4JZ5A

High-resolution structure of catalytic domain of endolysin ply40 from bacteriophage p40 of listeria monocytogenes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
b'GSHMMVLVLDISKWQPTVNYSGLKEDVGFVVIRSSNGTQKYDERLEQHAKGLDKVGMPFGLYHYALFEGGQDTINEANMLVSAYKKCRQLGAEPTFLFLDYEEVKLKSGNVVNECQRFIDHVKGQTGVKVGLYAGDSFWKTHDLDKVKHDLRWVARYGVDNGKPSTKPSIPYDLWQYTSKGRIKAIASPVDMNTCSSDILNKLKGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gp26
publication title Crystal structure of catalytic domain of endolysin Ply40
rcsb
source organism Listeria phage p40
molecule tags Hydrolase
total genus 75
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jz5A00
2VQTA 2XPKA 5DEZA 3AS3A 8A3HA 1L8NA 4MTVA 1TE1A 4C7FA 3MV01 4PMNA 2CBUA 4JFUA 5E0FA 4HA1A 2RGLA 3BH4A 4J3VA 4LGXA 4PTXA 3II1A 2VUYA 1CLVA 2XG9A 4N42A 3WNOA 3JUGA 2W67A 5D4YA 1UWRA 1HVQA 3OBAA 2DIEA 3APGA 3UR8A 1UKTA 3NSXA 4AD2A 3S6TA 4D1JA 2J7FA 2WLYA 4CD8A 5F7UA 1HJUA 1WDPA 4UQEA 1RP9A 3WF1A 1PX8A 1BQCA 3RJXA 3AJ7A 1OWQA 3PZIA 4W8BA 4W88A 4P8UA 2QPSA 2ZXDA 1WDSA 3OIHA 2JF6A 2WBKA 4OBRA 1JAEA 4GQRA 1B2YA 5I24A 2WMHA 2FGZA 3VGEA 3VIMA 2A3AA 2CYGA 3ZSTA 5A6BA 3ARUA 3ARVA 4ZENA 2WWCA 4GZIA 5E09A 3OGRA 3NUKA 1LL7A 3VNZA 3WBEA 6CGTA 2VCCA 3ZMRA 1NM9A 5LA2A 4CN6A 3WD3A 5BCAA 2F2HA 2VVSA 3B9DA 3ARWA 3ARXA 2YDQA 1UH2A 2YOCA 4DWSC 1WZAA 3WQ8A 4KWUA 1KGXA 5ABGA 4AIUA 3W82A 3RM8A 1XGZA 2NT1A 4FF5A 3WKZA 2WC4A 1BFNA 1LJYA 4CN1A 2J25A 4KRTA 5LA0A 1LQ0A 3AHVA 3GYCA 3FAXA 4NRRA 1WKYA 4FK9A 5BXPA 3VIHA 5CLTA 1CXKA 2ZXQA 1WZLA 2BVTA 4Q22A 4AIOA 4IISA 5AY7A 3CHCA 1CGXA 2V5CA 2EXOA 4JAWA 3WNKA 1DHKA 2W91A 1UZ4A 2WMIB 1YQ2A 2Y2WA 4CVUA 3VGFA 3IAQA 4GO8A 3WNMA 5CXPA 4OOUA 2F8QA 1QW8A 2XYLA 1GQIA 1UKPA 1QNPA 1W91A 1V02A 4AXNA 1H4PA 3F5JA 9CGTA 2O9TA 4HU8A 3KE0A 1VFUA 1FH7A 2E3ZA 3LPFA 1B3ZA 2VX4A 5GQBA 1UWSA 1H0GA 2YL5A 1JNEA 2DSKA 3CIVA 1ISYA 4X0NA 3MUAA 2BVDA 3T2PA 4B3LA 2BY2A 1FP8A 2EQDA 4ZEPA 1L0PA 4F79A 4HPHA 1EXPA 4PRWA 1G94A 2J7BA 1GQJA 4AWEA 1PBGA 3LMYA 4U2YA 3WMCA 2WYSA 4M24A 1XSJA 4W8AA 1VIWA 1M01A 1SFSA 1XH0A 1UD2A 1Z32X 2E9BA 2VOTA 4HZ6A 4NRSA 4JKLA 1RPKA 3N15A 1NOWA 3S2CA 2X09A 5D9OA 3WEMA 5HNNA 3AROA 5GNXA 2XVLA 4V28A 1JGIA 4AEEA 4HA4A 3VIPA 4ML4A 3ZJKA 1ODZA 1J11A 4QAWA 5CGMA 5M5DA 2HVMA 3CMJA 3NSMA 3FW6A 3MV11 1KBBA 2IXUA 1JIBA 1W9UA 1FP9A 1WPCA 4PYSA 2BV9A 4KGJA 4B9ZA 1B0IA 2BXYA 4JFVA 1PPIA 2J8FA 4M8UA 3UEQA 5A6AA 5CG0A 3TP4A 3UG3A 4CUCA 2WC7A 4QLKA 5IDIA 4GXPA 5HXMA 1W1VA 3ZIZA 1JI2A 1JZ7A 4CU8A 1QNQA 4PUDA 3MSDA 1ECEA 2CERA 2QLYA 4GI6A 5A6KA 1JZ6A 2PWDA 2CESA 3CH9A 1EQPA 4MDPA 4UQDA 1CTNA 1VJZA 4ACZB 3VD9A 2CHNA 3VOCA 1R87A 2YL6A 2J62A 2CCRA 1E56A 2B31A 2PBGA 4OZOA 1C8QA 1PIGA 5I77A 4HPGA 1E6SM 4ACYA 2ZX8A 4LYPA 1V6WA 1BYCA 4U33A 4YHGA 1TR1A 3MMWA 2VURA 4PSRA 3W37A 2DH2A 4JL1A 1JZ4A 3AS0A 4HOWA 2E8ZA 2CNCA 3NIYA 4JZ5A 2WMIA 1B3XA 4GZJA 2D0HA 2W5FA 3WDIA 2WNWA 3AZTA 3SUVA 1A3HA 3ARRA 1C93A 1H11A 5I78A 1EH9A 3RCNA 3WH5A 4E8CA 2WPGA 1GORA 2OSWA 2Y8VA 5A94A 4AZIA 1NOFA 2WKGA 1JDCA 4GPNA 3BLPX 2BY3A 1QW9A 6A3HA 3L4VA 4B15A 4B16A 1V6UA 3BMWA 1XSKA 2CITA 1VFOA 1GVIA 3POCA 5A6MA 3ZO9A 1E6ZA 3NDZA 2WHMA 3VIKA 4AD4A 3WDPP 5DT7A 2WHKA 1HN1A 3K8KA 1J12A 2DH3A 1ITXA 1ZBKA 2BHUA 1EDQA 3RIKA 2YDSA 1CPUA 2XHYA 1TA3B 3MSGA 1JF5A 1V3MA 1EA9C 1NARA 3EMQA 4TXEA 3CMGA 1JYNA 1U2YA 4PMRA 1QPKA 1KQYA 5AC4A 1H5VA 5M03A 1XSIA 1JYVA 3MMDA 3W29A 1B3WA 3AIWA 5GNYA 1BYDA 4TVCA 1JFXA 2ZUNA 3T2QA 1EGZA 1OB0A 3SCRA 3GNRA 4MB5A 2WW5A 4CCEA 1QBAA 4AZ6A 5JUVA 1J18A 2WWDA 1V3IA 3LPOA 2C7FA 3QHNA 2WMJA 5E0CA 3VUPA 2FH6A 2VRQA 4D6EA 1ODUA 4PMDA 2ZUTA 4H7VA 1H49A 1KXQA 1C92A 4OOZA 3SUUA 3W53A 4HMEA 4AIEA 1QHPA 1HT6A 1GJUA 3W6MA 1Q4NX 2W4XA 4AEFA 1CEOA 1MQQA 4IPLA 1C90A 4D6IA 4BQ5A 3VIIA 5A8PA 5TD4A 3AICA 4HA3A 4PMQA 4ZXOA 3VIJA 2J79A 1E1EA 3CLWA 2G3MA 2GJXA 2FHFA 2J8GA 4S3JA 3CUGA 4ACZA 3SCVA 1ESWA 4D6FA 4UR9A 2DPEA 1E6RA 4NSBA 3BLKA 1IT0A 4WK9A 1G9HA 3VMNA 3W0KA 1RP8A 2J7DA 3O9NA 1KR0A 5CZKA 2WCAA 4BA0A 1SMAA 4OUEA 2JE8A 4AC1X 2DSZA 2JIEA 3QHMA 2G3IA 3ARSA 3M07A 2V3GA 1H1NA 1YHTA 2XGIA 1E4MM 1M7XA 4E8DA 5D9MA 1OT1A 2VX5A 5I0DA 4CVWA 2QPUA 1LG2A 1UZ1A 3KZSA 3AMKA 4TTUA 2BHYA 1XD0A 3O6AA 2PWFA 5E6ZA 3BAXA 1HKKA 2QV4A 4YHEA 4C7DA 3IK2A 2GK1A 3CO4A 1HP4A 4ZE5A 3WD1A 1J0IA 5EB8A 3SCOA 1W1PA 1KXTA 1MXGA 2FHBA 2WHJA 3RM4A 1JF6A 1R86A 2XWEA 2OYLA 1CXIA 3BAWA 5A3HA 1K9FA 1E4LA 1JAKA 2XVPA 4H41A 2FHCA 3EMZA 3VX0A 1UQZA 4E2OA 1ZBWA 1NP2A 3SCNA 2DT3A 2JIWA 2WVSA 5ABEA 2ZE0A 2BVYA 1TA3A 1ISWA 1KXHA 4BZYA 4EE9A 1Q6DA 2ZUMA 1PZ2A 2YLLA 4HOXA 1GVYA 3AXHA 3VDCA 3WQ6A 3PZ9A 4AW7A 1V08A 1VBUA 4TVDA 3WQ4A 3WMSA 3VD4A 1W2PA 4FLSA 1LL4A 2VZOA 4AZCB 3HJEA 4PBGA 1JZ8A 1UD3A 4ZXLA 1UR4A 2VRJA 1XHGA 1MVYA 1FHDA 2ZUSA 4D6GA 4RE2A 4JFWA 4HP5A 4U3AA 3ARQA 4QFUA 1FFQA 4M81A 1ITCA 5D8WA 4M1RA 3FXYA 4PCSA 1XRVA 2YBUA 2OWXA 3VPLA 1EOMA 2E9LA 2DT1A 4QDMA 4V27A 1QI5A 1UQYA 3PTMA 3WQ5A 1HJSA 1GOWA 3CHFA 5JIWA 2VZSA 2NW0A 1EO7A 1B30A 2GJPA 1GPFA 1GCYA 1V3LA 3VNYA 4CKQA 4URIA 3VMPA 4Z2IA 1E73M 1R8LA 2CBJA 3A4AA 4Z2KA 1BGAA 4KMQA 2UWFA 3CZLA 4R5EA 5M17A 1W3LA 2ZICA 3K8LA 2XUCA 3VM5A 