4K05A

Crystal structure of a duf1343 family protein (bf0371) from bacteroides fragilis nctc 9343 at 1.65 a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
391
structure length
384
Chain Sequence
PRIRIKTGIEVLKEQNFKCLEGKRVGLITNPTGVDNHLISTIDILHEAPNVNLVALYGPEHGVRGDVHANDSSTGLPVYSLYGKTRKPTPEMLKDIDVLVYDIQDIGCRSFTYISTMGVAMEAAAENNKEFIVLDRPNPIGGLKIEGNVVEDGYISFVSQFKIPYLYGLTCGELALMLNGEQMLSKPCNLHVVKMKGWKRKMDYVQTGLQWIPSSPHIPHPHSAFFYPVSGILGELGYMSIGVGYTIPFQMFAARWVEAEKLADNLNRLHLPGVIFRPMHLKPFYSVGKEEHLQGVQVHIVDFNKASLSEIQFYVMQEVTALYPDRAVFDHADKERFHMFDLVSGSKEIRERFSQRNRWEDVRDYWYKDVDDFRRLSQKYYLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical exported protein
publication title Crystal structure of a hypothetical protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 123
structure length 384
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07075 DUF1343 Protein of unknown function (DUF1343)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4k05A01
3.90.1150.140 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4k05A02
4K05A 4JJAA
chains in the Genus database with same CATH superfamily
4QGRA 3KTOA 5B3KA 4ZQBA 2NN3C 4R5MA 1GUAA 4WKNA 2YFKA 3G5MA 4BUZA 1HNXB 1P1CA 1K4KA 3DYBA 1OI7A 1Q1NA 5BSWA 2OHXA 3K8OE 1VMKA 3DM5A 1S9DA 4JU8A 2HQSA 3GELA 4D79A 3HA7A 4LWZA 4NPCA 3E0QA 4JLUA 2X3YA 1NX9A 2X1HA 1JMKC 2VHUA 3TKYA 3O74A 3HY3A 3K9HA 1SCDA 2I7TA 1L1EA 4DR5B 3NWJA 1VJTA 1KY2A 1I3KA 3DDHA 3JQQA 1TE2A 2J9GA 5HG0A 4TTVA 1EVEA 4BOYA 3MINB 1B1CA 3PXUA 1IJEA 2HNBA 1N92A 1D03A 1JEQA 4WBTA 3LQ4A 5BR1A 4W9RA 3I4JA 3L6CA 1EWKA 4CIXA 4RD6A 4UU8A 3I2JA 2XVZA 3MAJA 1SH7A 1UOEA 1JKXA 3IKTA 4JIGA 1K5PA 1QG0A 2POQX 3JYLA 3JQ7A 1JH8A 4DNFA 2WTUA 4ZJYA 1N5JA 3DNMA 4WYGA 1GUBA 3LQYA 1CZKA 4E5SA 2O8NA 3M3DA 5KYKA 1Q19A 2CDRA 2W6MA 1P39A 5LMZA 5H02A 1SHKA 4XWKA 2VMUA 2VT7A 2IY7A 4M9ZA 3EQ2A 2BFPA 3ONEA 3OIUA 1F14A 2JIDA 4M1YA 3U3XA 1J2RA 4LDJA 4BC0A 3ESBA 4M36A 4GVPA 1C1DA 3G8AA 3AL0C 2HAEA 5KWJA 1W5TA 2HA4A 2R2GA 1R8SA 2R3SA 1YQEA 2CSUA 4LVOA 2EERA 4UU1A 2P77A 4ZOQI 2VWHA 4DCCA 1W4BA 4O4LB 1DU4A 4HMOA 4C0BA 1CP3A 1KDOA 4CU5A 2OQ2A 4BLSA 5AW5A 1MGPA 1T13A 3K7YA 2ZI4A 5EIBC 4LVNA 3GGSA 1NSFA 4UFOA 4FJ2A 1DARA 3BG5A 1UADA 4KX5A 2HSEA 1R4AA 1UPFA 5C46F 1XE3A 1BXZA 4EJFA 2QI9F 5BMOA 4WTOA 3QEJA 2DBQA 4BO3A 1M2WA 3HBJA 3SJCA 3KBOA 1QO0D 1XA4A 4URFA 3BIJA 1QYWA 3GZNB 4AL4A 3IUEA 1EFTA 1HLDA 2E49A 1ORHA 4XEHA 4ASUD 3D5QA 4I4CA 2EZ4A 2W83A 1VLLA 4DRZA 2CNNA 1C0PA 5LC1A 5L3SA 2F7SA 4ZSWA 3G2KA 5HRAA 2IYPA 3R7SA 1ELOA 4F85A 2X4DA 1ZI9A 4KWIA 4YT8A 3REQB 3U56A 3KHKA 3V1MA 2I0FA 4DNXA 5AVVA 2RAPA 2FK8A 1ZGJA 2C4NA 2DQKA 2I6QA 3F5DA 2JEOA 4RKEA 4ERXA 3EMKA 4HB4A 3RSLA 3IT2A 5M5BA 1V2GA 4YDSA 3NB0A 3VK4A 2ZI3A 1GC0A 3NHFA 4JNCA 1U1EA 1LU9A 3BN3A 4R1MA 3RPEA 3W3AH 4KO1S 4DQKA 2N42A 3FNRA 3T3NA 5BRAA 1RBYA 1U2DA 1QPGA 1NBOA 1JEYA 4IMPA 4KCGA 4QTUB 2GN0A 1YFLA 1O0CA 2I2DA 3TRIA 4DEYA 2HSDA 2B2XA 4RTSA 3G9UA 2WM3A 3TATA 2LRHA 2QMZA 3HRHA 4FX2A 1KO4A 2XV1A 3K6RA 3I8OA 4DLXA 3GLHE 1XTQA 1W4ZA 3O03A 3VAXA 3LO5A 2IEYA 3ESYA 3MCUA 1EEXB 2YHSA 2QM8A 5A0FA 3MK31 1SC6A 3ZKWB 1JIKA 5DHQA 3FPAA 5ERGB 1QVZA 2Z1YA 3CQ4A 2Z1MA 4IEEA 3KYBA 3WLSA 2XDQA 1FMCA 2YWCA 2JAPA 3LC7O 1XZQA 4XIJA 3DWIA 3S2GA 5JNWA 3CHYA 1H6DA 5C8YA 2OHGA 5JO9A 5BP7A 1PMMA 1ASDA 2AVNA 3IT0A 3KYDB 1I4DD 2ZY2A 4R9RA 1E1KA 1BHSA 1A82A 3RM3A 4B32A 3QSYA 1FMTA 4ER7A 5KNBD 1I1HA 4UEQA 1ASEA 3EEFA 5BYBA 4YAEA 3CVXA 4D3YA 1HNWB 2V0YA 3HXPA 1Z12A 5J2UB 4M0DA 2W6ZA 3GDHA 4V0KA 2P5SA 5FWYB 3BB4A 5IF3A 4DIUA 2VSQA 2XVMA 4XVRA 2LDXA 1M4NA 2WG1A 3U40A 3QPCA 2ZTLA 4ZI5A 1EINA 1U04A 4OVKA 4BMCA 4BCBA 5JG7A 3RBZA 4LE2A 1X9IA 4A16A 1M1ZA 2HH9A 3RHSA 2I6SA 3ELPA 3DMHA 4KSCA 3M5CA 1P6QA 5JEEA 4W8GA 3AHEA 1JL3A 3CPJB 4NG5A 2ZRJA 2CCJA 4XQ9A 1L1FA 1SB9A 1VL0A 4ZOAA 3I5UA 3S28A 3AF6A 1Q84A 4TTTS 1U8AA 2G7JA 5KOHA 2DFTA 1K6JA 2XNDA 4OHVA 3L79A 3KOMA 1HQDA 2ZRDA 1TIKA 2OUKA 5EP4A 4FHGA 2ZVJA 3OFSA 1Y9DA 1E1MA 4MQRA 1A1SA 2LPMA 1JFLA 4N76A 4J0GA 1GTMA 4MAFA 2JKZA 3PYLA 5BV1A 3PG5A 1M34A 4MWDA 1P4HA 4Z86A 2AEEA 1G9SA 3EVAA 3D0OA 2Q9UA 3BX1A 1NUHA 3MM4A 4UEJA 2C78A 1FY2A 3ADBA 3HZHA 1SBCA 3TMAA 4QQRA 4YLGA 1LVGA 1JH9A 2H1VA 1XNQB 3PR2B 5AMXA 3AKYA 2QPTA 3H8SA 1R0BA 3FUTA 3A05A 3T99A 2IGTA 2V3WA 3IELA 2R8OA 1C4WA 1YB2A 1WKGA 4Q4HB 1VE7A 3UJAA 1UKVY 4ZK6A 3RUPA 3RAJA 2MYUA 5JROA 9ATCA 3TZ6A 1A9SA 1O62A 3GJ3A 2PMCA 2OGTA 1VKJA 1T3GA 3LBFA 3GDWA 3V2HA 2ZUUA 2Q9BA 3EWSA 3OAAA 5BORA 3UAKA 1CB7A 1PSDA 3SWWA 1VQ1A 2VZ9A 3OLYA 2Y1LA 1FJGB 3FVUA 3R44A 2QTLA 3PQDA 4PO3X 1R12A 4DCSA 3N2GA 2QKYA 3E9EA 3AETB 1TJ5A 3L41A 4B2PA 1ZXBA 2PS9A 3OLZA 3D8NA 1C9MA 5AUNB 3TZBA 1S96A 1RC1A 3DHEA 1Z15A 4X6XA 3RRBA 1RWQA 5KJ6A 2XMGA 3NTRA 2ZWPA 1Y1TA 4CKEB 1P1FA 2NU6A 3K0BA 2XX3A 1WZNA 4EG5A 1T5LA 4BE4A 2KJQA 1I2DA 3EVBA 1FDOA 5EWMA 4C1NA 3QP9A 1SXPA 4QUKA 1MDXA 3ZXUB 1CY7A 5ER9A 2PCLA 2PGIA 2D06A 2B36A 5A3VA 1JG1A 3E70C 2PH7A 2LCFA 3HFGA 4B6PA 1EE1A 4ENTA 3FYUA 3VR5D 1SVOA 1D8TA 3SP1A 5L3ZA 4F5MA 4B47A 1SNYA 4BXOB 3HVYA 3KUDA 