4K05A

Crystal structure of a duf1343 family protein (bf0371) from bacteroides fragilis nctc 9343 at 1.65 a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
391
structure length
384
Chain Sequence
PRIRIKTGIEVLKEQNFKCLEGKRVGLITNPTGVDNHLISTIDILHEAPNVNLVALYGPEHGVRGDVHANDSSTGLPVYSLYGKTRKPTPEMLKDIDVLVYDIQDIGCRSFTYISTMGVAMEAAAENNKEFIVLDRPNPIGGLKIEGNVVEDGYISFVSQFKIPYLYGLTCGELALMLNGEQMLSKPCNLHVVKMKGWKRKMDYVQTGLQWIPSSPHIPHPHSAFFYPVSGILGELGYMSIGVGYTIPFQMFAARWVEAEKLADNLNRLHLPGVIFRPMHLKPFYSVGKEEHLQGVQVHIVDFNKASLSEIQFYVMQEVTALYPDRAVFDHADKERFHMFDLVSGSKEIRERFSQRNRWEDVRDYWYKDVDDFRRLSQKYYLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical exported protein
publication title Crystal structure of a hypothetical protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 123
structure length 384
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07075 DUF1343 Protein of unknown function (DUF1343)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4k05A01
3.90.1150.140 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4k05A02
4JJAA 4K05A
chains in the Genus database with same CATH superfamily
1M75A 3VTKA 3VOBA 1LBIA 4ATNA 4BLVA 3ABIA 5HQ3B 2GHRA 4COKA 2HUPA 5AT1A 4FOSA 1MG0A 1JAIA 3QY9A 4E4TA 4ERNA 1H0KA 4BO5A 1ACMA 3O3CA 4RAEA 6NULA 2JFXA 3DP9A 1XAHA 3BN3A 4HH1A 4A82A 3DYIA 3VZRA 1HT3A 3BXEA 3FVVA 2V65A 3P2JA 2NZWA 2FFQA 1G9TA 2R00C 3C43A 4DMHA 2WQ7A 2OCLA 4RLQA 4JAVC 3DZGA 4XX1A 3I72A 3FVXA 2VK1A 1L4EA 3Q8LA 3JWEA 2VP9A 1DWUA 1CJUC 4XFJA 3X3HA 4FVTA 3RTBA 2UDPA 2CMGA 2SBTA 3F9TA 4REQA 5B1DA 5KWEA 3RM3A 3MC6A 2H63A 3GN1A 2G88A 2CNDA 3HP1A 5ECDA 4TWRA 2WYOA 2D1SA 1W2HA 2YWJA 5MDHA 1GKKA 4U6QA 3UT5A 1RFGE 2VWGA 3L06A 2P62A 3GLTA 3EVZA 4F5KA 2VO1A 3GGDA 4RIZA 3L8MA 1V2GA 4R54A 10MHA 1JHUA 2BUBA 3FOBA 2VJPA 1Z4MA 2G7JA 5LJIA 3DZBA 3ANSA 3EOAI 4RDHA 2YIMA 2ISQA 5JWHA 5KNDA 3L9WA 1T4CB 2WWIA 3PRKE 3MCZA 4BFCA 1BQDA 1U7UA 5IM4A 2Z2YA 4TMVA 2HJVA 1V37A 1RU3A 4MWDA 1VKZA 1JJBA 3NXKA 4JBXA 5DI9A 5BR8B 4JNCA 4L9AA 1I5RA 2E4WA 3ICPA 1A7JA 2A4MA 2OK7A 1EQBA 2H57A 2C98A 3VYUB 4DSTA 5IKEA 1BGVA 2VNKA 3KZKA 1GZ3A 1PX2A 4K9QA 2E4VA 3L7BA 4LYYA 1DRUA 1L5ZA 4TUYB 4GLLA 1BVYF 2YY7A 1BW9B 1TTQB 1I41A 1EK1A 1T43A 1J70A 1ZMBA 3KK0A 1U0BB 3RYCA 1RS0A 4JZKA 2RHCA 1TU3A 1NJSA 1M0OA 4P8RA 1EX6A 1IBSA 2XIQA 3HCBA 1X8JA 1GU0A 3X2FA 5BYBA 2QWXA 2WK9A 3EGXB 1BN6A 2YC2C 2BAGA 1NUUA 3T7KA 5A6SB 4RZIA 3DXYA 5ILQA 1C2TA 2ONYA 3OE1A 5KTOA 2HIGA 3NDJA 1Z08A 5CA1B 5BSWA 3QFSA 4GWGA 2NPFA 1S2NA 3UJNA 1IL0A 2RGNC 4M1YA 2ZR7A 4LNUA 4U9IS 2RGBA 3NBQA 3BMOA 5H81A 4F56A 5EWMA 4ZIRA 2PT9A 3O7MA 4RMHA 1RLMA 4J0QA 4DUGA 2XB8A 1K4YA 4WOBA 1M1UA 2RBGA 2DF8A 5LUAA 1FRVA 2QT0A 1A2BA 5PGMA 1TU4A 2ENWA 4GE9A 1WB6A 3CJQA 4NZOA 3GWGA 1CQ6A 4PO1A 1AJRA 1PS8A 3L0IB 2F1IA 1ZW6A 3DBHA 3Q0TA 4MYCA 1KZYC 3LYHA 4OLAA 3FYDA 1SHJA 4MV7A 1TT5B 4QFCA 4MQ6A 4EL0A 1G2IA 1MW9X 2QD4A 5I9MA 4R2XA 1DLIA 2LZ0A 4R98A 1GCGA 2XRYA 4N3AA 1PWHA 3VRHA 4CCSA 3KV1A 4TROA 4REQB 3GJ4A 2YY6A 3E9KA 1GNPA 3KUDA 1GC2A 4RHXA 3VZPA 3U19A 4PYKA 4RGVA 4RGBA 4X8OA 1ASBA 4LHSA 3QUCA 2DU8A 5EXEA 2AUMA 1XTTA 3GLKA 1A7AA 3N39C 3L0OA 2BFAA 1L5QA 3UT5B 1MNQA 1BKSB 2XCIA 2F67A 4GDYA 3PD1A 3D6NB 1T4GA 3Q7RA 2QRNA 1DJQA 1YR8A 2NNLD 1LW6E 4XJPA 4GR4A 3WNVA 2VDKB 5GAJA 2IT1A 2NN3C 2D8MA 5JS8A 1V7CA 4MYRA 1PL8A 1KNXA 4HNSA 1CT9A 2YV3A 1UAYA 1Q77A 4LAFA 3G1UA 2DERA 2YZ2A 2RGCA 4OM7A 2RB5A 3PHHA 1O96B 4M0FA 3N2NA 3PNVA 3QU7A 1EE2A 2O8CB 1VE7A 1QYVA 3O3OB 2F9FA 4QECA 2VP5A 3FFTA 1WAMA 5E4FA 2PMBA 3MRSA 3FVUA 3KR1A 4R6WA 1M33A 4TMZA 4Z3DA 5CM2Z 3B5JA 2GNPA 4XEUA 2Z9XA 3WKSA 3QVUA 4I8AA 3ZHQA 2XB9A 4KTTE 4KRFA 1WKHA 1VPDA 4WESA 2I8AA 1CY1A 4FOPA 3G79A 2F4VB 1R0CA 3N1UA 1ZVKA 4B7CA 3HLYA 1GUDA 2IYWA 4TYNA 4QE3A 1YS4A 3SZ3A 3RYCB 3GFOA 2B1JA 3GRFA 4YJKA 3R6WA 3WTCA 1XVLA 3AWDA 3HA2A 2V59A 2VHVA 5ALZA 1AKMA 4M0PA 1DRJA 5I9NA 3EFEA 1W2WB 1V41E 2XWSA 1U8XX 5H59A 1AKNA 5JUWA 1H93A 2VH5R 4RD0A 1QG4A 2IY7A 3IXMA 2H2FA 1AS2A 3TSZA 1Z6ZA 3P2KA 1DWQA 4ISYA 2HCBA 4ER3A 2MTBA 3ZGVA 5TPWB 3DDZX 5A2QA 1W44A 2P1DA 1DAEA 5EWMB 2NVWA 4YV2A 1PR2A 1OH5A 4AAYA 4PLZA 1GFZA 2J6IA 4Q21A 4E07A 3GT4A 4RA6A 4KIFA 2Q2NA 2JFNA 4TGLA 4CNQA 1HDXA 4TX1A 3M6AA 5JYDA 4PPGA 3WNDA 1J22A 4G1UC 4Z2YA 3HRIA 1ZI8A 1FSGA 3PPLA 3R0XA 1UF9A 3DBHB 3I1JA 3VR4A 2YICA 2J32A 1XKLA 1T1IA 1WLSA 4ZHQF 3NHPA 4V2UA 3ROQA 5L3QA 3HK2A 1D2GA 3TZ6A 2YN4A 3SF8A 3FOAA 2BFCB 2CL5A 3DR4A 1MVLA 4D4GA 2WT4A 1THTA 3T9FA 1WKCA 1RWXA 2Y1OA 1HQDA 2C7QA 3UJPA 1U6KA 2Z20A 4JYPA 4KMOA 2E6KA 5FWDA 4Q03A 1PBTA 4UHMA 1M1XB 1M1YE 3SM3A 2PO5A 1L5FA 2X15A 3CURA 3OWOA 4UKDA 4ZA2A 5F7OA 1HFWA 2VFAA 3AEZA 1L7MA 1YL6A 3A36A 1BEZA 5EXTA 2OGSA 4L15A 4A2CA 1XOIA 2XQFA 1SHZA 1AHEA 1GRQA 2GSDA 4Q3DA 3V33A 4UREA 3Q7IA 1ZGZA 1KP2A 1UDCA 3EXIA 1YAAA 1HL3A 1NRIA 2GLTA 2XWQA 4ABTA 1VJ0A 3AM5A 3W2EA 2PGDA 4UOZA 2Z30A 2N1BA 1FNNA 4XPZA 3USZA 1H42A 2V55B 4BNJA 2GEVA 4I1OA 3BGIA 2R6DA 2J30A 2XMGA 2SNIE 2JIOA 1ZNQO 1RQXA 4WZBB 1KAFA 5KI6A 2IZ0A 1TYZA 5D3KA 2HHHB 5C34B 3BJIC 4WESB 2D1YA 4Q34A 2IE8A 3H8VA 3DD5A 1MFZA 2OKJA 4N01A 4GGMX 4C20A 5F4BA 1W4RA 1J2YA 3WHIA 3COZA 3UATA 3ETNA 1R18A 1MO5A 