1UYQA 1W1TA 3CZKA 3GXFA 4Y7EA 5I2UA 3ZJ6A 3HMCA 3WY1A 4P7LA 3CPUA 4GI8A 1TMQA 4BQ4A 2WB5A 3WUGA 1RH9A 1R85A 2DQXA 1K9TA 4FLOA 4GQQA 3IJ9A 3B8SA 3WFLA 4RE3A 1NWRA 2A3BA 5KEZA 2X2YA 1C7TA 3ZM8A 2BNJA 3VDHA 3EYPA 3IJ7A 4J3UA 1WDRA 2V5DA 3OLEA 4P7NA 4M29A 1JDAA 5A6BD 3BGAA 4PSPA 4L4PA 3WNPA 5D9PA 3BMVA 2ZUVA 2DGAA 5HOSA 1EQCA 4TVUA 3L4TA 2ZXBA 2ZX7A 1ISZA 1Q6FA 4YN5A 5A1AA 1HXJA 2AAAA 1E43A 3AIVA 3AMGA 3BSGA 1R7AA 1CENA 1E4NA 1MFVA 2WVVB 4TUFA 4UQ9A 4J3TA 5A2BA 3PTKA 1N82A 4W86A 3AHZA 5HPCA 2VR5A 2Y8KA 1QHOA 3KEHA 4P8XA 3PZTA 5E9AA 1Y7VA 4JHOA 2PI6A 4CD6A 4KH2A 4D72A 2ZOXA 5DF0A 4NZCA 5A6SA 1KGWA 2D20A 1H0IA 2GDUA 2WANA 4UOQA 1C91A 1E71M 4UNIA 3W28A 1AVAA 1P6WA 4Z2GA 1J01A 2QHAA 1X1NA 4NF7A 2C0HA 1W3KA 3VO0A 3WD0A 5A2CA 1O6IA 5GNZA 2XM2A 1E5NA 3VGBA 1PEZA 5CJ5A 5A95A 4XV0A 4PTMA 3SCTA 4H8UA 3BC9A 1E3XA 4CGTA 1M53A 2WLZA 3AS2A 2D2OA 4AZCA 1E70M 1E0VA 1VB9A 3WUFA 1E9LA 3TTQA 4UTFA 1ZBCA 2ZXAA 2DT0A 4MB1A 3BAJA 1AQ0A 2PF0A 2UY2A 5GPRA 3TTSA 2WHLA 3K46A 4D6CA 4UQAA 2VRKA 2WM0A 1R7OA 3PZVA 5BRQA 3ECQA 3OB8A 1DWHM 3WF0A 1WZMA 4GO9A 3ZJ7A 3ALGA 2W92A 3CTTA 1J0ZA 1UKSA 2GFTA 3QGVA 4J27A 2BHZA 1B3YA 2G4FA 1OBAA 2WVUA 3WF3A 1BG4A 2BS9A 1TG7A 2CBVA 1UH4A 2WVTA 5CGTA 1X6LA 5EBAA 3OLIA 4U5KA 1CGUA 1ZB5A 1OM0A 5D9NA 3ZJ8A 4F9DA 2XSBA 4P7OA 3FNDA 2YA2A 4X9YA 3SCPA 3LPPA 1JG9A 3WDQA 1OGBA 3DHUA 3A3HA 4P7RA 4EANA 3QHOA 1LL6A 3THCA 3D3AA 5A2AA 4AISA 4MB4A 5IFPA 2Q8XA 2ZWYA 3MKKA 1HNYA 1O7AA 3D5HA 3F5KA 1B31A 1HX0A 1E0XA 2XVGA 4K68A 4OBSA 1HL8A 1E1FA 1MYRA 2JEPA 1DWGM 3CZEA 3T0DA 4CD4A 4RE4A 3CZGA 3MO4A 2OSXA 2QF8A 1JDDA 1UH3A 1XD1A 4H8VA 3WFZA 3J7HA 1WB0A 4W85A 2GJXB 1TFVA 3BAKA 5FIPA 4PMUA 1HL9A 3GXMA 3VM7A 3WD4A 3CBWA 1VJSA 1GUVA 4U3CA 4PTVA 2WVVA 4GIAA 2EO7A 4M80A 4PTWA 1ZJAA 1KWGA 2J78A 4BCEA 4DWSB 1JL8A 1HJQA 1B90A 2UY4A 1HJWA 4AY1A 4J3WA 1XCXA 1EIBA 3OZOA 3T0BA 1CGYA 1DTUA 3EDJA 3ZR5A 1BG9A 4UFIA 3SUSA 4D6HA 1CECA 2ZIDA 3EDFA 2A3EA 1VBRA 1BVNP 3MUY1 4JKMA 4HMCA 3ZT7A 3ZT5A 1CGVA 5CPQA 1AMYA 1D7FA 3MS8A 3W6LA 3ZQ9A 3CHDA 3GBEA 1FH9A 1KXVA 1WAWA 5D8ZA 2GK1B 2XFYA 2PB1A 2XGBA 1US3A 2XVKA 5CSYA 1UR0A 1QNRA 5AYBA 3MUIA 1TCMA 3W24A 3GNPA 1GZJA 1CXHA 4H04A 2J75A 1V0MA 1CDGA 1DWJM 1GNXA 3M46A 4DM2A 2VZUA 5AC5A 1DWAM 1UA7A 4B9YA 1BF2A 2PBOA 4UFHA 2YIHA 4TX6A 2E4TA 4IUGA 1DP0A 4PCTA 2WK2A 1E4IA 1B1YA 1NQ6A 1WP6A 2WZHA 2GVYA 2MANA 2W62A 1KFWA 3A4WA 4PEEA 2AMGA 2VVNA 4QCFA 3U7VA 3FY1A 2V38A 3SIMA 3O2LA 3VGHA 3TOPA 1BTCA 2EBNA 2GUYA 3N18A 1F4HA 3WENA 3AS1A 1NH6A 4Z2LA 4LPCA 1V6VA 4UQCA 1E6QM 3U7BA 1TVPA 1H09A 2O9RA 2EPKX 4AD5A 1G5AA 1OD0A 4H2CA 4XB3A 2WSKA 2X0HA 4J28A 3W27A 1V3HA 8CGTA 4J7RA 3AIRA 4GI9A 1PX4A 3KL5A 1QOXA 4CU6A 3B9AA 1XV8A 4FMVA 3GXDA 4R27A 2G8ZA 2WBGA 2VO5A 3EDDA 4P8VA 1QNSA 4W7VA 5FKYA 1W9BM 4IPNB 1JD7A 1Q6GA 3UCQA 1J0JA 1TUXA 2A3CA 4UFLA 2JFEX 1W3JA 3PBGA 1QI4A 1LG1A 1PAMA 2G3NA 3VIGA 2EPNA 1V0NA 4KRUA 4ZFMA 3L4WA 2X05A 4A4AA 1WE5A 3VIOA 4HTYA 2NT0A 4CCCA 4IM4A 1QBBA 1C8YA 5E70A 2WKLA 2DSWA 3NDYA 4A3HA 1UR9A 4W8LA 4DWSA 1BAGA 3ZR6A 3WQWA 1ZJBA 4JFSA 1CBGA 2VL4A 3UR7A 3RO8A 4FLRA 3ARTA 1G1YA 3WELA 7A3HA 4OKDA 2TAAA 4U2ZA 3L4ZA 1DWIM 4UFJA 1SYTA 3MU7A 4M56A 3A47A 3G6LA 1HIZA 2X1IA 1HF6A 3L4XA 3AI0A 4MB3A 3K4DA 2YA1A 2PWHA 2XVNA 3SCWA 2YLAA 2OWWA 1M03A 3PZUA 1V0KA 4UZSA 3B9EA 1CYGA 3PZOA 4Z2HA 1GONA 2XFRA 4JKKA 2EEXA 4FLQA 1ISXA 2YKKA 2YBTA 3WH9A 2V3FA 2YA0A 1I1WA 3GM8A 4F9JA 4XX6A 1OSEA 1MW2A 3BAYA 4JCLA 2ESCA 1UKQA 1PJ9A 4EAMA 4WKAA 5CLWA 1E0WA 2WZEA 3MUZ1 1DWFM 4F8XA 1QI2A 1GOQA 3UG4A 4PN2A 4WIWA 3IANA 3WUEA 1D3CA 5AYIA 1VEOA 3QOKA 2PWEA 2ZUWA 4JL2A 2GDVA 2YL9A 3I3EA 3GXIA 2VJXA 4JIEA 2VR4A 5KZ6A 2GSJA 4U5IA 4AD1A 3G6MA 2BFGA 2ZX5A 3CUFA 4AMCA 3VVGA 4PMYA 1OT2A 3WNLA 4OJYA 4XUYA 1BYBA 2CBIA 3T09A 1UKOA 6TAAA 4LYRA 4QLJA 5FCZA 2CIPA 1K9EA 4DUWA 3VDBA 1M04A 4WSJA 2HISA 4QCEA 1JNDA 3FN9A 4LQ1A 4PMOA 1CIUA 4MJ4A 1CGWA 3VGDA 1MW0A 1I1XA 1XYFA 1NWSA 4UFKA 2OYKA 1VENA 3VD7A 3ARPA 4BQ3A 2E0PA 3VX1A 3W4RA 3T0AA 5C71A 5I3DA 1AQMA 3W25A 1VFFA 3WF2A 1J0HA 1OIFA 3RPMA 2WCSA 4CN4A 5FOOA 1JFHA 1WDQA 3DECA 1UA3A 5JBFA 5BXSA 5FL0A 1OIMA 1BGGA 3NJ3A 3AISA 1UHVA 2WMGA 3A4XA 4D1IA 1NOUA 1Q6EA 4MAVA 1PZ3A 4WKFA 3GZAA 2OSYA 3OGVA 1XH2A 1WCGA 1BVZA 2J7HA 2D0FA 2G41A 4HMDA 1CGTA 4GINA 2J4GA 5JBDA 1WZKA 1EDTA 2WMFA 3VINA 3M6DA 3CUIA 3IJ8A 5HBFA 1JZ2A 3PZQA 1Q6CA 3CZ8A 4V2XA 1V02E 7CGTA 4TOQA 5BROA 3OA5A 3WH7A 1ZU8A 4W89A 4WSKA 2DSUA 3WH8A 3N13A 4GZEA 2WMKA 4UZUA 5I5RA 4LYQA 1E55A 1WNOA 3WN6A 3VMOA 4AZBA 3FHQA 3RM9A 4W7UA 1IZJA 3VD3A 2VX7A 4D6JA 1W9DM 2D3LA 4PMXA 3BAIA 4GKLA 4AD0A 1FA2A 1LLOA 3AQUA 2OYMA 5CQ1A 4NI3A 4M82A 4CCDA 5DFAA 4MADA 2WXDM 4DUXA 3L4YA 4ATWA 3THDA 2Z1KA 2G3JA 3CUJA 2IUZA 1UD4A 1QHZA 1C7SA 1E5JA 2DT2A 1W9XA 4EKJA 3MANA 1J10A 5C70A 2WSPA 4J3SA 1W32A 5BXTA 3VTRA 5IHSA 2VI0A 5JIPA 1K9DA 5IHRA 4C7GA 1G01A 1CXEA 3W81A 2CKSA 4BS0A 5CSUA 3FAWA 4MNLA 3VIFA 2VZVA 3VDAA 2A3HA 3RMEA 2D3NA 2Y5EA 2FDMA 2J74A 3VKKA 2EPMX 3AYSA 3WEZA 2FH8A 3L4UA 5A6LA 1US2A 4F66A 5A8NA 3DYMA 2OLHA 3HU7A 1OGGA 1XYZA 1HKMA 4L4OA 3F4VA 7TAAA 5DMYA 4MNMA 1QNOA 2YJQA 3DYOA 4UQBA 4RL3A 2CHOA 1UWIA 