4JZVA

Crystal structure of the bacillus subtilis pyrophosphohydrolase bsrpph bound to a non-hydrolysable triphosphorylated dinucleotide rna (pcp-pgpg) - second guanosine residue in guanosine binding pocket
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
MYEFKDYYQNTVQLSFDDQPFSDSPKHVWVICRFGGKWLLTEHEDRGYEFPGGKVEPMECAEEAALREVKEETGARVKSLKYLGQYKVLGKEKVIVKNIYFADIEKLEKQADYFETKGPVLFHELPENLSRNKKFSFIMKDSVLPISLKKLKESGWIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacillus subtilis RNA deprotection enzyme RppH recognizes guanosine in the second position of its substrates.
pubmed doi rcsb
molecule keywords RNA PYROPHOSPHOHYDROLASE
molecule tags Hydrolase/rna
source organism Bacillus subtilis subsp. subtilis
total genus 36
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4jzvA00
5CFIA 3BAPA 5GHOA 5C7QA 3A6SA 4V14A 3MCFA 2GT4A 3U53A 2VNPA 2YVPA 3FFUA 3Q93A 5FSIA 5CFJA 2QJTA 3GZ6A 2A6TA 3HHJA 1KTGA 5GHJA 4K6EA 1PPWA 5GHIA 3X0KA 4HVYA 2Q9PA 3X0OA 2CL3A 3HYQA 3I7VA 5ANTA 1MR2A 2O1CA 3DKUA 3EESA 3OGAA 3MGMA 4ZG0A 2G73A 1Q54A 2J8QA 2O5WA 3E57A 3ACAA 5ANSA 3SHDA 1VHZA 2W4EA 1V8SA 3FJYA 1PUQA 2PNYA 1V8RA 3FSPA 5FSKA 5ANUA 3MDGA 2O5FA 1G0SA 3G0QA 2B2KA 2A8PA 3KVHA 4N1UA 2DUKA 4KYXA 3MDIA 4C9WA 2A8TA 4C9XA 1HX3A 3Q1PA 3X0SA 1K2EA 2XSQA 1KHZA 3Q2TA 3X0IA 1TUMA 5BS6A 1VHGA 1I9AA 1V8YA 2I8TA 4ICKA 3O69A 4KTBA 1IRYA 1NFZA 5GHQA 2FKBA 1SU2A 1XSBA 1OW2A 5FSOA 1VIUA 1G9QA 2I6KA 3O61A 1RRQA 2DSCA 2KDWA 1VK6A 3A6UA 3GZ8A 2YYHA 3H95A 4MPOA 4JZSA 3SMDA 4YPHA 3F6AA 1SJYA 1MK1A 2DSDA 3GWYA 4YPRA 1PUNA 2YVNA 2GT2A 3O8SA 3CNGA 3X0JA 4N1TA 5GHPA 4JZVA 3EF5A 2R5WA 3ID9A 4NFXA 2B06A 3X0LA 3I9XA 1VC9A 2QKMB 3BM4A 3X0QA 4JZUA 2VNQA 3FK9A 1VRLA 1RRSA 5GHMA 2KDVA 2PQVA 3O52A 5C8LA 2A8SA 3A6VA 3AC9A 2A8RA 2QJOA 2FVVA 1V8TA 1Q27A 1PUSA 3GG6A 4S2WA 1PPVA 3X0RA 3Q2SA 3I7UA 5ANVA 5C7TA 2AZWA 3EXQA 1V8UA 1MQEA 2YVOA 1R67A 3N77A 3DUPA 1U20A 4S2XA 1X84A 1V8WA 2GB5A 4KG4A 5I8UA 1X51A 1VCDA 3BHOA 5FSMA 2JVBA 3P5TA 3P6YA 3A6TA 5BONA 3Q4IA 5ANWA 