1QJ5A 1N5LA 4EFNA 3LUAA 2ZJYA 1C3EA 2YJZA 4JYBA 3VM6A 1E2LA 3JRXA 2PMKA 3VC1A 3RBXA 3HLKA 3K4PA 4D8TA 1PFUA 3TX2A 2H52A 3QX9A 1RYNA 4M9RA 3LHSA 3IDZA 3W8NA 3QXCA 2PWBA 3P19A 3JWBA 4A36A 5E38A 2P2GA 4UVGA 4OQ4A 2CYAA 3O2NA 4KCGA 3AUJB 3H2YA 3G13A 4BCDA 4EKIA 4ZO8A 3F4KA 4CVNA 4RA6B 5E7IA 4Y1FA 2A2ZA 2Z2KA 1ZMOA 4FZRA 4OHRA 3UNXA 2P4QA 2FPLA 4AD8A 2H85A 2VDJA 4KQIA 3CWQA 1H2EA 5JO9A 4P08A 2J8ZA 2PQ0A 4RKQA 2DOKA 3LSTA 4RVHA 2VMWA 3A06A 2YOGA 3DKVA 2LCQA 1SB8A 2XMBA 4OAPA 1EX1A 1ZD3A 2LGJA 1MDFA 1DAFA 1Z06A 2Z8YA 4OQFA 2WKSA 4HLCA 1PJ2A 5EXSA 5L3QB 3H8WA 5B1IA 3SF8B 1YS6A 1FE8A 2K5UA 1ML4A 1R50A 4GUAA 2X0JA 1RR6A 3D6UA 3KKOA 4WJZA 1AMOA 2DGKA 2X76A 5H02A 1BHSA 5G4LA 4F5GA 3GUZA 3KR0A 1I30A 4S1WA 2JVJA 4W82A 4RQTA 4MY5A 2PT5A 3OZXA 4Q9DA 5TT0A 1PWZA 4BQFA 3SIPA 2X5DA 1GZDA 1UC9A 3GMTA 4DBCA 3OUUA 2YNMC 4Q4CA 3KDSE 4OGFA 3ORRA 4ZJPA 4WY5A 5KVVA 2QMYA 1LZKA 4FLFA 1BXGA 3E3MA 4BAUA 3IUSA 2ZVQX 4GVXA 5TMDA 3EXIB 1LDMA 4MQ5A 4JB2A 2YRIA 2HIAA 3WIOA 5LOVA 4W1XA 2Z2XA 3W8FA 4MV0A 4OV6B 2ZS9A 4JVMA 1FUIA 4JX9A 3RVRA 1NQVA 3NM4A 3DF9A 3OT4A 3IMEA 4ZC8A 3E3LA 3LFHA 4I2VA 4E15A 5LQRA 2QS9A 1CG6A 2X86A 4OOFA 3DCYA 1YL5A 1SCNE 1C3VA 2XMSA 2E5FA 2GXUA 2QVXX 1T8UA 2QRLA 1IHXA 4DM3A 3NOOA 2RHMA 3IERA 1RBZA 4MKRA 3LVJA 5G2QA 3P0RA 3EIXA 4RJTA 1SK9A 4W91A 1O94C 3TLKA 1Y8AA 5E1OA 1O97D 4OJKA 4MCJA 4G24A 4E5SA 4OT8A 4AJNA 4WBXC 2EHJA 4MGHA 3LX5A 2IPAB 3AETA 2ODQA 4DIBA 3RFUA 5HK8A 1WBJB 1E1QA 4BNNA 3NT4A 4HX9A 2HM7A 1SVMA 4A8JA 2BWJA 3FOCA 3NIDB 3IOBA 2VOEA 4J0CA 4BKQA 4TTTS 1QP7A 4IV0A 4X1IB 1IY9A 2FX2A 1LS6A 4WV3A 3PE6A 4LBZA 4JF1A 4LYEA 4HEA1 1LPNA 5J4VA 4GX5A 1KI1A 1CUVA 2MWMA 5EAVA 2FW9A 2ECOA 2GASA 4QVKA 4DV7B 4I7EA 2O0HA 1E3JA 3U44A 1G8JA 5EFOA 5G1OA 2XZOA 1FFCA 4NICA 5ALLA 4AP5A 1BA2A 1T6YA 1ASMA 2W4MA 4CM9D 1D6SA 4F84A 3VR6A 2I6FA 1I1QB 4QARA 3E15A 5DLQC 3HCRA 1CDEA 4OATA 4J0FA 2FSIA 2NQTA 4D79A 5LZ7A 2AXPA 5H3HA 1HLFA 1UFRA 4EPWA 4Q9JA 2JGDA 2Z8XA 3LL7A 5K0ZA 4R2JA 4AK9A 3TTSA 2CD7A 3R7BA 4II7A 2CJGA 1DEAA 1QO0D 1T0JB 1HE1C 3WAGA 3UMCA 1YFZA 4NNPA 4WK6A 2BIGA 1GDDA 5E8JA 2XUQA 2OO5A 4BAGA 2IU4A 1OYYA 2YBEA 2ZDQA 4PQYA 1BIFA 2KHZA 4IXOA 1A82A 3BRWD 3S2UA 3HPQA 3PFGA 2V3WA 5HF6A 1RADA 4RCYA 4RK4A 4OX9B 1CQIA 4NNJA 3GUCA 3P0FA 2B8JA 1EXNA 1JZSA 2JS7A 2WVAA 1P6QA 2HIHA 1PJ3A 2C78A 1I2MA 2NXEA 3KJZA 2VT2A 3IKLA 3V4PB 1GN8A 3RGGA 4QM7A 5A9TA 3IUYA 2DJ5A 3SJ7A 1OX6A 4MI9A 5JRZA 4F8YA 3SKYA 3TKYA 1BXGB 1YIDA 2HWUA 2L69A 5JDCC 4E1OA 1C7ZA 2CUZA 4NH4A 2JFPA 2PHZA 1XDUA 4KVFA 2DFKB 1CLEA 4LHWA 2HUUA 1JHDA 4NNOA 5LOVB 4KSYA 4A2WA 1ZHFA 3E8XA 2PEYA 3VOMA 1AUVA 2ZYIA 3WBBA 3DEFA 4MYUA 3I52A 3UUFA 4MOWA 4EGQA 3T8YA 4FUQA 1NDQA 3BA6A 4QA9A 2PJUA 2HP2A 4HGPA 1DT5A 1UQUA 3HL2A 3V1UA 2Y3IA 3N8GA 5ERXA 2DXIA 4L8GA 3IDSA 4J1TC 4RF3A 1QYXA 5GVRA 2GMUA 1YVEI 4ZRMA 1SVNA 1NMQA 4L0OA 2XT6A 4D8UA 4CG0A 4NYJQ 5HKAA 1OYWA 2A1VA 3H5RA 4IGEA 2G4VA 2BKUA 1GYQA 4NTZA 2XXJA 3FUWA 3HBXA 1XCMA 4ZAYA 2D7YA 3FGZA 2CNWD 2XKAA 2O6HA 1E5DA 4UUNA 5TIIA 4AX8A 5EPOA 4K9NA 2PXAA 4GM1A 5K8UA 5DX1A 1SCAA 1A4XA 4BMCA 5E0OA 2QN3A 3WQHA 1II0A 1XC7A 4C4PA 1GNRA 1P0MA 4TZ6A 3E0QA 5HZMA 2P9EA 4CE6A 1V8FA 1PGQA 4HNUA 1J1IA 1WZCA 3CMMA 3DTVA 1D7UA 1FLVA 4G81A 4Z49A 4PX2A 4B3IA 4XJOA 1YB4A 4PICA 1ECLA 1FJ2A 1LUAA 3KVNA 1Z4NA 3ER6A 4FCCA 3T4UA 5A03A 4JLBA 1ZZGA 5SYMA 4CF5A 4NOKA 4MWEA 1D04A 2QI9F 2WWHA 3QM1A 2VT3A 3U44B 5DTJA 3N3AC 4I1VA 2AC4A 4KH0A 5M3BA 2GM3A 5LWQA 4IMRA 4JBWA 4LYFA 4ARVA 3R7WA 2QN1A 4Q9LA 5C5DA 3PGA1 1QFSA 1TO2E 1YUMA 1YZKA 1V5IA 3GD7A 1L5RA 1AX4A 4XWWA 4L5JA 5JYEA 4WYCA 4B87A 2V9ZA 4R1UA 2RK4A 2FMXA 1HH4A 3X43A 2B8WA 6REQA 4O4LF 4I9GA 1XRMA 2IP4A 2JGDB 4XJTA 1RI5A 2EIXA 4JP2A 4BLTA 4HAXA 1J8MF 3MCVA 1UXKA 2PX0A 1Z17A 4LSWA 5T4EA 5JFOA 4Q82A 3O4HA 2V8BA 2HK7A 3R74A 2ZRCA 2BWPA 3H3XA 1CQIB 2O23A 3Q10A 2QMEA 4LTMA 4TTVA 3JZIA 4TL7A 3T3EA 4RS3A 2Q8PA 3BFVA 2WFZA 5DH9A 2ZB8A 3QKUA 3G7UA 1T2UA 5BNWA 4BP8A 3S55A 5JT1A 1KGSA 1TIKA 2A9OA 1TQ6A 1KZHA 3HL0A 3MIZA 2QU7A 5IYZF 2HF7A 1IZ7A 1XQ9A 3IV9A 3BH6A 1TTPB 1IVNA 2VIAA 1OXUA 1RWVA 2XA1A 2OMEA 3ITDA 3AX6A 3RPEA 2YV2A 3K9GA 5EZ5A 3IV7A 2ZRDA 1H0HA 4JIGA 5C1DA 5AW9A 2QR2A 1B4XA 3S8YA 1A5SB 2ZAIA 2Z9VA 2R2NA 5EMLA 2QZ9A 3VR2D 2MIIA 1J9GA 2G1JA 4EHIA 1YFJA 4NSNA 3C2QA 3G7NA 4BKOA 3ROTA 1MGOA 1NR5A 1M9NA 2C2KA 4V0QA 4EFKA 2A1IA 1XBTA 3TNFA 2VMOA 1A88A 1RAFA 4C06A 2H3HA 3IXQA 5ECWA 3DC7A 5KSPA 4CM5A 1INLA 2X77A 2XITA 5CCEA 5CYPA 4IO0A 1XLUA 1UXOA 4F6CA 3C5CA 2XUIA 4I81A 1QAQA 3OD1A 4BLUA 2A5GA 3RBAA 1UT8A 5KTNA 1YZ3A 3TG8A 5FJIA 2B9EA 2L2QA 1L1RA 4FUTA 2FSSA 2G17A 1Z3IX 3DA8A 1V6SA 1E5QA 4ZI7F 3T7TA 1JBEA 4AKSA 5K0TA 1OY1A 1XZIA 2B78A 2EP7A 4B8YA 3GUVA 2WM3A 1TQ8A 1W46A 3LG2A 4S04A 1OGYA 4RFVA 2H7VA 2QTCA 5C3MA 1EWQA 1P7ZA 4HAVA 4B4KA 1N78A 1IXSB 3IR7A 3P5BA 3FZQA 3GMSA 1IXZA 4QQNA 1ORIA 1QNLA 4AB1A 5CVTA 5FEUA 3O8NA 3AIOA 4S0ZA 3D3NA 5IH7A 3F73A 3KYCB 4K2IA 2QSUA 5BYKA 2JI7A 2HRCA 3R7WB 1BRMA 2Z9DA 4DV3B 4AF8A 2Q07A 1JIQA 1XLWA 4Q93A 3H5WA 3I6YA 3I8SA 2FSPA 4KQCA 5H83A 4D9CA 3NJRA 4DDMA 1V2HE 2EGHA 3WSTA 2AKYA 3ZH9B 3V00A 1I32A 1VJTA 3MSXA 2VCEA 4B6SA 2ROQA 6REQB 2J4FA 1FQJA 1PVVA 1CUHA 2B35A 1DJLA 