1UWUA 3IAPA 3WDJA 3ARYA 1KR1A 1GOIA 3SUTA 1JXJA 2PWGA 1E72M 3GNOA 2XTKA 4UOJA 1GOKA 1E6NA 1J0KA 2JALA 1PIFA 1UR8A 1MW1A 4TTGA 3AIEA 5BXRA 4WLCA 1JYWA 3K4AA 3WSUA 4BQ2A 4MNJA 1CZ1A 2JEQA 1GJWA 1NWUA 1UD5A 4KGLA 2CEQA 4LX4A 1EDGA 1MWOA 4JFTA 2PC8A 1NP0A 1UD6A 3BCFA 2D23A 2BY1A 5JBEA 4YPJA 3RJYA 1JI1A 3OGSA 5IXEA 1W2VA 1W1YA 1BPLB 1B9ZA 1V3JA 2DDXA 1W9VA 1XC6A 1J0YA 1KB3A 3W26A 1H41A 3AZSA 5A8MA 1GHSA 1D2KA 2VNCA 4D71A 1GOOA 2EPLX 3WDRA 2JF7A 1KCKA 1TZ7A 4P8WA 1VEMA 1K6AA 1OD8A 1KBKA 4PMVA 3SCUA 2V3DA 2CKRA 2Y24A 4E4PA 3N1AA 3WNNA 1V6XA 3L2LA 1HKJA 4HZ8A 3N9KA 3RDKA 3ZSSA 3ALFA 4HU0A 4Q7NA 3E1F1 1KCLA 3EDEA 1UR2A 1I75A 1BHGA 3W38A 2W63A 4QLLA 1PX3A 3N17A 1KWKA 1JZ5A 4UFMA 2E40A 3WL1A 4LXFA 1UG6A 1MQRA 1JYXA 1VAHA 2D1ZA 2GJRA 5IFTA 3VD5A 1NWTA 2VX6A 4OIFA 2QMJA 3K8MA 5EFDA 1V6YA 4PMZA 1HVXA 1VEPA 3UESA 1ZS2A 3F5LA 1EOKA 2WAGA 2XFFA 4HOZA 2X0YA 3HN3A 3TTOA 1V0LA 3K1DA 4MDOA 1JXKA 3ARZA 1A47A 1QI0A 2O92A 3AHXA 2FGLA 1QI3A 5HDRA 1UOKA 2OWCA 3EMCA 2BXZA 3AZRA 1MFUA 3UERA 4W5ZA 4U31A 3SEPA 1LWHA 3MMUA 2W61A 1BYAA 4AYSA 4CD5A 1DEDA 3N04A 2X8RA 4BF7A 1TVNA 3AYRA 5BRPA 2J7GA 4X0VA 4XZWA 2QMKA 5ECUA 3WUBA 4W93A 1H2JA 1MXDA 1UWTA 1JD9A 1S46A 1ISVA 3CUHA 3PTQA 3PN8A 3AMLA 3DHPA 3WF4A 5A69A 2XJ7A 2DSVA 1JZ3A 2ZWZA 1FHLA 3AMCA 1E40A 3AXXA 3BXWA 4A3YA 2CXGA 2XIIA 5ABFB 4JCMA 1XH1A 5DT5A 4B3KA 4PUEA 1CLXA 1BSIA 4XZBA 5CPSA 3OG2A 3DYPA 1ZL1A 3TTYA 3I3DA 3I3BA 2J77A 2WC3A 3TA9A 5HPOA 3GH7A 1UWQA 2O9OA 1FH8A 1MQPA 3BSHA 3AHYA 2XSAA 3AHTA 3NCOA 4AZ7A 2VC9A 2YDRA 3N12A 3UG5A 1X6NA 4H8HA 3KL3A 1J9YA 1IV8A 1KQZA 3UETA 1FFRA 3GTNA 3SCSA 5FD0A 2YL8A 5FL1A 4D6DA 1G0CA 2VTFA 5A6JA 4WKHA 2XIBA 1HKIA 3POHA 3VILA 5LA1A 3AIBA 1MW3A 2F61A 1UR1A 3PZNA 3QR3A 1QVBA 3WL0A 2VQUA 3WH6A 3CZJA 3NSNA 1GQKA 1HP5A 5CPTA 4P7QA 3WDHA 2Y4SA 4W7WA 4ATDA 1OINA 3CGTA 3ZOAA 3PZGA 4Z2JA 1W9PA 4CU7A 3WD2A 1LF1A 3SURA 3GH4A 2IXVA 3AIQA 1UUQA 1VF8A 2BY0A 1SR0A 4W84A 1CXFA 1GOMA 1E6XM 3GBDA 5BWFA 5EMYA 1GQLA 2DIJA 4ATLA 3KL0A 1WO2A 1OGSA 1VRXA 3EDKA 1IZKA 3U57A 5A8QA 3PHAA 4DWSD 4DM1A 4W5UA 3ZT6A 1GHRA 1XCWA 3OLDA 2VZTA 1W3HA 3TONA 4N0RA 3U5UA 5I6SA 4QP0A 1VFMA 4J3XA 4AZ5A 4UOZA 3OLGA 2RGMA 2AOSA 2W66A 1ZBVA 3WBAA 2VT0A 2E8YA 1HJXA 3AFBA 3WQVA 2ZX9A 1HJVA 3NYDA 1V03A 4HZ7A 5A8OA 3M7SA 2EPOA 2VCAA 4CD7A 2XM1A 3SCQA 1CXLA 1C8XA 3VU2A 3AMDA 3SUWA 4W87A 3EBVA 1C3FA 1AQHA 1F4AA 1EHNA 3A6OA 1RD6A 2O9PA 3KWXA 3T2OA 4MAZA 1B3VA 3GDBA 1SMDA 3L2MA 3OZPA 1EHAA 3WMBA 4AZGA 2D24A 5I23A 4ZE4A 3RILA 3WEOA 1H3GA 5LYRA 5M3WA 2V3EA 5BYWA 2NSXA 3DC0A 1E6PA 3AOFA 4MPKA 5ABFA 2J47A 1UD8A 3N11A 2WZIA 3T08A 2E9MA 2J7EA 1BLIA 3AXIA 3U5YA 2D0GA 2CETA 3BCDA 3VGGA 1EO5A 3CHEA 3LPGA 4DUVA 4UCFA 1V3KA 5I79A 4S3KA 1U30A 1CNVA 1GW1A 1FOBA 5E6YA 2DEPA 2XWDA 2ZUUA 4EK7A 2VCBA 2ZX6A 2D22A 4MJ2A 2UY5A 2J7CA 3FHAA 1E15A 3PZMA 5ABHA 5C8BB 4AD3A 3AIUA 4JHZA 3GH5A 3QOMA 5EFFA 4TX8A 4MNKA 4WJXA 1E3ZA 2Z1SA 2C8NA 2VMFA 2WCGA 1OCQA 2CPUA 4WF7A 2EJ1A 1LWJA 4AZHA 1U33A 2UY3A 1KGUA 5DO8A 1CWYA 3WIJA
chains in the Genus database with same CATH superfamily
3TLQA 4XO6A 3AS3A 3G24A 4GJ1A 3P74A 1TE1A 8A3HA 3MV01 3WJXA 2CBUA 1DIOA 4J35A 1ECQA 3NURA 2RGLA 3BH4A 3F03K 4GK8A 4NXSA 1CLVA 2Y63A 1D7KA 3GR8A 3GG0A 1HVQA 1RXOB 3S6TA 1SZNA 4S39A 2QXWA 1TPVA 3FEQA 3BG5A 1THFD 2GOUA 1RUSA 1J5TA 3LRLA 3EA1A 3DG7A 3CU2A 3PNZA 3WF1A 5FACA 1XINA 3N34A 3AJ7A 3B03A 4E3TA 3PZIA 3SIZA 2SFPA 1SFTA 3NO5A 1XBZA 2WBKA 4OBRA 3DDMA 1RR2A 1H1ZA 3WLOA 3BTNA 1T0OA 2CYGA 4JIIX 4G2DA 1LCOA 3ARVA 4ZENA 5CBBA 1LL7A 1OK6A 3WQDA 3ZMRA 1NM9A 5LA2A 3RYSA 4CN6A 3GSMA 2F2HA 3HO8A 3BOXA 3UPBA 3OZMA 3H7UA 3ARXA 3ONBA 4CQDA 5K9XA 3EKZA 3IIZA 3TH6A 5CC3A 1EB3A 4AIUA 3MW7A 5F2MA 3AU2A 4CN1A 2J25A 4KT2A 5CAKA 3GYCA 3NDOA 1ME9A 3WLIA 4WCJA 1WKYA 5BXPA 2I14A 5CLTA 2E67A 1O5RA 4AIOA 5G4WA 2PGRA 1R3RA 4IISA 2WNQA 4HYVA 4UCGA 2EXOA 2HSAA 3ITTA 3MA8A 1YDYA 3K13A 3L5AA 4GNKB 1F8IA 5CSSA 4EWJA 4GO8A 2XYLA 1QNPA 2R1PA 4XK2A 3F5JA 4HU8A 4LUTA 4QDPA 1FH7A 2E3ZA 3K1GA 2MNRA 3AC0A 4INFA 1UCWA 1JNEA 1Q4WA 2DSKA 1R6WA 1VYRA 4KEMA 3LOTA 3T2PA 4B3LA 5BU9A 2BY2A 1XDJA 3URNA 2ZADA 1WDWA 4LUYA 1L0PA 4KEZA 4UTHA 4F79A 1E1CB 4PRWA 3HBLA 1GQJA 1NF7A 4AWEA 3NM1A 4DJFD 3LMYA 4UTJA 2Z1XA 3H7RA 1XSJA 4C1NB 1Z32X 3R12A 2VOTA 3QH2A 1W31A 3OODA 4NRSA 1RPKA 5MHBA 3N15A 1K03A 3MI6A 4CCZA 5HNNA 3AROA 4GUIA 3BW4A 5DCDA 4AEEA 4AX7A 2NUYA 3V0TA 4EF8A 3ZJKA 4QAWA 1IEVA 2HVMA 3CMJA 4PB4A 4S3AA 1DORA 3G1HA 3FW6A 3BGJA 3LBOA 2IXUA 1JIBA 1FP9A 1VYSX 3CS2A 1B0IA 5D05A 2V63A 4S3DA 7ENLA 3STPA 2HK1A 1EZWA 4GC4A 1UUOA 2O56A 2PGWA 4HNOA 2ONEA 3KOFA 4GC3A 3EA3A 5AHNA 5FJPA 2Z1VA 2JBMA 1O68A 4CU8A 4NHVA 3BLOA 4FAMA 1ECEA 2AL2A 3KZPA 4JICA 3FSUA 3QXBA 3CH9A 5C7VA 2HMCA 4MDPA 4UQDA 1CTNA 5HMDA 2J62A 5BOOA 1Q85A 2ATMA 2B31A 3CIXA 4ADTA 2PBGA 4NZFA 4YMZA 1KC7A 4DF0A 3WX7A 1E6SM 1VRDA 3T7VA 4IMAA 1WXJA 2C1IA 5I07A 4DJDC 1A0CA 1BWLA 3W37A 1YE6A 3S1XA 3UXAA 3AS0A 4HOWA 3G18A 3NIYA 1DTNA 3OVQA 3ZLGA 4YCOA 2D0HA 4ICCX 4XSMA 3KXQA 3NL3A 4CLMA 3BK0A 2WNWA 4AXKA 1PYFA 4O0ZA 4Z17A 4KCUA 3W74A 5A5WA 1XBVA 3KTCA 4XTDA 2WPGA 2VFGA 2PE4A 4AZIA 1NOFA 3T55A 3IPWA 