L4VA 1PZ2A 4PMQA 2FH6A 4W5UA 2JF7A 1G1YA 4H7VA 5IFPA 2CETA 3WEMA 3ZO9A 3AMLA 1VB9A 1M03A 1HKIA 1C7TA 3J7HA 5A8MA 4JHOA 3PZVA 2JE8A 3CGTA 5I77A 4WJXA 1QHOA 2F2HA 3VM7A 1EDQA 4KGJA 3PBGA 2GSJA 4GO8A 4Z2GA 5A2BA 2WLZA 1LWHA 4HU8A 3EDKA 3GXDA 1GQJA 2J75A 5HBFA 1D3CA 1PIFA 3VX0A 3W82A 1OGSA 2A3EA 3SCSA 4AEEA 2J77A 5DF0A 3CHEA 2OSYA 1V3HA 1A47A 3W4RA 4NRRA 4JHZA 4OKDA 2XFRA 2XSBA 1BTCA 2VCCA 3W26A 3QHNA 4PMVA 6TAAA 1VBRA 3L4WA 3GNOA 2HISA 4B16A 2EPOA 2QMKA 1V02E 4AYSA 8A3HA 1J0JA 1VFFA 2OLHA 4KWUA 4J3SA 3AIEA 3VMPA 4AWEA 5FD0A 3TONA 5I78A 3S2CA 1KBKA 1VRXA 1IZKA 4AZBA 1UWQA 2XVGA 5AC4A 1B9ZA 3OGSA 4TVUA 3BSGA 1ZB5A 1HX0A 2BY1A 4PMZA 1FA2A 2C0HA 1TA3A 1W3KA 3RCNA 1TVNA 3U5YA 1WCGA 5FKYA 2XWEA 3WQ8A 2YDQA 2ZWYA 5ABFA 1H5VA 3ZJ7A 2VCBA 4WLCA 3U7BA 3AMKA 2GDVA 2D20A 4M80A 1KR0A 2VI0A 1MW1A 3VU2A 1AQHA 3EYPA 4JFSA 3SCRA 3PZ9A 3ZQ9A 1X6NA 2D0HA 1O7AA 2XIBA 3BH4A 1BVNP 1XCWA 4MAZA 3HN3A 1Q6FA 4E8CA 3TTYA 4QFUA 4H8HA 1UKPA 1W3HA 1KGXA 3VILA 1XV8A 5IDIA 4LYPA 4YPJA 1HF6A 3ZOAA 1GQKA 3KZSA 2D24A 3WL1A 1G01A 1RH9A 4PN2A 3BAXA 5A6LA 1UQYA 1E73M 5IHSA 1NM9A 5D4YA 1KWGA 1OIFA 4Y7EA 2ZX7A 3VD7A 1J12A 1LF1A 2J7EA 1HVQA 2VMFA 4U31A 4W84A 4IM4A 5A6MA 1VEMA 3CUFA 5I79A 2J7DA 4CVWA 1OSEA 3ARRA 3K8MA 2Y5EA 2BY0A 3VIOA 1X6LA 4EKJA 1KBBA 3WNLA 4UFKA 5BXRA 5AYIA 3ZSTA 4DWSB 3OG2A 1JIBA 2CBVA 1VJZA 1QNSA 1V0KA 4J3TA 4AZIA 1V03A 1WDQA 3IJ7A 3CUIA 4LQ1A 5CPQA 2VL4A 2J47A 4DWSA 4CUCA 3AQUA 3NDZA 6A3HA 3AXIA 3AMGA 2YKKA 5EB8A 1E6XM 3O9NA 1GW1A 3AXXA 4Q22A 4QAWA 5CSYA 1QI0A 1W1VA 4M56A 3W6LA 3N1AA 1R7OA 4F9JA 4DUWA 2XTKA 1VF8A 2WVTA 4E4PA 1MXDA 1ISZA 4OOZA 1HJWA 2F61A 1UA7A 3T0BA 2UY4A 3ARPA 4F66A 1E0XA 1WP6A 2DSWA 3AFBA 3I3BA 4JFTA 3VMNA 3PZMA 1BYAA 2D1ZA 3WY1A 2GK1A 1W91A 3WDPP 1V6YA 2WWCA 2Z1KA 3VDBA 1E6NA 1KXHA 2VO5A 3HU7A 1KWKA 5C8BB 3SUSA 1JXKA 5A2CA 2D3NA 2DT3A 2WM0A 2CBUA 3U5UA 2XVKA 4W87A 3AS2A 2JFEX 1JGIA 1FH9A 4AMCA 1SFSA 3D5HA 4F79A 2CERA 4HMEA 4WSJA 5E70A 4CN6A 2V5CA 2O9RA 4B3LA 2BHZA 2PWGA 3NIYA 3GNRA 3WH5A 1HP5A 4BZYA 1ZU8A 1WO2A 1E6QM 3O2LA 5LA2A 2GFTA 4QP0A 3PTKA 3RILA 2VX7A 3ARWA 2WMGA 4GI9A 2W67A 5A8NA 1UWRA 5JIPA 1QHPA 4DM1A 2RGMA 3SUTA 4UQCA 4RL3A 2WHKA 2G3JA 3WQ5A 2FH8A 3WH9A 2JALA 3AOFA 2DQXA 4KH2A 3NUKA 2WANA 3K4AA 1WZAA 2DSKA 1QOXA 1J0YA 1XGZA 2VR4A 4YHGA 3N18A 2YIHA 5I24A 3G6LA 1R86A 3VD5A 4GI6A 1HVXA 1FP9A 3I3EA 2VTFA 3A4AA 3RM4A 1OGGA 2WWDA 5JBEA 1NWTA 1BG9A 4UQEA 4TX8A 5JBDA 1U2YA 3K4DA 1ISXA 1UWUA 3WMSA 4ZE5A 3CMGA 3BSHA 2XG9A 3VX1A 4U3CA 3QOMA 1XSIA 7CGTA 4MADA 1D7FA 1CIUA 1W9DM 2V5DA 2JIEA 5A6KA 4Q7NA 2YOCA 1B30A 4PRWA 5LA0A 5E6YA 2O9PA 4AD2A 3VDCA 1W3JA 3MSDA 2D0GA 4GI8A 2BXZA 4JL2A 3HMCA 4YHEA 1KQYA 1J0ZA 4D6EA 1JI1A 1JD9A 4W8LA 1ITCA 4URIA 1OINA 1V3LA 4Z2JA 4F8XA 3GXFA 3F5KA 3FW6A 2VZTA 4YN5A 4MNMA 2D23A 3BMWA 4JAWA 4CD5A 1E56A 4H41A 3CUGA 5IXEA 3RO8A 1JYVA 2X0HA 1AQ0A 1VAHA 2W63A 3W27A 3IK2A 1JZ5A 4UQAA 1JD7A 2O9OA 4HTYA 2OWXA 2BXYA 4AZCA 3EDDA 4M29A 3GXIA 3BXWA 1E5JA 3GDBA 3AI0A 4C7DA 3VOCA 4S3KA 1EGZA 4PMUA 3BAJA 1DWIM 3WSUA 3VIIA 4AD1A 3PTQA 4BF7A 1EDGA 5E6ZA 4UR9A 3RJXA 1MXGA 3KL3A 1KQZA 3SIMA 3B8SA 1UHVA 3U7VA 1KFWA 4PSRA 4HA4A 3ZSSA 1LL7A 1E40A 2BV9A 4GIAA 3M7SA 5FL1A 4P8XA 1V3IA 2UY5A 4MNKA 3AIUA 2J74A 3FXYA 3UESA 3UEQA 5C70A 3FHQA 2WHMA 2YL8A 1IZJA 3TTQA 2WCSA 4QCEA 3K8KA 2EJ1A 2W91A 4C7GA 2DDXA 3AZTA 3F5JA 3K1DA 2VRKA 4PSPA 2ZUSA 4MDOA 1E72M 2WZHA 3WF1A 1DWFM 3KL5A 1B90A 2WMIB 2ZX5A 3AHTA 1VFUA 5HNNA 1JF5A 4PMNA 4WKFA 4FLQA 4W5ZA 1WKYA 4LPCA 3SCUA 3CZGA 3L4TA 3AIVA 2Y24A 4AC1X 3WKZA 8CGTA 3OLGA 2DT2A 1UD6A 4ZENA 1V3JA 3WEOA 1KGUA 4FLOA 3EMQA 4A4AA 3WDJA 3WFLA 4PMRA 3W81A 1WZMA 2EEXA 2O92A 4GKLA 1BF2A 1EHNA 1PZ3A 1MFUA 1UR9A 1M53A 4NSBA 3A6OA 4UCFA 2ZUVA 1CYGA 3CZ8A 4CU7A 4IPLA 4JCLA 1UWTA 2J79A 1JL8A 3L2LA 4DUXA 5I3DA 3LPFA 1OM0A 1BHGA 1V3KA 2GUYA 3F4VA 4B9ZA 1MWOA 5AYBA 1E6ZA 5JIWA 2G41A 2XJ7A 1XRVA 1DEDA 5D8WA 2XM1A 2E40A 1JFHA 3MO4A 3F5LA 4MB3A 1CGTA 2Y8VA 1NP0A 4MPKA 3VGGA 4V28A 1JZ4A 3A3HA 1WPCA 2J7HA 4D71A 4HPGA 1E0VA 1ZJAA 2JEPA 3W25A 1E4LA 2WSPA 2VQTA 1ISYA 2GJPA 4AIOA 2VX4A 2VZVA 3L4UA 1XH2A 3AJ7A 2E4TA 4Z2KA 3GZAA 1KCLA 1MW2A 3MANA 1C7SA 2WBKA 2OYLA 4UQDA 1CGUA 3AS0A 4BQ4A 1IT0A 2EPKX 1CLXA 3ZJKA 1TMQA 3ZMRA 1JDAA 3WQVA 3WQ6A 2V3FA 3PN8A 4WKAA 1XH1A 2GVYA 2YL5A 4B15A 2O9TA 3APGA 3PZNA 5JUVA 3WF2A 3UG3A 1Y7VA 2NT1A 1NOWA 3VIGA 4PMYA 1EIBA 1UH4A 2XPKA 3AIWA 2XHYA 3W37A 2FGZA 1PEZA 2J4GA 5A6AA 1I1XA 1B3WA 5D9PA 1HKJA 2RGLA 3ECQA 4X0VA 4CD6A 3PZUA 2EBNA 2A3CA 1WDSA 1H41A 3GBDA 4CKQA 1UH3A 4L4PA 4D1IA 2CYGA 3AROA 4GZIA 3VIMA 1HKMA 5I6SA 3BCFA 2BVTA 4W88A 4N0RA 2UY3A 3OZOA 1V3MA 1E1EA 2WCGA 3T2OA 4TUFA 3CHCA 3VGBA 3CMJA 4C7FA 1L8NA 1UD5A 4J3WA 1QHZA 2YA1A 5JBFA 4WF7A 3VO0A 2QPUA 1CDGA 2HVMA 1UKTA 2E9LA 3CLWA 4J3VA 4D1JA 5A1AA 1H0GA 4DUVA 3CZEA 1HT6A 1E55A 2EQDA 4OJYA 5FCZA 2DSVA 1ODUA 2WNWA 3AZSA 