1JRKA 5GHNA 1NQZA 1SOIA 4YOQA 5FSNA 3L85A 5DD4A 2FMLA 3X0PA 1RYAA 2DSBA 3N9UA 1Q33A 1JKNA 4NFWA 4S2VA 4IJXA 1MUTA 3R03A 1F3YA 1MQWA 2YVMA 5DDGA 1XSCA 5IW4A 2A8QA 4HFQA 3WHWA 1VIQA 3COUA 1XSAA 4DYWA 1PPXA 2ICJA 3ZR1A 1V8MA 5IW5A 1SZ3A 5FSLA 2B0VA 4ILQA 1MP2A 5DEQA 1K26A 3QSJA 1KT9A 1HZTA 1VC8A 3X0MA 2G74A 3SONA 3O6ZA 4S2YA 4KG3A 1QVJA 3FCMA 1V8VA 4JZTA 3GZ5A 3GRNA 3RH7A 1NQYA 1V8LA 2ICKA 1X83A 5HZXA 5ISYA 2DHOA 5LPGA 2I8UA 1V8IA 1PVFA 3X0NA 5DPKA 3J7Ye 3ZR0A 2RRKA 3EEUA 3F13A 1NFSA 3Q91A 1GA7A 1V8NA
chains in the Genus database with same CATH superfamily
5CFIA 3BAPA 5GHOA 5C7QA 3A6SA 4V14A 3MCFA 2GT4A 3U53A 2VNPA 2YVPA 3FFUA 3Q93A 5FSIA 5CFJA 2QJTA 3GZ6A 2A6TA 3HHJA 1KTGA 5GHJA 4K6EA 1PPWA 5GHIA 3X0KA 4HVYA 2Q9PA 3X0OA 2CL3A 3HYQA 3I7VA 5ANTA 1MR2A 2O1CA 3DKUA 3EESA 3OGAA 3MGMA 4ZG0A 2G73A 1Q54A 2J8QA 2O5WA 3E57A 3ACAA 5ANSA 3SHDA 1VHZA 2W4EA 1V8SA 3FJYA 1PUQA 2PNYA 1V8RA 3FSPA 5FSKA 5ANUA 3MDGA 2O5FA 1G0SA 3G0QA 2B2KA 2A8PA 3KVHA 4N1UA 2DUKA 4KYXA 3MDIA 4C9WA 2A8TA 4C9XA 1HX3A 3Q1PA 3X0SA 1K2EA 2XSQA 1KHZA 3Q2TA 3X0IA 1TUMA 5BS6A 1VHGA 1I9AA 1V8YA 2I8TA 4ICKA 3O69A 4J7HA 4KTBA 1IRYA 1NFZA 5GHQA 2FKBA 1SU2A 1XSBA 1OW2A 5FSOA 1VIUA 1G9QA 2I6KA 3O61A 1RRQA 2DSCA 2KDWA 1VK6A 3A6UA 3GZ8A 2YYHA 3H95A 4J7GA 4JZSA 4MPOA 3SMDA 3F6AA 4YPHA 1SJYA 1MK1A 2DSDA 3GWYA 4YPRA 1PUNA 2YVNA 2GT2A 3O8SA 3CNGA 3X0JA 4N1TA 5GHPA 4JZVA 3EF5A 2R5WA 3ID9A 4NFXA 2B06A 3X0LA 3I9XA 1VC9A 2CZRA 2QKMB 3BM4A 3X0QA 4JZUA 2VNQA 3FK9A 1VRLA 1RRSA 5GHMA 2KDVA 2PQVA 3O52A 5C8LA 2A8SA 3A6VA 3AC9A 2A8RA 2QJOA 2FVVA 1V8TA 1Q27A 1PUSA 3GG6A 4S2WA 1PPVA 3X0RA 3Q2SA 3I7UA 5ANVA 5C7TA 2AZWA 3EXQA 1V8UA 1MQEA 2YVOA 1R67A 3N77A 3DUPA 1U20A 4S2XA 1X84A 1V8WA 2GB5A 4KG4A 5I8UA 1X51A 1VCDA 3BHOA 5FSMA 2JVBA 3P5TA 3P6YA 3A6TA 5BONA 3Q4IA 5ANWA 1JRKA 5GHNA 1NQZA 1SOIA 4YOQA 5FSNA 3L85A 5DD4A 2FMLA 3X0PA 1RYAA 2DSBA 3N9UA 1Q33A 1JKNA 4NFWA 4S2VA 4IJXA 1MUTA 3R03A 1F3YA 1MQWA 2YVMA 5DDGA 1XSCA 5IW4A 2A8QA 4HFQA 3WHWA 1VIQA 3COUA 1XSAA 4DYWA 1PPXA 2ICJA 3ZR1A 1V8MA 5IW5A 1SZ3A 5FSLA 2B0VA 4ILQA 1MP2A 5DEQA 1K26A 3QSJA 1KT9A 1HZTA 1VC8A 3X0MA 2G74A 3SONA 3O6ZA 4S2YA 4KG3A 1QVJA 3FCMA 1V8VA 4JZTA 3GZ5A 3GRNA 3RH7A 1NQYA 1V8LA 2ICKA 1X83A 5HZXA 5ISYA 2DHOA 5LPGA 2I8UA 1V8IA 1PVFA 3X0NA 5DPKA 3J7Ye 3ZR0A 2RRKA 3EEUA 3F13A 1NFSA 3Q91A 1GA7A 1V8NA