1DQNA 5FV7A 3AM1A 5HKOA 4WNCA 5K6AC 1JSXA 2GO7A 1IOVA 5FWNA 1RRVA 3F1LA 2QM0A 1JGTA 3GJ8A 4QG3A 3I8XA 2GZ1A 2ZY2A 1UP6A 5ULLA 3ZWNA 2DCUA 2D2FA 4F72A 2VXYA 4CLEA 1ZCZA 1W94A 3H5IA 1KMCA 1A8SA 4YP9A 2WDPA 3I45A 1V1MA 3SHQA 3EUCA 1XI2A 2QXUA 2P75A 3DJYA 3D8RA 4LY0A 4NPAA 2ZFUA 3DWIA 4JEWA 3ACZA 3HSYA 4JMLA 3M3HA 3G02A 4IDQA 3TD9A 2GPTA 1IQRA 4CMCA 1TMKA 1DAGA 2JAOA 4HAIA 1JG8A 1GV0A 2Q4TA 3FH0A 4TLLB 1JLLA 3DMDA 3FTBA 2PL5A 2Q3HA 4F1KA 3KQTA 5DCUA 1ECBA 1KI6A 1RXUA 3TB4A 1WXEA 4MA4A 4UASA 1U3FA 3Q4GA 1KVUA 3AVPA 5EP3A 5AXCA 3ZE2B 4I8IA 1ADJA 4F5FA 2IZZA 3W04A 1M72A 4J8PA 8OHMA 3Q6IA 2VYVA 2P3LA 4QPPA 4JDPA 1AIAA 4L4XA 2W6IA 1QF7A 3VXKA 2ODTX 4GOKA 2XHZA 2O2JA 1NBAA 3QE3A 1XZAA 1Y6ZA 3BULA 2GJKA 3HWWA 1ASAA 5JTUA 1X7DA 4OI1A 1HG1A 3CY6A 2CVHA 3CVYA 4ZPXA 3WWEA 2ZKLA 1OB5A 4LRYA 1ZD8A 3S27A 3ORSA 1WXHA 3ZS9A 5F7ZA 4TYMA 2VMVA 2JJYA 4RD2A 1GYRA 4GBED 1OASA 2DUWA 4CR8A 3M1AA 2EWMA 2RAPA 3OZDA 1X1EA 3TSYA 1CF4A 3AC0A 3AP2A 3T7IA 3TMYA 4Q4HA 3TXAA 4RK1A 2PNFA 4M36A 1U28C 1M6VA 4WNAB 4B47A 4CEJA 5ALEA 1Y34E 2MU1A 1K3UB 3UTDA 1AK9A 3BS4A 3KX2A 3Q0IA 3OSZA 4HB0A 4ZYYA 3UG6A 5IVIA 4PAGA 1ABBA 3WK8A 3FD8A 3TGPA 2PBZA 1IM8A 3CS3A 1SBTA 5LLSA 3K31A 1YJCA 1GPBA 2J3DA 3O90A 1G21E 2VHXA 1NFQA 1TKCA 3E18A 1RC1A 1AGYA 1NN1A 2FEPA 2JI9A 2ECKA 4B8ZA 4CW7A 2L82A 2N9UA 2ZSMA 4MGZR 1YE5A 4CG1A 1KY2A 2IE0A 3S2GA 4EGSA 4ZCMA 3PHJA 3WLQA 4G9EA 4O4JF 3NVDA 2EWWA 4NULA 2YXPX 1NBHA 4M0KA 4IF4A 1IPFA 3RKRA 2IH4A 3OQOA 1VE6A 1N9ZA 2PQMA 1Z0IA 3IP3A 4OYLA 1L9XA 5GADl 1NU6A 4U7JA 3GUHA 1QHXA 1I6WA 5FTMA 4GRAA 1RLJA 4IM7A 4ZVNA 1CSEE 1KAQA 3CQ9A 1NT4A 4BX8A 1YFLA 3UH1A 1P39A 2GN0A 4J7UA 3EI8A 2P3SA 1QRUA 1ZUHA 2D4HA 3D8HA 3GPBA 4ZDJA 2XLBA 3I05A 1E3MA 4IGAA 5EJ2A 3B60A 4RLHA 1CBUA 5K0JA 3AZPA 4FYPA 3CVXA 2JFBA 2E55A 3H1EA 2Z6VA 1V1MB 1YKSA 4OKNA 4ND5A 4L07A 5ILOA 3C3YA 1J04A 2QTRA 5I7UA 5BJ3A 4BNFA 3I3OA 5HNKA 5DNAA 5JDIC 1HLPA 1JEQA 1VE9A 4I4CA 3Q8NA 1PR1A 5M7EA 4N7RA 4DLAA 1IIBA 1PLJA 2P6RA 1Q1BA 3NU1A 3P97A 1R6BX 1EFRA 1L4NA 2NT4A 1PYOA 3BJEA 2IBMA 3M6IA 1JLLB 4W7HA 2CUNA 2VA8A 2JJGA 1P74A 4U8HA 1ZDMA 1SPAA 1GZSA 3QWFA 5AUOB 5DOVA 3AJ8A 1EVYA 3L0SA 4TS4A 4NI5A 1HBJA 2ZJZA 3BTSA 1RWMA 4M1EA 4RNCA 2FQYA 1C9MA 5HKBA 1O6BA 4MQLA 5E7QA 4ZEWA 4DDKA 4UEKA 4JEHA 5TDHA 4IW7A 1DXQA 4PXSA 3N07A 4RORA 4LGYA 5J5CA 1PFQA 3DFKA 4UVEA 4FMCB 2ZVJA 3WA6A 1I7SB 2WP0A 3G9QA 4KI7A 1B7GO 2H51A 3D5TA 3SP1A 2AFVA 3PGLA 4ZEOA 1PZEA 4DRYA 1I51A 1IZZA 5IKMA 4HF7A 3FUUA 2GK3A 5FP0A 4A0FA 2ONZA 4JEZA 1Y1QA 3O9VA 1QDEA 4XB6B 4LE2A 1ISSA 1U9IC 3LFUA 1M6VB 3U3OA 4CEJB 3IV6A 4RGYA 4JDUA 2WUEA 1FQWA 1C4OA 1HMYA 4EGCB 1R1DA 2E7JA 3PDBB 2WJ4A 2XD9A 2WY2D 2EFDB 4UXJA 2BGLA 4TTQA 5AI4A 2O5EA 3RROA 4B7ZA 4JLWA 3WMEA 1SUWA 2HOYA 5ALIA 4IDEA 4DR5B 4YYZA 4CODB 3TIVA 4PQFA 4KU4A 4DIMA 1KRXA 2QA5A 4V03A 4DIUA 2Q41A 1ZAYA 2VAXA 2X4IA 5I8WA 5DHSA 1JSRA 3HXQA 2J5RA 3C87A 5BWLA 4IXWA 4F0JA 3UYKA 3WDMA 4HXFB 3HDVA 3NAGA 4NFSA 4GKJB 4ZWNA 5AW4A 1U0EA 2XGMA 5DWDA 1IBRA 5A04A 2FXIA 4EFDA 4CDRA 1ULZA 1I7DA 3SQNA 5IH3A 8ABPA 4KQXA 4E3ZA 4ROTA 4LWZA 1T2AA 5JH7B 1EVIA 1T5BA 3VU3A 3LBNA 3OC6A 4JNKA 4BFWA 3E9DA 2YXNA 1UJMA 1H1DA 1NVAA 2OBNA 1EWYA 4CTJA 3CRNA 5K03A 2IDMA 5JAOA 3AEMC 5AM0A 2QG9A 1H2HA 4N40A 1AK2A 3AUUA 5CM9C 3SXJA 2J3LA 1GG8A 5J1TB 5FOTA 4G5OA 4DS3A 3CF0A 3GLUA 2JCBA 5FT8A 2Q9AA 2I1QA 1KMHA 4QDOA 1MABA 1JEQB 4BQNA 1AY5A 4LBVA 4MPJA 1CY2A 2ST1A 5C5CA 2H11A 2B9VA 4DIFA 4ZT7A 3RHFA 3DLAA 3GRCA 2XB6A 3ZCPA 4F3CA 1ZH8A 4G3XA 2FSFA 4BU0A 4LWQA 4BV3A 1UKBA 2QLTA 5HFNA 1Z2CA 1F9EA 1P17A 4UATA 1R6XA 3UK2A 2DY0A 4AZ0A 3N5KA 3ETLA 4NZZA 3FROA 3AESA 4WEOA 1J4AA 1HFJA 4RPJA 3AEOA 1EBUA 2ZB7A 4DGTA 4NU6A 3JALA 5JZSA 1PD1A 3L7IA 1YB1A 4Y2YA 4N82A 2R5CA 2FF7A 3A6DA 5CMLA 1XU7A 4R1SA 1SIUA 1S96A 5D84A 1AM4D 3H84A 3N0VA 3VZQA 1PX0A 1RI4A 1IY1A 2LVBA 1NKSA 4EI7A 4DKXA 1B9HA 5MFPA 3AHIA 2OXIA 2CH1A 5B57C 2XX3A 1KJIA 3SS8A 4U2FA 4S2EA 1TFUA 3HXPA 1GCKA 5JLJA 3G0IA 4PS0A 2PMFA 1QE0A 1YULA 2F1RA 2YZ7A 3E9ZA 4HPWA 1NYLA 4QOFA 1BJ4A 4N03A 2BJVA 1QFZA 1TF2A 5GY7A 1DFOA 2JRLA 4G1VA 2P0EA 2Z6UA 5FHRA 4MVJD 3BIOA 3AJAA 3D3JA 1BN7A 1YIAA 1U2EA 1NAIA 3NBZC 1FFSA 2BGWA 1IULA 3M6UA 4R2KA 4DVJA 5FOWA 1O62A 4IIDA 4AJHA 3GFBA 5JAHA 5E4TA 3WK6A 2FZGA 1TQ4A 2CUTA 5HSGA 2YIDA 4P9NA 1UBKS 2W43A 2OCYC 3NIWA 2AZTA 1E9SA 3QI7A 1ZC9A 1FDIA 5I9LA 4YCLA 4CM1A 5FULA 3RTDA 1JDTA 2FQQA 2X9GA 4HFJA 3ZI7A 4I9HA 5G0UA 4YQYA 4MDFA 4UUPA 3RANA 4GS5A 3W2HA 2YC4C 4J3FA 3OHMA 2N0SA 4Q1AA 3VTAA 3DHYA 2GHIA 5G41A 1Q44A 4AJ2A 4PSDA 1BJNA 4RL6A 2AFIE 3KTFA 2CC2A 2M32A 1KMHB 3BJRA 1U7WA 3ZU4A 1MABB 5DLEA 1KEEA 2YR0A 1T3TA 1NKVA 1H5UA 2WICA 4J0JA 1SZDA 3JZDA 5GTDA 3ITKA 1NI3A 1G1MA 4V0RA 4G1BA 5EIBC 3RSQA 4MSUA 3L4SO 2HLDD 4M9QA 2LTAA 4RVCA 3VSCA 3MBBA 4BQSA 5BN5A 1S02A 3QHXA 1I2ZA 1AF4A 4RX1A 5HM6A 1UEIA 2JRCA 2WJWA 2BD0A 2K2WA 1GEXA 4KMSA 1C3XA 4AZ0B 3DG9A 1AGXA 3O2QB 2DUNA 3DBIA 1U2QA 3AB8A 3V2GA 2YKVA 3CXUA 3MTAA 1O5IA 5JNLA 4AWBA 1ENPA 5DPMA 4D42A 4Q47A 4WQMA 5JI3E 2HJ9A 2ORVA 5CLIA 1T5OA 3JALB 5CJPA 4EGAA 3MF4A 5L3SA 3BYZA 3AF0A 2G5GX 1E5XA 2C0RA 5KS2A 3TIIA 2R5CB 1H5NA 3OLZA 2ENUA 1AMRA 3WS7A 2D2EA 3G5TA 2WTMA 4HMQA 