1NP2A 1R87A 1C8XA 1B3VA 1UD3A 1PX4A 4NZCA 3CUJA 3UCQA 3OLIA 2EPNA 5E0FA 3AS1A 3RDKA 1KB3A 3E1F1 4MJ4A 3POCA 4XB3A 2WC4A 3MUAA 4P7RA 4GZJA 5DFAA 1HNYA 3QOKA 5ABGA 1S46A 2WVVA 3VM5A 4AY1A 2ZUTA 1KXQA 1G9HA 1UOKA 3SCNA 1CXFA 3QGVA 1OD8A 3N04A 2WHLA 3NCOA 1RD6A 4FF5A 1W9VA 2W92A 3UG4A 1HKKA 3DC0A 1ITXA 3AYRA 1B1YA 1C91A 1GNXA 3PZQA 4AD3A 4GPNA 3VPLA 2EXOA 1J0IA 3BGAA 4AD5A 1CNVA 1M7XA 3OGVA 4ZFMA 1JI2A 4CD7A 2FDMA 2E3ZA 1K9TA 2WMFA 5KZ6A 2DGAA 1CECA 2ZX8A 4XV0A 3LPOA 1QVBA 3VD9A 1EH9A 3GH4A 1PX3A 2DT1A 1W9BM 5CG0A 5GNYA 1U33A 4CN4A 1H11A 1E4IA 2X2YA 3L4ZA 4U3AA 1NARA 3EBVA 2WYSA 3WF0A 2NT0A 2AMGA 1FP8A 3N17A 1V0NA 5A8OA 3HJEA 1EOMA 4JKMA 3AIQA 3FNDA 4NI3A 3MV01 4U33A 2PWDA 1UWSA 4W85A 1W1TA 1TZ7A 1JZ7A 2ESCA 1TFVA 2WPGA 1ISWA 1J0KA 3VIPA 2J8FA 1J01A 1PX8A 4HMDA 4M81A 1TVPA 3MMDA 3BAYA 2ZUWA 4ACZA 1XYFA 4PMOA 2J7FA 5GPRA 5BROA 3WL0A 1Q6EA 4UFHA 2PBOA 4S3JA 1HN1A 1RPKA 1CWYA 2XIIA 4PCTA 4GINA 2BS9A 3SCTA 1J10A 3KWXA 3KE0A 3MUIA 3PZIA 1XC6A 2VCAA 5CPSA 1MQRA 1M01A 1CGYA 2J78A 3RIKA 4Z2IA 2DSZA 2X05A 4AIUA 1VEOA 1CGVA 2QV4A 4OBSA 1MYRA 4BCEA 1R8LA 1CXKA 3AXHA 1WE5A 1RP9A 3WUGA 3OLEA 1UR2A 2VT0A 1UR8A 3D3AA 4BQ5A 1DHKA 3KEHA 1B3XA 4HP5A 4D6DA 1N82A 3SUWA 5E0CA 1WDPA 2CNCA 3CZJA 5BRPA 2PWEA 3VUPA 4ATDA 2WW5A 3SCOA 4ZE4A 2YJQA 1SYTA 3CUHA 1GVYA 2CPUA 1TUXA 1YHTA 3WMCA 1BAGA 3B9AA 1FHLA 2CXGA 4B3KA 3OZPA 2MANA 1YQ2A 4CN1A 4GQQA 3ARUA 3PZTA 1WAWA 1JFXA 1NWSA 2XSAA 3NJ3A 2GDUA 3SUUA 3W28A 4WIWA 1ZL1A 3RJYA 4HPHA 1MQQA 2CHOA 3NSMA 1EXPA 4FLSA 3GNPA 2VZOA 4D72A 3WN6A 1PBGA 2D3LA 1KGWA 1MFVA 1QI2A 5AY7A 4GZEA 2OWWA 1UZ1A 1FFRA 1GORA 1US3A 2BVYA 4P7NA 3ARTA 1UUQA 3MKKA 3VIJA 4KRUA 4MNJA 1Z32X 4MJ2A 5A6SA 4PBGA 3TP4A 1OT2A 7A3HA 1Q4NX 2E8YA 2ZIDA 5GNZA 4HOZA 4W7UA 2E8ZA 1QBBA 5BCAA 2PF0A 2FHCA 1W1YA 1CGWA 1ESWA 2G3IA 4PUEA 1OGBA 5F7UA 1FFQA 4HU0A 1BGGA 1H1NA 4BQ3A 3PTMA 2DIEA 1U30A 3NSXA 1W2PA 3THCA 3VVGA 2CCRA 4P8UA 2VUYA 4UZSA 1UD8A 3CZKA 1LWJA 4F9DA 1CXHA 2OSXA 4PTMA 2W66A 3K8LA 2WVUA 5CZKA 3FY1A 2YL6A 4M82A 1GOQA 3ARVA 3DYMA 3ARQA 1V08A 2QF8A 3MV11 1GPFA 4WKHA 2PBGA 3T09A 2D22A 1OD0A 5CQ1A 2WBGA 2QHAA 1GONA 3WUFA 4D6FA 4CU6A 4PCSA 1JZ8A 2XVLA 1BYBA 1HJQA 5EBAA 3SCQA 2BVDA 4FK9A 1B0IA 2WMKA 3WH6A 1ZBKA 5EFDA 3SURA 5CPTA 2J62A 3PHAA 1OCQA 4UQ9A 4WK9A 1TR1A 1QI4A 3WF4A 1E9LA 2BFGA 3FAWA 2GK1B 2ZUNA 5D8ZA 4P7LA 2VJXA 3OBAA 3ZJ8A 3VGHA 3JUGA 2ZX9A 2X8RA 3ARSA 1SR0A 4AXNA 2DH3A 1BGAA 1EO5A 4CU8A 5FIPA 3W38A 5EMYA 5AC5A 3AIBA 5BXSA 2J25A 4BA0A 2VNCA 1E15A 4JIEA 1GOWA 3N11A 1J11A 3ZT5A 3N9KA 2G3MA 5CJ5A 3ZT6A 2DSUA 2VRJA 1UD2A 1JAKA 5GNXA 3SEPA 1F4AA 3GXMA 4P7QA 4ACYA 1QI5A 4J3UA 1EOKA 4PMXA 2G4FA 3VTRA 1GJWA 4MTVA 1OWQA 3CH9A 1UA3A 3AMCA 3WFZA 1UR4A 2WMHA 3WBAA 3M07A 1BG4A 3NYDA 1LLOA 4B9YA 1ZBCA 1CXLA 3G6MA 4IUGA 5A6BD 1E6SM 1VBUA 3AHYA 1JDCA 1ODZA 1WDRA 3VIHA 4X0NA 3UERA 1CLVA 3OGRA 1ZBWA 2E9BA 1J18A 1R85A 1XYZA 2WAGA 4QLKA 3TTOA 4Z2HA 1MW3A 2XM2A 5HDRA 2ZUUA 1UG6A 5DO8A 3AS3A 4NF7A 3MMUA 4W86A 2WK2A 1Q6CA 4MB4A 2VOTA 2WVVB 1US2A 5ABHA 2YDRA 4AD4A 4XUYA 1ZS2A 1XD0A 9CGTA 2ZWZA 3OA5A 1VFOA 2D2OA 4UNIA 2VC9A 3AIRA 4UOJA 2XVPA 1BFNA 2AAAA 4J3XA 1UZ4A 1CPUA 1W32A 2Y2WA 5DEZA 4AW7A 3CIVA 2FHFA 1CGXA 2V38A 1BPLB 3WDIA 3VMOA 4H2CA 3TOPA 1E3ZA 2E9MA 4GXPA 4ML4A 4IISA 2BNJA 1KXTA 5FOOA 4NRSA 1C90A 1GCYA 4HZ8A 1H09A 1DWGM 1V02A 3FHAA 4ATWA 3K46A 4RE4A 3WELA 1G0CA 4UQBA 3A4WA 4W93A 3W6MA 3AHZA 5C71A 2C7FA 1GZJA 3RM8A 3VIFA 3LPGA 1J9YA 4M1RA 2IXUA 4EANA 5CXPA 3DHPA 3B9EA 2ZICA 2VZUA 5M17A 4KGLA 3AICA 1E71M 1EHAA 2WHJA 5HXMA 4PYSA 4HA3A 1GOMA 4J28A 1E4NA 5A6BA 1TA3B 5HPOA 3WD1A 3W0KA 3VD4A 3EDJA 1G94A 2D0FA 1AVAA 1FH8A 3W53A 5A2AA 1WNOA 3N15A 2UWFA 3GYCA 2CIPA 1C8QA 4QDMA 1W9PA 5A3HA 4GQRA 5D9MA 4FLRA 3UETA 3GH7A 4R27A 1VFMA 3WUEA 5KEZA 1C93A 1XSKA 3FAXA 2Q8XA 4LYQA 3WD3A 1V0LA 3MMWA 1CENA 1QNOA 2ZXBA 5A69A 5A94A 2ZOXA 3DHUA 3OLDA 4JL1A 3UR8A 2X09A 3WQWA 1UH2A 4CD8A 4W8AA 3WMBA 1EQPA 4AZ5A 1UYQA 1W9XA 5BYWA 3ARZA 4PMDA 1OBAA 4PTVA 4UFIA 4CD4A 1XH0A 2XFFA 3ZM8A 3WBEA 2FHBA 1NWRA 4A3YA 3AMDA 1B2YA 1K6AA 5TD4A 2J7GA 1JF6A 3WNNA 5A95A 4AISA 3ARYA 2J7CA 4LX4A 1W3LA 4CGTA 1WZKA 4PTWA 2E0PA 1HJVA 1PIGA 5CGMA 3IJ9A 4W7WA 7TAAA 1JNDA 4L4OA 1K9DA 2ZUMA 3IAPA 3EMCA 4PEEA 2OSWA 2PB1A 2QLYA 3GM8A 3NDYA 3CPUA 1GOOA 1BVZA 3SCWA 2DEPA 3T08A 4D6IA 3T2QA 1UKQA 3MSGA 1OT1A 4AZGA 5EFFA 3N12A 1VENA 1JZ2A 1GOKA 1E6RA 3BMVA 3GH5A 3WD2A 1BLIA 4MB1A 5GQBA 3A47A 2VX5A 1OIMA 2JEQA 5M3WA 4N42A 1JYXA 1QNQA 1WB0A 3ZIZA 1I1WA 3VNZA 3L4XA 4DM2A 3POHA 1X1NA 5CLWA 2YDSA 2YL9A 3BCDA 4P7OA 1B3ZA 1D2KA 2J8GA 2V3GA 3I3DA 1BQCA 3L2MA 1J0HA 3ZT7A 1FOBA 2DH2A 1P6WA 3MS8A 1QBAA 4UFMA 4H8UA 1OB0A 3WEZA 2B31A 3WNMA 3L4YA 3AHXA 2X1IA 2X0YA 1L0PA 3WH8A 4TVCA 1BSIA 2V3DA 2V3EA 3FN9A 1DWAM 1RP8A 2YLLA 3MUY1 4OUEA 1JG9A 1CZ1A 2CKSA 2W5FA 3AHVA 1E3XA 2WMJA 2CKRA 3DYPA 2BY2A 4LYRA 1Q6GA 2WZIA 