chains in the Genus database with same CATH topology
5CFIA 3BAPA 5GHOA 5C7QA 3A6SA 4V14A 3MCFA 2GT4A 3U53A 2VNPA 2YVPA 3FFUA 3Q93A 5FSIA 5CFJA 2QJTA 3GZ6A 2A6TA 3HHJA 1KTGA 5GHJA 4K6EA 1PPWA 5GHIA 3X0KA 4HVYA 2Q9PA 3X0OA 2CL3A 3HYQA 3I7VA 5ANTA 1MR2A 2O1CA 3DKUA 3EESA 3OGAA 3MGMA 4ZG0A 2G73A 1Q54A 2J8QA 2O5WA 3E57A 3ACAA 5ANSA 3SHDA 1VHZA 2W4EA 1V8SA 3FJYA 1PUQA 2PNYA 1V8RA 3FSPA 5FSKA 5ANUA 3MDGA 2O5FA 1G0SA 3G0QA 2B2KA 2A8PA 3KVHA 4N1UA 2DUKA 4KYXA 3MDIA 4C9WA 2A8TA 4C9XA 1HX3A 3Q1PA 3X0SA 1K2EA 2XSQA 1KHZA 3Q2TA 3X0IA 1TUMA 5BS6A 1VHGA 1I9AA 1V8YA 2I8TA 4ICKA 3O69A 4J7HA 4KTBA 1IRYA 1NFZA 5GHQA 2FKBA 1SU2A 1XSBA 1OW2A 5FSOA 1VIUA 1G9QA 2I6KA 3O61A 1RRQA 2DSCA 2KDWA 1VK6A 3A6UA 3GZ8A 2YYHA 3H95A 4J7GA 4JZSA 4MPOA 3SMDA 3F6AA 4YPHA 1SJYA 1MK1A 2DSDA 3GWYA 4YPRA 1PUNA 2YVNA 2GT2A 3O8SA 3CNGA 3X0JA 4N1TA 5GHPA 4JZVA 3EF5A 2R5WA 3ID9A 4NFXA 2B06A 3X0LA 3I9XA 1VC9A 2CZRA 2QKMB 3BM4A 3X0QA 4JZUA 2VNQA 3FK9A 1VRLA 1RRSA 5GHMA 2KDVA 2PQVA 3O52A 5C8LA 2A8SA 3A6VA 3AC9A 2A8RA 2QJOA 2FVVA 1V8TA 1Q27A 1PUSA 3GG6A 4S2WA 1PPVA 3X0RA 3Q2SA 3I7UA 5ANVA 5C7TA 2AZWA 3EXQA 1V8UA 1MQEA 2YVOA 1R67A 3N77A 3DUPA 1U20A 4S2XA 1X84A 1V8WA 2GB5A 4KG4A 5I8UA 1X51A 1VCDA 3BHOA 5FSMA 2JVBA 3P5TA 3P6YA 3A6TA 5BONA 3Q4IA 5ANWA 1JRKA 5GHNA 1NQZA 1SOIA 4YOQA 5FSNA 3L85A 5DD4A 2FMLA 3X0PA 1RYAA 2DSBA 3N9UA 1Q33A 1JKNA 4NFWA 4S2VA 4IJXA 1MUTA 3R03A 1F3YA 1MQWA 2YVMA 5DDGA 1XSCA 5IW4A 2A8QA 4HFQA 3WHWA 1VIQA 3COUA 1XSAA 4DYWA 1PPXA 2ICJA 3ZR1A 1V8MA 5IW5A 1SZ3A 5FSLA 2B0VA 4ILQA 1MP2A 5DEQA 1K26A 3QSJA 1KT9A 1HZTA 1VC8A 3X0MA 2G74A 3SONA 3O6ZA 4S2YA 4KG3A 1QVJA 3FCMA 1V8VA 4JZTA 3GZ5A 3GRNA 3RH7A 1NQYA 1V8LA 2ICKA 1X83A 5HZXA 5ISYA 2DHOA 5LPGA 2I8UA 1V8IA 