3BE7A 3O07A 2BY3A 2QUTA 1QW9A 5I7GA 4O57A 1V6UA 1EJXC 2CITA 1GVIA 2PAJA 2Z25A 3ZO9A 1QRQA 2QCMA 3HPSA 3NDZA 2CC0A 1O5QA 3WDPP 1HN1A 2BHUA 1EDQA 3BMXA 1E1CA 5DN1A 3WLTA 1UP3A 2YDSA 4ILSA 2YCIX 3MSGA 2V5JA 1OYBA 3NQ8A 4PZVA 1EA9C 1QPRA 3CXOA 4GUHA 3NXFA 4C1NA 3DI0A 3C52A 3KTSA 1TPB1 1U2YA 3V75A 1XP3A 4H9XA 1D3HA 1SJCA 2PDYA 1EX5A 1H5VA 2FDSA 5LXXA 3KCOA 1ITQA 4TVCA 5D38A 3VOGA 1OEPA 2ZA1A 1OB0A 2P50A 3SCRA 3PPCA 3HOJA 1W37A 4AZ6A 2WWDA 3H24A 3OHMB 1A5NC 3VUPA 3O05A 2WZMA 1FUYA 2J66A 4WDWA 1KNWA 2ZUTA 1EBHA 1TTIA 4N6EA 1SR9A 3KBWA 2XZ9A 1EC7A 2XN0A 2WQPA 1QHPA 1SZGA 1HT6A 1GJUA 3MI3A 4IPLA 1OF6A 4Y9NA 5C9UA 2PGFA 3VIIA 3CAVA 1F6PA 1TJ2A 4DELA 1E1EA 3CLWA 1O5KA 2FPVA 3BOLA 3TZNA 3G1VA 3EOEA 1SGJA 4ZOAA 4H7ZA 1OG0A 4D6FA 3TYDA 4ZO7A 3DIPA 4JTAA 1HZYA 1OJXA 2O4MA 1E0UA 5AZ0A 3O9NA 1S2UA 1SMAA 4PL1A 1TX2A 2GOKA 1IQ8A 2JIEA 3QHMA 3LSCA 2G3IA 3LUTA 3Q67A 2Q8ZA 4EPKA 2BWGA 3ARSA 3M07A 3N3TA 2VGBA 3GNNA 3R1ZA 4M7SA 5REQB 1H1NA 2XGIA 8XIAA 3W01A 2PTWA 1OT1A 4HNCA 4ML9A 1DQWA 4E6MA 1AFSA 5I0DA 4JQ2A 2QPUA 4RZBA 1UZ1A 4TTUA 4FO4A 3RF9A 3BLEA 3W70A 3IK2A 2GK1A 1RALA 4N6FA 4C6PA 4XUGA 1TJ1A 1MDRA 3E0WA 1RVKA 2A3LA 4A3RA 4DO5A 2YYTA 3BUVA 3ENLA 1JCMP 2FHBA 4JOMA 1QDSA 1CXIA 2R14A 1XBXA 1E4LA 2VFIA 7PTDA 3NEHA 1ZUAX 3M47A 3OYZA 4UMAA 3PSVA 3VNLA 1UQZA 4E2OA 1NP2A 4MFDA 1K7XA 1ISWA 3EWZA 1PZ2A 2R94A 2BVWA 1PTGA 3C2VA 3WQ6A 3PZ9A 3SFWA 2DVUA 3W83A 4UTWC 1V08A 3IGHX 3VNIA 3M5YA 4LF2A 5KZDA 4S1FA 4C6IA 1O12A 3TQVA 4AZCB 1Y0EA 4XBJA 2QPXA 2VRJA 2VUNA 4RE2A 4JFWA 3CK5A 1FFQA 4M81A 2AGKA 4OV9A 4OFCA 1K8ZA 3FXYA 2Z28A 4FNPA 3S5OA 1X7FA 1QI5A 1UQYA 3PTMA 2CLLA 1GOWA 3W2UA 5JIWA 4CNPA 3VNYA 4RPPA 1OABA 2JQXA 1KM4A 1E73M 1P6BA 1WQ5A 2BOGX 4J40A 2CBJA 3DN5A 2QIWA 5D30A 2G95A 1W3LA 3KTXA 4IFOA 4GIYA 1EP1A 1JUEA 3IJ6A 3WQGA 3EOUA 1UYQA 3QLLA 5FJRA 4LV4A 3VA8A 4DZHA 5CH9A 4NNCA 3D6NA 3DFYA 3FVDA 4G8TA 4P7LA 4GI8A 1KKOA 2XFWA 1RH9A 1FHUA 2QUMA 4FLOA 3CL6A 2D69A 3IJ9A 3WFLA 1NWRA 1C7TA 3ZM8A 1EGMA 4AFYA 3BGAA 1HKVA 1ME8A 4L4PA 2XN2A 4UR8A 5REQA 3THUA 2DGAA 1QPOA 1VFTA 4KWSA 2ACRA 2OLSA 1EQCA 4TVUA 4PUUA 2YB1A 4HIBA 1H62A 4UXDA 2ZXBA 2ZX7A 2PDBA 1DJGA 4NZJA 1Q6FA 3IVTA 5FF7A 3DENA 1LWIA 1R7AA 2OT0A 4GIRA 4O8RA 5A2BA 2PRLA 3EXSA 3A13A 1F61A 3KOYA 3A12A 4M6UA 4Z0JA 1M7PA 3M7WA 4X3ZA 1Y7VA 1JPIA 4JHOA 4ALDA 4D72A 3BL3A 4PULA 3V0SA 5AVNA 3EWDA 2A85A 1C91A 3WO8A 2H8ZA 2YCEA 1W5MA 2QHAA 4XAGA 1F74A 2R91A 1KRBC 1LOSA 3SZ8A 3WD0A 3KM8A 4K7VA 3MWAA 4E38A 2ISVA 4QBXA 4A8RA 4O1FA 5CZSA 3RLHA 1TELA 3BC9A 1E3XA 3AS2A 4KWOA 4AZCA 2WQDA 1E0VA 1VB9A 4IMCA 2DW7A 3G77A 1ZBCA 3E2SA 1Q6OA 3LCLA 2UY2A 4E2DA 3TTSA 4GUJA 3K46A 2VRKA 4GLEA 3PZVA 1R7OA 5BRQA 1DWHM 3PUOA 1AODA 3C2EA 3T78A 2QCCA 3ZJ7A 2QVNA 3CV2A 1XUUA 3CTTA 3LCIA 4O0QA 3SN1A 1CI1A 4F48A 3MHGA 1FXQA 4O28A 2GFTA 4J27A 4DF2A 2WVUA 4RXFA 4ZB0A 3S8HA 1X6LA 5EBAA 1Z9AA 4DNHA 4DJFA 4GRSA 1ZB5A 1OM0A 3HURA 2XSBA 1VH7A 3SCPA 3LPPA 1RA5A 2QJIA 4UUIA 5T26A 4P7RA 3THCA 3RUBL 5CPNA 4KFNA 3OO2A 4MB4A 4RW5A 3S5SA 5D09A 3MKKA 1O7AA 4A05A 1OK4A 3QY8A 5AHIA 1WXYA 4PTDA 3WCZA 3AXMA 2XVGA 3PSWA 1A5OC 5G4HC 1MYRA 5AHLA 3CZEA 3CZGA 3TV8A 2QF8A 3CH0A 4P2VA 2Q3OA 4W85A 3ORWA 1WBHA 3NAVA 1TFVA 3WD4A 3CBWA 1VJSA 5BRBA 1S2VA 4M80A 4PTWA 3L9CA 4P61A 1XLBA 1DJNA 4DWSB 1ZQ5A 3D3FA 5RUBA 4K6AA 3APTA 4Y96A 4J3WA 3VOHA 2E6YA 1L6FA 1SQ7A 4X9SA 3LNPA 4UFIA 1M7JA 5LNRA 2A3EA 2PDFA 3TNOA 3MUY1 3NVTA 4IG2B 2O4QA 1AMYA 3CHDA 1EKOA 3GBEA 2FLIA 2ISFA 1SW7A 5CSYA 4Y2WA 2IQDA 1J5SA 1QNRA 1UZHA 1EJVC 3CIWA 4FR6A 1GZJA 3FFSA 4Q4MA 2INEA 1DWJM 1W1ZA 1GNXA 4LAKA 3P82A 3U2EA 1ZCOA 1G7UA 3Q2DA 3PAOA 4ERAA 2YIHA 2E4TA 1F73A 4PCTA 4DEFA 3BJTA 3RPTA 3LCFA 4WGXA 1RJRA 1KFWA 4GXWA 1FCVA 3VNDA 4LB3A 5LKYA 3W7NA 1NELA 3USZA 5C2XA 2GUYA 1F4HA 3B8TA 4YYCA 1XBYA 1NH6A 2HBXA 2BTMA 4JIHA 3W22A 3GS6A 2PLJA 1S5NA 4O18A 1GYMA 5GJPA 2F9RA 4FXFA 4AD5A 2FPYA 1OD0A 4XB3A 3W2LA 1AG1O 1KTBA 4Q32A 1S3TC 3UJSA 4QJ5B 3ITGA 4J7RA 3H2NA 5CSRA 3WBXA 3AIRA 3N2OA 3ISIX 3R94A 2KX9A 2Z1WA 4UWMA 4KFOA 4DI8A 3EDDA 4P8VA 3OOQA 5FKYA 1UROA 1XKYA 1Q6GA 4US5D 1G7VA 3HF3A 2JFEX 3M0KA 1OFOA 3VIGA 2EPNA 1V0NA 2ACSA 5CPOA 4BEQA 2X05A 3WFAA 3CUXA 1WE5A 3AAMA 3U2CA 3VIOA 1XGEA 4QE4A 3MDWA 5TIMA 1QBBA 2PZ0A 1XKJA 4CNUA 4DWSA 1BAGA 2WPBA 3ZR6A 4L1WA 4XZMX 4K8GA 1JPMA 4WHBA 1C9DA 3ARTA 1G1YA 5AZ1A 2GWNA 4QSFA 3L4ZA 3I7QA 4UFJA 4GFSA 1SYTA 1TV2A 3L4XA 3ATZA 2YA1A 2PWHA 5CGQA 3SCWA 3V36A 4KETA 2HTMA 4IG2A 1CYGA 3KRBA 5LNVA 1SZRA 2XFRA 3UW6A 5B80A 3T1GA 1TX0A 1EEXA 4MYAA 1I1WA 3PANA 1L6YA 4FPSA 1MW2A 3AU6A 4EAMA 2FYMA 1XIIA 3UWWA 1DWFM 4PN2A 5HNRA 2PU0A 1D3CA 2FTYA 2FZMA 3KX6A 3WK3A 1OCNA 2ALDA 3W71A 3N2BA 3V4BA 2DIKA 2GDVA 3IGSA 3SQMA 3M64A 4ZQRA 4ICNA 2GSJA 3IK4A 4U5IA 1LP6A 4AD1A 2BFGA 4GA8A 1OT2A 3TQPA 1F3WA 1U1HA 2REQB 4LNYA 3F2DA 4IP7A 3N2CA 4DUWA 1EC8A 3CMFA 3VDBA 3F2CA 4LCSA 3MO7A 4I7VA 4Z1CA 4QCEA 1JNDA 5AECA 2QAPA 5HMEA 1RPXA 3VUSA 4QR6A 1L6SA 4MJ4A 2YXOA 3VD7A 1EJSC 3ARPA 4BQ3A 2E0PA 1HL2A 3VX1A 3T0AA 1QT1A 3W25A 4R88A 3CWHA 1J0HA 3RPMA 4C6JA 3SADA 1VCGA 1WDQA 3DECA 1UA3A 5BXSA 4BEUA 4L9ZA 3VCRA 1BGGA 1Q6EA 4MAVA 4S3FA 1PZ3A 