4QLJA 4H04A 1VEPA 4J7RA 4HMCA 3U57A 4HOXA 4V2XA 2YLAA 3M6DA 4FMVA 1Q6DA 1KR1A 3IJ8A 2PI6A 3WNOA 4OIFA 3WDRA 3ZR5A 5CLTA 3EDEA 2WLYA 5DT5A 4DWSC 3AYSA 3UR7A 5M5DA 1DWJM 2EO7A 2ZXAA 3IANA 1HL8A 1CXEA 1SMDA 2JIWA 2NSXA 1GHRA 1QW9A 1W2VA 5HOSA 2NW0A 3WENA 4HZ7A 1I75A 1PPIA 3AISA 4AD0A 1E0WA 1HP4A 3AZRA 4OBRA 4TX6A 3SCVA 4CVUA 3T0DA 2VVSA 4AIEA 4AZ7A 3T0AA 4BQ2A 3WDHA 2WVSA 5BWFA 1GJUA 3N13A 3ZR6A 1QI3A 3RMEA 3GBEA 1XCXA 2CITA 1GHSA 1LL4A 3BAKA 1UKSA 3CHDA 3UG5A 3II1A 3VD3A 1XD1A 3B9DA 2VX6A 1V6WA 3NSNA 1JZ3A 1QW8A 4PTXA 2VQUA 1E70M 1EQCA 4JCMA 5ECUA 4EE9A 1B31A 1LQ0A 4W89A 5FL0A 4EAMA 1F4HA 4CCDA 4KRTA 2DPEA 1UKOA 1AQMA 5HPCA 1V0MA 2DIJA 1V6UA 3A4XA 4D6HA 4AZCB 1CBGA 1XHGA 1B3YA 2WZEA 1VJSA 3SCPA 3W29A 1A3HA 1IV8A 4HA1A 1GUVA 4R5EA 1C8YA 4OOUA 1PAMA 1TE1A 3WQ4A 2J7BA 5D9NA 1M04A 2WKLA 1H0IA 1UR1A 4JFVA 1NQ6A 1UWIA 4D6CA 2A3BA 1NOUA 2ZE0A 3CHFA 3IAQA 3QHMA 1GQLA 2PWHA 2CHNA 4M8UA 1BYCA 3VINA 1E43A 1JAEA 2G3NA 3LMYA 3TTSA 3CTTA 4X9YA 4K68A 1W1PA 5A8PA 4JKKA 4IPNB 3CO4A 5A8QA 1DP0A 3DYOA 3VGDA 2QMJA 1DWHM 1V6VA 4AEFA 5CGTA 3ZJ6A 3WDQA 4BS0A 4V27A 2GJXA 4W7VA 1ECEA 5A6JA 4ZEPA 5BXTA 3M46A 1CTNA 4TTUA 3BLPX 3BC9A 1JXJA 3WD4A 3CBWA 3WD0A 5I23A 4LGXA 1HJUA 1MW0A 1QNPA 4ZXOA 5ABEA 2VRQA 4ZXLA 2WC3A 2F8QA 1E1FA 5I5RA 1DTUA 3WUBA 4XZWA 2G8ZA 3WF3A 2CESA 3MUZ1 2OWCA 1W9UA 2XWDA 3TA9A 1E4MM 5I2UA 3VGFA 5M03A 4JFUA 1NH6A 4D6JA 1HIZA 1HJXA 2W62A 4UOQA 4ACZB 1O6IA 2XGBA 1ZJBA 2YA0A 4OZOA 4QLLA
chains in the Genus database with same CATH superfamily
3QY7A 3UJEA 1YX1A 4JTCA 1ICSA 4JTSA 2CEQA 5HNRA 3IRSA 4XSLA 3O6AA 3GTNA 3VNYA 4JN7A 1IE7C 2EKGA 1MVYA 1TTIA 2CLFA 3BE7A 5LIXX 1O94A 3INPA 1FHDA 4JTFA 3WH7A 1R7AA 5H91A 1QPKA 1FWHC 3MWCA 3QEZA 2Y8UA 1H49A 2PPGA 2VENA 4I90A 2ZTKA 4N9BA 1S39A 4UZUA 3BSMA 3QGAC 5G1TA 1RR2A 3ZS4A 1JYNA 3KBMA 3DGRA 3CHVA 1BWLA 2F6UA 2A1YA 1VHNA 4J27A 4PFHA 1KM5A 5H6HA 2Y4SA 3I6TA 5AYYA 3S5ZA 3S9YA 3OVPA 1A5MC 4XD5A 2WJFA 1RQHA 3SRKA 1K9EA 1MI3A 3H53A 1EC9A 1MQPA 4U5IA 1UR3M 4PUDA 3STPA 1PJ9A 1RBOB 4GH3A 1GYNA 2XYLA 2AOSA 3PUGA 3STGA 3OOQA 2BASA 1UD4A 4TOQA 3VNDA 2WC7A 3VC5A 3PS7A 1T8XA 4N7QA 1P7TB 1W3NA 2NSOA 1GG1A 2ACUA 1KXVA 3DECA 3GFZA 1W56A 3LM7A 3R5EA 1BXCA 3D3FA 2GYIA 3SFKA 4ZMGA 2NUXA 2WMIA 4L1WA 5DT7A 2YGYA 4J2PA 1LG2A 1HXJA 4U2ZA 3MHGA 3M5ZA 4GQGA 4Z2LA 4UTFA 2ZXDA 1GW9A 2WSKA 3VDAA 4IF2A 2AKMA 3MVIA 1KW1A 3DN5A 3KWSA 2OYMA 4N6EA 2ICSA 1SMAA 4PB5A 2QGYA 2XIMA 1H2JA 1LLWA 3KL0A 1E5NA 3HV9A 1SFLA 1VCGA 3QR3A 4KIRA 6CGTA 3QKEA 4JFWA 2D2HA 1IWPA 4ES4A 4DYJA 4W4QA 1EA9C 2HPIA 4IWWA 1ISVA 4YVXA 2WB5A 4XUGA 4TVDA 2QCDA 2YBTA 1LL6A 1UPPA 4DJFD 1FH7A 5D2VA 4LF2A 1AD4A 3CZLA 1V5XA 3TYAA 2G5WA 2GJXB 1V4YA 1TWZA 1D3HA 4AWTA 3DIPA 3CU2A 1RLCL 4CCEA 1QXLA 1ICQA 4PMQA 3QC0A 5BWAA 1G1YA 5BOEA 2PLCA 3TNOA 1TZZA 1N2VA 3GKAA 5FI8A 2CETA 1HKIA 3J7HA 1MSSA 5A8MA 3W1QA 4JHOA 4V15A 2DZAA 2JE8A 3RPTA 1UWAA 3MB9A 4WJXA 2F2HA 3BICA 1EDQA 3M44A 4L65A 4F2UA 3PBGA 4GO8A 4TV6A 2WLZA 1LWHA 1ZUAX 3EDKA 4H4IA 1PIFA 1SVDA 3W82A 3O7UA 4NP7A 3QV7A 2J77A 1SO3A 4CQCA 3IARA 3CHEA 2OSYA 1A47A 1VFTA 3OQEA 3GU2A 1R38A 2XFRA 4DPPA 4DJFA 1WAUA 4PMVA 3QHNA 4WDUA 3L4WA 6TAAA 1SZNA 3GNOA 3LBCA 3EOEA 4N9EA 2B7QA 2ONEA 3KCJA 5MF5A 2TSYA 3GHTA 8A3HA 4MYXA 1Z44A 3VMPA 1B54A 2X7VA 4FHAA 5I78A 4QSHA 3GZ3A 5H2ZA 5EGRA 1CCWB 1S5MA 1BWVA 2XH2A 1PCKA 1UWQA 4ZTXA 3SY1A 3WQDA 4KWWA 3OGSA 2DUXA 2VFGA 1HX0A 2ZDSA 3LHYA 4PMZA 2FIQA 5HANA 4GZ7A 3U5YA 3RLUA 3WQ8A 3TW6A 4NI8A 3ZJ7A 3CV1A 3AU6A 3LCXA 5REQA 4C6BA 4S2BA 2VWSA 5CJNA 3VU2A 3OYXA 3NURA 3V4BA 5DBTA 1F3TA 3ZQ9A 2D0HA 1WXJA 1P6BA 2TRSA 2E7FA 1XCWA 1POKA 3HN3A 3H7RA 2ZYFA 9XIMA 4MKSA 1U5VA 1TV4A 1W3HA 1PO9A 1HF6A 1GQKA 2D24A 3WL1A 4AMAA 3W23A 5IHSA 4YS1A 1NM9A 4QITA 5D4YA 4QM1A 3UZYA 3VD7A 4KCVA 2WNQA 2J7EA 2QEZA 4YCOA 1O12A 1X7IA 2INFA 5A6MA 2J7DA 4ZB2A 5ABTA 4ZOBA 3MTWA 2PLJA 3BV7A 4DN1A 2HVNA 3UQNA 5CC5A 5DLCA 4EKJA 1KBBA 4O1FA 1KCZA 4RV3A 3W84A 4UFKA 3E49A 5AYIA 4K8HA 3W7GA 4Q8PA 1BXBA 1VJZA 1V0KA 1DIOA 1V7AA 1WDQA 3CUIA 4LQ1A 5CPQA 4K2SA 3FA5A 1XIJA 1TKKA 4TIMA 3ES8A 3FVDA 3GNDA 3AMGA 3AXXA 1PE1A 5BU6A 4QAWA 1QI0A 1W1VA 4OVXA 3M6YA 1XLDA 3M0XA 3FK4A 3TN5A 4R33A 2XTKA 3EA3A 7TIMA 1MXDA 1J4EA 1MZRA 3ABOA 3ONCA 3T0BA 4H01A 4HCLA 4V33A 2UY4A 3Q58A 3N2OA 4Y9PA 1E0XA 1WP6A 1BYAA 2D1ZA 3WO8A 2Z1KA 1QWGA 1E6NA 1LT8A 1OCNA 2BX7A 4IGMA 3A9BA 1YIXA 2Y7GA 5C8BB 3SUSA 3A21A 4ALDA 3EPMA 4C6FA 1CI1A 4S38A 2CBUA 3FJLA 1G69A 1FWIC 1MXSA 4LEQA 3GRIA 2ACRA 1JGIA 4XD4A 1IWAA 1FH9A 2CLIA 3UPWA 4RDVA 2PD5A 4F2BA 2QCLA 1V7YA 4CN6A 2V5CA 2O9RA 3N6QA 4AWSA 3WBWA 2DZUA 2XH4A 3CYVA 1HP5A 3QLDA 1US0A 5E0KA 1ZNNA 3H21A 3EB4A 1ZSXA 3O2LA 5LA2A 4QP0A 1RHCA 2VX7A 1AH4A 4GYPA 5JH2A 2W67A 1SM9A 4FOJA 1DXIA 2H3BA 4IQJA 3EWWA 2XDFA 1QHPA 4DM1A 5JIPA 3BGGA 4S3DA 2GSHA 3RX2A 2G3JA 1EYWA 4Q8QA 3WQ5A 3AOFA 2ZZ4A 3LCFA 3H23A 1FCBA 4UTJA 