1PVFA 3X0NA 5DPKA 3J7Ye 3ZR0A 2RRKA 3EEUA 3F13A 1NFSA 3Q91A 1GA7A 1V8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFI A;  3BAP A;  5GHO A;  5C7Q A;  3A6S A;  4V14 A;  3MCF A;  2GT4 A;  3U53 A;  2VNP A;  2YVP A;  3FFU A;  3Q93 A;  5FSI A;  5CFJ A;  2QJT A;  3GZ6 A;  2A6T A;  3HHJ A;  1KTG A;  5GHJ A;  4K6E A;  1PPW A;  5GHI A;  3X0K A;  4HVY A;  2Q9P A;  3X0O A;  2CL3 A;  3HYQ A;  3I7V A;  5ANT A;  1MR2 A;  2O1C A;  3DKU A;  3EES A;  3OGA A;  3MGM A;  4ZG0 A;  2G73 A;  1Q54 A;  2J8Q A;  2O5W A;  3E57 A;  3ACA A;  5ANS A;  3SHD A;  1VHZ A;  2W4E A;  1V8S A;  3FJY A;  1PUQ A;  2PNY A;  1V8R A;  3FSP A;  5FSK A;  5ANU A;  3MDG A;  2O5F A;  1G0S A;  3G0Q A;  2B2K A;  2A8P A;  3KVH A;  4N1U A;  2DUK A;  4KYX A;  3MDI A;  4C9W A;  2A8T A;  4C9X A;  1HX3 A;  3Q1P A;  3X0S A;  1K2E A;  2XSQ A;  1KHZ A;  3Q2T A;  3X0I A;  1TUM A;  5BS6 A;  1VHG A;  1I9A A;  1V8Y A;  2I8T A;  4ICK A;  3O69 A;  4KTB A;  1IRY A;  1NFZ A;  5GHQ A;  2FKB A;  1SU2 A;  1XSB A;  1OW2 A;  5FSO A;  1VIU A;  1G9Q A;  2I6K A;  3O61 A;  1RRQ A;  2DSC A;  2KDW A;  1VK6 A;  3A6U A;  3GZ8 A;  2YYH A;  3H95 A;  4MPO A;  4JZS A;  3SMD A;  4YPH A;  3F6A A;  1SJY A;  1MK1 A;  2DSD A;  3GWY A;  4YPR A;  1PUN A;  2YVN A;  2GT2 A;  3O8S A;  3CNG A;  3X0J A;  4N1T A;  5GHP A;  4JZV A;  3EF5 A;  2R5W A;  3ID9 A;  4NFX A;  2B06 A;  3X0L A;  3I9X A;  1VC9 A;  2QKM B;  3BM4 A;  3X0Q A;  4JZU A;  2VNQ A;  3FK9 A;  1VRL A;  1RRS A;  5GHM A;  2KDV A;  2PQV A;  3O52 A;  5C8L A;  2A8S A;  3A6V A;  3AC9 A;  2A8R A;  2QJO A;  2FVV A;  1V8T A;  1Q27 A;  1PUS A;  3GG6 A;  4S2W A;  1PPV A;  3X0R A;  3Q2S A;  3I7U A;  5ANV A;  5C7T A;  2AZW A;  3EXQ A;  1V8U A;  1MQE A;  2YVO A;  1R67 A;  3N77 A;  3DUP A;  1U20 A;  4S2X A;  1X84 A;  1V8W A;  2GB5 A;  4KG4 A;  5I8U A;  1X51 A;  1VCD A;  3BHO A;  5FSM A;  2JVB A;  3P5T A;  3P6Y A;  3A6T A;  5BON A;  3Q4I A;  5ANW A;  1JRK A;  5GHN A;  1NQZ A;  1SOI A;  4YOQ A;  5FSN A;  3L85 A;  5DD4 A;  2FML A;  3X0P A;  1RYA A;  2DSB