4QSMA 1AGPA 4DLBA 5CXXA 3EUFA 1R0XA 2J9RA 2ISCA 1XO1A 1AA9A 4X0EA 1OBVA 1IEVA 3WJ1A 3RAGA 4YB8A 5LZ5A 4N3NA 1I6KA 1ORIA 3C41J 5ESWA 5DEOA 3PUXA 2NXNA 4IMIB 4GGMX 4WKOA 4CM7A 3OUUA 1QE0A 1KEPA 2IYAA 5HKAA 1S6YA 2P9FA 3IEKA 5JECA 1KMKA 1RXYA 4P84A 3GGCA 2C7PA 3VHXB 1C3OA 3EOZA 1T9HA 3DL2A 1DC6A 4L8GA 4F3TA 2C04A 3LGAA 2BFEB 4R4JA 3TNJA 4RO0A 1F8XA 3W2IA 3VDMA 3SYNA 2QQEA 4TN5A 4AYXA 4MLPA 1ISPA 2ZZMA 4QXMA 5KHOC 4NAUA 3NGLA 4L4ZA 4M99A 2VJOA 1PFUA 2CJYA 1QKJA 7MHTA 1GQQA 2VOEA 4AF8A 1JMYA 1NLZA 3ZV4A 4IFIA 3BHNA 4JYZA 1NDUA 4CKWA 3AERB 3VKGA 3ZS8A 3KE8A 1W4AA 1X6VA 4NJMA 5FBWB 4DCNA 3C74A 3PUVA 3LIPA 4EB6B 4HH4A 1I7LA 3I23A 2VDKB 1GZ6A 2ZROA 4Q4LA 3A2MA 5HQTA 2E37A 2JHPA 1URPA 3JQEA 3BE6A 2Z4TA 1NW7A 5JMTA 5DVZA 3L8DA 3TX2A 1KJJA 4ISCA 2W8JA 4MWTA 1EXMA 2Y92A 3NHLA 2Y6UA 4MQMA 4DMMA 3BGVA 1IM8A 4EI2A 1PG2A 2GHRA 2JGDB 2CL0X 5AVZA 1CIPA 1XIVA 1T5TA 2PA0A 3ULKA 3NT5A 1LC7A 3TEMA 4F2DA 5AW3A 2R4TA 1O9BA 2WZDA 3PGJA 5DF1A 1GNSA 4FOTA 1Y82A 4EPXA 1SO8A 1XD2B 2UZ4A 3OQPA 2WTXA 5K3CA 3W8DA 5ISMA 2BZGA 3F6RA 3A4YA 3WWZA 1FYXA 4JHLA 2YWEA 2VSXA 2NZ2A 4NAHA 4OJYA 1WNFA 2WUGA 2FR8A 3E5RA 1WVGA 4DQDA 4LEIA 1XMVA 1WEKA 4OEHA 4KPEC 1X13A 2QQ0A 5AP9A 2W8WA 2ZB2A 3IR6A 2DY0A 5GONB 5IVPA 1YU9A 1W87A 1E64A 1Q0SA 3BYZA 3EZFA 2VMTA 3BRQA 4JS0A 3IERA 1KPIA 5DNUA 4EW1A 3CYFA 4JEZA 1SAYA 3M33A 2WILA 2DOUA 1PX2A 4LC9A 2PZMA 4ADDA 3MS2A 3AR4A 4QE3A 2IUUA 2G7MC 4MKIA 1UFKA 4DILA 2ZI7A 1AE1A 4KDFA 3RF7A 3ABZA 1O96A 1AHNA 4S12A 3RADC 4DV0B 2VP2A 3KHUA 4KZKA 1KETA 3P5SA 5C1DA 3LHSA 4DRXB 1QOZA 2QUKA 3B1EA 1R4MA 3P6KA 1Z9BA 3I6ZA 2QZZA 3OZRA 1W36D 4JEMA 4I0WB 1A7JA 3ENZA 2WLSA 3ESXA 1WQ4A 3U2QA 1ZKMA 1N5KA 1SPXA 4ZDIA 1PNRA 3L0DA 2O8EB 2P5UA 3JRNA 4YAUA 2NMVA 3U81A 5FBLB 1DGQA 2EP7A 2ZVPX 3GC6A 2PGOA 2NTJA 4ID9A 2ID4A 4B9AA 4EG1A 3ITDA 5CG2A 4KFSA 4NATA 1PEYA 1DBVO 4LMAA 4B8WA 3U4DA 3B7PA 4UHDA 5CR9A 5KYVA 2GPAA 2YQ5A 1SQ6A 4ROSA 3RARA 1R2QA 4X92A 1P9WA 3M82A 4BQRA 1JNYA 2GAJA 2QUIA 5IANA 1BJTA 5DXFA 4K6CA 2XF2A 4D26A 5JE8A 2E4UA 2B6HA 2C9MA 4QGAA 1M8KA 1S7CA 1SIBE 4JL6A 2ZUVA 1ZH2A 4PN7A 3SVLA 2WW8A 4BB0A 3CINA 3ANSA 4TYPA 2NIPA 4I8DA 4D4MA 1CEXA 2NTEA 5DTQA 3EVZA 1PR5A 1K08A 1GIAA 4CF6A 3KDSE 3K2BA 1L5SA 1P81A 2KS6A 1IYZA 2RAFA 2J46A 1X7YB 1MAPA 1JW9B 4JJGA 3CBQA 2MSNA 2VJKA 5F7ZA 4OCZA 1QHGA 1FDTA 1FNNA 1T8WA 4IIEA 3NBAA 2CWWA 3GR9A 2R6HA 2VJDA 3M2TA 1DVRA 1L7NA 3FXAA 4GX5A 4IDQA 4AUKA 1LPNA 1HV8A 3NWBA 3PUZA 3JAWA 2W6QA 4P0TA 2MSKA 4II7A 1GZ4A 1YF3A 2BMWA 4TMYA 1KMHA 4B8ZA 1S3FA 2ZC0A 4OQYA 3K28A 2WICA 5TPWA 1XX6A 4TTSA 2GUWA 4PQYA 1XZLA 2DTEA 3DXWA 3WQHA 1BJOB 3G23A 1YZVA 3S2FA 3VTKA 2YJNA 4Z8YA 1T29A 1MVLA 4BN4A 4BWGA 3ZWMA 1Q0QA 2I3AA 4F4IA 1FPQA 3JZIA 4LYGA 1D6JA 2R84A 3QLTA 2IBMA 2C3OA 4EYGA 1V7QA 1VE1A 2G0AA 4FGKA 1PLJA 3DW1X 4YRPA 3SZLA 1U9IA 3NONA 3L0IB 4MJ3A 3T7TA 3X2SA 1HTBA 1NW4A 5TEWA 2UZ0A 1GTJ1 4PO1A 4CKCA 4UZSA 1SC3A 1BC5A 3UHPA 1XG5A 1TXGA 1Y5MA 4F3NA 3MMPA 3QE0A 1ZD8A 1JIXA 1CDDA 3UH1A 3CF6R 1YFZA 1E9AA 1QRUA 3AW8A 4PAWA 2QP4A 3LYHA 2J7PD 3SKVA 4RCZA 5KJFA 1TCUA 3S68A 2OBYA 3L4JA 5ES4B 1WUIS 4V0SA 3M34A 3H5VA 3RYFB 2VAWA 2DM6A 1LA2A 4CG2A 1NURA 4PZUA 1KYQA 2PWPA 1XT6A 3Q72A 2C2MA 2AHOA 1QGNA 3AV0B 2RI1A 3CH4B 3TCMA 1F2VA 4ZT2A 2ASVA 3HJCA 3BPSA 3BD7A 2OFFA 3INNA 1BYUA 4JUAA 2O20A 1ANKA 4IWYA 3P9KA 4I66A 1NY5A 3P32A 1Z38A 4PLYA 4OHCA 4B4KA 1WDMA 3PDWA 5FUWA 1OREA 3OM9A 3KXDA 4NE2A 2PKCA 3IP1A 5FTNA 5KNCH 2C9CA 3AI3A 3GCDA 4K6FA 3ADPA 2YWRA 5B12A 4F56A 4URZR 5LA6F 3CCBA 1U0EA 4R16A 3QYJA 1WF6A 1C9CA 1E1LA 5SYNA 1E2DA 2HDOA 2A5LA 3WGBA 4A92A 3SD7A 2HWXA 2QAGB 4M37A 3K0HA 3KTDA 3AEJC 2J9ZB 4WJLA 3RJZA 4LHYA 1M6EX 2JFBA 5C31A 5TIIA 1DE0A 3UHAA 4X93A 1WUYA 1KOJA 1IBRA 4PLHA 4R8DA 2OSVA 1Y1RA 4L3VA 2CZQA 3F6PA 2HDHA 2VAVA 2M1ZA 3FTNA 3DKPA 4R0VA 5EWLB 3SF8A 1PEAA 1TK9A 1G8KA 2FSUA 4MS1A 4BY9E 1Y6JA 1W2WB 1XDWA 1XMIA 2IPOA 4BNVA 3H42B 3T9EA 2A0FA 1M0NA 1T2UA 3WB1A 4B3MB 3W2HA 2V5VA 4B85A 1XZEA 5DT2A 1O95D 3L1KA 1WXFA 3FWHA 3G9XA 1GKLA 4YONB 2GF9A 3KKKA 1SCIA 4IIUA 4HWKA 4YXWA 2VUTA 3D6NB 2FUEA 4BBJA 5IF9A 2JLZA 4KH0A 1T4DA 1D2GA 4L6AA 1T5SA 1UPAA 2QEQA 4DQLA 2OCXA 4Z6KA 1CFJA 1IIBA 1DCTA 3AEMA 2W6CX 3F73A 4J4BA 3MLAA 1Q1GA 5BQXA 2ZIAA 3C6KA 5KYXB 1I48A 1W5EA 3HJFA 4H7FA 3KPVA 1T8YA 3DB1A 2NPIA 1N2CE 1VHWA 2QD3A 2QDKA 1DCFA 3RJ9A 1EWRA 2DBVO 5DX5A 4YCSA 4AP6A 4CLRA 1RXIA 4E5PA 3ODPA 3UJ6A 4CT5A 3CUWA 2H1IA 3I2HA 1XD9A 2O23A 3R3XA 5H83A 1IHYA 2OQIA 4W7IA 3VJKA 1XELA 1PHPA 4JLNA 4B34A 4DT1A 4TKZA 3WRXA 4RY2A 1OV6A 3QHPA 5CVVA 3W4IA 4JX9A 1HC7A 4GICA 3UWSA 2C07A 1KXZA 4BGUA 2B21A 3A8TA 3CX6A 1EXWA 3PEEA 3TQTA 4L4XA 4QQFA 2BFWA 3CPSA 2VKQA 4ON9A 2ZBDA 4JAVC 1YDGA 2E2WA 1OASA 3R1IA 4K1LA 3M1LA 4ZV9A 2ZATA 3LDGA 2GM4A 3KZMA 3OO1A 1GPWB 4L7VA 1XN1A 2N1BA 1ZJJA 4IR7A 3EHDA 4F21A 2HA2A 1RJ9A 3U0VA 4YN3A 2XBLA 3BDAA 2JLRA 4N5DA 4AX8A 2CLOB 3E9RA 4KO2S 3EVCA 4X00A 1SVNA 3IAXA 1GUFA 1X7DA 1E62A 1N77A 3STXA 2VSNA 2ZTVA 2NZJA 4OV6B 1V11B 5JS2A 2QB2A 2W2QA 2RHTA 1XWIA 2P7IA 4BHDA 2AATA 4JI7B 3RYCB 4YIKA 4QQ8A 4KWEA 