3EW9A 3E5NA 4HVCA 2AR7A 3RIYA 4E13A 5ALNA 3LDHA 3P27A 1N2CB 3U3RA 1Y8QA 4L4RA 4NXMB 5H80A 4L7VA 3AL2A 1J49A 3OCUA 2JFVA 4A6RA 2P9FA 1OX4B 2YKYA 5CK5A 2HF2A 1WKVA 2R0QC 1EG7A 1WG8A 4KG7A 1CK4A 1ISFA 1W6UA 3PE4A 3G0CA 3HUUA 2IP2A 4NE2A 1IAVA 1ARSA 2WT8A 1ZOLA 4FS8A 2WSSA 4WH0A 3Q1LA 2P35A 2GF9A 5J5AA 5IDYA 1YV9A 1JG1A 3LL4A 4OI2A 4LY9A 1ZR2A 1HYEA 1SVIA 3K05A 1ZISA 1KQFA 4NJEB 1DINA 2PX6A 1T3IA 1JPNA 1IXYA 5JCPA 4ND3A 3CSSA 3B2QA 2H9YA 5I9TA 3TFTA 1MLYA 1W30A 1H4TA 2H1FA 3DF7A 4JUBA 3TZLA 2CV0A 4DCPA 3ZX4A 3VHLB 4TMRA 1WMAA 2DSNA 4ZEMA 2V8OA 2R8YA 1O4WA 3U0VA 5TMBA 3I5XA 2Z1MA 5BMVA 2FWMX 1N5RA 3TI9A 2C31A 5HF8A 2HI0A 3QJGA 2QJFA 1N7GA 1RAHA 1IHYA 5SZIA 3S3TA 1TYAE 5JXWA 3K8YA 5IABA 3DT8A 3ZCQA 4YRCA 4OBWA 3ZWAA 4UHNA 3LPLA 5FI1B 3U9LA 1PLLA 3TFOA 2ZWAA 2IDZA 4R5ZA 1V5FA 1NF2A 2XVAA 2D6FA 1WUIS 2MSWA 2F90A 1IYZA 3FDJA 1YRWA 2GCIA 1D0IA 1LBEA 2CTZA 1U7PA 4EYSA 5TF4A 1STOA 1YJBA 5KVAA 3JZMA 5HGJA 4YAEA 4IRMA 1JW9B 5EE3A 5CT6A 5C31A 3QKTA 1FTYA 2GYWA 1E7WA 3FZEA 3QE0A 3OTGA 4NL4H 1UODA 4P36A 5BQFA 4ZXFA 4HUTA 3CH5A 5HYVA 3OY2A 3O8CA 3KV3O 2XJ9A 1BMQA 3M1IA 4YRMA 3GZCA 4CIYA 1T3ZA 1T1EA 1XO1A 2VS1A 4ISCA 2XCTB 1DKAA 2YMQA 4OTLA 2VK8A 4IWXA 5ICEA 2YFHA 1II9A 1K6IA 4LGCA 2QD3A 2IXAA 1H8HA 5BN5B 2QMHA 1NQTA 4J9UE 5L40A 1DKNA 1LA2A 3PLRA 2J9ZB 4WCFA 1GGHA 1YKGA 2EBHX 3KFLA 4YDQA 4M4SA 2QLNA 5KO2A 1Z0FA 2CLCX 3QBEA 4FFOA 3AM4A 1EJ0A 2DQSA 2QM3A 1G42A 4NYMR 5JXJA 1WCIA 3FMGA 3ER9A 1ZO8A 4JASB 1D6MA 5J3JA 1XNQB 1GD9A 3F0HA 2O1EA 3GXBA 4B73A 4UE2A 1SRRA 1V8PA 4NFYA 4BFXA 1E5VA 1P3DA 3H42B 3FVSA 2IX3A 2J4CA 2QRQA 5AVWA 1Y8RA 3QX7A 3WQRA 5BV1A 2YWEA 3HY4A 4YC7A 2L19A 1GSHA 1Y8QB 4LF5B 4IILA 1W96A 3NNNA 4XWYA 1NLUA 2YWGA 2OTCA 2XVYA 1EGAA 3TKAA 3IMFA 4CCYA 2A9PA 1U8TA 1PNRA 4M8SA 1E1MA 2ZCVA 3QLVA 1KNQA 3I9V1 5LM3A 1KSJA 4YAJA 4EPTA 1U6JA 5DX5A 1SUIA 2BF4A 2YJTD 2FPWA 2XMZA 1P75A 3AMVA 1U1GA 4QLOA 2PA3A 3EA5A 1PSWA 1IZYA 2OSVA 4WERA 3KKQA 1E5TA 4FU0A 4IVRA 1V1JA 3CNOA 5T64A 1J9EA 1RYDA 5BUQA 5IJ9A 2M1ZA 4DY6A 2QE6A 3UHFA 1WZIA 2IOFA 5PNTA 2FPPA 1C7NA 3E2PA 2IZ1A 4RABA 4G0WA 3LQRA 5HOEA 4N3CA 4LNUB 4E2XA 3LQYA 2WA2A 4K40A 1Z39A 2YWXA 3BMOB 1AMUA 4KMMA 4BX3A 4XGQA 5AKGA 4UTNA 5FOSA 4P38A 4ZIRB 5BMVB 1T9BA 1KMNA 2IIVA 3JYLA 1VYTA 5SY4A 3RSLA 1YJAA 1WU7A 3TFWA 3PCRB 4AQYB 5B3LA 2BRUC 4G84A 1QH9A 1VM6A 4JJ4A 3WNBA 3REOA 4DUZB 3SKXA 4Q76A 2ZS7A 2R5EA 3F6BX 3HP4A 4I99A 4OA5A 4YWHA 2C3UA 1ZHHA 2ZYAA 3UY4A 3ULKA 4PZZA 1AN0A 3WLAA 3WGIA 1U8AA 1XDZA 3PGYA 3FNQA 1HXHA 5F2EA 2E4ZA 5HHTA 5DHUA 2ID8A 2HJWA 1JFSA 3MAFA 5T6BA 3FHCB 3NDBB 5JXHA 2ZT6A 4P53A 4XYMA 5AJVB 3KEQA 3KT0A 5KYGA 3M5UA 3AUTA 1O95A 2L18A 4L6IA 3RK4A 4BO6A 2PKCA 1IH8A 4EWLA 1T2NA 5JQGF 4UTPA 3FF4A 3I9OA 4JLNA 4R6XA 4G4IA 4PX3A 2PB0A 3BCBA 3H5VA 2M6KA 1Q3KA 3ABZA 5FTLA 1EX9A 3ELWA 4WCFB 3I58A 4H1HA 2ZXUA 1ZM9A 2WTEA 5HMLA 1B0AA 1FP7A 3K9WA 4MZXA 3KZMA 4G25A 3G2NA 1WCIB 2Y66A 1JHPA 4NCNA 2OCGA 1UT6A 3BWXA 1BHQ1 1RZRA 3VZBA 5CVCA 2VMUA 1WMDA 3R40A 4FHZA 3RAJA 4N9WA 1SHKA 3W3AH 1NU8A 2CDNA 3WBJA 2VPZA 1KI2A 5A2GA 3HN2A 4BV8A 1Y8RB 1NUPA 4WKCA 1SCQA 5AMXA 2JFYA 4PY2A 3LQQA 4YMVA 3ZCVA 4QXPA 1ONPA 3UMGA 2EZ9A 1Z26A 2C59A 4D4KA 3PNYA 2RJNA 4CCYB 3MMXA 1RLTA 4U7FA 4PC2A 2QE7A 1FFGA 2XJ4A 3PR2B 2DT8A 3B6IA 1K7YA 1J2RA 4WVFA 1HQKA 5EUEA 2E1PA 1E3WA 3NU8A 4TLAA 1MP0A 4D0RA 2VCYA 4RAOA 3W6ZA 3INRA 5C52B 2GWHA 4V0NA 3IKJA 4RPCA 1FUUA 2BTEA 1ENZA 4D57A 5IJ9B 2QENA 2WUGA 2YVQA 2C5LA 5KX5A 3PKZA 2FPPB 4PHGA 1SXGA 5DIZA 3LYUA 2P65A 4F06A 4GU5A 2LIVA 4AUKA 3EZSA 2E4UA 5B7NA 2VWHA 3LW8A 1OSNA 4KJZA 1DHTA 3O2JA 3REQA 1BVHA 1VDZA 4FR2A 5K0EA 3AOEC 3KKZA 3O73A 5IDXA 5FPPA 4F21A 3KBBA 4JT8A 4K46A 1KO7A 4OHYA 2AG5A 3WHKA 3UMFA 3VMMA 4RTNA 1ZA2A 2QQ5A 2CJYA 3RIEA 3B1KA 2J3QA 3KYJB 1OXTA 4B2LA 5FBZA 3K96A 1YDFA 3NS7A 4D2IA 3AB3A 4DLRA 1NW4A 4BNUA 1AIPA 3I73A 3FDIA 2GARA 2CJFA 4EYGA 2WG1A 4C7XA 3QLJA 2FEXA 2JLCA 1YT5A 3MAFB 4CF4A 3WIEA 3PGJA 2X0FA 2OE2A 1PJBA 3HE3A 4GP6A 1H9AA 1YS1X 4LC9A 1BOFA 1YE3A 3LXMA 3JD2A 2H2IA 4RNDB 4PYOA 3CZMA 2F1KA 3VDXA 4PWZA 1CIVA 4CDGA 3KQUA 4XTRA 3ZVKA 2PFSA 4YCJA 4H4EA 4H51A 3PENA 3E05A 2J3JA 4JOSA 3O8DA 3GPIA 2XMCA 5E6SA 5KYWA 4IHJF 3FGNA 2F8LA 3GG9A 5DXAA 4OXXA 4F71A 1BMFA 4XD7A 4BJ1A 4P92A 1SC9A 3LF2A 4P3YA 5IN5A 5C8YA 3KAQA 4RJ0A 2WUVA 4D0SA 1X0XA 3PDJA 4ZLVA 1AE1A 1QDLB 3E5MA 1OXOA 1B0PA 4A16A 3PCTA 1T9AA 3KLPX 4KEAA 5TS3A 2VPQA 5EVJA 3DOEA 3A0RB 3DOIA 4R2LA 4ARIA 1EVKA 3FYTA 3QLEA 1TEHA 3KPVA 2CFCA 3GOQA 2V98A 3RIHA 821PA 4FIDA 5F2NA 3PTAA 4OBBA 2J5XA 3HNPA 3P0JA 2PSEA 1QJ4A 5JAZA 4TYYA 1IQUA 2HXGA 5AW5A 4QEDA 4JX8A 5CDFE 3DOOA 2GS9A 5L9AA 4RF5A 3C3PA 2GJSA 1C7RA 2OYSA 4C3OB 3B9BA 2AXNA 1BFUA 2FJUA 3HUFA 1IOLA 1UBCA 5DW0A 3Q7PA 2A9KA 3FGOA 2Y68A 4UAGA 1E3WB 5EYPA 1R6TA 4BMXA 5DKFA 4BQRA 4H6WA 3OC0A 4Q4DA 4IDHA 4G5SA 3M3DA 4IQ0A 2HREA 2AY8A 2VP6A 4ENPA 3KLNA 4E3RA 4L0MA 1H2XA 3GPLA 1E2FA 1N2SA 3C48A 1QK5A 3AK4A 1DRVA 5EEGA 2F3TA 1J8YF 1Q0ZA 3A6LA 3IELA 2WM8A 3OCZA 3BB4A 1ASNA 3ZV4A 2WKRA 1B8OA 3D0KA 4GPD1 1RXYA 3B3JA 3UH0A 3KT6A 4GL4A 3RHSA 2WMOB 1Z25A 3RAGA 3REQB 1X7ZA 3U6BA 1UCFA 4YQFA 4CMHA 1B0ZA 1N6OA 5F4ZA 4CGYA 2OHVA 9AATA 3EIHA 