A;  3N9U A;  1Q33 A;  1JKN A;  4NFW A;  4S2V A;  4IJX A;  1MUT A;  3R03 A;  1F3Y A;  1MQW A;  2YVM A;  5DDG A;  1XSC A;  5IW4 A;  2A8Q A;  4HFQ A;  3WHW A;  1VIQ A;  3COU A;  1XSA A;  4DYW A;  1PPX A;  2ICJ A;  3ZR1 A;  1V8M A;  5IW5 A;  1SZ3 A;  5FSL A;  2B0V A;  4ILQ A;  1MP2 A;  5DEQ A;  1K26 A;  3QSJ A;  1KT9 A;  1HZT A;  1VC8 A;  3X0M A;  2G74 A;  3SON A;  3O6Z A;  4S2Y A;  4KG3 A;  1QVJ A;  3FCM A;  1V8V A;  4JZT A;  3GZ5 A;  3GRN A;  3RH7 A;  1NQY A;  1V8L A;  2ICK A;  1X83 A;  5HZX A;  5ISY A;  2DHO A;  5LPG A;  2I8U A;  1V8I A;  1PVF A;  3X0N A;  5DPK A;  3J7Y e;  3ZR0 A;  2RRK A;  3EEU A;  3F13 A;  1NFS A;  3Q91 A;  1GA7 A;  1V8N A; 
#chains in the Genus database with same CATH topology
 5CFI A;  3BAP A;  5GHO A;  5C7Q A;  3A6S A;  4V14 A;  3MCF A;  2GT4 A;  3U53 A;  2VNP A;  2YVP A;  3FFU A;  3Q93 A;  5FSI A;  5CFJ A;  2QJT A;  3GZ6 A;  2A6T A;  3HHJ A;  1KTG A;  5GHJ A;  4K6E A;  1PPW A;  5GHI A;  3X0K A;  4HVY A;  2Q9P A;  3X0O A;  2CL3 A;  3HYQ A;  3I7V A;  5ANT A;  1MR2 A;  2O1C A;  3DKU A;  3EES A;  3OGA A;  3MGM A;  4ZG0 A;  2G73 A;  1Q54 A;  2J8Q A;  2O5W A;  3E57 A;  3ACA A;  5ANS A;  3SHD A;  1VHZ A;  2W4E A;  1V8S A;  3FJY A;  1PUQ A;  2PNY A;  1V8R A;  3FSP A;  5FSK A;  5ANU A;  3MDG A;  2O5F A;  1G0S A;  3G0Q A;  2B2K A;  2A8P A;  3KVH A;  4N1U A;  2DUK A;  4KYX A;  3MDI A;  4C9W A;  2A8T A;  4C9X A;  1HX3 A;  3Q1P A;  3X0S A;  1K2E A;  2XSQ A;  1KHZ A;  3Q2T A;  3X0I A;  1TUM A;  5BS6 A;  1VHG A;  1I9A A;  1V8Y A;  2I8T A;  4ICK A;  3O69 A;  4J7H A;  4KTB A;  1IRY A;  1NFZ A;  5GHQ A;  2FKB A;  1SU2 A;  1XSB A;  1OW2 A;  5FSO A;  1VIU A;  1G9Q A;  2I6K A;  3O61 A;  1RRQ A;  2DSC A;  2KDW A;  1VK6 A;  3A6U A;  3GZ8 A;  2YYH A;  3H95 A;  4J7G A;  4JZS A;  4MPO A;  3SMD A;  3F6A A;  4YPH A;  1SJY A;  1MK1 A;  2DSD A;  3GWY A;  4YPR A;  1PUN A;  2YVN A;  2GT2 A;  3O8S A;  3CNG A;  3X0J A;  4N1T A;  5GHP A;  4JZV A;  3EF5 A;  2R5W A;  3ID9 A;  4NFX A;  2B06 A;  3X0L A;  3I9X A;  1VC9 