2OBNA 4CL2A 4RMIA 1YJXA 2ZIFA 4I5FA 3OZ7A 1BW9A 1RRFA 1NMEA 4BA4A 4HGNA 1B0PA 4H08A 3R3WA 1LLCA 5M4BA 4FFCA 9MHTA 1MABA 2C7OA 4TRRA 4DIFA 3VR2A 2DH6A 2XPCA 4PINA 3DEHA 1E69A 1VZ3A 1TQDA 2CE2X 5B1DA 4WK0B 2BFCA 3N1UA 4HVAA 3GARA 2GPTA 3GLGE 3AVWA 4OQEA 3H11A 5SY4A 3AXSA 2ZRKA 2DG2A 1YNUA 5BN5B 2IUEA 5A3RA 4XJLA 3KCNA 1JYSA 5KUTA 4HLUA 1E8DA 3MJEA 1AQIA 1YT5A 3IODA 5FP0A 4HEA6 3HA3A 2DT8A 3L93A 1AV7A 2WB4A 3HVHA 4WZAA 4A91A 3E5NA 1WLSA 4RJIA 2B3TA 4NDZA 4KR2A 2ADFA 1DHTA 3ESQA 2OBLA 5K9ZA 1VC2A 2IH4A 1XAJA 1Q1EA 4HS4A 4B84A 1M2OB 3C8MA 1JFFB 1XMXA 2C8KA 4N3AA 4LGMA 1TQ6A 2YZNA 3ENKA 4AZ3B 4IVRA 3TTSA 1V4BA 1US8A 1KC1A 3OCCA 3UK0A 4R6WA 3UAZA 1BGWA 5FT8A 1REQB 2C2HA 1E9BA 3C5HA 3AILA 3HLKA 1WCWA 5E6UA 2VUHB 4B35A 3UFXB 4QOHA 4NU0A 1RYZA 5IEBA 1QVAA 4KBFA 1GGVA 2CFTA 5IZCC 1BMDA 4PR3A 4PG7A 4UBNA 5IN4A 4GS5A 3ZOKA 1Q5PA 1T8TA 2YKUA 3GQVA 4WXPA 3RHTA 2HPAA 1NVDA 3QELB 1P2TA 1XWWA 5I3ZA 1X7XB 4Y1EA 4KACA 1U0BB 4HH1A 3OLQA 5REQA 4OMDA 2A4KA 4KBGA 2YWJA 2VLHA 4J03A 3R5SA 1LS1A 2HU8A 9ABPA 4RJLA 3HKCB 4I5DA 1UAAA 3KL2A 1EQUA 3WVNA 4JY7A 3BKXA 2VHZA 4KQCA 2VXYA 4RF5A 2I76A 4K87A 2FPGA 1PZXA 4PSCA 3HXTA 1GC2A 2PH1A 3B12A 2BCJQ 2O54A 3B3FA 2OXEA 1VSTA 1F51E 4R8KA 2FLKA 2FSIA 5IDYA 3CVUA 2PVPA 3A1FA 5C32A 4BJHB 2W8ZA 3BA6A 3EUCA 2RK3A 1QGYA 1SXGA 1YACA 2AY8A 2G76A 1AMNA 2QSRA 3PNKA 5EP2A 2ZTHA 4W5TA 4CLHA 1J90A 1XVUA 4RK0A 2YHIA 3UMSA 2VWGA 3TW8A 3FDZB 1MDFA 3UUWA 2B1IA 1CUYA 3DMYA 1VSUA 2R60A 3WX0A 4YMTA 1KQNA 2JFWA 3VI4B 3D9QX 1Z2PX 4NHEA 4MW7A 5DXAA 3CW9A 4WK6A 3D8TA 2BBOA 1P9OA 1JVNA 4EAAA 1BEZA 4Y7CA 1TAQA 4F4EA 4QAQA 2HLDA 4X1IB 3NUGA 5A9SA 4UEOA 3I04M 2EGGA 3PHHA 3OZFA 3U7EB 4Q1VA 3TUIC 5CDTA 1GCAA 4LDAA 5JXHA 1C1YA 2NXWA 3IOEA 2ZOSA 3ORSA 4LJ9A 5LDGA 2ZBEA 4AAYA 3F5MA 5DULA 2AT1A 2QTHA 4DMRA 1TQ8A 4DUGD 4F4FA 1ONSA 3CE9A 2CLSA 3TI9A 3A3PA 2F8SA 3R7WA 1CQJB 4WXMA 3P9NA 4OKIA 4LRUA 2VZ0A 1Y4AE 2Q2QA 4KYOA 2OXFA 1FQWA 4YRCA 4RWEA 1N8SA 5EIEA 1G59A 4ZGWA 2ZGVA 4MGEA 1TM5E 4YQEA 1FVFA 4DSTA 1PWZA 4QPDA 5KOJA 1TECE 2HLNA 3VTFA 5JBNA 1PVDA 3OTWA 5THKA 1SXJB 3BGWA 1FLDA 4MLDA 4RVDA 2XSZD 3PQ3A 3SE7A 5LXTB 4FYIA 4KE7A 4PAQA 3CRW1 2HJSA 3O47A 4UBLA 1MO4A 3GVPA 4DZZA 2GD2A 3QVWA 4Q1EA 2CXQA 4MYTA 1Q2XA 1OIXA 5FL3A 2A86A 2HPVA 3VJLA 5SY6A 2PKWA 1TI7A 2Q5CA 4Y2RA 2CNLA 2GA9A 5ULLA 2WQZA 3UK1A 1H2YA 3MTIA 3FTCA 3PQ2A 3SS7X 3T3GA 4KI0A 4CETA 4ZCSA 2X0RA 4K9QA 4D0LB 2I67A 3CNNA 2Q9CA 2XNHA 3G5LA 2VMWA 4IXMA 3MCAA 1XKXA 2CUNA 1PT9A 1OR8A 3N0TA 1PFQA 2ZYVX 4JJFA 4NE7A 3DZKA 2B9EA 2A9QA 2GD6A 4CV1A 4KXXA 3A6KA 1EB8A 4CRWB 3KOUA 1JEQB 4R51A 1HK7A 2IXAA 5LFAA 2WJ6A 5AVXA 4BRWA 1M0SA 5K0EA 3EX7C 4TV8B 1W2HA 2PTGA 1B8PA 4PYOA 1LQUA 3F2VA 2QN8A 3AZOA 1HI9A 3I5AA 3JQ7B 5JXGA 3A9ZA 1IVYA 2JGEA 1E60A 4JROA 1YBFA 4FI3C 3UAWA 1BJWA 2BI7A 3FVQA 4HD8A 2F9MA 4GVXA 1E2FA 2VYFA 4YDRA 3KCQA 1U9YA 2ZWVA 1QCZA 3EXG1 1AZSC 3K9BA 2PWZA 3D7MA 1SBTA 2PT5A 3P0HA 4NZOA 2BMJA 1C1DB 1UXIA 1FU4A 1I3LA 2XCOA 4FIDA 4QU9A 4INZA 1A9XA 3H0CA 3NW9A 1OB2A 3PD0A 1KNQA 4FYWA 3BK7A 4YY3B 1KI4A 2H06A 5F1PA 5DNEA 1NYLA 4BLPA 4UATA 2HF9A 2FQ6A 2O3QA 1W36C 3Q0EA 1P5FA 3JQFC 2J32A 3ER6A 4MQBA 4EABA 4QVIA 4C6SA 2OY0A 1VLHA 4L51A 2XUPA 1J32A 1Y0BA 1EE2A 1XLTA 1NDQA 4W7SA 4BB6A 2FB9A 1EJIA 3O21A 3DZIA 3L4SO 2ZJAA 3VOAA 1XZPA 1F6WA 2GAFA 2C1ZA 2GEBA 4CQJA 3AI2A 5LNK6 1H8EA 5KB3A 2E3JA 1QIIA 4P4TA 1I7PA 1X1DA 2WF7A 1ZMXA 1UWKA 4C4PA 1K86A 1NJGA 4HEHA 3HEAA 4YVFA 1KBOA 3CIFA 3LMKA 4NOKA 2Q7XA 2VZ8A 5HDQA 1UWCA 4YPFA 1WDLA 4R2IA 5E0OA 5E4YA 5CLFA 1CQ8A 3PD6A 4WLJA 1WF3A 4RAQA 3F5FA 3ZLBA 1MIOA 4KYVA 2O7RA 3D1JA 3M6AA 4HMPA 2ACEA 5FUMA 3JQ6A 1EGAA 3UJNA 4YJKA 4YRSA 3W8NA 1BFDA 1Y3IA 2C2XA 4EI8A 2TPLA 2CVFA 3T4PA 3U26A 1P18A 1Z8NA 1YHYA 4K5QA 4YBZA 2W8TA 1PFKA 5DIFA 3DAYA 3F7MA 1O4SA 3NHSA 4QHYA 3KPUA 4FDTA 2QP3A 4IW7A 4UD2A 3QFFA 3NHWA 3A6LA 1RP7A 2IIPA 1D2AA 1JEYB 3UV6A 4JI6B 3AATA 2O3SA 3FUUA 2JB9A 1MNAA 3BS8A 5DTRA 3V2GA 3ZH9B 3PGA1 4YUXA 4L0CA 1LDNA 1P4JA 3DOCA 2A57A 2FMHA 3B8EA 5B7GA 2GT1A 4G5HA 4KAFA 5LD2C 2O7NA 3PU6A 4TTIA 3SHTA 3U4CA 2QM0A 1YBVA 4HAWA 4B33A 1YZNA 5K8BA 1IZ8A 3GP8A 2YRWA 1SK8A 4BP8A 4JUBA 3RC1A 1K27A 4OC9A 4GYJA 3QEBZ 1XEXA 4PAMA 3P1TA 2CNWA 2XUGA 1UKEA 2YN0A 3ILHA 1DT5A 1Z5GA 2EWWA 3FSGD 2Q5LA 4WNYA 1M6SA 3VZBA 1CQWA 1SU4A 1ONPA 3A4IA 3FZ6A 4P3KA 4IYOB 3IQFA 4LOAA 3LG0A 2X3UA 5L6MB 3KJEA 4M8KA 4HXFB 2ZE7A 2VI9A 3I1JA 1ULUA 3EEQA 1MG5A 5BSHA 4EYEA 3SKYA 1NNI1 2PGNA 1JQBA 4BRUA 5FT5A 3OMXA 3U1VA 4ADEA 2WIGA 3AI7A 3KOXA 3KQYA 1NMYA 4L08A 4Y6SA 1HOTA 1UT8A 2H9IA 4JELA 2Z8YA 4OLFA 2AV6A 1V26A 2YKYA 4KNVA 2WWYA 4EKDA 3KEGA 4ZYLA 1OW3B 2PLWA 3H5WA 3W77A 2BDTA 1KK2A 1E99A 4N5NA 1IN1A 1KDTA 1MJNA 1JJVA 5KMGA 4RS3A 5A02A 2GFQA 3ZBTA 2Z2KA 4FYKA 3ZE6A 1E3QA 4DBLC 2B5WA 3PDIA 2DBYA 4YCAA 1ESEA 3TFUA 3QEOA 5A4JA 1SXIA 4N12A 5CH5A 1FYDA 2JJ2A 4RPIA 3REOA 4C21A 1TUGA 1ULBA 3EIFA 4DJFC 1V3TA 2G5GX 2Y9MB 3QKSA 2BFNA 1N7JA 2UV8A 5AM5A 3T0IA 5KOHB 3Q12A 1FXSA 2FPUA 3TQHA 2JG2A 1LDGA 3PC8C 1QYDA 2QL6A 4BMOB 1GQSA 1UC4B 1FJXA 5JPIA 4GPTA 4DNPA 2HWYA 3AEZA 