1WX0A 4GYPC 2GJNA 3I7SA 1J0YA 3RXZA 2QNEA 1S3HA 4YHGA 3N18A 1YDOA 3R43A 5I24A 5HUPA 3B97A 2GOUA 1R86A 1EJXC 4GI6A 3I3EA 2VTFA 3A4AA 2CLPA 4ZSTA 3B8WA 3GTHA 4OFCA 4TX8A 3PJTA 1XIIA 3K4DA 1UWUA 4A2RA 1N55A 1NY1A 3S1GA 1PS9A 2JIEA 2PEVA 3CNYA 2VFDA 2F7FA 4ZZ9A 2RDTA 3UU0A 4AD2A 3VDCA 1YNYA 2QJHA 4GI8A 4YHEA 4X3ZA 4DJDD 1ITCA 3E0VA 3RCMA 5C9ZA 3P82A 3CT7A 1L6WA 1V79A 3FW6A 3FLUA 3DG7A 3ABQA 3BMWA 3N4EA 4FEZA 1JPHA 1AQ0A 1FQ0A 4HJWA 1JZ5A 4DX3A 2Z00A 1T5AA 3NL6A 3ITTA 2NQZA 4UNLA 2PDPA 3EDDA 3GXIA 1EWEA 3GDBA 3NR0A 3VOCA 1F61A 1CT5A 4S3KA 4PMUA 4GUFA 4JBRA 4IMFA 4IUOA 5CSRA 3RJXA 3T55A 3B8SA 1UHVA 1KKRA 3QC3A 4HA4A 1LL7A 1VC4A 1Q8AA 2YCIX 5FL1A 3TJIA 4QJ1A 2HZGA 3XINA 4MNKA 1XX1A 3FHQA 5HWNA 2WHMA 1IZJA 4B5NA 1XF0A 3MCMA 4HSNA 3FJNA 2W91A 4HK7A 3PK7A 1OK4A 3GVVA 1Z9AA 5C7HA 3WF1A 4KESA 3WK1A 1MUCA 3KL5A 1M3UA 4LF1A 2ZX5A 2NLIA 4QRNA 4KBXA 2V9DA 4Y8EA 2H90A 2VGGA 4O11A 1X39A 3DUGA 2Y24A 2Q8ZA 2BOFX 2V5JA 3ITCA 4FI4A 3EKLA 1UD6A 4JICA 1V3JA 3WEOA 1KGUA 2VEIA 8TIMA 4AEOA 4PMRA 3NYZA 1WZMA 2EEXA 1O95A 2OELA 3PANA 1PZ3A 3WLQA 1M53A 1RVKA 1CYGA 4CU7A 1UWTA 3N6JA 4HYVA 3L2LA 1OM0A 1BRLB 4O54A 5AC8A 2NX9A 3N2MA 4UR8A 3U4FA 1GKQA 1XRVA 3NTYA 1GWJA 2VDHA 3P0XA 2PTDA 4LRTA 4ASTA 3HPAA 3F5LA 1XIHA 3UNDA 4Z1BA 5FSEC 2DUAA 4MPKA 2JKEA 4V28A 3VXGA 3W1NA 2J7HA 3JU2A 4GE8A 3DHFA 4LJ3A 1D8WA 4GX8A 3TQKA 1E4LA 4MWAD 1RLDA 2ALDA 2GJPA 4H9XA 4BKNA 7ODCA 5EMLA 3MCNA 3LGEA 5DANA 2PAJA 4ZOAA 3WK0A 2E28A 3GZAA 1MW2A 2OFJA 1XLFA 3LZ3A 6REQA 1X8FA 4ZA0A 3ZMRA 4O4VA 2TODA 3EOUA 4B15A 3PZNA 5HR7A 3WF2A 3UG3A 4PMYA 1Z89A 5I3IA 3WLJA 4K38A 3W37A 2J4GA 4I8YA 4GUHA 4R9OA 3G1DA 4BWLC 4PUWA 1DL3A 4X0VA 3ECQA 3L5LA 3PZUA 1A3WA 3LA4A 4HYRA 2EBNA 4NXKA 4UTLA 1WDSA 3PUOA 1U5HA 3E0LA 4CKQA 3BV4A 4L4PA 3AROA 4GZIA 1PKLA 3RCYA 5D04C 1HKMA 5I6SA 4AG0A 4KWVA 1WBHA 3KRUA 1O5KA 2ACQA 1A5CA 4N0RA 4YMZA 3OZOA 2DZSA 2WCGA 4E2VA 4I7VA 4C1NA 3H4WA 4TUFA 3VGBA 3GNXA 4US5D 1KRAC 4NT0A 5C2XA 3P14A 3A3XA 3VO0A 1CDGA 3PJUA 3CLWA 5FF2A 4REQB 1HT6A 3GWQA 3TCEA 4FX8A 3EWZA 1XUUA 3ZR4A 3R58A 3OLIA 1AFSA 4PCNA 4MJ4A 3IACA 4QEHA 5ECVA 3C2EA 4OHQA 4GZJA 3NQ7A 3MCOA 2QCNA 1RBLA 1JUEA 2J24A 3W73A 1LRQA 4JY8A 1JDEA 5E1QA 3QGVA 2I16A 2RAGA 3N04A 6TIMA 3CAVA 2BDQA 1Q5MA 1W9VA 1YLVA 4UTKA 3UG4A 4XKYA 1HKKA 2HXUA 5I02A 1B1YA 4MY8A 3AJXA 1MUMA 4GPNA 2Y7DA 3VPLA 3HG4A 1J0IA 2V5KA 1M1BA 1TPFA 2R1NA 1OX4A 4ZFMA 3OA3A 2DZWA 1K9TA 2GGEA 4GVFA 3SQSA 5KZ6A 2DGAA 1CECA 2ZX8A 1Q66A 2FJKA 2Z26A 1QVBA 4XZNX 1TIWA 2DT1A 4CN4A 2NXIA 4MFDA 3RG6A 1E4IA 2X2YA 3L4ZA 5J5DA 2Y62A 4YYFA 4KT2A 2AMGA 1FP8A 4IPJA 3N17A 2F9RA 4FZIA 3GVWA 1KFEA 3MV01 4AUBA 1UWSA 3MBFA 2OXNA 1TZ7A 2P1FA 3GR4A 3VCRA 1ISWA 1O1ZA 3BG9A 3EWBX 5C0QA 2J8FA 1J01A 3STFA 1NF7A 1TVPA 4C6CA 3MMDA 4AU0A 4QQUA 1IGSA 1D9EA 1CX9A 5T9CE 3K2GA 1AG1O 3WLLA 5GPRA 3DG3A 3W7HA 1SO6A 3SGZA 2GQAA 3OQ8A 4G9PA 2PBOA 3UZZA 1K1DA 2E68A 3EA1A 3ANUA 1RPKA 4PCTA 2D2JA 3GS6A 1A5LC 2E1WA 3NZQA 1JCTA 2NXHA 4ERAA 1J10A 2RH9A 2C15A 3BW4A 3KWXA 1TJRA 1V51A 2VCAA 1TV8A 5CPSA 1MQRA 3RIKA 4WRHA 3N73A 2DSZA 1VEOA 4DQWA 1VYSX 4OBSA 1R8LA 4PUMA 1LM1A 4UBPC 3UNTA 3OLEA 3D3AA 1DQWA 3GG0A 4ZQNA 4DZHA 3TYUA 1X98A 4ZQRA 5E0CA 2IQTA 1HTIA 1WDPA 2CNCA 1XW8A 3CZJA 5BRPA 3R94A 1JUBA 2PDBA 2WPBA 2NQJA 1GZ1A 4G8TA 1XKJA 2CPUA 3NZ1A 2W27A 5GVJA 4KCTA 4XZLX 2RKXA 1BAGA 1QATA 2I57A 2FKPA 4DAFA 1QDSA 1FHLA 3GX9A 2CXGA 5AN7A 1RJQA 4CN1A 2O7QA 4GQQA 3WJWA 2QS8A 1UC5A 3GO2A 3AYVA 3TLQA 3W28A 4Q4MA 3RJYA 4H9MA 3GNPA 1W5MA 3UFYA 1WYIA 3W1PA 1CLKA 4PUNA 1L6SA 4YXGA 3EKGA 3VNLA 4J3ZA 5AY7A 3N2TA 1UUOA 4ENLA 1P0NA 3W2JA 1TTJA 1XM3A 3SSJA 1NFPA 4F0SA 4JTQA 4IH3A 3EKZA 4C5ZA 3DAQA 1Q4NX 1Y0EA 3RX4A 1ENUA 3OZYA 5GNZA 3PBUA 2E8ZA 5BCAA 2AGKA 2X40A 4ROQA 1KM1A 2PF0A 2YCLB 3HF3A 2NWSA 1I4NA 3P8JA 3GAKA 3UZWA 5BNKA 4O17A 3PTMA 1ZRQA 1W2PA 2OZ8A 4L64A 3THCA 2GQ9A 3F4DA 2GOKA 3MUCA 4R9XA 1UD8A 4BJHA 6ALDA 1NF0A 2B81A 1LWJA 1YDNA 3V5FA 1CXHA 4F9DA 2OSXA 1F76A 2WVUA 2IKHA 3FY1A 1GOQA 3HA1A 4IOTA 3TUUA 1GPFA 4X61A 5M1TA 2QHAA 3OIXA 3M16A 4PCSA 1BYBA 1HJQA 1P0DA 4R7JA 1ZBKA 3W2KA 5XIAA 3VOIA 3PHAA 4UQ9A 5DRCA 3WF4A 2IPGA 1VPXA 3UYIA 1X1ZA 2FTPA 4P7LA 3T9PA 3ZJ8A 2R1LA 2X8RA 3HQOA 3ARSA 3EEZA 1SUXA 4AXNA 4OV4A 3MI2A 5FIPA 1XRTA 2VUNA 3CUXA 4BF5A 3W38A 4IMEA 3AIBA 1DXFA 5LHFA 2J25A 5DMMA 3TIMA 1R9XA 3LQGA 1GOWA 1TWSA 4RDWA 3S5NA 1VGAA 2NV9A 1J11A 2G3MA 5CJ5A 3ZT6A 2VRJA 1UD2A 1OQFA 1JAKA 1E0UA 3GXMA 2YZ5A 3R1ZA 4ACYA 4GUGA 5AC7A 2O4QA 1GJWA 3BG3A 1WXYA 2WMHA 3WBAA 3M07A 1KBLA 4YU1A 3AUOA 3NYDA 3A23A 3GDTA 4TO8A 3GXNA 3P67A 3WLKX 4OT7A 3SRDA 1LRNA 3KOYA 4N4QA 1TWDA 1TWWA 2NZLA 4CEXC 4FPSA 1XYZA 1I0DA 2GVJA 3NPWA 4QLKA 3QW3A 4Z2HA 2ATMA 1EC8A 4JTLA 2NUWA 4NF7A 4W86A 3D47A 4NG3A 2HMCA 3W2NA 2VOTA 2WVVB 1J2WA 3FYOA 3U2ZA 3P5YA 2R6OA 2OEKA 4AD4A 2R82A 1VFOA 3SGUA 3HGJA 3AIRA 3TWAA 1GVSA 3WCZA 1GYMA 4DRSA 3NGFA 