A;  2CZR A;  2QKM B;  3BM4 A;  3X0Q A;  4JZU A;  2VNQ A;  3FK9 A;  1VRL A;  1RRS A;  5GHM A;  2KDV A;  2PQV A;  3O52 A;  5C8L A;  2A8S A;  3A6V A;  3AC9 A;  2A8R A;  2QJO A;  2FVV A;  1V8T A;  1Q27 A;  1PUS A;  3GG6 A;  4S2W A;  1PPV A;  3X0R A;  3Q2S A;  3I7U A;  5ANV A;  5C7T A;  2AZW A;  3EXQ A;  1V8U A;  1MQE A;  2YVO A;  1R67 A;  3N77 A;  3DUP A;  1U20 A;  4S2X A;  1X84 A;  1V8W A;  2GB5 A;  4KG4 A;  5I8U A;  1X51 A;  1VCD A;  3BHO A;  5FSM A;  2JVB A;  3P5T A;  3P6Y A;  3A6T A;  5BON A;  3Q4I A;  5ANW A;  1JRK A;  5GHN A;  1NQZ A;  1SOI A;  4YOQ A;  5FSN A;  3L85 A;  5DD4 A;  2FML A;  3X0P A;  1RYA A;  2DSB A;  3N9U A;  1Q33 A;  1JKN A;  4NFW A;  4S2V A;  4IJX A;  1MUT A;  3R03 A;  1F3Y A;  1MQW A;  2YVM A;  5DDG A;  1XSC A;  5IW4 A;  2A8Q A;  4HFQ A;  3WHW A;  1VIQ A;  3COU A;  1XSA A;  4DYW A;  1PPX A;  2ICJ A;  3ZR1 A;  1V8M A;  5IW5 A;  1SZ3 A;  5FSL A;  2B0V A;  4ILQ A;  1MP2 A;  5DEQ A;  1K26 A;  3QSJ A;  1KT9 A;  1HZT A;  1VC8 A;  3X0M A;  2G74 A;  3SON A;  3O6Z A;  4S2Y A;  4KG3 A;  1QVJ A;  3FCM A;  1V8V A;  4JZT A;  3GZ5 A;  3GRN A;  3RH7 A;  1NQY A;  1V8L A;  2ICK A;  1X83 A;  5HZX A;  5ISY A;  2DHO A;  5LPG A;  2I8U A;  1V8I A;  1PVF A;  3X0N A;  5DPK A;  3J7Y e;  3ZR0 A;  2RRK A;  3EEU A;  3F13 A;  1NFS A;  3Q91 A;  1GA7 A;  1V8N A; 
#chains in the Genus database with same CATH homology
 5CFI A;  3BAP A;  5GHO A;  5C7Q A;  3A6S A;  4V14 A;  3MCF A;  2GT4 A;  3U53 A;  2VNP A;  2YVP A;  3FFU A;  3Q93 A;  5FSI A;  5CFJ A;  2QJT A;  3GZ6 A;  2A6T A;  3HHJ A;  1KTG A;  5GHJ A;  4K6E A;  1PPW A;  5GHI A;  3X0K A;  4HVY A;  2Q9P A;  3X0O A;  2CL3 A;  3HYQ A;  3I7V A;  5ANT A;  1MR2 A;  2O1C A;  3DKU A;  3EES A;  3OGA A;  3MGM A;  4ZG0 A;  2G73 A;  1Q54 A;  2J8Q A;  2O5W A;  3E57 A;  3ACA A;  5ANS A;  3SHD A;  1VHZ A;  2W4E A;  1V8S A;  3FJY A;  1PUQ A;  2PNY A;  1V8R A;  3FSP A;  5FSK A;  5ANU A;  3MDG A;  2O5F A;  1G0S A;  3G0Q A;  2B2K A;  2A8P A;  3KVH A;  4N1U A;  2DUK A;  4KYX A;  3MDI A;  