1PTJC 4LNAA 4AQ7A 3SX0A 4ZICA 3N2ZB 1GL7A 2HTEA 1P9RA 3HLMA 5IG2A 2Z57A 3AINA 1ARGA 3L0ZA 1G38A 3GRAA 1DXOA 4PHFA 4FMBB 1GPKA 2ORDA 1C29B 5C37A 3N3AC 2C00A 1M34B 4PFNA 3RABA 4KIWA 2REOA 4DQ0A 1QDLB 3WZ2A 1C9YA 3R7DA 2CZGA 2JDIA 2C59A 1EU1A 5EVJA 5JSZA 3VMMA 2YNMD 3FMGA 2PO7A 4DNQA 3U1TA 2QRZA 4KMSA 3GUHA 3FI0A 4QD3A 4LKRA 4DREA 2RGGA 3CSUA 1EYZA 2IW1A 3LKBA 1JQJC 3H2YA 4Q1CA 4DIMA 3D7KA 1WMEA 4GH5A 1TRHA 4RV5A 1TMYA 3K0CA 1AB5A 4IDEA 4EUEA 5M29A 4MHOA 3R40A 3TZLA 2PY6A 2WV7A 2FUNB 3PNLA 3P0FA 4MUGA 1O95C 1LNSA 5B55A 3HP4A 3P9RA 2AMVA 3U19A 4GSKA 1NXXA 1GAWA 2VPZA 2HCJB 3GR6A 1YVUA 1KMIY 5CB0A 3O94A 1F9AA 3N2GB 2W2MA 1T5IA 4FI3F 5IJWA 1MC1A 1KSFX 1M66A 1XU9A 3KSMA 1LB1B 1V45E 1M8FA 1S89A 3U4GA 3H7AA 1SKMA 1TCCA 4IDFA 2FI1A 2HO4A 3DZFA 3GUVA 1PKEA 3G02A 2NVWA 4HTFA 3N2YA 1F8YA 3FVXA 2BOVA 4GPIB 3DE0X 2OKGA 1X19A 1YO6A 4F5EA 3LD9A 2WNSA 3O7MA 2NU6B 2WAAA 2VI8A 1KBZA 3Q8XB 3JQAD 2B4KA 1ZX1A 3UXMA 5EKSA 5G1PA 5EWMB 3GPDG 5FWNA 1PYGA 5JH7F 3STVA 3DEJA 1W44A 4IDHA 5KYTA 2IUFA 4DGTA 3LZCA 3FYUB 4O1HA 4FCWA 5BR7A 1TVCA 1F7UA 2VDOB 3KLMX 1AT1A 1R16A 1XMSA 3BBLA 4FR5A 3CKKA 1ZWKA 4O25A 1F60A 1H1CA 3GIDA 4BWVA 1KYVA 5DDIP 4F9GA 2MMCA 3VQTA 2VRCD 4AZWA 4EYQA 3MPOA 1L2TA 4XYMA 1SHLA 3ZWPA 3C2QA 1ARSA 3D5EA 1JT2A 4GOJA 2X40A 3ZHRA 2BP7A 1C3OB 2OBBA 3O8NA 3EFOB 4CODB 1DAPA 5JT1A 2FWIA 3FHCB 2QU7A 1JHPA 1G21A 3NHUA 3HU5A 4XJPA 1TLLA 2CMHA 5FWDA 3X1YA 2Q1WA 3TSZA 1LZLA 4K9RA 4AKSA 1WCYA 4FR0A 3V9AA 1T9DA 5J23A 1S2GA 5B36A 4K0KB 5I47A 3TE6A 5GJWC 3E53A 2P5TB 4GBJA 3ID6C 5T3UA 1Q11A 3L06A 3SZGA 1J5XA 1FS6A 2JKYA 5EUQB 3MHTA 4QGSA 4L27A 2FN8A 2ZZNA 2CINA 3H2IA 4CKWB 4AKHA 1ICIA 4PCAA 2FSGA 3C8UA 4QWMA 2PPVA 3EH2A 1JNXX 2HGSA 4NJMB 3NJRA 3L5OA 1Z7EA 4OK5A 4AG3A 8GPBA 3SZ3A 3DZJA 5FOSA 5AKEA 1J7KA 4K2HA 1EJ0A 2RFLA 1NPYA 1KH1A 3OWHA 4R1TA 1DKPA 2FEWB 6PFKA 4YCNA 2OC9A 4W5NA 5C2JB 4GI7A 1ENOA 3CSDA 2VIBA 1JEAA 1OFVA 4ETMA 3N5KA 4NBUA 3H1PA 2XE6A 5HQ3A 3B9BA 4FFOA 4OQQA 4OUDA 3WLAA 4ME6A 3IEVA 1R1DA 4JEWA 1RYBA 3GPCA 1QX4A 2C44A 3FTEA 5C52B 3ACDA 1LC5A 1Q83A 1FDUA 2NO7A 4W1XA 3CUSA 1V4VA 3S99A 4WESB 1XEWX 1GZSA 1R4NA 2D5AA 4E7PA 4R5FA 3E3OA 2Z09A 3JD1A 4CDRA 1RRGA 2D2IA 4I99A 3IPYA 1Y7IA 4FEEA 1HT1E 5AOBA 2J3DA 4QFCA 2XKJE 4RJTA 2GDZA 3C3BA 1SCQA 2PMBA 2WM9B 4HWSA 4QDXA 4UD6A 2LE0A 4FD3A 3RJMA 2IEBA 1TAHA 5GQSA 1JT9A 1PV1A 2X5XA 4WJKB 1ZM9A 4DHWA 1GGNA 4AURA 3T61A 3K9FC 5CBKA 2IHUA 3SBXA 2EC5A 1T15A 2JCGA 3MMNA 2G83A 3U5TA 3PCTA 3F97A 5ALQA 1GGHA 1UBKS 2J3IA 3V4LA 4W63A 3H6GA 4ZVNA 1IHPA 4HYQA 1PAUA 1O96B 2AD1A 4LZNA 2O3TA 1AG9A 3NT4A 5K6TA 2Y6VA 1A9PA 2GFIA 2D1QA 4YWHA 2GNPA 1R4MB 1KI6A 4EHNA 1PYOA 3UW3A 3HVUA 4RZHA 3R6GA 2PH3A 1SBNE 1C9DB 5TPZD 2BHSA 3KQMA 1RZ3A 1VKNA 4KNWA 1V8ZA 4AVYA 4CR8A 3R0JA 2BGJA 3DTVD 2XA9A 5EHXA 2DR0A 1H9CA 2JGTA 2P1RA 3AUFA 3WOHA 3PNQA 1WDWB 4RF3A 3TWOA 1GA4A 2Q3BA 4IW3B 2QTBA 1MG0A 1CR2A 2ZG6A 3HCBA 3DFFA 1YS7A 5T8KA 2E7ZA 4KAAA 1MIHA 1PJRA 1KK3A 1OXOA 3G1UA 5FD8A 4M2MA 2PK3A 5JXJA 4CMKA 3EFHA 1NZJA 4EX6A 3PPWA 4B6GA 2YHAA 2ZRAA 5GV7A 4KHPB 5K99A 4E03A 3UT6A 5IWAB 4I7EA 1NHWA 1LRJA 1TZ2A 4MV9A 3DF9A 4O1IA 3OOYA 1RTKA 3F71A 2R47A 4JYBA 1C9EA 1NFQA 1ZJ4A 3E8XA 2R6FA 1JS6A 1YXMA 4ZKEA 3WYDA 2VDLB 2FSPA 1B42A 1Q91A 4OBWA 3W2GA 2H2HA 4GSLA 4B6SA 3L92A 1PHRA 3EA4A 4PV7A 2GPNA 3TOXA 2UDPA 5M2QA 4PGAA 1VJ5A 3IJEB 2YIJA 4U0JA 3GWPA 4J7AA 4M9XA 4DLVA 4FWIB 3ZCQA 4EUHA 5JUWA 1ODLA 4UUMA 2PFKA 3JAWB 3TLKA 1FSGA 2IPLA 4MP6A 4J16A 2R25B 3I9KA 2VYND 4BQFA 4EZBA 1OFGA 1KMHB 2XADA 2ZSKA 6REQA 3BDIA 3ISVA 2IDJA 5TPWB 3RUCA 3A14A 1LKZA 1F17A 3H2SA 2F2TA 2V5UA 4LMRA 5IT5A 1V71A 1KKUA 1XTTA 1E0SA 3AKZA 4EKIA 1PR6A 3K0AA 1P4AA 1UFOA 2I7CA 3TVYA 2CVZA 4X9XA 4CL0A 4F84A 3N7NA 1L3IA 4OGFA 3TD6A 3QRWA 3UJPA 1QIEA 3JQGA 5ALDA 3P27A 2H63A 3MRVA 2F43A 4GO1A 1NZFA 2QMHA 3PNPA 5ICMA 3KSRA 1E3TA 4D7AA 2VK4A 4KXNA 1GM5A 3FM9A 3MKJA 5H59A 1CJCA 1MLYA 1YDEA 2FUKA 2FFQA 2BTQA 3WCOA 3F7OA 3Q7EA 1B0ZA 5JY6A 2PX2A 4GWLA 3D4OA 2GZMA 1VA4A 3BSSA 1F2TA 3BH0A 4F9EA 3WLMA 4D97A 1CKEA 2FXVA 4MRSA 1XHFA 1PSZA 2P68A 1ND5A 1ASGA 3QKWA 1WPGA 4NYJQ 3C1UA 3SC3A 2AOVA 2JCXA 4BEVA 1KAQA 3USCS 2Y0CA 1Z2AA 3M9XA 1IB0A 1BNCA 1CUVA 1PWXA 4NEHB 2J9YB 4DEXA 3OJWA 2FEPA 1JU3A 4TL8A 1ZH6A 2RIRA 4O8CA 3CNEA 3SG0A 5TDHA 5LQNA 4PC3A 3ZBQA 4DBLE 2AHRA 1W7NA 4X3CA 4IH4A 1GPJA 4J3JA 3FTPA 3OJXA 5L3VA 3ZHYA 1U2RA 1Q6YA 1RAFA 4JI2B 3V6MA 1WW8A 3W3ZB 3QUBA 1E7MA 2WKPA 5EJ5A 1E1YA 1ZSYA 2N9UA 1T8PA 4QASA 1HT2E 1OGJA 5ADVA 3PDBA 1NXVA 3Q3JB 4AJLA 1R5NA 3QQ5A 4F6LA 3IDAA 4RXMA 5EKDA 2Y3IA 2KFPA 2WFMA 1JPNA 4KGXA 1VL6A 1YIZA 1JEDA 2JGLA 4GKBA 2A5JA 3SF8B 4WBSA 1M0TA 4MS1B 2LW7A 3PT9A 3LZDA 2WOJA 4FL0A 1LTHR 1I7QB 4WERA 1FW6A 4MLZA 2H2WA 3GBSA 5L53A 4B75A 1QRDA 5KQMA 1WQ3A 2F64A 4UAJA 1Z06A 1PZNA 1ZD4A 1L3BA 5BSTA 2IZ0A 2PKQO 4UOYA 3PFCA 2XUIA 2UYCA 2AYYA 2YFHA 3IALA 5B1IA 2YWGA 1QTNA 2O5RA 2ODTX 1ZA1A 3I30X 3I4FA 1VBMA 5CFMA 1EHYA 3HB7A 1OAOC 2MMGA 2QG6A 2W6ID 3JAKA 3ZWWA 1RHJA 3K9NA 1UXKA 4PO9A 3UATA 1N8KA 4C4ZA 2VNIA 5JBQA 1TO1E 3TRJA 2R8XA 4LV6A 