2AAAA 1UZ4A 2HQAA 4AW7A 2QAPA 2V38A 5SWUA 3VMOA 2E9MA 2XH0A 4IISA 4QJ4B 3CWOX 1KXTA 2P50A 1OC5A 1W0MA 1C90A 4JEQA 3FHAA 5CSSA 4H6RA 1P5BA 5CXPA 3B9EA 4XO6A 2ZICA 5M17A 3AICA 1K02A 4GQBA 4MLRA 3KBSA 5A6BA 3O63A 4PC8A 3NVTA 1G94A 2D0FA 3FCPA 3RUBL 3W53A 1G67A 2VEGA 4RLIA 4GQRA 1I6NA 3LCHA 3UW6A 3ATYA 3WUEA 2FDSA 4JHMA 2X1TA 5AHFA 1C93A 1TJ1A 1XSKA 4LYQA 1WKEA 4B2DD 3LG3A 3MMWA 2VXNA 1CENA 4MG4A 2CHRA 4FXRA 4UR7A 4ERIA 3DENA 3MP4A 1SSDA 3WQWA 1UH2A 3WMBA 1EQPA 4AZ5A 2DJXA 5B7ZA 1W9XA 2PDCA 3H2EA 3ARZA 4L6DA 1ZALA 4PMDA 2DORA 2A7RA 1XH0A 4LUTB 1NWRA 3AMDA 1DJQA 1OJXA 1U1JA 2J7GA 1UW9A 3S2NA 3WNNA 3ARYA 4IGNA 5AHLA 3NEHA 1TYGA 3UYCA 4R88A 1W3LA 3NQ2A 1GVRA 4PTWA 1ADDA 2ZRXA 3TOYA 4W7WA 4M6QA 3C2RA 3L68A 5KITA 3V5OA 3IVSA 2QLYA 4JS3A 3GM8A 1TUFA 3U8GA 3CPUA 1YPFA 4MWAB 1JQVA 1OCJA 3WQOA 5IOBA 3MSGA 5EMUA 3KTXA 2OOFA 1VENA 3ABZA 1JZ2A 1GOKA 1E6RA 3FXGA 3QH2A 3SO7A 6ENLA 2PTZA 4RXFA 2JEQA 3DFOA 3IGSA 5M3WA 3W7MA 1Q6RA 1I2NA 1TJ2A 4XTDA 3N14A 3VNZA 1DBTA 2FZ8A 2OZ3A 3POHA 4DM2A 3CB3A 4NJIA 2YDSA 1XLJA 3IV8A 1ONXA 4BWLA 4ORMA 1XISA 4L6HA 3VOFA 2XZ7A 4QG6A 4GQ0A 2V3GA 3L2MA 1IXOA 3ZT7A 5EL1A 1UBPC 3MS8A 4H8UA 2B31A 1XQKA 2X1IA 3WH8A 2V3EA 5A5WA 5HWMA 4QNWA 2G4JA 4EPBC 2ZZ1A 3G1RA 2C16A 5LGZA 4OUEA 5CBBA 1XIEA 1F07A 1JRCA 3WLMA 4JNYA 4FX7A 1BRLA 1CZ1A 2CKSA 3LOTA 1KFCA 3AHVA 1VKFA 3UBPC 1S2UA 1Q6GA 3CV6A 4H04A 4EPDC 4WD0A 4J7RA 1YKWA 1EX5A 3QVQA 4FR6A 3WMLA 2QV5A 3ANYA 3HGRA 3HPZA 4KPLA 1QFEA 2O56A 1Q6DA 4A3UA 1KR1A 2QR6A 3IJ8A 4HHMA 3WNOA 4OIFA 2QUMA 4L6OA 3ZR5A 5CLTA 1RJPA 5L6UA 3EDEA 2ABAA 4DWSC 1I60A 3AYSA 4E2DA 3GYEA 4M6PA 3IJQA 4H6EA 3IANA 3ONBA 4C6EA 2JIWA 2NSXA 2YZRA 1QW9A 1UASA 2NW0A 1KD0A 1XGDA 3HPXA 4AD0A 1HP4A 3AZRA 1E9ZB 2UZ9A 4K1GA 4Y6GA 3FEMA 2H9AB 1F74A 2VVSA 3TSDA 1H1ZA 4BQ2A 1S2CA 4HVXA 5BWFA 4O12A 2WKJA 3MHFA 4K37A 3MSYA 3UG5A 3KRBA 5LSMA 4FXSA 2YCLA 4LEFA 5DY2A 4K7VA 3NSNA 3K13A 1JZ3A 1QW8A 1E70M 4JCMA 3V5CA 8XIMA 4PA8A 4JTJA 2AQOA 1SJAA 2W0UA 4HPNA 4H1ZA 1V0MA 3A4XA 1XYAA 4XO7A 3CQIA 1F8MA 4LNYA 2WZEA 1A3HA 4HA1A 4JTDA 4HIBA 2CWXA 2VC6A 5K9DA 3TMLA 3TFXA 1TE1A 2J7BA 2WKLA 4ORIA 1J5SA 3KW3A 1X38A 4D6CA 2A3BA 3PPGA 3IAQA 4JYDA 3U2OA 1V8EA 3QQ1A 5A8PA 2TYSA 2NVCA 3R0UA 3CO4A 3CWNA 5A8QA 2H3DA 3GC4A 2QMJA 3XIMA 3GXTA 1XG4A 1ZP4A 1H7PA 4KCUA 5EMMA 4ZEPA 5BXTA 1KM4A 2V2DA 5CZ0A 3BC9A 1JXJA 2YB1A 1W37A 2GWGA 3WD0A 4QE5A 2KAUC 1ZHAA 1VFSA 1QNPA 4ZXOA 3MP5A 2VRQA 3R0KA 3TMQA 4ZXLA 1KC7A 1DTUA 3DFQA 2CESA 3URNA 1W9UA 3NO1A 4HGXA 1NH6A 4XBKA 1VD6A 3O6DA 2XGBA 1ZJBA 4Q8TA 5KINA 3D46A 3REQA 1GOIA 3A3WA 1TTPA 2V81A 3WNPA 4TTGA 3M5XA 1GQNA 1PYFA 5K9CA 4NNBA 3LTPA 3OO2A 4GC4A 2PC8A 3IIXA 4AX6A 3STCA 5BOFA 3QZEA 1XYCA 1DE6A 1JZ6A 3PBYA 1DHPA 3FYPA 2XGIA 1SZEA 2LLEA 3VIKA 2FVLA 2O7SA 1DJNA 3W1LA 1Z6KA 1Z8AA 3TYEA 5E09A 5I0DA 1EP3A 1R3SA 4MAVA 1NDYA 1QJWA 5I3HA 3SBFA 1ZAJA 3WBYA 4IT1A 3M0IA 3T2PA 1V77A 4E8DA 4H8VA 2YBVA 4NX0A 5I3JA 3N29A 1RY0A 1T96A 5ABFB 1Q7ZA 3LRMA 2BOGX 3PZOA 3CEPA 4EVZA 4RE0A 3KP0A 4YVVA 4HOWA 2Z2UA 4JIHA 3TJXA 2UY2A 2PSNA 5TQLA 4AZ6A 4MNLA 4ROPA 4KMQA 1NWUA 1QTWA 1Q85A 1UC4A 4RE2A 3VDHA 1V6XA 4TXEA 2GGHA 3VKJA 4RZ6A 1DPMA 3NOYA 2C3ZA 1JDDA 2IXVA 3LY0A 3PB2A 3KP1A 2WCAA 3TJ4A 2P88A 2TAAA 3XISA 2YSWA 3ZVHB 4WHBA 4WEVX 3GLCA 1UIPA 2QCFA 4PH6A 2DVTA 2EPLX 1E51A 2ON3A 3W71A 4AZHA 4HNUA 5K7JA 2OQLA 4KETA 3KVMA 4DZIA 1VIWA 3B8IA 2Z1SA 3BAIA 5C5YA 3KBWA 3MU7A 4Q8NA 3V36A 3UXKA 1VLWA 3MKCA 1S2WA 4H6QA 1UQZA 3FVMA 3K5XA 5D30A 4RE3A 1K9FA 1F6KA 3MMTA 3TTEA 1JNEA 1SW3A 2ISSA 1ICPA 2FB3A 3OB8A 1GVIA 4MY1A 4A3HA 4NNCA 2WXDM 4GIYA 4QCFA 5BXPA 1HL9A 4S2CA 4LCRA 3GUWA 4OE7A 5RUBA 3KBNA 1XPGA 5DBUA 2IPJA 2I1OA 1EGVA 5IFPA 5HMFA 4RW3A 1W6TA 2TMDA 3IIPA 3TW9A 4HBKA 4GUIA 5KTLA 4DZAA 3L66A 3T42A 4H3DA 1QHOA 3MT1A 2PD9A 3AYTA 4I6VA 5FSDC 1YNQA 4G1KA 4KGJA 2GSJA 1H50A 4Z2GA 5A2BA 5K9XA 4LRSA 3V75A 3V1PA 1KM6A 4GBDA 3DG6A 1D3CA 3HG5A 3WLHA 4WY0A 1A53A 4DHGA 3G1HA 4AEEA 4B5WA 5FJTA 1V3HA 3Q65A 3A12A 5LNVA 2AQVA 5D02A 3T7VA 4Z1DA 3W26A 3M43A 1VBRA 3OHIA 4Q7IA 2EPOA 2QMKA 4IHCA 5I07A 4AYSA 5CC6A 4O28A 3R89A 1VFFA 3URAA 2C79A 2POZA 3R10A 1BKHA 2B7NA 4AWEA 5LNRA 3W7EA 1TPH1 4MZ1A 1QPNA 2DUZA 1VRXA 1SO4A 3HMJG 3SJNA 3L2IA 1JCXA 1LUCA 1I2RA 1NEYA 3GSMA 4Z08A 4TVUA 3O1NA 3I6EA 1S5VA 3TC3A 1W3KA 3FKKA 3RCNA 1TVNA 3TQVA 2XN2A 3L67A 3W88A 4WLCA 3AMKA 3VFLA 3PFMA 2D20A 4M80A 5CZSA 5B80A 4GACA 3EA2A 1MW1A 1AQHA 5FAGA 3EYPA 3PZ9A 1EA0A 4IGSA 5HULA 1Z41A 4MAZA 3O05A 3A24A 1Q6FA 2W6RA 4M51A 1FWCC 3WYZA 4HCHA 1RPXA 4QFUA 1UKPA 3S42A 4UCGA 1RH9A 3UGRA 4PN2A 1UQYA 1E73M 3I7RA 1R0MA 4K39A 2Y70A 3ELFA 3RNDA 3W7PA 1HVQA 2VMFA 3W7IA 2RDXA 4W84A 1MEHA 4MPQA 1FX6A 5J8LA 1VEMA 3CUFA 1ZTVA 2BOEX 3QQ0A 2E6AA 5I79A 4CVWA 4FX6M 2Y5EA 2BY0A 3VIOA 5I3FA 2XGZA 4IMGA 4ZQPA 1XG3A 2Q3RA 3WNLA 3GVRA 3ZSTA 2CBVA 2X41A 2P76A 1IEWA 4J3TA 2J6XA 3NOEA 2CLLA 3CQHA 