4WKFA 3OG3A 2ZC8A 3PNUA 1P6CA 3PWGA 3A64A 1D8CA 4HMDA 3H2FA 1CGTA 1DKWA 1BTMA 3LHUA 3P3BA 3VINA 1EDTA 3M6DA 1TVLA 3I7SA 3PZQA 4EXAA 3CZ8A 7CGTA 4TOQA 3CWNA 5BROA 3WH7A 3W7PA 1UMLA 1AK5A 3IV3A 4W89A 3SY1A 3N13A 2ISDA 4LYQA 1E55A 3LHVA 1W8SA 1WNOA 3WN6A 2GSEA 3VMOA 1XYAA 3O1NA 3P67A 3EKGA 4DYEA 4WD0A 2ZZ7A 3SBFA 4DJDD 3VD3A 2VX7A 1W9DM 2D3LA 2NQHA 1TE6A 1R9YA 2CZDA 3BQ6A 3CQKA 5B7ZA 4LFYA 2YFOA 4GKLA 2DU2A 1FX6A 2OYMA 3ITXA 4CCDA 1TV7A 4MIMA 4K1WA 3BPWA 3QV6A 2G3JA 1UD4A 1UBPC 1J2WA 1C7SA 5CC7A 1E5JA 5DELA 1MNZA 1W9XA 4HA0A 3KBVA 1SFLA 2AAMA 3L0NA 4QIUA 1TZ9A 5BXTA 3ZZ1A 3VOJA 1VS1A 3NQ7A 4MNLA 3QC0A 5PTDA 2VFEA 4LSBA 3MCNA 3TC7A 1UBSA 1FRBA 2OTDA 1A3WA 1I45A 3W7EA 1XM3A 4IFKA 1VLIA 2P8BA 4G7EB 3QJAA 1PCKA 3GVWA 4E4UA 1EJUC 5A8NA 2REQA 3USBA 3DYMA 2OLHA 3HU7A 3KLLA 1RCQA 3QVQA 3M0JA 1XYZA 1V6TA 1QNOA 4ZQOA 3O0KA 3Q58A 3UY8A 4R9XA 3FJLA 4Y9PA 4DRSA 2YCLB 1GOKA 5FSDC 4DZIA 4QS6A 2X0SA 4JDYA 3HG4A 4MGGA 5CZ0A 2HE8A 4KWVA 1ADDA 5BXRA 2V2HA 1I2RA 1JYWA 3MQTA 1VIZA 3WSUA 4BQ2A 2TMDA 2JEQA 2JKEA 2CEQA 1EDGA 1MWOA 1UD6A 4I3GA 3RJYA 3TWBA 4H9UA 3EWWA 2BGNE 1PXGA 5IXEA 3LZ3A 4C6KA 3OQ8A 5FEXA 4Q8NA 2DDXA 6REQB 1W9VA 1J0YA 2I9UA 5TF0A 3SGGA 2D2JA 2VNCA 4D71A 3WDRA 2JF7A 3EWBX 4CNOA 4M6VA 3GTHA 4E4PA 1V6XA 2F7FA 3PTDA 3P8IA 5FF4A 3N9KA 5FJOA 3RRAA 4V33A 1QK2A 5DCBA 3T4CA 4HU0A 3E1F1 5D2YA 1UR2A 3IGXA 1BHGA 3W38A 5K9DA 4KIRA 1BKHA 3WL1A 1MZRA 4CQBA 3UD6A 1NWTA 1CX9A 2QMJA 2X7VA 1EJTC 5DY2A 3W1UA 4YVVA 3VC5A 1MUCA 3UWEA 1PTDA 3BANA 3RCMA 2HDJA 1FTXA 3HQNA 1V0LA 1RBAA 3G0UA 1G4PA 4C90A 4WGHA 4KIEA 1QI0A 3AHXA 1ONWA 2TPSA 2FGLA 1QI3A 5HDRA 3EMCA 3RLVA 1MFUA 1PS9A 4W5ZA 1XLIA 1LWHA 3P5ZA 3LQGA 4CD5A 4O1AA 6ALDA 1MZHA 1BXCA 4YWIA 4Y9OA 1O4UA 2J7GA 3ZWTA 1KFJA 4IHCA 1L2UA 7TIMA 4G7EA 4IIDA 1KFCA 1H2JA 1JD9A 1S46A 2Z27A 1ISVA 3RLUA 3VE7A 4F0SA 2Y5JA 3WF4A 4N9CA 1QWGA 4LAMA 2YCLA 4DUOA 4I9AA 2XIIA 1P1XA 5ABFB 1OFDA 4O50A 1EYEA 3QPYA 1PKLA 4B3KA 3XIMA 3CEPA 5G2IA 4PUEA 5LZLA 4GX9A 1E9ZB 3OG2A 5AC8A 3TTYA 3SQSA 3GH7A 1YNYA 1MQPA 5FESA 2VYOA 2UZ9A 1OFAA 2NVAA 4J1OA 3KL3A 1XLMA 3UETA 6REQA 3SM0A 1TPWA 5G5IA 2KAUC 2WKJA 3S9IA 1RBLA 4MWAB 5FJTA 5A6JA 2QUNA 4WKHA 2XIBA 3POHA 3C2YA 4Y9MA 2F61A 3QR3A 2R1KA 1B5TA 1ZTVA 3WL0A 2VQUA 3WH6A 3QY6A 4XD3A 4H1ZA 3NSNA 1GQKA 3RITA 3PVFA 4KCVA 4JQ4A 1POKA 1JULA 2Y85A 4CU7A 3MP4A 3LHZA 5D32A 3V35A 3G22A 2AMXA 4IUOA 2Q71A 3RFAA 1G6CA 1VR6A 3PFMA 2GQ9A 1EP3A 3EZ4A 3ZFHA 1DXEA 4W84A 1CXFA 5BWFA 2VC5A 4NX0A 3KL0A 1WO2A 1OGSA 3EDKA 2GJNA 1FDZA 4X2RA 3PHAA 2GL5A 1GG1A 4W5UA 3ZT6A 1M5WA 3FK4A 3LCHA 3TONA 1VFMA 2R8WA 4A8NA 3OLGA 2NSOA 3W86A 4H9VA 4F0HA 1ZBVA 3WBAA 2VT0A 5C7HA 3TN6A 3TVAA 4RZ5A 3HGJA 1HJXA 4L4LA 2Y88A 3UNDA 1HJVA 3DESA 4HZ7A 4FALA 2Q02A 3RO6A 1C9WA 3MMTA 2Z4GA 4LVDA 3O6YX 3LTSA 1V93A 4UTTA 4W87A 4IIBA 1LLZA 2O9PA 1JCNA 1FWTA 3AJXA 3L2MA 2QDDA 3OZPA 1EHAA 2J9XA 4AZGA 2D24A 1R2RA 1DL3A 4JD4A 4Q4OA 4TMCA 4MZ1A 5BWAA 4NYYA 1QCWA 3CB8A 2NSXA 4GUGA 3DC0A 3BGGA 4GVIA 3S83A 3AOFA 1Z3NA 5C2GA 5ABFA 4GY1A 2WZIA 2E9MA 1BLIA 3W76A 1N2VA 2CETA 3VGGA 4UCFA 5EL1A 2OR2A 4S3KA 1U30A 1GW1A 8RUCA 4TR9A 1ONRA 2PD9A 2OFJA 4PBFA 2R9RA 2D22A 3L21A 3TYUA 4O1CA 3GG8A 1PV8A 2J7CA 3SQLA 2HNHA 1H1YA 4WOQA 5EGRA 4Q8UA 1QPNA 2GDQA 3T8QA 4TX8A 2P3EA 1E3ZA 4S23A 2O55A 2C8NA 4O17A 1ZHAA 3ZS4A 1ML1A 2WCGA 4L6DA 1PUDA 1FWHC 2EJ1A 1LWJA 4AVOA 1U33A 2UY3A 1MXSA 1YX1A 1UOZA 5I03A 4MLJA 4PTNA 3EEGA 2ZRVA 2ZQ0A 4L7ZA 4Q8QA 4C7FA 4LAOA 2E6AA 5E0FA 3ES8A 3QW4B 2HJPA 1W6TA 4LGXA 3MCMA 2CLEA 3II1A 2WNNA 1OCJA 5AHFA 2XG9A 3WNOA 2OZ8A 2UV8G 2Y62A 2W67A 2QJJA 1UWRA 3UR8A 1X6UA 1GTEA 4AD2A 1T41A 1YYAA 3MKVA 4D1JA 4CD8A 1PKMA 1VGAA 5EKYA 5F7UA 3U9IA 2YFNA 1N8WA 3G1SA 4UQEA 2R24A 5T8GA 1RP9A 1NJJA 1DJIA 1EXBA 3DAQA 3I4KA 1Y8BA 3RJXA 1OWQA 1VFHA 4P8UA 2FTPA 1T96A 2QPSA 1GPWA 4IXXA 2NZLA 4BHYA 3H2AA 4GQRA 4WSHA 1B2YA 2FGZA 5DMNA 3VIMA 5KETA 1OHLA 3BCJA 1LM1A 2PTXA 3ARUA 4GZIA 5H1WA 1F3XA 3OGRA 2XN1A 3WBEA 3NQGA 3CNYA 1AQFA 3O6DA 3UWVA 4HPNA 3B9DA 2YDQA 2YOCA 4Z08A 4KWUA 5ABGA 1M7OA 1YKWA 2ZRYA 3RM8A 5SWUA 2QV5A 4NT0A 2C0AA 3GG1A 4D8ZA 3BG9A 5CG7A 4NNAA 4NRRA 4XWUA 3VIHA 4N2YA 4XBKA 4FXRA 4Z1BA 1EX1A 2ZXQA 3HZ3A 2I56A 2Q6ZA 3B0UX 2ADAA 3CHCA 1XIFA 1VP5A 2VEIA 3GHRA 4XIAA 3C2OA 2DUXA 1DHKA 4AEOA 3O6CA 3VGFA 1ITUA 3IAQA 3MDUA 4M7TA 1MI3A 5CXPA 4QAIA 4OOUA 4WVXA 1GQIA 4HSOA 3UZWA 1RY0A 1W91A 1V02A 4AXNA 1H4PA 4PCFA 1VFUA 4R85A 3LPFA 1OX4A 1H0GA 3QW3A 3MUAA 2NLIA 2BVDA 2X7WA 1F6KA 3B0PA 1A5LC 2J7BA 2OO6A 3DHDA 4H19A 5LNUA 1PBGA 2G96A 4U2YA 3WMCA 3EB3A 1I2PA 1V5XA 3ITVA 1FCQA 4W8AA 1M01A 1TCDA 1UD2A 4HZ6A 1R5YA 4OE7A 3WZ0E 3ME3A 4K8EA 4DBDA 1T5AA 3E9AA 3STFA 5B7YA 4B5TA 4LRTA 3VIPA 2NLYA 5CGMA 5M5DA 4YCPA 4DVOA 3NSMA 3DFTA 4DIAA 4QM1A 3N3MA 7XIMA 1W9UA 4GNJA 3I7RA 3GK0A 4YTSA 1PL9A 5I3KA 4G1NA 5D02A 2QULA 1PPIA 4PGLA 4M8UA 4NZ5A 1Q13A 1JRCA 5A6AA 2AQOA 4PUJA 1R47A 3UG3A 4CUCA 4TU1A 3IUHA 4GGHA 3TMLA 1UR3M 4GXPA 3VE9A 3PS7A 3ZIZA 2DVXA 1O5XA 3B97A 1GZGA 3BO9A 1QNQA 4GE8A 4GI6A 1T8QA 3BJFA 5KTLA 3C8FA 1HG3A 1XJBA 5DX7A 3B06A 4A6GA 1X1ZA 1V4YA 1XWYA 2E68A 2X1UA 2NXIA 5H8MA 1E56A 1XLAA 1AZ2A 