4KXMA 3EVAA 2PFGA 4YREA 2VMRA 3PU6A 1BDIA 3RJTA 3RKUA 3FLAA 4U00A 2VBFA 5DMXA 4YIKA 5DISB 1RCUA 4WVLA 4PSCA 4OI0A 2TPLA 1SVWA 1XQVA 4AN1A 1IHOA 1JPJA 2P9BA 2QRHA 2PUFA 2DWOA 5K05A 5DZSA 2UV8A 1E58A 4PXYA 3A4TA 3OFSA 1DQRA 3Q40A 3WLMA 4ZV4A 4F4EA 1PSDA 2QP9X 3ZK8A 2HZBA 4LBYA 4E7PA 4KH1A 4CUJA 1NVXQ 3C85A 4OGGA 1RCFA 3I3SR 4KK4A 4C4OA 1YVUA 4M3NA 4BBJA 1CZRA 3LLMA 5E6SB 4JSRA 1N0WA 1N5JA 2WSIA 2RH9B 5KYWB 4TQ9A 2ORED 4L73A 3PUZA 1NHWA 4QD3A 3IIEA 2WMDA 1C8VB 2ODEA 2PO7A 5C8YB 5T67A 4E1BA 5AUNB 2WHRA 4U3JA 4AJOA 1EWTA 5EMJA 4KL8S 3I5MA 1P0CA 3MUFA 3K0BA 8AATA 1R3DA 4JJEA 4IEFB 2R6CA 2QB3A 2XTNA 4RZSA 4K8RB 3CLUD 1ETHA 1O6ZA 3HCDA 4Q7LA 5J2TA 4PLFA 3VK4A 4FDMA 5CEFA 3CR8A 1H6DA 1G6KA 2KQUA 1Z6TA 3IB3A 3FGPA 3CX8A 1YR7A 2PL1A 4W1RA 4M54A 3OPMA 1Y8ZA 4IY7A 4HCJA 4GAEA 3SXPA 3OTIA 2IV2X 3QFFA 5IEBA 1SO8A 4FFLA 2ZYTX 5JD4A 2AJ8A 1Q12A 3GA0A 1XLTA 1SKUA 3C6BA 4BO7A 1L7EA 1G4HA 2VCHA 4PPNA 3GYGA 3BGVA 2ZRFA 4D0LB 5EYPB 5IS2A 4N0QA 1P1IA 4RIGA 1R8XA 1PTJC 2XBUA 3EX7C 3GLFE 2Y0PA 1D4OA 5JAIA 4UOYA 2P2SA 3AETB 2IHBA 4J0DA 3FQAA 2C8KA 1RWPA 2OG2A 4KODA 1PBNA 2IXBA 1K92A 2YJGA 1KYTA 3FSEA 4IFIA 4A8JB 4DJTA 1GTZA 4JLDA 5ANRB 2BGRA 5I4KA 2GPNA 4DTIA 5ELLA 2X0IA 4OHKA 4D7AA 3UGJA 3LU1A 4JC0A 4HTFA 4AW9A 1NSYA 1X7ZB 4JI2B 3ZXUB 4UBOA 4KXWA 9ATCA 1T1RA 4NV0A 2V7WA 2C20A 1G2QA 2QL6A 4M89A 4DB2A 4FFSA 3IQIX 1U65A 3T5CA 3ELEA 1QORA 4YIHA 1J8VA 4NF2A 1UPXA 3HJUA 1BVUA 4PYIA 1DI0A 4QTUB 5AK0A 3K70C 3FYHA 1GADO 4YROA 2BE9A 1VMIA 4HRVA 2NG1A 1PMMA 1Z3CA 3RRFA 3EEFA 4GP9A 1ZKDA 4NZYA 1MPTA 1J5XA 2CHQA 4WL0A 2ZY5A 4I5FA 1QGYA 3WGYA 2C3MA 3AVTA 1LX7A 1NR7A 1VMAA 5G1PA 3BDAA 1P4JA 4HVLA 3IAHA 2QBTA 1DJMA 4MVJF 2H4ZA 2FKAA 2QPTA 3EZ1A 5DM60 4A2QA 2JG2A 2Z3WA 5K20A 2OVFA 1UIRA 1EZ4A 4NBKA 2H65A 4X92A 4TWZA 2VP2A 3EZXA 3OM8A 1DVRA 4JBNA 5CIYA 3RSSA 4HJRA 4QULA 2KW5A 2XWJI 5CFOA 4K9KA 3I2KA 3UMVA 4IYRA 5CYGA 5JSQA 2VMYA 3BCUA 4IJQA 1MC1A 3BXPA 3M1YA 4MXDA 4JYZA 1JQ5A 2E89A 5CW1A 1ZSVA 3FF1A 2GN4A 2Q29A 4E5UA 4B3FX 1S2IA 3KVRA 1FYXA 4HWRA 2AN4A 4IXSA 1EH5A 2EW2A 2YRRA 5BN3A 5TX7A 1JP7A 3ZE0B 2ZYRA 3IAXA 3JYHA 5AM3A 3EE6A 3FZ6A 3UHAA 4UULA 2GDZA 2Q62A 2ZIAA 2W8VA 2Q28A 3LOQA 2Y9PB 3MMNA 1KPIA 1NZJA 1EGMB 5J2TB 2ATVA 3KALA 1B8NA 4OIMA 1YDWA 1DFHA 4FGJA 3FCYA 3G8BA 4A03A 3F3MA 1FUYB 4BPRA 5CYOA 4P3PA 1FNMA 1U2GC 4HZIA 2OB2A 4PZYA 1U4SA 3X1WA 3O8LA 5FBVB 4ZQFA 5EJIA 1UC5B 2IV7A 4EW6A 3IP1A 4DLBA 4LGMA 3FMIA 4DKJA 3ISTA 5J5VA 3ZNNA 5A0VA 4Y2QA 4YJDA 2BVNA 4KWHA 4XB1A 4HLDA 3WOVA 1J0DA 3ZZTA 3ROXA 4OJTA 3GFRA 4O5AA 3FOEC 3AVOA 3HBAA 1U4NA 4TXJA 3AEYA 3CLSC 1U8FO 5WRFA 4TUYF 5JRJA 2I6QA 2QZ4A 4WB0A 2OAEA 1YIZA 4QGHA 2C4HA 3U4AA 4IDGA 3D6JA 3ECSA 2YY5A 1CY7A 1VLJA 4HR7A 3DTVB 1RRFA 3IKTA 4CCAA 3DYVA 1NOKA 1HQYE 5JS1A 3NNSA 5C2JB 4NU5A 2ZUWA 5FPQA 3ZU2A 3D8NA 4I5GA 3PQ5A 1R74A 4OHZA 1Y7LA 1C0EA 1R88A 4A0HA 1BW0A 3JTXA 1DQPA 2LE0A 4J91A 4HTFB 1RMYA 4JV5B 3JQRA 1B00A 1PR3A 3SCZA 4D74A 1VA4A 3ST7A 1P0FA 1KPHA 1JSCA 2QYTA 3O82A 2PL3A 1HFEL 1NNI1 5CA1F 4OJYA 3K9HA 3DB1A 1CC1S 1I4LD 1WULS 2CYBA 4NHOA 1UBHS 3WCOA 1CP2A 4IR7A 4OI4A 1N2BA 1SIBE 3NRBA 3ORHA 1OI3A 1LRKA 1I29A 4Z4GA 3T7AA 3FYUA 1D2RA 3TL3A 2C42A 1ODKA 3KWJA 4RK5A 1CY8A 1M8JA 3NEAA 4FHCA 5BWBA 1DUIA 4D81A 2A5LA 3CYFA 1Z0KA 3W9YA 2OOKA 1D4ZA 2JJ8A 3OCWA 3T3DA 5KREA 3E48A 2HO4A 4M2KA 2XODA 4L0DA 1XTRA 1FTNA 3N76A 2XKKA 4JXZA 4YP1A 4DBVO 3HGMA 4DA0A 2VQ3A 2F64A 1SVOA 3IHLA 4M0MA 1LF5A 4V24A 4ZZ1A 1ABEA 3PITA 5AHKA 1EUZA 1KZ9A 5J9FA 3DXVA 5AJYA 4L5BA 1DIBA 2HFJA 3QJ5A 3LX6A 3VU1A 4AJ9A 3TECE 4N5LA 4XWOA 1CS1A 4EMYA 4O2AA 4FYHA 3WMWA 1EXDA 1ZSNA 1OLSA 3KGXA 4PIPA 5C5EA 5BN3B 3A9RA 2RARA 1LC0A 5JATA 1YR2A 4LSZA 2GZ3A 4LXYA 3BAZA 3W1HA 1YQGA 3AR4A 2GPYA 1FS5A 2NX2A 1X8XA 4DAEA 2IS6A 5C4GB 5K6TA 2OO3A 2IYRA 5KKNB 3H4MA 5BUSA 1EFHA 3VOTA 4KAJA 3CR7A 1OYOA 1JAYA 2LV8A 2QLRA 2XCLA 5FADA 2R5FA 3NHBA 2Q46A 4H77A 2WB2A 2Q9UA 5A4IS 1YDMA 3O1HB 3M6XA 4R2MA 3ZNPA 3I30X 3VDRA 4KVAA 2RE8A 1WOYA 1RI2A 1RACA 2XNCA 1E2PA 5IM4F 2H3EA 1JNXX 2CFRA 3SJAA 4PE5B 4B4UA 1CL1A 4NDAA 2ERXA 4MUGA 3F90A 4CM8A 5G3YA 4QTYA 1CQXA 4IH9A 4HNAA 4J7CA 1G66A 2ZZMA 2C0QA 2R8XA 3HB5X 1XG5A 1SOUA 5F7JA 5IWQA 1VP4A 4WB0B 3V32A 2XNDA 5FYDA 5KYVA 1EFUA 2R751 3FW1A 7ADHA 1EPUA 1VCNA 5HTOA 3LWNA 1ZONA 1P0QA 2Q5IA 4YHHB 4FJ2A 3TLBA 5SZJA 1RI3A 3G0OA 4ZEXA 1GRVA 3TTUA 3QA3E 1VCIA 5AUPB 1WSWA 3ZRQA 4JMPA 3RT1A 4WXMA 5A5FA 1R64A 1E96A 3NC0C 2H6EA 3K2EA 5AVOA 1N7HA 2O19A 1KPGA 2VBIA 5IBRA 4B9BA 1UDXA 4GE0A 4FOLA 4X63A 4LRSB 2XDQA 2I4LA 4BFUA 1XJWA 4FX2A 1OFUX 1ADCA 3ISJA 1VEFA 2Q3LA 1GL6A 2RJOA 4I08A 1MIHA 1ISPA 2DBZA 3HKCA 1IK6A 3JR7A 1Y4ZA 1DCKA 5D85A 1NXWA 4QJBA 5F5LA 3SPXA 1XMSA 1VSQA 3KYDA 2I5PO 2VYQA 4L5AA 3G88A 4IX8A 4OAQA 3MWKA 4PPFA 3F67A 4M1ZA 3GROA 1M0EA 3OO1A 4MVWA 3M83A 1X2AA 1HDRA 4G56A 4ALMA 2CJHA 4C9BA 4OAOA 4MVXA 1DU4A 5J8QA 3E2FA 1LV8A 2CJWA 4HATA 2PEZA 1A3CA 4DLKA 3LVQE 1TOAA 2ZT7A 1QAMA 1OTYA 3MJEA 1TPYA 4U2GA 4X91A 4ECAA 3IJ5A 3CN7A 2P2NA 3BQNB 2Q4RA 4U6NA 3VKFA 3F1KA 4TT3A 4HBGA 5B4TA 3AJEA 3E6AA 1HURA 3GNLA 2VI8A 5FUBA 2V7UA 4UAJA 4PN3A 3PJ0A 1DCMA 1RYYA 3EH2A 4O2AB 5JBQA 3STHA 1Z2NX 1OLSB 1XT6A 2FHPA 2MYPA 