2ZSAA 4FGZA 1WVMA 1ISFA 4BLUA 3PWTA 1C4OA 4Q3NA 2XH1A 4CQLA 1DDOA 1EK2A 4IY7A 5DOZA 2E55A 1NRXA 3BCSA 1E2BA 4URVR 3FJYA 4LFBB 5EIHA 3OE1A 4G3XA 3VC7A 3H05A 4P3PA 3FZQA 2BHLA 2Z2ZA 2ZYTX 4CLRB 1CHNA 1U4OA 5EXTA 4OFWA 2XOKD 4I4NA 5CFRA 4WJZA 3RT1A 3V1KA 1AJEA 3LA8A 5BUQA 1LDBA 1Z6AA 4BFUA 3TXYA 1N2ZA 2IDKA 2XYQA 3GJRA 8OHMA 2GYYA 1R6UA 1UFQA 3JQBA 5JDIC 3NM4A 1BEEA 4Y9TA 2WP0A 1N5OX 4ZO6A 2PS0A 4G4SO 1CLEA 3U61B 4R1UA 2UXCB 3THYA 1F2DA 1SC1A 1UPBA 3CZ4A 1DFOA 2R0QC 1ZONA 4C87A 1T4MA 2OD2A 3B1CA 1XPUA 4H51A 4DMLA 2JI6A 4U2KA 2D2VA 1DAHA 2GAOA 4GRDA 3ZXIA 4DZRA 4F86A 1RJ9B 1ODFA 2IOHA 4N3CA 4N7MA 1QG4A 1DUVG 1Q1AA 4I4LA 4AZVA 4TXJA 4L5CA 1P19A 3TG8A 3NFYA 1BG6A 1YBHA 5AKJA 4HX2A 2FWPA 3IEXA 5ENZA 1O9HA 5MN4A 3H9CA 4BTVA 3KYIB 1GPDG 1GHTA 1UZLA 3FWNA 1Y3HA 3L1VA 4P7JA 3EIAA 1IUNA 1SVIA 1UKBA 1BW9B 1R5OA 3L4EA 2Z5LA 5FV4A 1ECJA 2OHJA 1MABB 2P4SA 4Z1OA 1GFWA 1UKJA 1TATA 3UBMA 3DMDA 5LKRA 3R6LA 3G2LA 3EXHA 4AJKA 2BFCB 4ALMA 1PZMA 3E7WA 2JI7A 1W48A 4GP9A 4NDNE 2Q8QA 1B23P 1U0RA 5TEVA 1Z5WA 3IXLA 4NBRA 4X65B 3LCUA 2CCKA 3FNFA 1I94B 2UYQA 1NUPA 2ZVDA 1VKHA 3I34X 3S81A 4TQAA 4A6RA 1TEZA 1Y6RA 1O77A 4X8HA 3CX8A 5NULA 1A8HA 5HSGA 3IL2A 4D8YA 2JH9A 4QZVA 4R9NA 1AMSA 1AKRA 3FZEA 4ZP1A 4EAQA 2FQ1A 3HJGA 4J1NA 3C45A 4IH1A 3WWEA 3TDKA 4B3CA 2ETXA 3Q2KA 3P9QA 5KHLB 1LXCA 4LQDA 1KDPA 1US8B 2JK0A 3NR2A 2WG0A 2Z08A 3G17A 3Q1LA 3O3OB 4NNJA 1S5PA 2VA8A 5E6UB 3IEUA 3I09A 1BKDR 2XR1A 3GGOA 3VR5H 1SKYB 3LQFA 2IV2X 2HI0A 2P2GA 4GLLA 4HDQB 3J7AC 1MVOA 1JJIA 1HFKA 4YMGA 3IMFA 3MG9A 4EM6A 3VI3B 1BXGB 1JVBA 3HO8A 1Y37A 4KIJA 3M9LA 3A6EA 5E7QA 4XWYA 5DYTA 2CHEA 4KN8A 1XCGB 4CCWA 4X24A 4WGFA 2GK4A 3QGMA 3O83A 4NY1A 3GLGA 4BBPA 4JENA 4DVGA 3O4JA 1PTKA 3W3AA 4R9VA 2JJHA 2OCAA 1UDAA 1RXCA 5ALYA 2A5GA 1Q0HA 2VHYA 2FPGB 1X15A 2EX0A 1RWPA 2FETA 5E1BA 1I1OA 1GARA 1N1DA 1GZDA 3LDUA 4DLYA 3F6CA 1P61B 4GWGA 2C1EA 4DIEA 4LBZA 3JQPA 3CGWA 3CG0A 3IVRA 2HRRA 3IRVA 3K1AA 5FNZA 5KDOA 4WLVA 2YHIB 3TLZA 1L8LA 2DYKA 3TW8B 1NQWA 4MUKA 4PSVA 3ZBPA 2IKQA 1Z73A 4MI6A 2J33A 4OSEA 5BSMA 4XFKA 5GIOE 3EZ2A 3SYMA 1S3IA 1WRBA 2BEUA 4YRZA 2NPOA 1W9HA 1NYRA 1OZGA 2MSLA 4R98A 2XW6A 5JFTA 3I2KA 5TMEA 3S1LA 2ZIVB 2PS1A 2WK1A 5A9SB 3Q1KA 1J49A 2H29A 4DV4B 3SOPA 1V39A 3U4IA 2LTAA 4FIZA 4N82A 4DJEC 1Q2UA 2J07A 3VJRA 5JY1A 2D74A 2UUBB 4Y2SA 3DSRA 5IJAA 4NF2A 4LIPD 3FDFA 5FBVB 3QPWA 1LTQA 2YBDA 4OREX 5I8WA 2VJBA 4LY0A 2RHGB 3U1BA 5JJIA 3KVOA 1WSBA 5LWQA 1E1DA 3R7WB 3IA2A 4ZRNA 4ECEA 4NXMB 1Q0LA 4BO0A 2QXUA 3I2YX 1VHTA 2C2WA 3HVKA 5I7WA 3DZHA 4BTEA 3GEIA 1T0BA 3HL2A 2GTPA 2BHTA 3CRMA 4LMBA 5KOJB 1AMRA 2NG1A 3E3LA 1J2TA 3ASZA 3KETA 4UBOA 5D84A 4XJVA 1M8JA 4QOFA 4ZI7F 3L8GA 3H8WA 3ZTWA 2EFDB 2O4UX 1TO2E 3QPBA 3RRXA 2OM2A 4S2UA 3VK2A 3GUYA 2C5GA 2O2CA 4BFVA 3P71T 1KOFA 4F91B 5KSZA 4N47A 5HFNA 2XUKA 2I8AA 1AKYA 1KQ3A 3IYLW 3IBCA 1H6AA 2MCFA 3JATA 3DVRX 4QJBA 2GR9A 4WCFC 4MYRA 3RIHA 4LZWA 4RGYA 5BWOA 4EW6A 4UZEA 1ZBDA 4V0ME 2F1OA 2R85A 1SC4A 1Z17A 2NOAA 1ZHOA 1ZP6A 1KYIA 1ZGHA 3GGGA 4FZVA 5CBPA 1PSWA 4CGYA 1XTPA 5DMHA 5BOVA 2Q5EA 3BILA 4MRVA 1CDEA 1QGUA 4B40A 5ALIA 4OA8A 1EAYA 3QXHA 3OBIA 4B7CA 1NVBA 3WLPA 3SHVA 3W1VA 5JSKA 3K7EA 3IQGX 1HETA 3PPXA 1RZRD 3RVRA 3P45A 4X3PA 2ON6A 4QJ5A 5BSVA 4Q9IA 3W7VA 1FUKA 2B1QA 1FZTA 2WI8A 3OICA 3ZDQA 3NDNA 4OG2A 1JDUA 1EK5A 2X9NA 2KYRA 2A3NA 2OPHA 1Q0UA 4Y9RA 4YAFA 1JE0A 3RREA 4BAUA 3ANYB 3GN1A 4UCWA 5KC8A 3OZVA 2FN6A 4AXBA 4IPTA 1TLFA 3VPXA 2EW1A 2AEFA 2XD4A 2P2NA 1A9XB 4FNAA 2BMDA 3KSBC 3KXLA 3ADKA 4JOQA 2PJDA 4U2CA 2PZAA 2C7TA 4YP5A 2PEYA 4CXMA 1XI2A 4HHEA 4OAPA 3B2EA 4R5ZA 1CY0A 2WHXA 2ID9A 1U9CA 3AU9A 5C7IO 4C3OB 2ZXUA 4W8OA 3L8EA 1GL6A 2VMNA 5DWQA 2BI4A 1KF0A 3SR0A 4EMUA 4XLZA 4RIFA 1QRTA 4N54A 2GQNA 4H6WA 1TLTA 2ZB8A 3N6VA 1QH9A 5IAKA 2NO9A 4A36A 1MAVA 1GTZA 3JWIA 1U7WA 4I1YA 3L4BA 4J4TA 2HBRA 2P2SA 4L3OA 3E03A 3HA5A 3NALA 4ILEA 4MV4A 1MBZA 2CHFA 1HRKA 2R8BA 1IDOA 1PJLA 3ZYZA 1NJ8A 1DKRA 2AXNA 1DIHA 1G3MA 2BM8A 1TTHA 3V4RA 2ATVA 3Q9NA 1NJ5A 4AY6A 2QPOA 3F2IA 1U1CA 2GN1A 3RIEA 4BUCA 3RD5A 1CZHA 1JAIA 4E5KA 2QLNA 3PD6B 3QHQA 3SFZA 5CB4F 3QPUA 1T36B 3OTHA 1MIOB 2JIQA 1SEVA 1HORA 2WWWA 4UM5A 3Q15C 1ELUA 2PDAA 3C3EA 4NMXB 3CBGA 3S40A 5IBRA 3I12A 1R8YA 3QOWA 1CFZA 3GZTB 3SCZA 2IBSA 3I2FA 1ELQA 5BUZA 3CQ6A 5HILA 1LRKA 3I39X 5FLXA 1PFYA 3DL0A 4JCCA 2VNHA 3AF5A 2SECE 1N25A 1V16A 1OZAA 1FU8A 4UTRA 3G13A 4B2YA 1QZTA 3EC2A 2Y27A 1DBQA 3W6ZA 4MUBA 1HWYA 4IXDA 2MSCB 3C48A 3GA7A 1K8ZB 1DV1A 2H1RA 4CFSA 1JAYA 2SKCA 2VBIA 3LYLA 4D0RA 2C82A 3SF0A 4TSFD 1RQ2A 2AVDA 3HCFA 4PYRA 3TTYA 1TIPA 1S2LA 4LI0A 4NMLA 1FTWA 2JGNA 2ANBA 1RBZA 2RCYA 2R7NA 1H94A 2X5DA 4IRXA 4U3JA 3TJZA 4NESA 1NPTO 1YDFA 2ZULA 2R5EA 1GUDA 3KDAA 1N9GA 2GJKA 1C4XA 1BHJA 1EP1B 2I29A 5ES3A 4WNAA 4B44A 3ZZMA 1OX4A 1XEXB 3WLHA 5LQCA 4R2MA 5AVJA 5LNK1 1IRXA 3CIOA 3MTBA 2YOBA 1WXGA 1NRJB 4H1UA 4YP1A 3WISA 2O2DA 1G5FA 2OG1A 5JAMA 2ZYIA 2ST1A 4JITA 4KQEA 5FJJA 4C5BA 4CI9A 3RT7A 1XMQB 1DRWA 3AEJA 3C6XA 3A9WA 4L0QA 4DG5A 3I9V6 4H4DA 3JD0A 4D9JA 1NVVQ 5JSYA 4NYMR 4RZ3A 3P9YA 4JB8A 2NPFA 