3QQ0A 4OZOA 1S2WA 1Q8JA 2NV1A 4AB4A 3SAZA 4PUNA 1LBFA 1C8QA 1PIGA 2PEVA 3BLDA 4HPGA 1BEUA 3NPWA 4ACYA 4LYPA 1R38A 1V6WA 1BYCA 4YHGA 4E8GA 1OC7A 4PSRA 2DH2A 2DFAA 1WXZA 2E8ZA 3STEA 2CNCA 4HNNA 2GVGA 4JZ5A 5ABTA 2J6VA 4M6QA 4I6VA 1KCXA 3FYPA 1MUWA 4LOCA 3V16A 4NKCA 1OFPA 1QXLA 1XIMA 3RCNA 4HNVA 3WH5A 4E8CA 2Y8VA 1WKFA 2WKGA 4GPNA 2NUXA 3BLPX 2XIQA 2BX7A 4J2PA 4HHPA 1XSKA 5IBXA 1GKQA 1A5MC 1S39A 1NDWA 3CEUA 2WHMA 2OU4A 4JEJA 4NUWA 1J12A 3K30A 2DH3A 4H6EA 4R3UA 1WA3A 4K36A 1VHCA 5IM51 3RIKA 2DZBA 4HJWA 2Y61A 1CPUA 2XHYA 1Z8AA 2PDKA 4H7CA 5AB3A 2GUBA 3FKRA 3NR0A 3LXBA 4B5WA 2CZEA 1NARA 5D33A 1VQTA 2FPTA 3CMGA 4FEZA 1JYNA 4XZLX 4PMRA 4DZAA 1KFBA 1FKXA 3MSYA 5M03A 3S6DA 1JYVA 4LYKA 3K2GA 3REQB 2FZDA 2YZ5A 3ES7A 3C56A 1JFXA 5G2WA 4O1BA 3KBJA 4MB5A 1I2QA 4CCEA 1H63A 1QBAA 1NVMA 1V3IA 3S1GA 5G2HA 2VDGA 2FH6A 2VRQA 1ODUA 4H7VA 1H49A 4U4MA 1KXQA 4K1GA 4UMBA 1C92A 3W53A 4HMEA 3KHJA 4AIEA 5MKGB 4A21A 4L4MA 1AD4A 3LHTA 4G7FA 1Q4NX 2W4XA 4XKMA 2F38A 3EX3A 1C90A 4BQ5A 4DJFC 1RLDA 3T07A 1Q2SA 3AICA 3CAKA 4HA3A 4LEQA 3EWUA 3W1NA 3N2MA 1OFRA 3QTGA 1Y5VA 3QC3A 4IMDA 4BR1A 4IFRA 3CUGA 1KA9F 3PC0A 3U48A 3TK7A 2P0IA 3I68A 4UR9A 1Q63A 4FI4A 1E6RA 4NSBA 3E0FA 3MUXA 1UIPA 3H4GA 2DQWA 1IT0A 4WK9A 3GFZA 2HVNA 1IXPA 1RP8A 4UNLA 4GVGA 5CZKA 2WCAA 4FNQA 3TAKA 2VWTA 3KP1A 2JE8A 3NVDA 4AC1X 3R58A 2NWSA 3CT7A 1E51A 1IF2A 1BXBA 1J6PA 2V3GA 2B7QA 3R43A 2CZFA 4KEUA 3W1MA 2FKPA 4L9XA 2BOEX 3P8JA 2C79A 5F1UA 2BLEA 3HG2A 3O6AA 3QZAA 1B4EA 1LBMA 1HKKA 3PB0A 2QV4A 4YHEA 3V0UA 4C7DA 1RJQA 3UA4A 5C9XA 1J0IA 5EB8A 3LX9A 4GFIA 3RM4A 2WHJA 3V5CA 2YCKX 5CZTA 3BAWA 5A3HA 5L9FA 1JAKA 4Q4RA 2XVPA 3BDKA 3SRHA 4H41A 2FHCA 1PIIA 3E12A 4XAPA 4EPBC 1L6WA 3EMZA 1IHIA 3VX0A 1Q3NA 3SCNA 3IARA 4Y6GA 5F2LA 5ABEA 3NNTA 3RG6A 2CLHA 1KM6A 3DFPA 4EE9A 4H8NA 2ZUMA 1GVYA 1H7RA 4AW7A 2QNEA 1XXXA 3WQ4A 3O7UA 3VD4A 1A5KC 4FLSA 3O8AA 2NX9A 1UPMB 3LLFA 2H6RA 4ZXLA 3AWNA 3GIYA 2OMAA 1XHGA 1BSLA 1F3TA 4HP5A 3N4AA 4U3AA 4QFUA 3MP3A 5D8WA 4RNFA 3VFLA 4BKNA 3S1WA 2PDMA 3WG6A 2YBUA 4U10A 3QN3A 4LWWA 1EOMA 2E9LA 4QDMA 5T91A 1YIXA 1DYSA 3PFRA 3W1LA 2NW0A 1EO7A 1B30A 3VDGA 2FVKA 1GCYA 1V3LA 5U4NA 4ZQNA 3W84A 2X41A 3VI2A 4Z2IA 4IIEA 3IUIA 5HANA 3A4AA 3LI0A 4IPJA 3LSBA 2FZBA 3DG6A 2XUCA 1DXIA 4GUFA 1EP2A 2ICSA 3CZKA 2F84A 1XIDA 2YX0A 3E0VA 3HMCA 3CPUA 1TMQA 2I5GA 2GZXA 2OVLA 1VZWA 1QUMA 4LT9A 3MUCA 3UU0A 2OQLA 4RE3A 2A3BA 2X2YA 3KRZA 1TPH1 2BNJA 3EYPA 3IJ7A 4O53A 4HCDA 4P7NA 2PA6A 3K5XA 2OKTA 1R3WA 1L6GA 4PSPA 3QR1A 1X8FA 3PBUA 2O7QA 5I00A 1TMLA 4DQWA 1LRTA 1B57A 3SJ3A 4LS2A 4G9PA 3W00A 3SY5A 3NQ6A 3TLLA 5C2CA 3WLRA 1YADA 5A1AA 4DZ5A 4QTGA 1IGSA 3SN0A 3KS6A 3AIVA 3BSGA 1T8XA 1CENA 1E4NA 4TUFA 2DZSA 1U1UA 3PTKA 4XKYB 1N82A 4NG3A 1ZENA 1I4NA 2PZNA 2ZRXA 4XQ6A 4C65A 3OVRA 3PPFA 4MKNA 2VR5A 3GKFA 1QHOA 3L0KA 1SO4A 3KEHA 3PZTA 5E9AA 3IIXA 3SSJA 4CD6A 1QOPA 3CPRA 5DF0A 4NZCA 5A6SA 2GDUA 2YXGA 4UOQA 4NAFB 3OVGA 4LUSB 2ZYFA 1AVAA 4W9TA 1US0A 3G1AA 1P0NA 2EAWA 3UFYA 3WYZA 1W3KA 3B8IA 5A2CA 1O6IA 1KBIA 5GNZA 3HIJA 1E5NA 2Z2UA 5HNTA 5A95A 3W1TA 4I9MA 2QGHA 3WUFA 3TTQA 2ZXAA 3N4FA 4PFMA 5G1YA 1AQ0A 1CB7B 2WHLA 3W72A 4JNZA 4CQAA 3HG3A 2WM0A 4AVNA 2G0WA 5K3VA 3WF0A 3W7RA 1WZMA 1RK6A 1XYMA 4PCNA 3ALGA 4F0LA 2B7OA 3QRHA 1S2CA 2ANUA 3TA6A 4NU7A 1XLFA 3QMRA 3KRUA 4PC8A 1H51A 1W1B1 1J0ZA 3O16A 3QYQA 1EUNA 1UKSA 2J6XA 5I3IA 2G4FA 3WF3A 3WQCA 1TG7A 2CBVA 4QNEA 1UH4A 2WVTA 1R3QA 5CGTA 1M41A 3GFYA 4MHBA 1TKKA 4GQBA 3OLIA 2W3ZA 3UPWA 5D9NA 3ZR4A 1IEXA 3C61A 1HTIA 5EMMA 2OXNA 1JG9A 3A22A 4WUIA 3S0CA 4EANA 4QX4A 3DFSA 4JTGA 3D3AA 5HA7A 4GCXA 3NPXA 5IFPA 2Q8XA 3TMQA 3F5KA 4L1XA 2O0TA 2PU1A 4C6OA 1QK0A 3G1RA 3KBNA 2OT1A 3KCJA 3R79A 5FJIA 4WX2A 3M44A 3GDKA 1E1FA 2R1LA 2JEPA 1DWGM 3APYA 2OSXA 1JDDA 1UH3A 4HU3A 1REQB 5C6MA 2GJXB 3BAKA 3LBCA 5D37A 5G1TA 2IPWA 2A6LA 1QR7A 4Y9AA 3MWCA 4XKYA 4BCEA 1JL8A 3GHSA 1P48A 4IOTA 3EWXA 1KCZA 1LORA 2UY4A 1HJWA 4JTQA 4H6QA 1EIBA 4M19A 3RGTA 4AC7C 1DTUA 4KFPA 3SW6A 3DGBA 3V5OA 4NAFA 3EDFA 4LUSA 4MKVA 5LGZA 1VBRA 4ZOCA 2PLCA 4NZ1A 1CGVA 3MS8A 2PWVA 1XPYA 4YTQA 1FH9A 5FEWA 2Z6IA 1BD0A 2ISSA 2XGBA 4FX8A 3UWZA 1W5OA 2Z1BA 1XIEA 5DRCA 1TCMA 3W24A 3LRKA 3FSTA 3M0YA 2BGQA 4H04A 4H3DA 4RLIA 2J75A 1V0MA 3SDOA 3GAYA 3EX1A 1MEHA 3HM7A 5I3JA 1PWMA 3TYAA 1LT7A 4NNBA 5FSEC 1UA7A 4TX6A 3LG3A 3KW3A 4IUGA 4Q7BA 7ODCA 1MRAA 1DP0A 2C14A 1B1YA 2GVYA 4J3ZA 4QNWA 3N4EA 9RUBA 3U7VA 1UC5A 4O1EA 2V38A 1RVGA 3R25A 3VGHA 4EXQA 3PJWA 1U5VA 4B4HA 3WENA 3AS1A 5HK4A 4Z2LA 4LPCA 3EB4A 1R3VA 4GMEA 2FQIA 4UQCA 2HV5A 2EPKX 2PDCA 3H6OA 4YS1A 1JCJA 4H2CA 1S3HA 2P88A 3VCCA 2O7SA 3MTWA 4J28A 3ITYA 4FNSA 1V3HA 4CNNA 8CGTA 3T4WA 3I6RA 2IMRA 4DB7A 1PX4A 2OEMA 6ENLA 1QOXA 5XIMA 3ZLHA 4CU6A 3KVKA 3B9AA 4R27A 2WBGA 2VO5A 3MI2A 4A2RA 1AZ1A 4IPNB 3BOFA 3R10A 1XDMA 1J0JA 2A3CA 3WLLA 1W3JA 4PMJA 1OFBA 1LG1A 1PAMA 2G3NA 4H6KA 4GH3A 1REQA 1G4EA 2ZZ6A 1K4GA 5CC5A 2VGGA 4I9TA 3R11A 1PVNA 5GJMA 4HTYA 4IM4A 3RLGA 2VEGA 3MZNA 3NZRA 5E70A 2I57A 4H6RA 3B8UA 3DBPA 1R3SA 2NQ9A 1YDVA 4MUPA 1SO6A 3GC4A 1JVNA 3MYPA 1ZJBA 1CBGA 5LIWX 2E09A 5K4XA 4B92A 3P0WA 3VAVA 2PSNA 3WELA 7A3HA 4G5DA 