3HDHA 1DKPA 4BEVA 2NTVA 1EP1B 1KI6B 5CHEA 2EFGA 4AZTA 3JZFA 4EA9A 1ANKA 3L4KA 3NH9A 1EB8A 4YN3A 3C15C 1LFAA 1GDHA 1LKCA 1UWLA 4I1SA 4XI9A 4G0VA 1VKRA 4PWYA 1CV2A 3EGWA 3RRJA 2OBMA 1VLZA 2A9QA 4L51A 4Y67A 1PJ8A 5IAKA 2C2YA 2QTGA 1W4LA 1SZUA 3N8IA 4ENQA 2FVYA 1XEXA 2O8FA 3RRMA 3SU8A 5M04A 5EFSA 1IG3A 1YF3A 3BIFA 2O2YA 3VHXA 4HNAB 3UJBA 3NONA 3FTNA 4IFBA 5BRAA 2VMZA 4LK2A 4HHEA 2C8JA 3WL6A 4EHAA 1OPXA 4YUAA 4Q4HB 3ZHSA 5CFQA 4GX1A 1HE8B 4XA8A 4DLWA 1SHTX 2OORA 3UB3A 2QG4A 3WI7A 4LX0A 4G5GA 1EJ6A 2I3DA 3G59A 2GJ9A 1Z36A 2H4YA 4GBJA 4JEMA 3UFXA 2J67A 1KH2A 1GLNA 2F59A 1QYIA 1EFAA 5FPYA 2FH5B 3OU6A 1P4AA 3PG5A 2XB4A 1OAOA 5D3ZA 5L3RA 5AIBA 4HFMA 1W2GA 5KYKA 3ROGA 4KKVA 1WP4A 3SHOA 1V6AA 2XDQB 1FU8A 1WTAA 1JR3E 4OTZA 4X20A 4IXZA 2ZIWB 5I8PA 1QTRA 4QYIA 3ZE6A 5LQJA 1Z4LA 2NUAA 4QDXA 2H4WA 3JQPA 1UEJA 3RODA 3BD9A 4RO0A 1ABFA 4J75A 4ZU3A 1MAPA 1ZJ5A 3KYDB 5TGTA 4BC1A 3EB9A 2FDRA 1JS3A 2VZ0A 3C7CB 4IIBA 1DOAA 1EFRD 2ZUEA 1V5WA 1BE0A 2Q4BA 3QV2A 2ZJFA 1JHOA 3BGOS 2O8DA 3N28A 2HRZA 1CR2A 2X5OA 3MN1A 2ECFA 4KQFA 5IJXA 4RSGA 2LDBA 3KTDA 1O58A 1N75A 3ZV6A 3QWBA 5C1PA 4P84A 2CJWB 4HQRA 4MW1A 1PEDA 2WZBA 1C8KA 1L5LA 1P91A 2XWPA 4ZQEA 3NWPA 4WLEA 1PUIA 4ZCPA 4AECA 4EA7A 4BRZA 1I0LA 3L9XA 1KMQA 4CKCA 5DM2A 2VC2B 4B76A 1DLJA 4ZC1A 1WMSA 8GPBA 3CEAA 1JG4A 2QT9A 3T9DA 3B6KA 3B1JA 2BP7A 3E2YA 3BEOA 2Z5VA 1TQ2A 2ZR9A 3BPSA 3K6SA 1ODSA 2GBIA 4ADSG 4F8JA 2UZ1A 3CLVA 3PRHA 3D1VA 2W6ZA 1FZTA 5K3FA 2EBWA 4RPKA 2R6R1 1FJGB 2HOZA 2MCFA 3EZGA 3ADPA 1ORHA 1Z9BA 1J2UA 2ZSKA 3QZUA 5I92A 3R9KA 4L4ZA 2YV4A 3DGEC 3O4FA 4XOIA 3D5EA 3G49A 1J7KA 3DGFC 5FAKA 5JC8A 4DEYA 2QUZA 1UPTA 3BM5A 4MA0A 2E2WA 3L8FA 1KDYA 3RWMB 5LP1A 1ZYUA 4RVOA 1CJTC 2ALJA 1XEXB 2O8FB 4LZNA 4JVLA 4MMYB 4MW0A 4YMGA 4B7UA 1ZRHA 1KFCB 1J8QA 1IUNA 3M6MD 4GYJA 4D25A 1XEAA 4N47A 1MW8X 5CT4A 1DADA 3MJSA 3ISLA 1F0KA 3UGQA 4A2PA 2QR5A 3L8ZA 2X0DA 3WZLA 3IUQA 1QBGA 2BFMA 4GECA 3BK1A 2FWIA 5GIPE 3IMKA 1KY4A 2ES4A 4WK0B 5FTNA 2Q4EA 2A78A 5DGHA 4DDUA 1O1YA 4MP3A 3UFXB 1WXQA 4OSPA 1VIDA 5BW4A 5DX8A 2AFHA 3WB1A 2J46A 3WWZA 4AY5A 2PWAA 5HM8A 4UMEA 4F9TA 2JI8A 1GILA 1OA0A 1XV5A 3NP7A 3EAGA 4PM4A 3TBHA 1E64A 2A3RA 4D6PA 1JHVA 4X20B 3AQIA 3GFPA 3B2NA 3GIWA 4EI2A 1WZ2A 4QYIB 5IWAB 1Z7WA 3T3NA 1E3IA 4EIWA 5LXTA 4YJ2F 1T0IA 3EPKA 5K0GA 3H99A 4A10A 1NATA 4ZI5A 1C3OA 1XR3A 3MRVA 5F78A 2GCPA 2EKBA 1XZLA 4PZLA 3GHHA 3TLEA 3E9YA 2W2TA 2PDAA 4XDGA 3PSAA 1XAGA 3DAFA 4FX5A 1ZOBA 4Y6QA 5KQMA 2O8DB 2VP0A 4DANA 4ZV7A 3BORA 3COVA 3ESZA 1WB5A 3ETDA 2ETXA 2XDWA 4NC9A 4KC0A 2XMRA 4K7JA 2OYCA 2WZQA 2CHFA 3HM2A 1EK2A 1P2DA 4OMUA 4LY3A 2OCBA 2WIAA 4HGNA 5IULC 4ZCRA 3EI9A 4WXHA 4UDNA 3U4HA 3MTDA 1C3JA 3IQGX 4EW2A 4QC2A 5AI0A 4CKCB 1ECJA 4UFOA 5M2QA 4O0MA 4KO3S 1ZC4A 1ATIA 3CCFA 2ERYA 1BRTA 3CLTD 1A2OA 4LQCA 2VMPA 2G9RA 1AA9A 3K73O 3QG5A 4C4SA 2DKOA 1DRKA 3U5TA 3L18A 1OAKA 4BFSA 2UZ1B 3A7EA 1XF1A 2DPGA 2F17A 2FJ0A 4WUTA 4RJLA 5K3FB 4URFA 4W5WA 5JSYA 2HPAA 4FFPA 1E8DA 1K2VN 3LC7O 3KHKA 3VUFA 1KZ1A 4QZVA 4UE6A 4H15A 4C7MA 2X1VA 3GUYA 5IZCA 3AESB 5LOVF 4G4SO 3AZOA 1X87A 3NUQA 1KAOA 3LS2A 5FFMA 2F8JA 1GZ5A 1LC5A 2ZWVA 4BO2A 3MS2A 5A02A 3N2LA 4QOGA 2OB1A 1WHTA 5ADVA 1ZN8A 2Y93A 1AHFA 3QY0A 4CCWA 1V3QE 3ROPA 3RW9A 2G5CA 5SV2A 2B82A 2IOHA 1OW3B 3URMA 3C7AA 4KLZA 4RZ3A 3KHUA 2D5BA 4LN1A 1Z83A 2X5NA 2VATA 1Z12A 1P9NA 5HKKA 5CH3A 1F5SA 3FCCA 1BMDA 2ZETA 3BRQA 2A1TS 4KXXA 2P6MA 1U3VA 3T5GA 3QUSA 2DR1A 2JEYA 1Z2OX 5I4CA 3T06B 1GD1O 4L9SA 3GNTA 1PR4A 3P4UA 4RM1A 1E9EA 2AWNA 1RJGA 1R4AA 2AFHB 2BI1A 3R3UA 1JT2A 3M33A 1PR5A 3MGGA 2H48A 4C2UA 5LMCA 2E7UA 3C4JA 4BP9A 2VJAA 5JJ5A 1M67A 4P0PB 4LOHA 1O08A 2OMKA 5G4KA 1ONSA 2IYSA 3TSAA 1N6LA 3OLWA 3AXSA 3P9CA 4JUCA 2C9YA 2W8BA 1VSTA 3ZBQA 3GNQA 1KF0A 5LXTB 3EDQA 2OPHA 1H6AA 1YQQA 4AULA 1IN1A 4PTLA 1C3OB 3PPYA 4W1PA 1LXCA 2WD8A 4QU9A 4CQJA 4PX9A 1BQAA 2B8NA 2NMPA 1BT4A 2FK8A 3CTMA 3W5HA 3EODA 4BJHB 3BX1A 3C41J 2WHQA 1S8FA 2VQ6A 2BEUA 4DTCA 3G5MA 1NP6A 4K6FA 2C2HA 4RKYA 2YOBA 1S1MA 4JLAA 1ZD9A 3NBAA 1SFFA 1JXQA 4LY6A 1VI5A 4FFBA 4RSRA 3C6KA 2OHOA 3V7YA 2ZDHA 1P44A 1TECE 5HBGA 1ZW1A 1RYZA 2SKEA 4UPEA 3PE3A 5KNDD 3EFHA 2ZP7A 1YI8A 2R9VA 1KEEB 2GNOA 3U13A 3PXBA 2EX4A 1E7SA 1JDUA 5EQFA 1RTKA 3H05A 1ZOSA 2Y1EA 4PIMA 5TPZA 1D6JA 1N5MA 3IBCA 1FFAA 1T8RA 1Z7GA 4HOYA 3QNMA 4DG8A 4MLZA 2E0IA 5CDSA 1IBKB 2N42A 2C84A 3B5EA 4J9VA 3E4DA 2IHKA 3FAKA 3MLEA 4CMJA 3UA3A 3H9BA 4P3NA 2POQX 4MUBA 1LTHR 2H17A 4LZZA 3QI6A 4UMFA 2WSSD 1JTFA 2PIAA 3HUEA 1WHTB 5ENVA 1NW8A 3D8TA 3P9RA 2QP4A 3BQMB 3TSCA 5L3SB 4K2MA 4ZJUA 3DTNA 5CDUA 2GLXA 4AL4A 4UM8B 4DLLA 3TATA 1YR3A 4LOAA 4EI8A 3LOUA 4HG2A 5HF9A 2W2LA 4ME6A 3OZRA 4YGXB 1NWHA 2GJ8A 1U2RA 1RYFA 2OFWA 1Y7TA 3PI7A 1FDUA 3OTHA 5JASA 5IT0A 4EG0A 1FDRA 4DR1B 4K2HA 3A14A 3F5QA 1NM5A 4ALIA 2CCJA 4DV5B 2WJJA 2EVWX 5F2KA 3RSGA 3G2OA 3Q2OA 2QRPA 2R87A 1ZIYA 4DUGD 5F3RA 4KUHA 3RC1A 1ZD5A 2WKPA 5FORA 2CJXA 4ZCSA 2A57A 2QQGA 4G9BA 1IBLB 5IKXA 1KAMA 4S1TA 4JQSA 4X1KA 3GQVA 4QVGA 2XTZA 1CKEA 3VJMA 1I0ZA 1NF8A 3IP8A 4G0YA 3WJ2A 1IN6A 4LZOA 6YASA 2BL4A 5G4KB 1ARZA 1KEZA 1P7WA 3KKLA 5C37A 4P0QB 4JBGA 1TCBA 3I76A 1KBQA 3C5HA 2UYYA 5HE9A 4OHVA 3ZLJA 1R0KA 5EJ7A 2DFVA 