4C9W A;  2A8T A;  4C9X A;  1HX3 A;  3Q1P A;  3X0S A;  1K2E A;  2XSQ A;  1KHZ A;  3Q2T A;  3X0I A;  1TUM A;  5BS6 A;  1VHG A;  1I9A A;  1V8Y A;  2I8T A;  4ICK A;  3O69 A;  4J7H A;  4KTB A;  1IRY A;  1NFZ A;  5GHQ A;  2FKB A;  1SU2 A;  1XSB A;  1OW2 A;  5FSO A;  1VIU A;  1G9Q A;  2I6K A;  3O61 A;  1RRQ A;  2DSC A;  2KDW A;  1VK6 A;  3A6U A;  3GZ8 A;  2YYH A;  3H95 A;  4J7G A;  4JZS A;  4MPO A;  3SMD A;  3F6A A;  4YPH A;  1SJY A;  1MK1 A;  2DSD A;  3GWY A;  4YPR A;  1PUN A;  2YVN A;  2GT2 A;  3O8S A;  3CNG A;  3X0J A;  4N1T A;  5GHP A;  4JZV A;  3EF5 A;  2R5W A;  3ID9 A;  4NFX A;  2B06 A;  3X0L A;  3I9X A;  1VC9 A;  2CZR A;  2QKM B;  3BM4 A;  3X0Q A;  4JZU A;  2VNQ A;  3FK9 A;  1VRL A;  1RRS A;  5GHM A;  2KDV A;  2PQV A;  3O52 A;  5C8L A;  2A8S A;  3A6V A;  3AC9 A;  2A8R A;  2QJO A;  2FVV A;  1V8T A;  1Q27 A;  1PUS A;  3GG6 A;  4S2W A;  1PPV A;  3X0R A;  3Q2S A;  3I7U A;  5ANV A;  5C7T A;  2AZW A;  3EXQ A;  1V8U A;  1MQE A;  2YVO A;  1R67 A;  3N77 A;  3DUP A;  1U20 A;  4S2X A;  1X84 A;  1V8W A;  2GB5 A;  4KG4 A;  5I8U A;  1X51 A;  1VCD A;  3BHO A;  5FSM A;  2JVB A;  3P5T A;  3P6Y A;  3A6T A;  5BON A;  3Q4I A;  5ANW A;  1JRK A;  5GHN A;  1NQZ A;  1SOI A;  4YOQ A;  5FSN A;  3L85 A;  5DD4 A;  2FML A;  3X0P A;  1RYA A;  2DSB A;  3N9U A;  1Q33 A;  1JKN A;  4NFW A;  4S2V A;  4IJX A;  1MUT A;  3R03 A;  1F3Y A;  1MQW A;  2YVM A;  5DDG A;  1XSC A;  5IW4 A;  2A8Q A;  4HFQ A;  3WHW A;  1VIQ A;  3COU A;  1XSA A;  4DYW A;  1PPX A;  2ICJ A;  3ZR1 A;  1V8M A;  5IW5 A;  1SZ3 A;  5FSL A;  2B0V A;  4ILQ A;  1MP2 A;  5DEQ A;  1K26 A;  3QSJ A;  1KT9 A;  1HZT A;  1VC8 A;  3X0M A;  2G74 A;  3SON A;  3O6Z A;  4S2Y A;  4KG3 A;  1QVJ A;  3FCM A;  1V8V A;  4JZT A;  3GZ5 A;  3GRN A;  3RH7 A;  1NQY A;  1V8L A;  2ICK A;  1X83 A;  5HZX A;  5ISY A;  2DHO A;  5LPG A;  2I8U A;  1V8I A;  1PVF A;  3X0N A;  5DPK A;  3J7Y e;  3ZR0 A;  2RRK A;  3EEU A;  3F13 A;  1NFS A;  3Q91 A;  1GA7 A;  1V8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...