3B0XA 6XIAA 4U2ZA 2TAAA 2QDEA 5KMYA 3LNMA 2G3FA 1UUMA 3S4TA 4M56A 1EGVA 3E38A 3E3HA 2IKJA 3CASA 4DBWA 4WZHA 3W2NA 4NL1A 3AI0A 4I7WA 3DEQA 2OWWA 1H7OA 1MMFA 1V0KA 4UZSA 1XLHA 3PZOA 3NQAA 1W17A 3ABSA 2JK2A 3ZVHB 4FLQA 1ISXA 2V3FA 2YA0A 4JR5A 2F6UA 4RDWA 3NZQA 2XGZA 4EX4A 3NEVA 4YTTA 3VNJA 4UTLA 4A35A 4WKAA 3M0ZA 1E0WA 3R8RA 4XZ9A 4F8XA 3UG4A 3WUEA 3W7OA 2X40A 3N6HA 1VEOA 4ROQA 2R1NA 4JL2A 4Q6XA 1LQ2A 2YL9A 3M4HA 3UYIA 2ZVRA 4LCRA 2VJXA 2VR4A 5KZ6A 4K3ZA 2ZRWA 3CUFA 4QISA 4PMYA 4JDBA 4OJYA 1F3EA 5HWJA 4XUYA 1BYBA 1P0KA 1OQFA 2CIPA 1K9EA 2HISA 5HMSA 3EOLA 3FN9A 1CIUA 2V69A 1MW0A 1NWSA 2H9AB 1VENA 1ZP4A 3UXLA 3W4RA 2HQAA 5C71A 5I3DA 2BGSA 2A2IA 1VFFA 1OIFA 4AIBA 4CN4A 3NWRA 2J24A 3UP8A 4OGZA 1FWCC 5JBFA 3IVSA 4IX2A 1OIMA 3NJ3A 4HT3A 4D1IA 3A4XA 1NOUA 3JRKA 2E5DA 3U2OA 2P76A 3LTYA 3QZEA 4A3QA 5CC6A 1WCGA 1BVZA 2H3BA 1P0DA 1YBQB 4PR4A 2J4GA 4Q4SA 4UR7A 1WZKA 2V2DA 2WMFA 1K70A 4B5NA 1AA1B 3CUIA 4FOJA 5HBFA 3TN4A 1UIOA 4HPXA 1V02E 2Z0IA 3KVLA 3R89A 3OA5A 3MY9A 3EEZA 1ZU8A 3NL6A 4WSKA 3WH8A 4R7WA 2IPJA 2WMKA 2I7GA 2F6KA 2FZNA 4L9YA 3GY1A 3LU2A 3FHQA 3RM9A 1W1IE 4HD5A 1WOAA 3BAIA 2FJKA 2GPTA 5EA9A 1GYNA 3P7YA 3M9YA 4AD0A 1TUFA 4ROPA 4REQA 3UZJA 3ZVHA 4CNTA 3DFQA 2QGYA 4DUXA 3C6CA 3CHVA 3N9SA 4EKJA 3MANA 1SSGA 5C70A 5HWMA 4K8HA 1W32A 4LVAA 3VTRA 3NGJA 1A50A 5IDZA 5C9WA 2YZRA 4O15A 4BS0A 1H50A 5CSUA 3FAWA 3GDLA 3VIFA 2VZVA 1IGWA 2A3HA 2D3NA 3PBMA 2FDMA 4LCQA 4DN1A 4ZQMA 3G0SA 4RDZA 3AYSA 3WEZA 1XLEA 3G1DA 1US2A 4OU1A 4F66A 3W1RA 1N8IA 4MLRA 3LQLA 2B7NA 3XINA 7TAAA 2VP8A 3PBWA 4MG4A 4RL3A 2CHOA 3R0DA 1UWIA 1UWUA 2PGEA 3GUWA 4XZNX 1TRDA 3ERPA 4BFAA 4C1LA 3GNOA 4UOJA 2XTKA 3U8GA 1E6NA 1QNVA 2E1DA 2H9AA 2JALA 1PIFA 1UR8A 3FYOA 2OCZA 2HNEA 4JYFA 3AIEA 3NO3A 3CWOX 1K6WA 1WAUA 4MNJA 1J4EA 4NX5A 3L5LA 1CZ1A 3H4XA 3A9BA 3T05A 4LX4A 4HCLA 3BCFA 4E5TA 5JBEA 1S5MA 4YPJA 1BWKA 4QRNA 3OGSA 2OPJA 4LRSA 1Q45A 3NQDA 1PDZA 3SSZA 2QKFA 1H41A 3JVAA 2YYUA 1GWJA 1YBQA 1QAPA 3GXTA 4XD6A 1GOOA 3GVVA 5AHEA 3VNKA 1OD8A 2V3DA 2DZTA 3KDOA 4RNHA 1GVQA 3L2LA 1HKJA 3MKCA 3WBYA 4HZ8A 1RZMA 2PDJA 2INFA 2IKGA 4ZTXA 1X96A 2QJMA 1KCLA 3GC2A 4IGMA 3UA3A 2W63A 1KWKA 1JZ5A 3EXTA 2E40A 3IRSA 4MSSA 4F2BA 1MQRA 3CAWA 4L56A 2D1ZA 5IFTA 2PWUA 3QKZA 4IJCA 3B3DA 4YU1A 3K8MA 1ELSA 4JTLA 5EFDA 1V6YA 3LDVA 4PMZA 5AC7A 1HVXA 3LYEA 3GE7A 3UESA 2OELA 1ZS2A 3RR4A 5FEZA 2X0YA 3RPDA 3OZYA 1QW7A 1WKDA 3HN3A 3TTOA 1B9BA 1CW2A 1A5AA 1A49A 3K1DA 3M5XA 2EF9A 1TV8A 2OX4A 4N4QA 4EXBA 1UOKA 2OWCA 4CQ9A 2BXZA 3SO7A 4U31A 4PODA 4BY3A 2W61A 1YPFA 4AYSA 1O94A 3C3NA 1EPVA 1SJDA 3KS5A 4A8IA 3W2MA 4FA3A 4YTRA 3NQBA 6TIMA 3EPMA 4TO8A 1NF0A 5ECUA 2BASA 3WUBA 1R9XA 2VD9A 3MHFA 1TIWA 1MXDA 2QDHA 4AMAA 3CUHA 3PTQA 5AYZA 2XJ7A 2DSVA 4DWDA 3S2MA 2ZWZA 1FHLA 3IJIA 4MY9A 4XAZA 4PB3A 1QWKA 4NJIA 2QCFA 3F4WA 3H21A 1UWAA 3G3DA 4MZYA 3L23A 1EZ2A 5ECVA 5T9BG 4RX0A 3E02A 4FOUA 4HNLA 1IEQA 3CYJA 4ASTA 3DYPA 1ZL1A 3I3DA 2WC3A 1NEYA 1UW9A 5C9ZA 3NG3A 3PWAA 3HQOA 1FH8A 4PRRA 1OZMA 2FVMA 3LRMA 3THQA 1XIJA 2RJHA 4Q4KA 3UG5A 3GVGA 1J9YA 3GTNA 3F4CA 4XO7A 1Z6KA 4J5NA 5D2WA 2VTFA 4HPJA 2PDWA 4C6NA 4JY8A 1KV5A 4ONVA 3TDFA 1ZRQA 3CZJA 4XAYA 3URAA 2A4AA 3WDHA 3ZYZA 3CGTA 2X1RA 1R0MA 2PCEA 3PZGA 4Z2JA 4IGNA 2XINA 3WD2A 1XRFA 4WY0F 3GH4A 1EF2A 2IXVA 3N29A 5JMUA 3UXKA 1SR0A 3WJYA 4GGBA 1E6XM 4O4VA 3GBDA 5EMYA 1GQLA 3Q4DA 4DWSD 4DM1A 4IZGA 3OLDA 4LVFA 4PCPA 2ON3A 1Q6RA 4ORMA 4QP0A 4AZ5A 4JIPA 4UOZA 3CL7A 3N14A 5A6TC 3DUGA 2V9DA 3AFBA 1XFCA 2VFHA 2NUWA 2CZVA 5EBUA 4LUIA 3CL8A 3M7SA 1XQKA 3YPIA 1K7FA 1ONEA 1C8XA 2VR2A 1TTJA 3EBVA 3VK5A 1F4AA 3H12A 1RD6A 3KWXA 2HBVA 4MAZA 4H4IA 1SO3A 3GDBA 2A21A 1SMDA 3WMBA 5I23A 3LK6A 1DJQA 5AKQA 4ZE4A 3LV6A 1AJ0A 1QO2A 5LYRA 1DJHA 5M3WA 1W54A 4F4RA 3W2JA 3N11A 1KLZA 3T08A 1BVWA 5EMJA 1W5NA 2D0GA 2Z24A 1H61A 3BCDA 4O4WA 1MO0A 1EO5A 3CHEA 2WJEA 3LPGA 3TX9A 4XIMA 3HV8A 1PO9A 3CV1A 3NYZA 2OOFA 2RDTA 2QVHA 4ZODA 5BOEA 2DEPA 4KEVA 2DZWA 4CQ8A 2VCBA 2ZX6A 3ANYA 1NSJA 1UJQA 2FGBA 4HNUA 3FHAA 4R9OA 2HXTA 4AWTA 3VZZA 2I5IA 4C60A 4ECLA 4MVAA 4AYGA 5F4WA 2ZKMX 3AIUA 2AKZA 1KRCC 4DLMA 3W7DA 2I9EA 2X30A 1JQVA 1PWLA 1DJXA 3NOYA 5EFFA 1Z41A 2QW5A 4MNKA 4YNGA 5IBXC 5LIYX 1UC4A 4F0MA 8XIMA 1ZJHA 1OCQA 4EVZA 1PE1A 2ACUA 3WIJA 4LC8A 2DZAA 4WOZA 4HMNA 1L8NA 2QCDB 1XLGA 3PP7A 5BMWA 2ODOA 4PMNA 4ICMA 2PP0A 4JFUA 4HA1A 2DVTA 3HPAA 4QJ1A 3L0GA 4PTXA 4DXKA 2OJPA 1TTQA 3NL2A 3JUGA 4MOZA 5D4YA 3QQ1A 3OBAA 3APGA 3R2GA 2A6NA 2ZZ2A 1KKRA 2VWSA 3VKAA 5DRIA 2WLYA 1PHWA 4RJEA 1HJUA 4GKTA 1GVEA 1GVSA 1KM1A 4PH6A 3UBPC 1FWNA 1PX8A 1BQCA 4NAEB 1HO1A 4W8BA 4W88A 1IEIA 2ZXDA 3QLDA 3S2JA 4JN8A 4DBSA 1WDSA 3OIHA 3EOSA 2JF6A 1JAEA 5I24A 2WMHA 3VGEA 3ABRA 2RJGA 1XS2A 2DZUA 1SPQA 3IS4A 1S2TA 3IJQA 2XH4A 5TBOA 3ZSTA 5A6BA 3MJYA 4IJRA 1FWSA 3VNZA 2V67A 2VCCA 3WD3A 5BCAA 4QDWA 3FDKA 2VVSA 3LENA 3ARWA 3TAOA 2V6AA 4UIOA 1UH2A 4ZA0A 5AYXA 4PBEA 3S5YA 3WQ8A 1TB3A 4ZO6A 2NT1A 1BFNA 3TC6A 2Y7EA 1LJYA 4NILA 5LA0A 4BJHA 3JW7A 1LQ0A 3P0XA 4WDXA 3V1PA 1WKEA 1UMYA 3H53A 3GIPA 4FK9A 4UTKA 2BP1A 2AQWA 3U0HA 3DC8A 3SY8A 1WZLA 2BVTA 4Q22A 5E0KA 1GVFA 1P43A 1ADSA 4HGXA 1W8GA 1CGXA 2V5CA 