3BWWA 4B5UA 5G4EA 1HQTA 4MM1A 4M1BA 4I5UA 4BI6A 5C9XA 4GISA 3F2DA 2YKKA 3P7YA 3B4UA 5CSYA 3P2VA 2X1UA 3GNNA 1RQEA 2XFWA 3A64A 1FWWA 1OX4B 2WVTA 2Z6JA 2BODX 3C52A 4OOZA 1HJWA 4F66A 3QMSA 3VMNA 3AFBA 4JFTA 3WY1A 3WDPP 2Z0IA 1V6YA 1LBLA 3TR2A 1AZ2A 2WWCA 3WLTA 2B7PA 2E6YA 4ICNA 1YTEA 2EAWA 2IPFA 3HU7A 4UIOA 3SDOA 3WK3A 5LXEA 3B0UX 1EGMA 1JXKA 1KO0A 2D3NA 2WM0A 5FJUA 3U5UA 4NJHA 4GY7A 1UMYA 3IPWA 3PVFA 3VNIA 2JFEX 5JU6A 4PCFA 3NEVA 1FWBC 1FVPA 2DVUA 2CERA 5D05A 1KM3A 5T91A 5E70A 3UJ2A 2BHZA 2OKTA 2C18A 2MUCA 3WH5A 2C13A 3H24A 2DZVA 1W31A 2NVDA 1E6QM 4R7WA 1AJZA 1L2QA 1M6JA 4GI9A 3KCLA 3QPYA 5KSWA 2OX1A 3U4AA 1A80A 3SUTA 4RL3A 2WHKA 2FH8A 4E0CA 2DQXA 4KH2A 1QOPA 3ABXA 5XINA 2MNRA 3PP7A 3VZYA 2WANA 3K4AA 3W6YA 3PY2A 4DNMA 1GYLA 1SZFA 1QOXA 4RKAA 2VR4A 3DH7A 4PRRA 1BF6A 2YIHA 2OT1A 4QIUA 4Y9AA 3G6LA 3VD5A 4QDPA 1HVXA 3BLIA 5CAHA 3K4WA 1FP9A 4HYWA 4IQLA 5AHIA 2GGIA 2PWVA 1OGGA 2IS7A 3KCOA 4XD6A 5JBEA 1T8QA 3OU8A 4LBSA 5JBDA 2Z4GA 1U2YA 3WMSA 1ISXA 7CGTA 1D7FA 2ZZ6A 3H7UA 2V5DA 4Q7NA 5E6YA 2O9PA 4MJMA 3M4HA 4L1XA 1O1HA 3UPMA 2PU1A 1W3JA 4KWOA 4ZOEA 3G1XA 1XLLA 4QROA 3TYDA 1KQYA 1I8JA 1GKRA 2CXEA 2OZTA 4D6EA 3L21A 4DNHA 4W8LA 4URIA 1V3LA 4LBRA 3F5KA 5IRPA 5AB3A 2D23A 4JAWA 4H41A 4WR3A 2BMBA 3CUGA 5IXEA 2FZNA 4H8NA 2X0HA 3TN4A 1VAHA 2W63A 3W27A 4C90A 3UR5A 3GDMA 4RNFA 4IPPA 4DB7A 4JTGA 3QJAA 4XD3A 4KERA 2WSQA 2BXYA 4C1LA 2J66A 4M29A 3LRLA 3CM4A 4G7EA 4N02A 1RXOB 2CW6A 1FXQA 4EIVA 3WSUA 3G3MA 3BQ5A 1W54A 3NGJA 1EP1A 3PBMA 1DTNA 1F8IA 3KL3A 1KQZA 3SIMA 1EL3A 1F3XA 4Y90A 2ACSA 1E40A 3M7SA 1UCWA 4YTUA 1M68A 4AHOA 4DXVA 4JIPA 2BB0A 5C70A 4UTWC 2HRWA 3G5EA 4PRTA 1FTXA 3F5JA 3K1DA 3ORWA 4PSPA 2ZUSA 2NV2A 4NASA 2R91A 1E1CB 2ZZ3A 1B90A 3AHTA 3TKFA 3M0VA 5BMWA 3SCUA 1J5TA 4B5VA 2GZXA 8CGTA 3OLGA 2DT2A 4DZ5A 4I9AA 4O0KA 3MHUA 3C86A 3EMQA 4JTIA 3WDJA 1XIMA 4YCPA 5KMYA 4GKLA 1MFUA 3L7RA 5FAJA 3A6OA 3M7WA 2ZUVA 4DBWA 2J79A 2Z7KA 4DJDA 5I3DA 2AGTA 5IBXC 1V3KA 3F4VA 4C6JA 3CPRA 2EPHA 1PV8A 4B9ZA 3QM3A 3EB2A 4NZFA 3AC0A 1OFQA 3FOKA 1JFHA 2C1HA 3MO4A 4LVAA 2PZNA 3SY5A 2E6DA 1H60A 3NQ6A 4KFOA 4O0ZA 3A3HA 1WPCA 4HPGA 1NELA 1ZENA 1ZJAA 2JEPA 3RLGA 3W25A 1DIKA 4LV4A 3KBJA 3UWQA 3L5MA 2FTYA 3AJ7A 3U6WA 4WCJA 2E4TA 2C1GA 3KX6A 3MANA 1C7SA 3NG3A 5HUOA 1CGUA 3AS0A 4S3FA 4ZQMA 1TMQA 2FB2A 2V3FA 4WKAA 2GVYA 2YL5A 3VYLA 2NT1A 1EIBA 4DEFA 1EJVC 2VM8A 4NZ5A 2XHYA 4J1OA 5A6AA 1I1XA 3F4NA 3IUHA 1O5QA 4G2DA 2RGLA 3GG7A 3PC0A 1FHUA 4RR4A 1RA5A 3R79A 2IKGA 3GBDA 3TXZA 5XIMA 1TELA 4CNPA 1POJA 2WV8A 5HWJA 4IIDA 3T2OA 4WDWA 1MUWA 2Z7GA 2PF8A 2IQ0A 3CMJA 3S2LA 4C7FA 3KTCA 4M7SA 2YA1A 1TCDA 3EXTA 1I0BA 4WF7A 4YWSA 3HGSA 2ZZ2A 1UKTA 4UNKA 1UMLA 3M9YA 2EQDA 5FCZA 2WOQA 3TZNA 2CLHA 3AZSA 1XR2A 5AZ1A 2FYMA 1U22A 3UCQA 3RDKA 3APYA 1K70A 4O1DA 4O4WA 4XB3A 2ODOA 3W7LA 5DFAA 1HNYA 3QOKA 4IIFA 2ZUTA 4QG9A 1G9HA 1NFBA 1Y5WA 3QPZA 3B04A 3SCNA 5U4NA 1CXFA 4Q33A 1OD8A 3PB0A 1VH7A 4NY2A 2GDQA 2A3LA 4FF5A 4AXKA 4KEZA 3B4YA 4HNVA 3AYRA 3P81A 1PTDA 4D2JA 4AD3A 3A13A 3BJSA 2POTA 1FY6A 4Q8MA 3N3MA 2PRLA 1XIGA 4L4LA 2FDMA 3THQA 3CLMA 4E3VA 3L23A 4B90A 1TVLA 1JUKA 4NJGA 5G2HA 1W9BM 5GNYA 1YBQB 3W72A 1I2OA 2X1SA 3GIYA 1IEVA 3DCPA 4PTNA 3W86A 5G1YA 3G24A 3WF0A 2NT0A 1MDRA 1XLCA 3AIQA 3F2BA 1ZFJA 4U33A 2NQ9A 4JEJA 1WDWA 1W1TA 3M0MA 4XG1A 1K8ZA 2R1MA 2GUBA 3LLFA 4IX2A 3PR2A 3H4XA 2ZKMX 1K03A 1XRFA 1XYFA 1OFDA 1Q65A 1AQFA 3DGBA 4Q4QA 5ENLA 3NXFA 3WL0A 2EKCA 2BXVA 1CWYA 5KZDA 1O4UA 2QUUA 1J2BA 4GINA 2BS9A 4O13A 3P6LA 1DIDA 3R6IA 5LIUX 1O5RA 4H7CA 2L5HA 4OV9A 1H63A 1OYBA 3H2NA 4DY1A 3I6RA 4DF2A 4JDBA 3HPSA 4Z2IA 1U5JA 3NA8A 1MNZA 1H7WA 1SSGA 4YVPA 1CGVA 2EHHA 3S1WA 1QO5A 2QV4A 3Q37A 1FWNA 2PDMA 1MYRA 3H26A 5T8GA 1F3WA 1F2JA 4J2MA 3AXHA 3IS4A 3DZ1A 5A6TC 1UR8A 2X7WA 4AWUA 3P60A 2YPIA 5H8UA 1PCWA 5KZMA 1JCJA 1RK5A 3NDOA 4ATDA 4C6IA 4BFAA 5EMKA 3V0TA 4G7FA 1OX5A 1GVYA 2OX4A 3LCGA 3GG8A 1WBJA 3S1VA 1MEWA 3QW4B 3B9AA 4L1GA 2FQIA 4B3KA 2MANA 5AYXA 1SZGA 3BUVA 3BANA 3R8HA 2JQXA 4LH8A 1TPWA 1JFXA 3NJ3A 1TE6A 2GDUA 3SUUA 4JX6A 1DV7A 1ZL1A 2B7OA 1OYAA 2NQHA 1A4LA 2CHOA 1TSIA 3OODA 1PB0A 2D3LA 1KGWA 3QF0A 2GQ3A 4GZEA 2VHLA 4Q32A 1US3A 3ARTA 3BJTA 1LWIA 1UUQA 3LHUA 4XAYA 2E77A 1R3QA 1OF8A 1HKWA 4MJ2A 4MMWA 5A6SA 1KTBA 3TE9A 1SPQA 1S2TA 2GLKA 4K3ZA 3T40A 4W7UA 4JXCA 1R3VA 1AH3A 3RK8A 4XZIA 3HG2A 1Y5VA 3GR7A 4I5XA 1FKXA 5MKGA 1BGGA 4BQ3A 3CQKA 4ECLA 5F2LA 2DIEA 2C19A 3NSXA 4PULA 3MYPA 3LB0A 4NAEA 5MKGB 2Z2BA 3H2AA 3C0LA 3NL5A 4P8UA 1S5NA 3S9IA 4UZSA 3CZKA 3K8LA 5CZKA 2YL6A 3SQLA 3ARVA 3DYMA 1RY8A 4Q4KA 4WDXA 3IGXA 1WDDA 3T09A 2D22A 1OD0A 4QEEA 2WBGA 3WUFA 3BOLA 1T41A 2QJNA 1JZ8A 4AY8A 3DBNA 1EPVA 4JIIX 1B0IA 3PF3A 5EFDA 3SURA 3THUA 3WQCA 4WK9A 3G22A 1E9LA 4WXZA 4XZ9A 2GK1B 4UMCA 3KOZA 2CZFA 4JDYA 2ZVIA 4GNVA 2OU4A 2ZX9A 1A0DA 1ITUA 2DH3A 4HHPA 4CU8A 2J13A 1XIFA 1EPXA 2Z1BA 2ZZ7A 2VNCA 3G1AA 2XN0A 1MEIA 