3DXFA 2PO3A 3A1WA 4JBLA 2C4TA 2OK7A 5E3HA 2D5IA 4XTCS 5CK5A 2WAXA 5EPOA 2VF4X 4UHNA 3UKDA 3C3AA 4GOXA 5CFOA 5SZHB 3PKJA 2QL9A 4TT3A 5HKKD 1Y8AA 4RAEA 3FHOA 5KPDA 4LXTA 4PGFA 4EJ6A 3A7EA 2DKNA 2IPAB 1DKMA 2FP3A 1IIRA 2RAUA 2C2KA 4QT4A 1I33A 1JE1A 3QX8A 2GCGA 5KMGB 1O8CA 3F47A 3I2GA 1CYEA 1CUGA 1XZIA 3PDIB 2WKAA 4YJDA 2FZ4A 3L8MA 4URXR 2YINC 2GEFA 1UDBA 2JLQA 4ZV4A 1DKLA 4RXUA 2X0IA 2RAVA 3QKSB 4INAA 3PQ8A 5ICFA 3PXBA 1M2VA 3LH5A 4Q47A 3K2IA 4MRMA 2UYYA 5E2BA 1B6RA 3CZRA 3B6JA 1IK6A 3ZX5A 4RHCA 2IXBA 1ZC9A 1P0IA 5AKLA 4H3HB 4ZAVA 1XAHA 3I73A 4CUJA 4PYKA 3NBFA 4KHZA 1XK6A 3W8FA 4AMUA 3DBLA 3HVRA 3O3MB 3IH5A 3TTTA 4W5WA 4Q24A 2XGSA 3VNVA 3ZEIA 3O8QA 3C3YA 2ZR7A 1KEEA 1LV8A 3CUKA 2X8UA 2XRMA 4HDSA 2ZSDA 2E5LB 3UGTA 4N0EA 5JSZB 1SIWA 5JD5A 3V7UA 1Y4UA 3NHBA 1Z5VA 4CTNA 4RPLA 2XODA 1E89A 2H2DA 5EL0A 4NPHA 5E6SA 4LSGA 5CB6A 3D54D 2BW0A 1FDIA 1QB7A 4HFRA 1ST2A 4I5GA 3B46A 2YXEA 1RRCA 3K94A 4NBVA 1J25A 2GS9A 3D0RA 2C7BA 4P32A 4E08A 3SZMA 3R0VA 1DO8A 2FWMX 2Z30A 1LY1A 3VK3A 4KQHA 4EPWA 1R15A 3IC5A 1DIGA 1S08A 3K8QA 4E1AA 4P3YA 4IYJA 3T0GA 1S0UA 4DDUA 1G5QA 2HU2A 2XITA 3H2ZA 4JBGA 4GE9A 4WFKA 4EGJA 3DGEC 5JYDA 2AYZA 3GLRA 1OZ0A 5L3SB 3HWWA 4L74A 2ZT8A 2ZI5A 4MEAA 1ODTC 1VE3A 3CO5A 2JASA 2BWOA 4JQSA 1L5OA 2AG1A 4DLPA 4Y2GA 1TYDE 1Q15A 1BZYA 4TYYA 2Z1NA 4PYLA 5AI8A 4OLAA 3AOEC 2WHEA 1NATA 1YVDA 2A3RA 2QTTA 2YZ2A 1AC5A 4J1TC 1SUEA 1Z22A 1WMFA 2WVJA 4HTFB 3WIOA 3JTEA 1CQIA 4RFVA 1H2RS 3W4JA 2DSNA 1NXSA 4HGPA 2ZT6A 3BMOA 3S6JA 1NXTA 5HK9A 4LSWA 3DJYA 2C3MA 5J4YA 1XGKA 4DW8A 1LPPA 4RZIA 2OLJA 4ZC8A 4W99A 2EFEB 4CG0A 5F98A 4NCXA 1Z62A 1V2DA 2NU7A 5CMLA 3KHSA 3U60B 3D6HA 4K0RA 1TK3A 5D87A 2PJZA 4ZTUB 1U7ZA 3FKSD 3T5BA 4KDCA 3QF4A 4KNYA 3HO6A 1I0LA 3KSAC 1ZU5A 3HB9A 3QM1A 3P26A 4Z4HA 1I9GA 1D0SA 2D0IA 2JATA 3RIGA 5CJJA 4KKVA 3B2NA 5F9FA 1FQJA 1T0PA 1FVXA 4E33A 2P9HA 1UBEA 2WLTA 5HJ7A 2BP7B 2XDQB 1QXSA 4HGZA 4ALKA 3AEQA 1K2WA 5KIAA 5CW2A 2OCYC 1G2QA 1G21B 3VOMA 5C8YB 2Z0MA 4B48A 1EESA 1TZCA 1BFUA 5IZCA 1E1QA 3QNUA 5JS7A 2WJHA 3DE3X 1GV1A 2R66A 2Y77A 1R0SA 4R2NA 4MZXA 1A2KC 2A0UA 2DGMA 2B7CA 2O59A 5D51S 5CYGA 2AN9A 4PTLA 4OMFG 2R00A 4BMYA 2Z4SA 4XTRA 2GN2A 4I50F 3F5SA 4FZ3A 2H7VA 2F1HA 4NK5A 1LFDB 2EGUA 5DNCA 4K6KA 1EB9A 2GEKA 1L3CA 3PITA 5ED0A 4MB6A 4U2GA 5JTUA 4LZAA 3ZE1B 4LWQA 1GGEA 5HZMA 1Z6TA 4KQXA 2WY2D 2CHQA 2V6IA 3ZY6A 1E3DA 4NOGA 4D43A 1GPH1 4TZKA 3KAKA 1OY1A 2ZRHA 1Y81A 3QLJA 3GLHA 5KNCA 3S8MA 2E7UA 2C81A 5LLSA 1XV5A 3VAZA 2EZTA 5HQ3B 1KA9H 5LUAA 1RU3A 4TV9F 4OUDB 2OT3B 3LNCA 1IC6A 1X39A 4AC9A 5DB5A 1L0BA 4EB0A 3E2FA 1OV4A 3ZD8A 2P2YA 4B6QA 4D4IA 3MUNA 3UB4A 4RM3A 5L4LA 3PYMA 3VR4D 1C9JA 5LN1A 5CYOA 5I6DA 3C24A 3I6YA 4Q4CA 2DR1A 2AYXA 5EQJB 4YPVA 2ES4A 4ZM3A 1JBEA 3RSCA 4IJ6A 2MSWA 1XL0A 1XTSA 3TGPA 1Y80A 3RRMA 3KOZA 2Z1DA 1U81A 2WZBA 1TRKA 4KV7A 4FCTA 4PTZA 2VA9A 1YB5A 4ZJZA 1K1EA 1L4MA 5FIUA 4G8JA 1YB1A 3MEQA 2ALJA 2AWOA 1J0CA 1DX6A 2DPLA 1YJQA 1QCDA 1EFHA 3ZRPA 3O4RA 1D09A 5EZ5A 1P75A 3LUHA 3GEPA 2D65A 4RGVA 1UJNA 3L7LA 2W43A 3GI1A 4D0NA 5COAA 2HBYA 1ZZGA 3F1LA 1E2EA 2WU1A 1NV9A 1XN4A 1NBMD 3OA0A 1ZSVA 4FKZA 1SCNE 3RQIA 4JWKA 2DKJA 4UHCA 3FR7A 1DQRA 1KI6B 4BMSA 2WWRA 3ZPXA 4G4IA 1O89A 2DQZA 3U7QA 4JEHA 5BSGA 1JS3A 2A1TS 3TJMA 5FUXA 5IYZF 4TVBA 1N34B 1Z68A 1JWAB 3VYSB 1PEKE 3OZWA 1BE1A 2VZEA 1P7YA 2V4MA 3W5DA 2O1SA 3QN6A 1P9NA 3CTPA 4PRKA 4XDZA 3IDSA 4A1FA 1KEKA 1A4UA 2LR0A 2VPTA 4XFJA 2DFKB 2D5BA 2RHRA 2D59A 3KBBA 2BMVA 1IBJA 4L76A 1G6HA 1U11A 3FIJA 3RUYA 5SZJA 3LLSA 2DR3A 4I2VA 1O0BA 1YIDA 4OGGA 1YZTA 3JVVA 2YOFA 4C03A 3ANLA 2I66A 5TQ2A 1H8HA 3UKJA 2AEMA 4KXUA 5BSKA 1IU9A 4I6GA 1JIJA 5AT1A 1KFJB 3WO1A 5BW4A 2TMYA 2W5UA 2AXPA 1EXDA 5CGZA 4Y6OA 1GTSA 1X42A 2R6ZA 2O2IA 1TDJA 3V8EA 2X9GA 4UXHA 3C98A 3NYQA 5JEDA 2AI1A 5E3IA 4G2TA 2LV8A 4GGOA 5CB8A 1VFPA 2A30A 3GJXC 1SQFA 4TTRA 2W7HA 3WK6A 1PL6A 2A33A 2E6KA 3RGGA 3TZEA 5JSFA 3M6VA 3MAAC 1C3EA 2GYUA 1Z83A 4BYMA 3CO0S 3PFNA 3AVYA 1F0KA 2EKDA 4BVAA 4P92A 4L2IA 4QBKA 4REOA 1NUAA 1NW5A 1KZ4A 5JZMA 3QU5A 1ZM4A 3NIWA 3P2MA 4M4SA 5JH7A 4HWPA 4JUCA 4M1EA 5KSPA 5E4JA 3X1XA 2P78A 6REQB 2TMGA 2ODEA 3R5HA 3R9AA 3WMXA 4RLHA 1OHHD 4WYCA 4IVPA 5HZKA 3OIDA 4Y98A 4PNHA 1AJRA 1MLDA 1S06A 2GGSA 3A0UA 4GMHA 4YDHB 3TPZA 5TGDA 2PFGA 1DJEA 3MVEA 3K0AB 3SS9X 1CUCA 3DEYX 2CWDA 2IOFA 4ADBA 3KGXA 1UMKA 2HU7A 2HIMA 4PZAA 1AKTA 1PCXA 3A1EA 2SKEA 3JD2A 3JQGB 4X1YA 1RAIA 3GF4A 4J0QA 2B1JA 1QHIA 4EATA 2F43B 5F1OA 1E6CA 4X7BA 4YJGA 1V72A 4KMMA 1JS1X 3DKRA 3WMRA 2E4XA 1D9ZA 1OMOA 1ZQ1A 3OHMA 4UTXA 1R0CA 4RGBA 4ZCRA 1L5RA 1RLMA 5FLYA 4KW7A 3MT8A 3ZDDA 3NYSA 3CX3A 2BTQB 1OU4A 1X38A 3IFSA 3TPFA 3QJ5A 1CJ0A 3STHA 4KAMA 2F8LA 4NS4A 1FG3A 4JOBA 1LW5A 4X6UA 1NVWQ 4EMTA 1CC1S 3DMGA 1F2TB 2BKWA 4ZO8A 2HHJA 4TXLA 3D0KA 3JQCA 3PEVA 4MYSA 4OHXA 1XHEA 4AECA 2PIDA 1W5AA 1WUHS 2GO1A 2W42A 5I9NA 4FCCA 1DRVA 2ZUFA 4HYTA 3I58A 3G9TA 4PQRA 1U7OA 3O75A 1DMRA 3U4AA 2ORYA 2GKOA 1SUPA 2LKCA 5D5HA 2QY9A 3G8DA 5HOQA 5D7NA 2VGTA 1FFXA 3NXSA 2NVBA 3AM3A 1JA1A 2RI0A 2I4MA 4U2EA 1AHIA 4KAXA 5CCDA 1Q57A 4DLKA 