4HHMA 4O19A 3M0IA 4YVXA 3WNKA 2VC6A 3DU0A 2W91A 4GJIA 4IX0A 1UZ4A 2WMIB 2Y2WA 4CVUA 3KDNA 3P93A 3G1XA 1NU5A 4IGHA 3W7KA 3BWWA 1UKPA 3H2EA 3T42A 2E5BA 4G56A 9CGTA 1JEZA 2O9TA 1XYLA 3LLDA 3KE0A 3S47A 1Y65A 5GQBA 3OVPA 1UWSA 2YL5A 4NJKA 2OO0A 3CIVA 3V7PA 3CT2A 2WOQA 4ZEPA 4L5ZA 3LM7A 2QCDA 5GVJA 2XH0A 1NFPA 3BLLA 1W5QA 4JTTA 2FZ8A 2WYSA 3VOFA 4MM1A 4QQUA 2H3DA 4EAYA 2PURA 1SFSA 1XH0A 2E9BA 5JQ9A 1MEIA 4JKLA 1B54A 4LAZA 1NOWA 2AL1A 3S2CA 3WEMA 5L6UA 4V28A 3TCSA 2VKZG 4BK9A 1ODZA 2PLKA 1XL9A 3EX6A 1AL7A 3WLKX 1KBBA 3H55A 3T40A 4B90A 1VC4A 1WPCA 4QG9A 1AH3A 3KOWA 5JH1A 1Y5XA 2BXYA 4JFVA 2J8FA 4IIGA 3UEQA 1FXPA 2YW4A 1JUBA 5CG0A 4JN7A 4KCWA 1ZCCA 2WC7A 3U4FA 5BOFA 1K77A 3G5EA 1ZZMA 3EKLA 1W1VA 4NXKA 1JI2A 1JZ7A 5CJNA 3MSDA 2CERA 2QLYA 5A6KA 1JZ6A 3RMJA 2PWDA 5F4XA 1DBTA 4M3PA 2CESA 4LC6A 4NJGA 1EQPA 1VJZA 4ACZB 3TFXA 2P5NA 3FGCB 2X1TA 2HROA 2MUCA 5EY5A 3W1XA 5AOUA 3MBDA 4GQ0A 4GBDA 3A4JA 2ZX8A 1W5PA 5JH2A 4IMEA 2VELA 2E25A 4U33A 1Q6QA 1TR1A 3MMWA 4IQDA 5KINA 1VJIA 3S42A 3NQCA 3LI1A 5HQMA 3GVRA 4LY8A 3RX2A 4RZ6A 5AN7A 2WMIA 3COTA 3OHIA 1SUXA 3AZTA 9XIMA 1PHQA 4DNMA 3PAJA 5I78A 4N9EA 1EH9A 5HMFA 3P61A 4XD4A 1GORA 4NASA 4ZB2A 2OSWA 4DF1A 5A94A 2J9ZA 1JDCA 1YW1A 6PTDA 2BSLA 4PE8A 4GJJA 3PJTA 4B16A 5LGXA 3BMWA 2YSWA 1RQBA 3BV4A 3POCA 1R3YA 1E6ZA 2CW6A 3OP2A 3HPXA 4AD4A 3KAOA 3K8KA 4TIMA 1ZBKA 2ZZ5A 1YXDA 3EX2A 3W7HA 3HGOA 2ALRA 1ZNNA 3L68A 2OGYA 1GYLA 4ZO9A 4IIFA 2B4GA 3EMQA 4TXEA 2GQ3A 4LVBA 1QPKA 1NDYA 1KQYA 1WV2A 3L67A 1JDEA 3MMDA 2OG9A 4JYDA 1BYDA 2OX1A 3SN4A 3W9ZA 1UPPA 2ZUNA 1EGZA 3PG9A 3GNRA 3P6LA 3S5NA 2WW5A 2XIMA 1J18A 5E93A 1QMLA 3QHNA 2WMJA 1AH0A 2HWGA 1YPXA 4AF0B 4QG8A 4D6EA 3LCWA 1KD0A 3F4DA 4OOZA 3IACA 3IVUA 1YLVA 4B2DA 3EAUA 2C6QA 3GIQA 5LNSA 4AEFA 1CEOA 2Z2AA 1MQQA 2E28A 1Q6LA 3C0QA 5A8PA 4WJEA 4JTDA 5TD4A 1AH4A 2ZZ1A 4X60A 3W88A 1EFZA 1XUZA 3GZ3A 1A80A 3C4UA 3VIJA 3VZXA 4NY2A 2JGYA 1RQEA 3M0XA 3DH7A 3B0VC 4S3JA 1TJPA 4ACZA 1ESWA 2PF8A 3KLKA 5K9CA 3BLKA 4LS0A 3FGCA 3W0KA 4HSHA 3GUGA 4AY8A 3E6EA 4DX3A 1NAL1 4IH3A 3W7JA 3RXZA 3KP0A 1VPQA 3OIXA 5GJNA 3PY2A 1RSCA 1YHTA 3V18A 3QEZA 4IQLA 2VX5A 4FIRA 4JTRA 4P5UA 4CVWA 3AUOA 4I5XA 1LG2A 3KZSA 3AMKA 1XD0A 4GHRA 1FWRA 3GRIA 1ZAHA 5E6ZA 3BAXA 4I8DA 4KF1A 3RN6A 5EMUA 2E77A 1OYCA 4XBSA 3WD1A 3LXAA 3SCOA 2QCNA 1AMKA 4BI7A 1W1PA 1MXGA 1U5HA 4RV8A 1R86A 2XWEA 1OC5A 3A3WA 5F2IA 2EG8A 4X61A 1K9FA 4Z1YA 1XDLA 3ZVIA 2V0TA 2ZC1A 1ME7A 2QUVA 3LGDA 2BVYA 4BZYA 4ERGA 3A5FA 3GHUA 3CQHA 3S46A 1Q6DA 2YLLA 2JGQA 4MWAD 3VDCA 4DXXA 4WQ6A 1PCWA 5J5RA 4J2MA 3QPZA 4AUBA 1VBUA 2WSRA 4TVDA 3WMSA 2DW6A 4B3ZA 2Y5SA 1Y5WA 5FAGA 3UY7A 4LUTB 5HQLA 1KM5A 1JZ8A 3KBSA 4JX4A 4HZMA 2ZUSA 1MVYA 1FHDA 1J96A 5CZJA 4NZ3A 3ARQA 4Q3MA 4M1RA 4C6EA 4PCSA 2PC4A 4IQEA 3P5YA 2OWXA 4LANA 4AF0A 5MF5A 2YW3A 2DT1A 4V27A 3NFUA 4IF2A 1HJSA 1YTKA 1XLCA 2GJPA 1YNPA 4CKQA 4ZOBA 1DJYA 1OZQA 4Z2KA 2OLAA 1BGAA 3CZLA 3GDRA 3GW3A 2ZICA 2GVLA 3K8LA 5HUPA 3VM5A 3QZ6A 4H9MA 1GKPA 1W1TA 3GXFA 4HBKA 4TV6A 3TSDA 3R8HA 5I2UA 3BZGA 1GQNA 2TRSA 3B04A 3QQWA 3WY1A 4BQ4A 3OW1A 4DPPA 2WB5A 3WUGA 1I60A 3QR0A 3A5VA 1R85A 1K9TA 4GQQA 3DCPA 4GD0A 1JCYA 4R7JA 3VDHA 1S1PA 1WDRA 2V5DA 3LB0A 1TWZA 3OLEA 4M29A 4JPGA 2POTA 3S3GA 2QJNA 2W79A 2C3ZA 3BW3A 5D9PA 3WNPA 1X38A 1E9YB 3BMVA 4MYXA 2ZUVA 2OZ3A 3GXPA 1BWVA 2XIJA 5HOSA 4KERA 2VM8A 3KBMA 2AL2B 2WO5A 3PK7A 2AAAA 4QROA 3VC6A 3AMGA 2PP3A 2WVVB 4UQ9A 1YE4A 2IPGA 1F05A 3I10A 5DQPA 2CLMA 1V79A 3ANUA 1ZPTA 3MSRA 3TJIA 4W86A 5LIUX 2V5BA 3OJGA 5HPCA 2Y8KA 2E1WA 3UCCA 4Y90A 4JTKA 1KBLA 3O3RA 8TIMA 4KH2A 3TNBA 2ZOXA 4HVXA 1KGWA 4DO6A 1H0IA 1ADOA 2W27A 3W28A 4FX6M 1FVPA 2BG5A 1P6WA 4Z2GA 1J01A 1LROA 1MDLA 2PD5A 4NF7A 4OT7A 1LOQA 1HKWA 5EYWA 2FFCA 2ZA2A 5D2TA 3A3XA 4ZR8A 2XM2A 2PDXA 5CJ5A 2WV8A 5H6HA 3G1FA 3ITLA 4XV0A 4PTMA 3BARA 2PDIA 3GB6A 2G4JA 4H8UA 3LZ5A 4E2BA 4CGTA 1M53A 2WLZA 2D2OA 3MVTA 1E9LA 4UTFA 4OTKA 2DT0A 1DQXA 3KHDA 2PRMA 3TEVA 1YMYA 2PF0A 5GPRA 4D6CA 4UQAA 4QQ3A 2GSHA 4GO9A 3HG5A 5M2FX 2Z7KA 3GLCA 3E0LA 3RHGA 3C5QA 4UNKA 4S3EA 2BHZA 2FMNA 4Q6JA 1B3YA 1IR2A 1OBAA 1UB3A 4LY4A 1BG4A 2BS9A 3UJEA 2Z29A 2FZ9A 2QCEA 3EPOA 1P0BA 3RR1A 3DGRA 4U5KA 2QIIA 3D46A 4P7OA 4ZSUA 3FNDA 3SECA 2YA2A 4X9YA 1YRRA 4K38A 1OGBA 3LXCA 4L65A 2HS6A 2QCLA 3S2NA 4D2JA 1A3XA 2PTDA 1LL6A 3QHOA 2BXVA 4AISA 2Z7GA 3AXKA 1HNYA 1VBGA 3D5HA 1B31A 1IT7A 2RHGA 5LHEA 3W1QA 1JPHA 1R46A 1JCLA 3N2XA 4RPQA 3VABA 2GJLA 3ABZA 1HX0A 1E0XA 4F2TA 2FB3A 3P2VA 1RCOB 4FSAA 3OBKA 4CD4A 4RE4A 3MO4A 4EIVA 4H8VA 3WFZA 4L6OA 3TJXA 1RD5A 1WB0A 3G2GA 1HL9A 1JQXA 2Y89A 3VFCA 2A79A 1GUVA 2P1FA 2VGIA 4OVXA 2RKXA 2WVVA 2EO7A 4ERIA 1KTCA 1ZJAA 4HQVA 2J78A 1AUSL 2GGHA 4QJ3B 3E2RA 2ZDRA 3H2OA 1EIXA 1B90A 2ZE3A 3IGUA 2EPHA 3WK1A 3KWSA 1XCXA 3VYLA 3E0IA 3U2ZA 2QQ6A 4QE5A 3T0BA 3LN3A 4FS9A 1CGYA 1SSDA 4B91A 3S2LA 3WLJA 3ZR5A 4HKPA 3S9ZA 1GOXA 5E1QA 4HMCA 3ZT5A 2JKAA 3ZQ9A 1XCFA 3P60A 1S5WA 5J04A 1RV8A 2VEKA 4Q4QA 2GK1B 4HNTA 2XFYA 2PB1A 3MUIA 4WRHA 3GNPA 4LALA 3E49A 1CXHA 3W75A 2VEMA 1PDYA 3M5ZA 1CDGA 1Q7QA 2EG7A 3N9RA 4DM2A 3CQIA 4O12A 3OQEA 4O1DA 4A3UA 5AC5A 4WJ8A 4JQ3A 4B9YA 5DCEA 4LBRA 4IT1A