2WSBA 1D7SA 4BLOA 1NKTA 4IJMA 2ZUFA 3W5BA 1USUA 4TZKA 3W0LB 1ZJJA 2QMQA 4DC9A 1SKAA 4XE5A 4A1OA 2RGUA 3DCJA 5FAXA 1PV2A 2AN3A 1XIVA 3C74A 4KO1S 1VLQA 1CULC 5AH0A 1BYUA 5K3EA 2GN6A 4RELA 3V8RA 1U3GA 1PV4A 4TS9A 2BMEA 1Z0SA 2JISA 2UVPA 2XADA 1OLOA 1H4SA 4UBMA 2VHEA 4FFBB 2XECA 2JCSA 4BBPA 3G5LA 5LKAA 4AFNA 2XQVA 2HFKA 1AHHA 2H9IA 4LIPD 1P9RA 1OILA 1QHFA 4DMCA 1VL8A 5HRAA 1LK7A 3QXGA 5LYJA 4M22A 2V6MA 3NV7A 1V5GA 4P4SA 1IXKA 4RY2A 1SKBA 3GV0A 1LWNA 3LYAA 1GPWB 4BRUA 4LXUA 2XVZA 1C9KA 4JN6B 4PLYA 1MHTA 2Y76A 5LBTA 1HEUA 5A7GA 1YS7A 1U7TA 1V4VA 2X3YA 1DS6A 4KXNA 1DBVO 2CHUA 2AY4A 1YBAA 2NZJA 3S2FA 2VK2A 1G2PA 4E5MA 1N92A 1Y8CA 1Z5ZA 1P0PA 3KKMA 2YHIA 4AJIA 2Q5OA 2VHUA 1K88A 1YIYA 3WY9A 2PR2A 1ZGGA 4QXOA 5GGYA 5BV7A 2LCIA 1L4KA 5JS6A 3P1TA 4PC6A 3GAZA 3QBVA 3QU2A 3OIYA 4AJEA 4YRQA 3CX6A 1ZN7A 4XQ9A 3R0VA 4EB7A 2Y8EA 4MAMA 1N6PA 1W8IA 4MCAA 4C89A 3UK7A 3P2IA 2QG6A 3R4CA 4P93A 4JI6B 1MEEA 2YJ4A 5I7SA 2Z5FA 3NAZA 4PFSA 1MOPA 3A1VA 4S2UA 4H17A 2XB2A 4YBZA 1BHO1 3GC6A 4MDYA 3H2BA 2AK3A 1E6LA 4MJLA 3QVLA 2V1UA 3EYWA 1HZZA 1TM3E 4Z4IA 3PJEA 4EU1A 2CV2A 1UWVA 1EESA 4EA6A 4LHEA 3A3KA 3PTLA 1P0IA 4PTZA 2NSLA 2PLFA 1N9GA 4QBKA 3PJFA 2O50A 1RAGA 3UO8B 5CJ2A 4XYLA 3VPSA 4R1OA 4RTOA 1TJ3A 1NQ5A 4O1HA 4A0RA 1MQAA 1BWSA 1SY7A 1RNLA 3IHJA 1CQWA 1YQ9A 4JBIA 3K0AA 4X1KB 4R2NA 1HPLA 5IFKA 4UCXA 4BDTA 1ZL2A 1EHCA 3N7UA 2BZSA 3EIUA 3VR4D 1XJQA 1SC1A 1DBIA 2D06A 1ZBQA 3DZFA 3FDZA 3ZGYA 1Q16A 2EIHA 3L8EA 3AKCA 3OKCA 2NUBA 4U63A 2D54A 2CVPA 4QHYA 1TASA 4LF7B 5JZ9A 2XCSB 3CUUA 3ADBA 4PLVA 5FYQA 2GRAA 2VQSA 4DA4A 3DOCA 2TS1A 2ZIVB 4PZCA 2R4TA 1TJPB 4KE6A 1QB7A 7AATA 2R47A 1KYWA 2HF9A 4DIDA 2C7OA 3W90A 1C1DA 1WM1A 3M5WA 3IQZA 3BWNA 1YZLA 2QJWA 4AJLA 1VJ5A 5LSAA 2AEUA 3U4MA 5JD6A 3H8JA 4QOIA 4HN2A 4RPHA 1ORTA 2UVPB 1QOQB 5ADWA 3IA2A 4R0MA 4EPXA 1W73A 2W2OA 1B8PA 4MJ7A 4PNZA 2ZIUB 1H05A 3OCJA 5FWYA 4BU1A 2ZBVA 5AKHA 1NVKA 5G0VA 3K94A 4RH0A 4L8VA 4P4SB 4LJ5A 4DV4B 2BKAA 4KV9A 5GVSA 4CBSA 4OH7A 2ZYHA 4ZK6A 3AEJC 3I0MA 4YMLA 2X4DA 5C18A 2VYNA 4L4YA 5KIAA 2REOA 3H18A 5DB4A 3AUSA 5CDYA 1CUEA 1XRQA 1A7KA 3DEKA 4CDNA 1PO7A 1POWA 3ZCSA 4GUDA 3T5PA 4EITA 3DTTA 3TF5A 2QJOA 4LOJA 4M1MA 4ZJZA 5JMPA 2YHIB 3ZUGA 3IIKA 5BSRA 2QM8A 3DNMA 2O7CA 1QH8A 3CZCA 3L4EA 3WWYA 4B0PA 5G09A 4MLDA 3SLRA 1P2VA 2ZBUA 5ARBA 4RHYA 1RRCA 3CB2A 1J09A 3T38A 5LU8A 3F7NA 4WPGA 3I5TA 3IPXA 2CWWA 4BNWA 1FNDA 3FCRA 5DEOA 2OP0A 4P0TA 3U49A 3VAYA 3GH1A 2CDAA 1DBSA 1E9DA 5E1BA 1ESDA 3RBZA 5EWLA 1AB6A 3NU7A 1X77A 2POCA 4KAAA 2C5HA 2BN4A 4KQGA 4WXGA 2BZ1A 3KJHA 4MO9A 3JQAA 1Y6GA 4AG5A 1FFEA 1P9OA 2JD1A 2QAJA 1L4YA 3ANYB 3OJCA 3INGA 2FR0A 2A5DA 2IXGA 1PQ4A 3QLUA 1MXHA 2X14A 5EAIA 3JXEA 2P2CA 4C03A 5IWCA 4FMCF 1Q0RA 5B55A 4K26A 1BA3A 1FP6A 1SC4A 2Z5LA 2V4MA 4OJQA 3NBFA 1JSZA 3NCHA 1FDTA 4NBVA 3CG0A 4G41A 1N9GB 2J3IA 3JQQA 4NYIQ 1B8VA 4L9WA 3AIMA 1TYBE 2R7KA 4QBFA 5F51A 3SJBA 1YBMA 3B82A 3T3MB 4OX9Y 1XU4A 2VUIB 2VT7A 1I3OA 4FQ7A 1OXXK 2F3SA 1KYVA 2FF5A 2Q6LA 3DVRX 2R6AA 4Y9TA 4ETNA 1CZUA 3CF6R 3CVOA 4C2BA 3CX7A 3FDZB 3M5PA 1ZL0A 5DDIP 2IHUA 2B2NA 5AKYA 5JNRA 2R6FA 4EY4A 1K7XB 3TG2A 4G0ZA 5KX5B 4LMAA 2JLXA 5L6LB 4W5RA 3IE2A 3EF1A 2QTFA 4GWKA 1V25A 4FYXA 2CDRA 3EDOA 3ORYA 2UZ3A 3ANMA 4ITRC 2A8YA 5THKA 3KJQA 4D56A 3ET4A 3ISVA 2J0QA 4Z54A 1C1DB 3R7SA 2EQBA 5J63A 1WVMA 2NU8A 5ABPA 4K88A 4E12A 3ADOA 1EWRA 3R24A 1XEWY 3SYRA 3OA2A 2XNJA 1N5IA 3RF6A 3RV4A 1AMNA 3VNSA 3RC7A 2RH8A 1UOOA 4L75A 3L6BA 3RR2A 4EZIA 3CVVA 1K3TA 3ZU3A 1A9XA 1NY6A 2AR9A 4LW4A 2BM8A 4BZWA 4GOND 2CLMB 3L7LA 5JH7F 3C3JA 4WOPA 4G0QA 5ALDA 4K28A 3B38A 1M4NA 4PQRA 2NXCA 4RULA 2WV7A 2ZRKA 3GEEA 3RYFA 1DC4A 1UANA 5B1EA 4WY8A 3FZYA 5JD5A 4K9OA 1X92A 3SYKA 1JTVA 2DJIA 3U61B 1VI6A 4RHCA 2ZULA 2QI9C 1TGVA 4BVGA 4QTXA 1KC1A 3GLIE 3W9UA 2FUG6 1XFAA 4RE6A 3X1KA 3PB3A 4A0QA 4J16C 1QH8B 1R4ZA 1TA4A 4LFAB 1BDBA 2R68A 1NONA 1WZEA 4JU9A 4KLAA 1RM5A 3VK2A 3TAUA 1Z5UA 3DSRA 4KGZA 4U39A 4G0OA 3KE3A 3CUKA 5FD8A 3SZRA 4M9SA 3U17A 3U3MA 4AWAA 4AP6A 5EJFA 3NFYA 5EWLB 3UXMA 5BPHA 2YOHA 3ZJTA 3BRCA 3RFTA 4KWEA 1E1QD 4MGYR 1W5EA 2Q1YA 2UXBB 2GZ2A 4BNDA 2AZ4A 3DEAA 5GM1A 3GLSA 4CT0A 3VFDA 1FZQA 3WGZA 5D3MA 1ZRSA 4IL5A 1GPUA 1BJWA 5DMHA 3MEBA 2QAGA 3TZKA 1TM7E 4X93A 1ZP6A 4P34A 3KL4A 1YRHA 3QITA 1JVNA 4EL5A 2EJUA 4GC9A 2O5VA 1PKEA 3DO8A 4J7AA 3D0QA 4AZ3A 3HUTA 2BI9A 2HDWA 3IILA 3VR6D 4QWWA 4J1QA 5DJ5A 2ZI3A 3NC4A 5EMNA 4NARA 1WUHS 1GPDG 1OX5A 3P0EA 4TWBA 5KU7A 3K1YA 4BQOA 3SSOA 3IOEA 3AVQA 5KPJA 1QV9A 5JZMA 1RVV1 2RHLA 2DFDA 5BR4A 1EK0A 5H7XA 1UZLA 5DIFA 3SR0A 1Z2PX 4H6XA 3OOSA 2DEUA 5U4XA 1V3VA 2EDCA 3LV8A 2I6TA 1NJFA 3UVEA 3CISA 4A5SA 4TM7A 3I6MA 3BC8A 3KHSA 3GJTA 4EB3A 1A2QA 2JLWA 4P3OA 2ZATA 1C7FA 1A8UA 3RDPA 2X41A 3ILHA 2NU8B 2C5AA 4IDBA 2ZSDA 5FF9A 1UH5A 3TO5A 2EBUA 2VR1A 3EMVA 4QYXA 1KERA 4OQLA 5ES3A 2ZYGA 1ADBA 3LOPA 1FRZA 3VPCA 4I1UA 2IVFA 3M5CA 4EQ6A 3PXCX 2I8LA 4Z1OA 1ADYA 1JBQA 4ZYZA 1OMOA 4B40A 4J1SA 3DC2A 3HMKA 2NQ8A 3QPBA 5K3DA 2Z58A 2C4KA 5GZ1A 3C1TA 3I39X 1C1XA 1J9ZA 2IU0A 3EJWA 3BWDD 2G76A 1M3SA 3LLUA 2MYUA 4GIBA 4H0CA 4RTPA 1EAYA 2IODA 2DTXA 2JIQA 4I8XA 2VPWA 3UJ3X 3P96A 2BELA 1UFVA 2OESA 2V6GA 2W8WA 4F3YA 3D6MA 1CJVC 