1N7HA 3GJ4A 1E6LA 3LCRA 2P7HA 4RTOA 3KXIA 4OO3A 1CXZA 2AA3A 2J6IA 3BQ9A 4IIDA 3ZI0A 4X5OA 4V0LA 4YPOA 3F7TA 4QHTA 4KUHA 2QW0X 5IXJA 3TECE 3DOIA 5CD1A 4JEVA 1OKKD 1WD7A 3IUPA 3LF2A 3I61A 2R9VA 1G4AE 3CR7A 2AI3A 2BSQA 4NYIR 3L7IA 4JP1A 3PDBB 2V6JA 2GBLC 2COKA 3ZU6A 3DXZA 3DTYA 3E82A 1K0FA 2C96A 4EA7A 3TOCA 4KMOA 2IT1A 2L0XA 2YW2A 1JDJA 3QLVC 4N5MA 2HHCA 2OPBA 3PZRA 1VLQA 4O6ZA 3Q6MA 3TW0A 4CIBA 2F3TA 3NP7A 4ZWMA 2RGYA 2XNJA 4EKEA 2WYHA 2I2CA 5JDCC 5K51A 3LFHA 2TYSB 4G0NA 1RJFA 4Q7EA 1UR5A 5AD1A 3GRVA 4LWOA 2ZTMA 5A4DA 4N8EA 4X95A 3PR3A 4DR4B 3BRWD 4J9UE 3DT9A 4NABA 3BB1A 2J45A 4ADSG 2OQVA 5CURA 4P5PA 2CSTA 4CBRA 3VKVA 5FUQA 1E32A 4XRGA 3P2EA 4URUR 5HJEA 5T57A 3LU1A 3H4IA 4OLBA 2X5JO 3NPMA 2ZK7A 5EMLA 3JAKB 5FPYA 2P1ZA 3QMMA 4ALJA 4F7DA 1Y34E 2Q5FA 1J8QA 1U2GC 3MTAA 4RA9A 5LB2A 1C3LA 2AY6A 5K05A 5IHXA 1PBNA 5HZGA 3ZU5A 4URYR 4UDXX 2BI2A 5CVDA 2C88A 2QYHA 3SZRA 5B37A 1E2JA 3UC5A 1DTSA 1EHIA 4CQLB 1WDTA 3BJIC 2VYCA 2E21A 2BGGA 5DOVA 3WK5A 5J2TF 3A9XA 5B6JA 1Q50A 2I91A 1WZEA 1RWXA 3PC8A 4FU0A 1WA5A 3T4EA 1EP9A 1AHGA 1SHJA 4DSUA 2YN2A 1DHRA 1PTJA 4HUTA 4AJNA 2PSSA 2W58A 3TQQA 4GDFA 4YV0A 1GYPA 3DFIA 4RIZA 2JHGA 5AXAA 2VS1A 3DXYA 2F48A 3UCFA 2X0NA 1EFAA 4S1NA 4I1PA 4K05A 3ZXXA 5IKOA 2IP4A 1QU2A 2C5BA 2FMXA 4LY6A 3GNQA 4Z0NA 2QVLA 1GD9A 4NBWA 3OE5A 3THYB 3OOWA 5HJ2A 2PQ6A 3KFXA 1JAZA 1OQAA 5CJ2A 4TN1A 5BJ4A 3QBVA 1TO6A 1I9CA 4M49A 5IARA 5FFNA 5PGMA 4PIVA 1OT3A 2RARA 4M7PA 2CLCX 1N75A 3WHPA 2WHYA 3GEGA 2QMOA 1E9DA 3CG4A 5L40A 3BCBA 4DSZA 2VCYA 4JWTA 1YIAA 3EUAA 2IPNA 1FG7A 4B09A 1UFVA 5CDHA 2BMFA 1GN9A 2DETA 2Q4EA 3I0ZA 4JI4B 2ZU6A 1VI6A 3HCWA 1ZOLA 3WNDA 4GKAA 1MOSA 5IULC 1K3FA 1E2QA 2J4FA 3WO0A 3TGLA 1UJBA 4LYEA 2HLHA 2Y1FA 2E87A 3HYRA 3HFSA 2P2CA 4PXYA 4E2ZA 3PGKA 4FDAA 5TARA 3UAGA 1QYXA 4WEOA 1FMFA 2AFIE 4GF5A 4TMWA 3A6DA 4F5YA 1YMUA 4JFAA 1E61A 1E2LA 4D45A 3EMVA 2J5RA 4R1OA 3KTAA 2E9SA 3EXHB 1YQ9A 3F3MA 1YASA 2WJGA 3D7SA 3K1JA 1LSSA 5EJEA 4EPYA 5DGXA 2R7LA 4CKCB 3T5TA 3WDMA 3OE7A 3AR3A 1DPFA 3WP1B 3GEEA 2VJCA 3NC1C 1IOZA 4HAYA 3LVJA 1AS0A 3DQPA 3DC1A 2HJ9A 2PZJA 4IDAA 1ZJ5A 4G41A 1W0KA 2P30A 2Q3DA 1X7ZA 5A3JA 1E96A 4UULA 3K4HA 5J58A 4P7KA 2O57A 3ZIDA 4I8XA 1K66A 4FBGA 5DCLA 5DBEX 3MGCA 5DCYA 3GP3A 1VE5A 1DKOA 5IC5A 3OPMA 1T3TA 3UMYA 1N57A 1TF2A 3S2YA 4MB2A 3WGYA 1H2EA 1E98A 3LT4A 4O63O 3HJNA 5CT9A 1ULHA 5HF9A 3NANA 1KAMA 2NW6A 1CP2A 3FFWA 4JC4A 1DLIA 2ZY5A 3EARA 2V7GA 1DEAA 3HM9A 2MYTA 2XVAA 2DWOA 3PT5A 3M0EA 2W6NA 3OETA 4IDCA 3L5KA 3WLJA 1M1XB 3CUEF 2BT4A 5MF6A 4YAJA 4HNQA 3HT4A 4K6GA 4MPTA 5LU9A 4MH0R 1XNGA 3F8WA 2E5FA 1KMQA 2G6TA 2VJQA 2ZRMA 2Z2IA 4I4TF 4ZOCA 4P80A 1XB2A 2C94A 2ZIEA 3ECCA 2RHCA 5EIOA 1VGQA 2GPSA 3WCNA 3DR7A 4ZEWA 4XWWA 3T7DA 1JHZA 2GXSA 2YQ4A 1WE2A 3BFXA 2BBTA 3UA3A 4HJXA 2XCRB 2VH5R 3CUTA 3TTUA 4I1RA 2HFJA 1M1YE 2IVZA 1LI4A 2I3GA 5LR6A 1X14A 4O1MA 2PV7A 1TMOA 5B4TA 4B1FA 4NBLA 3SHOA 3K1AB 4UOZA 1A27A 1NG9A 1E4EA 1MC8A 2ZYHA 5KNBH 1KHTA 3IDQA 2Q2WA 1R74A 2BV3A 3WKBA 5CUQA 1QQ7A 3L40A 2BEUB 1GQYA 2O1EA 3D6KA 3RQSA 2ZSJA 3TZKA 4MVYA 2WHRA 1TL7C 4ZYZA 1U80A 4YV2A 1KZGB 5DWDA 3MUOA 1O87A 1MQSA 7AATA 3T9CA 3T1TA 3KSZO 4C4XA 1TMGE 1P7ZA 1YFKA 1N2BA 3WLQA 3HGQA 3I3OA 1A2OA 2C0PA 3KP1A 4WDQA 3NKLA 2Q2NA 3AG6A 2JGAA 4A6XA 3AGQA 1WSTA 1QV6A 3ZY4A 3A31A 1X1SA 1QNFA 3FRIA 3TUZC 4J0KA 5A7GA 2WWHA 3CQ5A 1PMOA 2K7ZA 2R1ZA 1K97A 1JU4A 2V3VA 2FYTA 3BE8A 2YMLA 4HNUA 2HM7A 4QNNA 3KQKA 4IKEA 3T34A 4K9MA 4ZODA 5IPFA 3GP5A 4UFPA 3ITNA 2FOXA 1TASA 3P9ZA 2QVGA 4NFHA 1OT5A 4DT1B 3EPPA 1VPWA 5TNXA 2W22A 3V4OA 5JS6A 1T3IA 2JLUA 3HYCA 3PC4A 2RBEA 1CF2O 3A4MA 3K4QA 4MIEA 3NIFB 3R3JA 3DV9A 2Y0EA 2UZAA 1ZL0A 2D8MA 2DKOA 1KKLA 1AKBA 1HOXA 1QZXA 2TS1A 2H4JA 1SK9A 2JAQA 1FUIA 1P62B 4C2AA 4JEUA 3JATB 2GYWA 2AN3A 3M1AA 2UZIR 2VSFA 1UMDA 5LZ7A 3IEMA 5J8QA 3QOXA 1I32A 2CKMA 2JBWA 3CNBA 3ZHZA 2P6OA 3EC1A 5CBPB 4PX5A 4JDUA 3ED5A 4PCUA 3JW9A 5DV9A 5DWVA 2BRUC 1N2CA 3YASA 2FN3A 4Q9HA 5CCXA 1QGUB 2QJOA 4TMTA 5GY7A 4LQ4A 2ZBGA 4CMIA 2HXYA 4ND6A 3C16C 2IHJA 3CW2A 3L18A 1K8YB 4FLMA 4DN6A 4MWCA 4C0WA 4ZDPA 3IJRA 4IILA 3EYAA 1QHFA 1I2MA 3WRYC 1WYUA 1W19A 4UQPA 1J7JA 2FX5A 3H11B 3KB6A 5FBZA 1DC8A 5FOTA 2R5FA 1ECFA 3H1GA 4H9GA 4WV3A 5G0WA 2OENG 5AQEA 3SYLA 2OVBA 4NS1A 4A2QA 5I5GA 5DSZA 5JZVA 2OORC 4HPJB 5B1YA 2PUVA 3F9TA 5I48A 1N2SA 4MEBA 1BKYA 2ZJ8A 1WU7A 3D4PA 4M8SA 3OPVA 3PYXA 2WAYA 2CLEB 5CH8A 3W5IA 3FVTA 2C8JA 3QX9A 4FFMA 1G9XA 4OLJA 4WZAB 2ZQ5A 3AJ9A 2FEOA 5A4KA 5FT4A 2YNMC 1HYEA 1LBTA 3UMMA 1RAGA 3H18A 2WAOA 4EQ6A 2AOUA 4FGSA 3ZJYA 3RH0A 4UTVA 3N86A 1XJCA 5C5CA 1T34A 3M4XA 1E7SA 4PO8A 1QZUA 3ZH2A 2IYQA 3UIEA 2RSLA 2GCIA 3H8VA 3V4ZA 3KQHA 2DULA 1O3YA 5DGHA 4YXFA 3INRA 2XHZA 2BYLA 1C3VA 4LRQA 3G49A 1KO8A 1CJSA 1XNHA 2CD9A 3DULA 1CR4A 4FCVA 5BNZA 3OFJA 4G07A 4ZU6X 1M1UA 3DT8A 4Q9KA 3L44A 2AJBA 4GEBA 1ADGA 2IXTA 4BJ3A 5BOSA 2P79A 2Q3MA 4G9GA 4IAOA 2AC4A 5AI6A 5REQB 5C7LO 1YC5A 2BPOA 1MFZA 4UU7A 1OXPA 4M0CA 4GGPA 4UM7A 2CJPA 4A0QA 3T9FA 1ZRSA 1YRLA 3OJEA 5H0IA 4JX8A 1N6LA 2DLDA 3U7RA 5L95A 2OV8A 3O91A 3DDSA 1ZH4A 2VJMA 