2FZDA 3QZ6A 2GJLA 3MBDA 2DSUA 3JR2A 4NYYA 5GNXA 5DCDA 1F4AA 3TC6A 4DYKA 1QI5A 4YWIA 2NUYA 2YYTA 4PMXA 2G4FA 4EXAA 1SFTA 1ADSA 3AMCA 1NIUA 3DFHA 4JD4A 1IIHA 4O15A 4NZ3A 4NAFB 3CS2A 4GCAA 1CXLA 4IP7A 1ZCOA 3EB3A 4GVGA 3M0JA 1JDCA 1EFZA 3W76A 1I45A 3KS6A 4N9DA 3VIHA 1MO0A 2OGJA 2YFNA 3OGRA 2E9BA 2F6KA 3L5AA 4WQ6A 2V30A 3GD6A 4EX4A 3R8GA 2INEA 4DBSA 4HU3A 3LZ5A 1VZWA 1UG6A 4H19A 5DO8A 4B4HA 4QGCA 1XLHA 2Y7EA 1W8GA 4U28A 2R24A 4MB4A 1A5KC 5ABHA 4UTTC 1ZS2A 4NKCA 1XD0A 1Q4WA 3WLSA 4NVTA 2XVPA 1OK6A 1L9WA 4H6KA 1BFNA 1ITQA 5BW6A 3KFTA 3TVAA 4J3XA 4BI7A 3DDMA 3ITLA 5HNUA 4JTUA 1VBHA 4IXHA 4B5TA 1CGXA 5FJRA 1K8XA 1RV8A 5JQ9A 2PTYA 3HFTA 1E3ZA 3SAZA 2BNJA 1OYCA 4IIGA 3PNZA 4NRSA 1TV3A 1GCYA 3LK6A 5D03A 2G96A 3C6CA 1H09A 5T9BG 3K46A 1XGEA 4RE4A 3WELA 1G0CA 4UQBA 3A4WA 4W93A 5G2IA 1PTGA 3EEGA 1YBQA 3LPGA 1J9YA 4EANA 3DHPA 2VZUA 4M19A 1IXNA 4KGLA 1E71M 1JGMA 4PYSA 4HA3A 4E4UA 1WA3A 3QGKC 5HPOA 3W0KA 5GJMA 2D2GA 1SQ7A 1E9IA 3C0SA 2H8ZA 2OGYA 1OC7A 1TPUA 3N15A 2UWFA 2OO0A 1TREA 1C8QA 4QDMA 1W9PA 4R53A 5DXYA 4HU4A 3GH7A 1VFMA 2KZHA 1VYPX 5KEZA 3PPHA 3MPGA 1G7UA 3FAXA 1EP2A 3MSRA 1QNOA 2HWGA 2HDJA 1DJYA 3OLDA 1IF2A 4W8AA 1XYMA 4LC8A 1XCFA 4XQ6A 2PODA 4HKPA 3IJIA 4A3YA 3S5YA 1K6AA 3CB8A 2VELA 4IQDA 4YNGA 4LX4A 1PL9A 5LNWA 1QK2A 1G7VA 1DVJA 3G8EA 4CGTA 4NJKA 1OG6A 3VE7A 4O1CA 1EC7A 7TAAA 4PEEA 2D73A 2OSWA 1P43A 1BVZA 3O6CA 2Y1HA 4UB9A 3P62A 4D6IA 1DKWA 3FFSA 3MQTA 1UKQA 2VDIA 3T2QA 2OTDA 4LUIA 1A4MA 1OT1A 1YRRA 4AZGA 2Z25A 2PC4A 4LC6A 3GH5A 3E96A 1BLIA 1XKYA 1K7XA 3A47A 5LXXA 1C9WA 4N42A 1JYXA 1WB0A 2Y88A 3W1TA 1I1WA 3QQWA 3L4XA 2DZPA 4Y2WA 2Z24A 3EWCA 4I6KA 5FF4A 4L9YA 3BCDA 1DJWA 1GPWA 2E1DA 4P7OA 4ZO7A 3B8UA 1D2KA 4GA8A 1J0HA 1FOBA 1P6WA 4UWMA 4UFMA 1UUMA 1OB0A 1TRDA 3W83A 3BLDA 1FDYA 1KV5A 3AHXA 4OGZA 1MRAA 1AD1A 5E5CA 4ADUA 1JG9A 2Y5JA 2GPTA 3QY8A 3CQ0A 3H70A 4FNPA 1GK8A 2BY2A 4IFKA 2WZIA 4QLJA 3S0CA 3WG6A 1FWRA 1R3RA 3U57A 4QJ3B 4HOXA 4V2XA 7PTDA 4UTMA 3M6DA 2QVNA 3WDRA 5IDZA 3U2EA 3KOFA 4FAMA 2ZXAA 1A5AA 3TEVA 5I3KA 5HOSA 3W01A 5TF0A 4HZ7A 1K8YA 1I75A 1DIEA 3AISA 1UIOA 4OBRA 3SCVA 4YIWA 3U2CA 5AVHA 1OFAA 4AIEA 1DJHA 2W3ZA 2FPYA 3HGOA 2NWRA 4JQ1A 3N13A 1JPMA 3ANVA 5TNVA 3H55A 3GBEA 1OZMA 1XCXA 4HN8A 1UKSA 1M7JA 3KVKA 1DYSA 4DLFA 3II1A 2DJLA 3U9IA 1XLAA 4PBEA 1W5PA 1B31A 1LQ0A 3KM8A 1W1A1 4IFRA 4CCDA 4A05A 1CB7B 4NAEB 2DPEA 1UKOA 2DIJA 1V6UA 4KEMA 4QNEA 4HMNA 1XHGA 1SZRA 2NV1A 1VJSA 4K8GA 5JH1A 1P1MA 2NLYA 5U7SA 3WK2A 1GUVA 1EBGA 4OOUA 2VGIA 3PWAA 5D9NA 3A22A 2EF9A 3EWXA 4JFVA 1NQ6A 3YPIA 3PUEA 1B9BA 3CHFA 3EZ4A 3MJYA 4S39A 1HO4A 3ATZA 3LGDA 3TW7A 3S9ZA 2HPMA 1E43A 3TTSA 3UWEA 2PGFA 3CTTA 3UCDA 4K68A 3DFSA 1W1PA 1GKPA 4EPEC 4JKKA 4FXJA 3G8RA 4GH1A 3VGDA 3NPXA 2V82A 4Q4RA 2Q71A 3ZJ6A 4BS0A 2R1KA 4WY0F 4KW2A 9XIAA 4XWUA 1FRBA 2R9RA 1JDFA 4HNOA 4TTUA 4DBEA 3ABRA 3BLPX 3LBMA 4C6PA 4CQAA 3CTLA 1G4EA 1AODA 3WD4A 3LBOA 4JIRA 4LGXA 4E2BA 1XFBA 3W22A 2WNZA 3O16A 5ABEA 3DESA 2QUVA 5I5RA 4IMCA 1MNSA 1R2SA 3WF3A 5AHNA 2XWDA 4JNZA 5I2UA 5FF3A 5M03A 2WO5A 4JFUA 3TR9A 2W62A 4GX9A 1O6IA 4LAUA 2PRMA 4MF4A 4QLLA 3UVAA 5DMYA 3O0KA 3S6OA 2PE4A 3S46A 1Y8BA 2QCEA 1BYDA 1TG7A 1K4GA 2OYKA 1G5AA 3HOJA 2YBUA 3FIGA 4ZCWA 4M24A 2CWNA 3RM9A 3WIJA 5CBJA 3E38A 4EXBA 4G6CA 1ZJIA 1GJPA 3WLIA 2RJGA 5JVLA 4JIQA 3LXAA 5REQB 2QCCA 4IL2A 1LJYA 1Y5XA 3THDA 4CNUA 3RO6A 2XIOA 2ZRUA 4GIRA 3BAWA 4JTKA 3W02A 1ONRA 4WSKA 4CCCA 3QHOA 3SUVA 2IUZA 4DLMA 2PDNA 1S2VA 3GIPA 2W4XA 2CZEA 2XH7A 2ANUA 2A3HA 4H7ZA 2E09A 3OIHA 5LYRA 1CXIA 4L80A 4RZ5A 1XSJA 1R47A 5K3VA 2JF6A 5K4XA 3RPMA 2EPMX 4XAZA 1TPB1 4LVBA 2V2HA 4E2OA 1E6PA 1Q13A 5IHRA 2BHUA 4CQ9A 3VKKA 1NDZA 3ALGA 3A5FA 1EJSC 3U48A 4DWSD 4JQ2A 1K77A 1HJSA 2A3AA 3MI3A 4B5SA 1K7EA 1M7PA 3QXBA 1TCMA 1LG1A 4A22A 2VGBA 1SR9A 3DU0A 1MMFA 4LXFA 4GBUA 4U5KA 4RV8A 2BY3A 4ZOCA 3T1GA 4KWSA 5G5IA 3V1HA 3ARXA 4DO6A 3EX2A 1GQIA 4US5A 3FGCB 3R2GA 3LPPA 1QCWA 5BRQA 3UWYA 2C8NA 2WJEA 4LVFA 1M41A 3LMZA 2HCVA 5LZLA 1UR0A 3F4CA 3JS3A 1RALA 3MYOA 3HTWA 4CNNA 1ADOA 1XI3A 3BOXA 1P1XA 1ZGDA 3GAYA 1WZLA 2CLEA 4Q4OA 3OEXA 1Q7QA 4MB5A 4NX5A 2HV5A 1FUYA 4A8IA 1JYWA 1XJBA 3LRKA 2RFGA 3TJLA 1C92A 5CSUA 3VNKA 3RU6A 1EO7A 3ALFA 2OR2A 3IUDA 3NM1A 2QPSA 3W24A 1V93A 2ZADA 4FOUA 4HZ6A 4EK7A 2DY3A 3GR8A 2RDUA 5CH9A 2PGRA 4RXGA 4UFJA 2Q02A 1JCNA 3L4VA 3QR0A 2FH6A 3UVIA 2JF7A 4RDZA 1LCOA 2ZC8A 3UXLA 1BXNA 4H7VA 4MGGA 4NUWA 1LP6A 1ZAIA 3WEMA 3ZO9A 3BTNA 4MWAA 1C7TA 1TQXA 4O1EA 3I68A 3CGTA 5I77A 4IJRA 4HU8A 4S23A 3HFYA 5HBFA 1HZYA 3VX0A 1XL9A 1L2UA 3SCSA 4DO5A 3W4RA 1B4EA 3LCWA 4JHZA 4OKDA 2ZC1A 4F3HA 3OG3A 1F9CA 4C6DA 3VNJA 4I3GA 2HISA 1VR6A 1HO1A 1J0JA 3TQPA 4ZTYA 4JN8A 2OLHA 4KWUA 3PPFA 4J3SA 1YE4A 4F48A 2IW0A 1TZ9A 3NQ8A 3TONA 3QV6A 3S2CA 1KBKA 1FWFC 3W7RA 1IZKA 2OT0A 4AZBA 3M5YA 5EPDA 2XVGA 1LQAA 1OG0A 1VCVA 3OTRA 2HTMA 5HJLA 3W7OA 3BSGA 2OCZA 2QF7A 4LUTA 