1H8EA 3I9NA 2P9GA 3I1FA 1HM5A 4ADDA 1TYDE 4PU0A 2ZLBA 3M0EA 2ATXA 4U3JB 4A6DA 2NPIA 5CDGA 5DNVA 1Z0DA 1PJZA 1YC2A 3RK1A 1Y9EA 1RI1A 3I6BA 1GIAA 5CG2A 3QW2A 4Z6KA 5JJBA 4FSXA 3K2BA 2X0KA 3AL0C 3DTVD 4GMFA 3QHAA 3EVFA 5DP1A 1V39A 4ZT6A 1YHNA 4Z9YA 1SKMA 3B53X 1OKKA 4J76A 4B45A 2HH9A 1Z4PX 1A5AB 8AT1A 1V3UA 1YHYA 1T25A 3D6FA 3H2GA 1SQFA 2AXQA 4HZGA 2QAGB 4V1CA 2EFEB 4YLEA 2HUFA 3QMMA 1CEEA 4YX9A 5HP4A 3W3ZB 1D1SA 4TYQA 2ORYA 1RBQA 3B8EA 3LHKA 3PBKA 1FJHA 2ZUBA 5CGZA 3HVUA 2CXHA 1T4MA 3HVKA 3MTQA 2B2CA 4S0XA 4ZOQI 4HEHA 3W05A 3BCAA 4C76A 1ASEA 3RWBA 3DBVO 4HMPA 4PCUA 3T5DA 4HNVA 5CW2A 2APJA 4D8VA 4PSVA 2AEJA 1P1KA 1ZXLA 3KEGA 1K63A 1O0CA 2MMGA 2I3GA 2GOYA 4IDCA 4C0JA 4URXR 2JLSA 1AZLA 4YMSA 3TQHA 2FEKA 4GLOA 5JCOA 1JG2A 2CLIB 2OLKA 3TI7A 1RM0A 3B89A 4PFNA 2DWCA 2QIOA 4KIUA 3N6XA 4QYSA 3PEFA 4P7YA 4WNYA 3CUVA 3QOXA 1E2KA 5J23A 2ZSBA 3RTGA 3CKKA 3D64A 3NWOA 2H7CA 4B43A 2GTIA 2YHBA 1KRHA 5EJ8A 1CDDA 1GTL1 2I33A 1M0TA 2GPBA 5CH8A 1AKUA 4NQRA 4Q1DA 2EQAA 1K5DA 3TTXA 1H5QA 3IDAA 4EQ6B 4Z4QA 2P8SA 4BVAA 2FHSA 4C05A 3EF3A 3B12A 2PKXA 3E8SA 5MF6A 4K0KB 1MD9A 3OZEA 4F1WA 5DWVA 2XDAA 4B6RA 2Q5LA 2BR5A 4AY2A 4UU8A 1C1XB 2AYZA 5EJEA 1PIWA 3LCCA 3NHKA 4KE9A 4INJA 4J4HA 4B3HA 5BQPA 2IOQA 1N3IA 1JIJA 1KZ7B 2X9QA 2PGIA 4TXHA 1IPHA 2GX6A 1L3CA 1V3TA 5EOVA 3CLKA 4DR2B 3CW8X 1BSVA 5AOAA 2OV4A 3ZG6A 5DASA 4AN4A 3R75A 4FMDB 4EVSA 4UPDA 3HDTA 3IMCA 4EKYA 1GBNA 4M55A 2ZT8A 2V5AA 1MOSA 1KYQA 1F5NA 2NTEA 3DYBA 4B6GA 1JDZA 4KFCA 3DS8A 3CE9A 1FMLA 2GFHA 4UFNA 2W90A 1XTSA 1FFWA 4OHXA 4R1TA 1R0BA 2YKUA 2HMUA 2SKCA 3V5NA 5DNYB 1IK4A 1P45A 2JZCA 5TRTA 3HY3A 1G16A 5IAJA 3X1YA 1IDOA 3OUZA 2EJTA 3NDPA 5AJTA 3NW9A 1T5IA 2WUFA 2DKFA 1GRCA 3DZZA 2DR0A 1CVIA 3HL4A 3D0RA 4F86A 3RAEC 3FOWA 4LGVA 5F35A 1I1HA 1XZDA 3P9KA 2VRWA 5KVSA 5AK6A 3DRDA 1ULTA 4C01A 3OESA 3RJMA 1R8SA 1XRSB 4HWOA 2X2EA 2HXYA 1XX6A 2EYQA 4FWTA 1HE2A 2RBEA 1LPSA 4QFBA 4EARA 2JA1A 3I6ZA 2ZE7A 3SJZA 5C8ZA 4I3GA 3AELA 1CR6A 3E3AA 3AEQA 5KKAA 3TGWA 4AUNA 2AEVA 2IHYA 1GC3A 3MMZA 4KR0A 3ANTA 4B7AA 4RPIA 2AY6A 5FWAA 4OQQA 2REXB 3UGTA 5LLDA 2WB4A 4O1MA 1HWYA 4WNIA 1GTSA 3B78A 2D0PB 1AK1A 1G5HA 1DSSG 3N7TA 4R71A 2GN8A 1V6CA 2ZSUA 1GGVA 1L5GB 4K81B 1ZR4A 5T4HA 1YZYA 3L1IA 3ENZA 2IZOA 4BZPA 2J9RA 2GCOA 4D3DA 2P5YA 1M0PA 2FDCA 2AMVA 1ZD1A 2RK3A 1ZJWA 3OSUA 1Z2EA 4IQ4A 3IHWA 4Y1RA 1YZTA 3RF7A 5H4HA 1PYGA 1C30A 1S2OA 5DE3A 1NXSA 1FP4A 3ZYCA 4FLEA 3QTTA 3GCWA 5BMVF 2GM9A 3FYUB 4U0KA 1ILEA 1FMJA 2WF7A 1UBSB 1L5OA 2GZRA 1U0LA 3L79A 3SQLA 1N8SA 3PVSA 3KQVA 4AMBA 4JEVA 2C07A 3RVLA 3Q2IA 3CBFA 1ZUD1 1JI3A 4OD0A 1W76A 2ZEJA 3FZ7A 1J23A 4LNJA 2CZGA 3IURA 1GZUA 3QP9A 3S2ZA 1PS9A 1NI4A 3D4PA 4V0KA 2QNBA 3EFOA 5J4KA 1RXVA 3OKFA 4JCCA 2VYVD 3A6HA 2CDCA 2W6ID 4IUBS 1PYDA 1K3FA 3DHNA 3H17A 1NQUA 1IB6A 3OFNA 1ZEMA 4NDNE 3TW0A 4R2WA 5HXXA 2HQSA 2O5CA 1X7YA 1TZ2A 4W8GA 3HJTA 3E58A 4BNHA 1SHLA 1ESCA 4BV9A 4QYMA 4INPA 4QGRA 3IIJA 2F7SA 4LQDA 2P0YA 3OTQA 5CYFA 3OFJA 1ZVJA 3FYCA 4R31A 4XLLA 1T0PA 1U1FA 3RIGA 1NGSA 2DKBA 2A5JA 3ZKAA 4EF4A 3T1TA 2H2DA 3ZLTA 4D4JA 3TAXA 3CUWA 1KY3A 4DNFA 1V8ZA 4ZAWA 1XCPA 3HA5A 4W99A 3NBMA 3KEOA 5B6IA 2OC9A 1DAKA 2DM6A 1KI7A 3ZHVA 2YMMA 1BKDR 4HWPA 5E6UA 1YQUA 3SZMA 4NAUA 4FILA 2P1RA 4EX6A 3B1XA 5K2MA 3USCS 3M5DA 4BMNA 3OKPA 3FSLA 3JVEA 3GEHA 3D7RA 5KHOC 3LCUA 1WXXA 2R2AA 1RZVA 4YB8A 3AZQA 3PDIA 4QSHA 5TY0A 1T2EA 4CM8B 1QSGA 3R23A 4KKXB 5BNZA 3NIBA 3LV2A 3NYWA 2JH3A 4JOBA 4EX7A 4P83A 2NSHA 4DABA 1XQ6A 3IDQA 5BUZA 4G0UA 1NBEA 2YW9A 3P52A 3LVRE 2EEZA 4LXTA 5G4JA 3LG0A 2YUTA 3PS9A 4OC9A 4CDMA 5KNCH 5NLLA 1OFVA 3CJTA 2Z61A 4PYMA 1VI2A 4LJYA 5JZVA 2RH4A 1U04A 5KQRA 5EGNA 4RTRA 4TYWA 2KWIA 3H87A 2I9PA 2VJNA 1ZJYA 2NP7A 1GCIA 3W4JA 2H1HA 1JDNA 3DJFA 3VO1A 1ARHA 3DQQA 3D8BA 2O48X 3K20A 2GCOB 1J33A 2H4XA 5CB4A 2DFLA 1V2DA 2RAUA 2XBNA 1KOFA 2D2VA 4IJVA 1E6EA 1I4DD 3HKCB 3O1IC 2ZI6A 5E4YA 5HUHA 4Y1RB 3DM5A 1C30B 1FP4B 3CLRD 5K3CA 4ZVLA 5ALQA 3MXOA 2W42A 3IAM6 3PWZA 5JCZA 3BL5A 1NVUQ 3QWAA 4FSHA 1EVZA 3OFVA 3IXLA 3I2YX 4CM6A 3QX8A 1QZ9A 2FEAA 3V3TA 1RJ9A 2TSYB 3E7FA 1L5MA 4PG5A 1DKLA 3V4OA 4UXHA 1NI4B 3PYLA 5ALFA 2QMAA 2CSUA 3EFOB 4GHWA 3KPWA 3JD4A 5GQSA 3WIBA 5CLJA 1GUFA 5B6JA 3H4IA 4G5YA 2PS9A 4IEEA 2IHJA 4UHHA 1VJOA 2NNWB 4DV0B 3EDMA 3V1KA 4XGRA 4JH0A 3DPSA 1X7YB 3QWHA 5KYYA 1O6CA 3HA3A 4PVCA 3RK0A 4B3MB 1XMOB 4ZO6A 4J2TA 4J1NA 2WU3A 3HRHA 3BERA 2ZTMA 3JS5A 4J0EA 2HNBA 1O97C 3PLAE 4B85A 3B6MA 2Q3CA 3TLXA 2QUBA 3H9GA 3P9ZA 3ZK7A 3A37A 4IJ5A 5AKLA 2ETVA 4KBGA 3RLFA 2FOIA 1ZM7A 3ZWWA 3C3CA 1CEXA 2J7KA 3EWIA 3L40A 4QREA 3W9SA 1BU5A 4Y6PA 3RVQA 1C9CA 4MR7A 5ECYA 4KVGA 5E6UB 4MV1A 1X1RA 4PAMA 3TQXA 1YE8A 2WBLC 4B83A 3B7WA 1EA7A 1K8QA 4HLQB 3QEBZ 1IVRA 3N2YA 1T2CA 1CUFA 3BXGA 1OQAA 3W34A 3PDIB 2YBDA 3SVTA 1NQXA 2WIKA 1EYZA 2VI5A 3NHZA 4HS4A 1UZAA 4N3GA 1CDOA 3VHXB 4B4WA 3K0CC 4U8GA 5EFZA 2CLFB 4WFIA 3ZDQA 3GGCA 4C7KA 2EFHB 1QZXA 4R8KA 2FPGA 1P2GA 3RHTA 4LRUA 3AYXB 1U9CA 4RV5A 3LXXA 2YZNA 4EG5A 3WXMA 1M0QA 2E7ZA 1ENOA 2AE2A 3GCDA 3HXKA 1GGMA 3C0KA 1WUTA 2YZMA 1VHTA 2G6WA 3COGA 2ZTUA 5J43A 1GSOA 2WZCA 3LY8A 1GDEA 1G18A 2HQOA 1HNWB 2BTOA 5JJLA 2HZPA 4KXUA 5FQOA 4TN5A 2OBLA 2GERA 3PD0A