4PFMA 3PSVA 2BY1A 2IMRA 3AU2A 4S3EA 3W70A 1Q2RA 1WCGA 3UXIA 3FA4A 1TMLA 2PCEA 2P0IA 1S3TC 3U7BA 3N2BA 4QXIA 4JFSA 4OUIA 1X96A 2JGQA 2XIBA 1O7AA 3BH4A 1BVNP 4QS5A 2OLSA 2VEFA 5AKQA 4KKXA 2SFPA 3RYSA 1QNVA 3PM6A 3DHDA 1KGXA 3VILA 5IDIA 3ES7A 2YCEA 3ZOAA 3KZSA 3NWRA 1FCQA 4I5RA 1PKNA 2VFHA 3BAXA 3DXIA 5A6LA 3EGJA 2FVMA 1KWGA 1ZY9A 1J12A 1UROA 4GJIA 1LF1A 5C2GA 4U31A 5DELA 1KCXA 3ARRA 3SRHA 5CC7A 4B2DA 4JNMA 1X6LA 3S3GA 3OZMA 3LHWA 4MZ8A 4DWSB 3OG2A 1A3XA 1JIBA 1NFGA 3ZVIA 1ZAHA 4XIAA 1QNSA 2V5BA 1JQXA 3P61A 1QPRA 1V03A 3IJ7A 3V0UA 5I00A 2OODA 4FOKA 2VL4A 1NQKA 3LQLA 1PTAA 4CUCA 1IEQA 3AQUA 3NDZA 1TX2A 3ID7A 6A3HA 4LU0A 2PCQA 5EB8A 1E6XM 3O9NA 4Q22A 5FEZA 5LGXA 1OY0A 2EG6A 4A21A 1KV8A 2XIQA 2I9EA 4M56A 4ZSUA 3SB0A 3N1AA 4HNNA 4F9JA 4DUWA 4JTTA 4MLJA 4Q6JA 3EXSA 3NQBA 5C54A 1VF8A 1FCUA 3S47A 1TWIA 4E4PA 2WJDA 2FPTA 2QJJA 3SFWA 4JGDA 5CEWA 3SADA 1EJUC 3AXMA 3N4AA 2DQWA 4E3TA 3GUGA 2YCKX 1G4TA 1KWKA 3U3HA 1Q7MA 5A2CA 4LYKA 4LB3A 4W87A 1VBGA 1OC6A 3AS2A 3C2YA 2Z28A 4PODA 3W2MA 1A5OC 4LUJA 4F0HA 3MA8A 4WSJA 5D33A 4HSHA 1QWKA 4N9CA 1MRQA 4ONVA 1TQJA 1J6PA 4UTTA 3P84A 2HBVA 3CK5A 1LOQA 1RZMA 2GFTA 5J5RA 3G2GA 3PTKA 1D3GA 3PNUA 1AK5A 3ARWA 2PZ0A 2WMGA 5A8NA 4DYEA 1UB3A 1UWRA 1XC4A 4A8NA 1W1ZA 1N8WA 2DW6A 4U10A 3F03K 1ONWA 2JALA 2V69A 3B8VA 1RA0A 4V1XA 3NUKA 1F7BA 1WZAA 2DSKA 3SGGA 5FEWA 1XGZA 2VR2A 4UMAA 3UT0A 2NX3A 1C9DA 3TROA 2A5HA 1JEZA 5DMNA 4RW5A 2QDEA 1J93A 1X7FA 3S4TA 4DJED 3IGHX 3OVQA 3UWUA 3VNMA 3E2RA 1KLYA 3CV2A 3B3DA 3RM4A 2WWDA 4UQEA 2VC7A 1Z7AA 4ZE5A 3CMGA 4Z1AA 2XG9A 3VX1A 4ZVJA 1D7KA 1IGWA 4OU1A 5F4WA 4MADA 1W9DM 5A6KA 5C9UA 2ISFA 3FYYA 4PRWA 2P5NA 4Y9MA 4WY0B 4BEQA 1B4KA 2D0GA 4W9TA 1DJXA 3HMCA 1YDVA 4WUIA 3E2SA 4CLMA 5LIYX 1JD9A 3PJXA 3DKJA 4F8XA 1HKVA 1PWLA 5IM51 4CQDA 4MNMA 3B03A 1Z3NA 3LTYA 3UJRA 1JYVA 4JQ4A 4LY8A 4QISA 1KRMA 4HTYA 3RGTA 2GVLA 4AZCA 3BXWA 1E5JA 4HQVA 4RCXA 4C7DA 3ZLFA 3BK0A 4B5XA 4UMBA 3BAJA 3W7KA 3PTQA 1UBSA 2J9XA 1RCOB 4BF7A 3GVGA 4GMEA 3LXCA 1EDGA 3S1UA 4B91A 7REQB 3W1AA 2F2KA 3PFRA 3CAQA 4UR9A 4P61A 1MXGA 4LV9A 3U7VA 1OFEA 4PSRA 1QT1A 4Q4SA 4GVIA 4GIAA 3LDVA 2I17A 2PDJA 1WXZA 5HINA 4FIQA 1V3IA 1IHIA 2RUSA 6PTDA 2J74A 2WCSA 2GL5A 4QCEA 1EXBA 3K8KA 2EJ1A 4NAFA 6XIAA 2W79A 4C7GA 3E5PA 4OTKA 4Z1YA 3AZTA 3WJZA 2QGHA 3OJGA 2VRKA 1BVWA 3ZFHA 3C0JA 3B05A 2QAFA 4MDOA 4Q7BA 3NQMA 4C6MA 3TA6A 1AUSL 4K6AA 1PDZA 1JF5A 2PA6A 4FLQA 4ADSA 4W5ZA 1WKYA 3CT2A 3CXOA 3L4TA 4Z42C 4AC1X 3WKZA 1JRBA 3VOHA 4ZQCA 4FLOA 4LSBA 1PHWA 2O92A 1BF2A 1EF3A 1EHNA 1DJGA 3SECA 3BZJA 1JL8A 4NNAA 4DUXA 5LIKX 4XAGA 2GUYA 4KS0A 4BR1A 4P2VA 3E2VA 3IRDA 2PDXA 3GK0A 3IWPA 1E6ZA 5JIWA 1JPKA 2G41A 2XJ7A 3BLOA 4HPXA 5D8WA 4Z1CA 4HZMA 2ZA1A 3URQA 2E40A 1G6CA 3EPNA 3RLHA 4MB3A 1CGTA 2Y8VA 1NP0A 5CC3A 2QIIA 3VGGA 1JZ4A 4EOUA 4EPKA 2I5QA 2VQTA 1ISYA 1VLIA 4AIOA 4O18A 2VZVA 3L4UA 1O60A 1XH2A 1XBVA 5D2XA 5D2TA 3SI9A 2A7NA 4Z2KA 4KFNA 1QPOA 4LNCA 3BW2A 4BHYA 4GRSA 2FZBA 1VJIA 4IG2B 2WBKA 2OYLA 3GY1A 4UQDA 1LUCB 1IIGA 2EPKX 1Z48A 1JDAA 4JTEA 3WQ6A 1XH1A 1TTQA 1KBJA 4M7TA 3S1XA 1Y7VA 1NOWA 3PULA 1XLKA 1UH4A 2HS6A 3AIWA 1PEZA 3T07A 2Q3OA 1B3WA 5D9PA 5D09A 3WLRA 1R5YA 2HBXA 2A3CA 1H41A 1J6OA 3VE9A 4D1IA 2CYGA 2WSRA 3HV8A 3E2QA 4IPIA 1PZ0A 4HTBA 3PTDA 5TIMA 4AFYA 5LIWX 1O5XA 1E1EA 2C1IA 2DFAA 1K8CA 3CHCA 1HG3A 4IFKB 1UD5A 5G2WA 4J3WA 4AVNA 3UY8A 1XLMA 1GT8A 4XZHA 2QPUA 3I10A 2HVMA 5DQPA 2E9LA 4J3VA 5DCEA 4D1JA 1H0GA 4DUVA 3CZEA 1E55A 4OJYA 1ODUA 2WNWA 1R87A 1C8XA 4ICCX 1B3VA 2ISDA 1PX4A 3ZWTA 2PP3A 5E0FA 3AS1A 1KB3A 1B3OA 4KEVA 3O15A 3E1F1 7ENLA 3POCA 5CAKA 2WC4A 3MUAA 4P7RA 3KTSA 1EB3A 5EKYA 2QDGA 5ABGA 2WVVA 3VM5A 1KXQA 1LBFA 3UXDA 1GGOA 1O66A 4C1KA 2OMAA 3EOLA 2VOMA 3KRSA 2WHLA 1PKMA 3NCOA 3URBA 2HEJA 3DFPA 1C91A 3PZQA 2WQDA 4LB4A 1EJTC 2EXOA 3OGVA 2PDUA 1JI2A 2E3ZA 5F2GA 4LAZA 4XV0A 4ZB5A 2Q6ZA 3LPOA 2B4GA 3HJZA 2WZTA 3HPFA 4FNTA 1H11A 4FALA 1FWSA 4U3AA 1F6PA 1U1HA 2GVGA 1C29A 1UJQA 1NARA 1SO5A 2WYSA 3LM3A 4BK9A 1V0NA 5A8OA 3HJEA 4JKMA 1LROA 1YXCA 2PWDA 1YPIA 4W85A 4IFOA 2OKOA 1DE5A 2YXXA 2Z2AA 3NQDA 2ESCA 1TFVA 4C6OA 3GFXA 3VIPA 2AKZA 3IJ6A 2ATSA 4M81A 5AYZA 2BZNA 3BAYA 2ZUWA 2ZBTA 4ACZA 4DIAA 5CPLA 3C61A 2OEMA 5BROA 4ZL1A 3TYBA 1GG0A 5F2MA 3VKAA 5FF7A 3H2MA 4S3JA 3S5SA 1I2PA 1HN1A 4C60A 2XIIA 2FTWA 2BWGA 5CPNA 3ZZ1A 4K1WA 4DJEC 2ZCGA 1T7LA 1S2AA 4LUSB 3SCTA 3C56A 3S6DA 4MYAA 3KE0A 3MUIA 1L6YA 2VD9A 1TPC1 1BQGA 3JW7A 1M01A 1CGYA 3BO9A 2VKZG 3O3RA 7REQA 3I4EA 4FXFA 2OEJA 4O57A 3W75A 1F3EA 4GNKB 4MKNA 1T0OA 5D38A 3ME3A 2BGSA 4BCEA 1KFKA 3KHDA 4O8AA 1CXKA 2VFEA 3VFCA 1WE5A 1RP9A 3KVJA 2PDGA 4Y8FA 1UR2A 2VT0A 4EXQA 4BQ5A 4I8DA 2QJGA 2CU0A 1DHKA 3KEHA 4H9VA 4HP5A 5TBOA 1N82A 3SUWA 5HNTA 4AAJA 1TV5A 3BLEA 3GDKA 2PWEA 3E0FA 4GJJA 3VUPA 3SCOA 4QQ3A 2YJQA 1SYTA 4AHQA 3RN6A 2UV8G 2V8ZA 1R46A 5F1VA 1W5OA 1XYLA 6XIMA 1YQ2A 4O8RA 2GQ8A 1OEPA 4HK6A <