3EQ7A 4QQNA 1RLJA 4MRPA 1AVTA 4N7BA 2ZUWA 3COVA 3PX2A 1KTVA 3UXYA 2Q21A 2IYNA 1A7AA 5LA6A 3WNBA 1XRJA 1FTSA 4HZIA 7MDHA 3UHJA 1N5IA 2HMWA 4C29A 1D2NA 1NW3A 3D2BA 1ESMA 2WRZA 3OP4A 1NU6A 4MVWA 4ZU3A 4B6FA 3UWOA 4LJ8A 1VMDA 4HEA1 2CLMB 5ALPA 1TUIA 3AUYA 4PZZA 3P2YA 4M1ZA 2PZKA 4CLDA 1V16B 4Q02A 5J59A 1ZCJA 3T9BA 1QISA 3MTQA 3EK2A 1OC2A 2GKSA 4AU1A 3I64A 5U1PA 5ICGA 3C4VA 4G1VA 2AE2A 5TF0A 3E9QA 4BGDA 4J49A 2O1XA 1Z3ZA 3FQAA 4QC2A 3MELA 3HKDA 4GUDA 4E1BA 2VLBA 4O5AA 1DSSG 2ZIXA 4EJSC 4K3UA 1FYFA 4UW9A 1N3BA 3EULA 1PVVA 3ZJ4A 4MKRA 5KKNB 4US1R 1NSTA 3ZWKA 5ERXA 1I0IA 5ENVA 4L6CA 4U3JB 4DEVA 5K0TA 1N9GB 3L9XA 4ATNA 3ZW8A 1HDGO 4JR2A 4UHFA 3C7CB 1YQTA 1IEWA 4EH1A 1HEUA 3LVMA 3WAJA 2ZJ7A 4WNAB 4EDFA 1P2GA 1OX4B 5DGIA 1OB5A 5GVRA 1G41A 3RBLA 3DV0A 2QGZA 1NUSA 2JHCA 5D3MA 3GCGA 2AFHE 4K6HA 2ERCA 4NZYA 1V2FA 2I6GA 2YHUA 3GBPA 1GL3A 1H0RA 3QV1A 1OFUX 3VO9A 1KL1A 1E6UA 4G8CA 2GRUA 4IIHA 2R2NA 3K70D 1GUZA 2XKAA 3N2NA 4BX2A 2IZZA 1HRDA 3G8CA 3AZQA 1SUAA 4ARZA 2JJQA 2CF5A 4C30A 1ZNWA 1ZVQA 1OLUA 2ZBFA 3VZSA 4PHCA 2F4NA 2B35A 1U63A 4RVFA 4D3XA 3JQDA 4JLAA 4ND8A 4RV4A 3NHRA 4S1VA 4JA2A 3KGWA 1E8NA 1LC8A 1U1DA 2HO5A 5K0SA 4P7GA 2IXEA 4EKGA 1G3QA 5BWCA 5JRJA 2EG5A 1XMOB 2FZVA 3HADA 1VJOA 1DG1G 4ZI7A 4F97A 3C3WA 2I7DA 1FVHA 4H0CA 3ZU4A 1LPAB 5AIBA 3PJDA 2C8LA 3OEEA 1OAOA 4B7XA 3TNFA 2H85A 4ED9A 1LC0A 5FTLA 2QZPA 5ARBA 1NF2A 5C5DA 3VPCA 4HNSA 4HWTA 3DEZA 1M2VB 1TFUA 2XB2A 1TUEA 1KKJA 1CSEE 1C1HA 1FL9A 4DY6A 3B53X 4ZT3A 1CVIA 1IJBA 2DMRA 3ZE2B 1C7JA 3GY0A 4EG4A 4HZUA 5EJFA 3OM0A 1ASAA 1QFSA 4E5MA 3PXGA 4FHEA 4HLDA 4FE3A 1KAHA 1N0UA 4KR9A 1ZU4A 3DBLB 1PBTA 1TADA 1XZCA 4KPGA 1Z26A 2Q8NA 2XCLA 3MJTA 2HT1A 3E3AA 3O8QB 1UU0A 2Q27A 2HQOA 1YAHA 4E14A 1KEEB 1PWEA 1QIKA 4LHVA 4YAGA 4HDSB 4GM4A 3VOTA 4AWBA 2PAFA 5AW6A 4L16A 3ZLUA 2Z43A 4KPYA 4FFSA 2GMSA 2NZXA 3H2GA 1VGVA 4KOAA 4HDNA 2HIGA 3N0RA 3F78A 3UC9A 5E6SB 3E4CA 4Q3KA 2CT8A 4RD4A 4QU0A 2EHDA 3IAS6 3CLHA 3TLBA 4HNVA 3DHVA 1OCEA 1RCFA 2QD5A 3PENA 3UKOA 4RABA 4OP1A 3P5BA 1OPXA 4JBIA 4XIYA 3KQUA 3PV0A 1VRCA 4WN9A 2Q6OA 1H5QA 4FOSA 2C4HA 4J1QA 1JLHA 5AJWA 3HBAA 4WXEA 3U62A 3H2BA 3OZEA 4GOND 3AEXA 5I9TA 2EFCB 1KWGA 2QN1A 3MLEA 1A7KA 1MB4A 2RGWA 5CCBA 2GPYA 1SUIA 3TRFA 2JLSA 4ZDOA 2O3RA 4FFWA 1SIUA 1DZIA 4Y8VA 5K6RA 3O2NA 3OBBA 4A72A 2YYZA 1CQIB 2AW3A 4XW2A 3DVLA 5G2OA 3QPDA 5MDHA 3VZDA 2GN8A 2Y0PA 5TQJA 1G8JA 1EZ1A 3BMOB 3HKEA 3OP1A 2WK9A 4EY3A 5JAUA 1F48A 2B94A 4YI5A 3FVVA 4IS2A 1ZD5A 4OGLA 4PQFA 2DQYA 2D00A 3A1SA 1LX6A 3AHCA 4NOMA 4LS3A 3H65A 2NU7B 3LOQA 4NMHA 1LWNA 4E07A 3M5PA 2A9PA 2R5WA 5E4TA 1RLUA 4MAAA 3K1TA 3QF4B 5HGXA 1MGOA 3ZDZB 4CM3A 3N8NA 4GD3Q 2H1HA 1QU3A 3M81A 1VEFA 2IZOA 3ZDAA 1J23A 4NIMA 2XB8A 2V9CA 1V6CA 2FF7A 5GM2A 1VI5A 1J33A 3ONFA 3J81k 5DLEA 4IVQA 4OKSA 1T4BA 3RC2A 3ZWBA 3B1VA 1FRQA 3UJDA 4KUEA 5AM0A 1NFRA 1QO0A 2QSJA 4G1BA 3IHWA 3FDIA 4N0PA 3UM9A 2HQ1A 3PE6A 2JIZD 3A4VA 1HTTA 4BECA 3UWKA 3U44A 4KIUA 2QG4A 4GEKA 3O3CA 4YHHB 1CUBA 4US0R 4ASUA 1EH5A 4O2BF 3AUTA 3U9LA 3OIWA 1TU4A 1VG9B 2MT9A 3GXOA 4NMMA 2AGVA 1IK4A 2JF0A 5I51A 3FKQA 3MLBA 1IY2A 3V7NA 5A06A 1GTVA 3HUFA 3D3WA 5ALKA 3WMFA 1M32A 1KK1A 4D56A 5IWCA 4IZOA 3VZPA 3VZCA 2BY4A 5F4ZA 4YQFA 5KJCA 4YFVA 3BRCA 3DW3X 1E3LA 4AN4A 5EN4A 3VV2A 2BCGY 2EJUA 4AZSA 4NAVA 2GJ9A 1ESNA 5EA2A 5FYQA 3KQSA 1SD2A 2JHAA 3FYSA 2PBZA 4LMPA 3KFVA 5DBIA 2K2QB 4XJMA 1OXTA 5HE9A 3ECSA 2HFKA 3RGWS 5ALOA 3BGIA 2F3PA 4GVLA 1BJ4A 3A9YA 3DYIA 3FNGA 2IEZA 3GLHB 4GBED 4EA6A 4ENWA 1DX9A 2QE6A 1GR1A 4L8FA 4I1IA 1CQ7A 5JIBA 4OXRA 3U7JA 3K0KA 3DD5A 1R27A 3OKFA 3FAKA 1U6JA 3C6MA 3ROEA 1FUUA 3CRVA 1E6MA 4G0XA 1A88A 4XEWA 4GLOA 3RHFA 5FTWA 4QPNA 4JSRA 3NO4A 3UGQA 3LBHA 1ODJA 4RLQA 2AY1A 5KQSA 4YUYA 4TVSA 4B7UA 4D6YA 4EG6A 4TMFA 3PEYA 3QUAA 4MINA 1PJBA 3V00A 1CUEA 4KC0A 1W94A 3NV9A 3L7AA 4MCHA 3PHGA 1I3MA 2HP1A 1UEXC 2QVYX 2YS6A 2LZ0A 3I3SR 2D5YA 1HDEA 4E2YA 1FYWA 1TOGA 4QARA 1G8MA 4Z4FA 3MXTA 1QQTA 4H63Q 1XPOA 3SOZA 5KNBA 4QPZA 3WTBA 3U80A 1QVRA 3R7NA 5L4SA 2NYRA 4J9VA 4Z1MD 2CEAA 3AONB 4GFDA 1ISRA 2G1PA 4ZCIA 2RGNC 3EF0A 4P4UA 3RU7A 4WADA 9LDBA 4YV1A 1OI3A 5IT9A 2DUUA 4PFJA 3OM1A 4G1CA 4K9SA 2FKNA 2HCTA 1GEEA 2FZWA 5HKBA 3UBTA 4WCFA 4KG7A 3ZX4A 3GEDA 1QP8A 1J0AA 2PX0A 1IBCA 1NBME 1G16A 4MWOA 4AY4A 4OI4A 5HCIA 4OBUA 5A62A 4Q00A 5HHYA 2JAUA 1J1IA 2GSWA 3WWDA 3WGQA 3KOYA 1L6IA 5IBQA 2D4HA 3DG9A 4EFKA 3NAZA 4BQNA 4BQQA 4DQ6A 4N5IX 2FYFA 1FDVA 2FQYA 4FGLA 5TQ2B 2I78A 4UE6A 3WQBA 4ZCTA 4WYDA 1E2KA 3FZYA 3FWYA 2R751 3F4KA 1P17A 5G0SA 2AJLI 4ABYA 1RVDA 3JALA 4EY6A 4E5DA 4UUOA 5DB4A 3RIXA 3IBFA 1POWA 1USGA 3KU4A 3RIYA 2Q1XA 2PB0A 3UB2A 3OZSA 3EI8A 1IWPB 4G0VA 4YMHA 4GWKA 1TPYA 1Y8RA 4Q12A 3RU9A 1TF5A 4HRXA 3V7FA 1MH1A 4EIWA 4EVRA 1DADA 4O6VA 1ORVA 1UQUA 4EGSA 2FPOA 2OHVA 3A6JA 5LP6C 3BXHA 2XTZA 2QTMA 3HWRA 4EPTA 4PNPA 5TY0A 4G26A 1NN3A 2R86A 2IQIA 1NLUA 3NKFA 2VDNB 2ID8A 3SDBA 1RJWA 3FWZA 2FE1A 3LPDA 3QEKA 1RXWA 3G88A 4C05A 3FZ8A 1AU9A 5IWQA 1WUTA 5CT6A 1EWQA 1FOEB 3GB9A 5EE9A 4L0MA 1G98A 1P4RA 2IRWA 2XOXA 2VQFB 2SHKA 1I7DA 3WL5A 4L2IB 3AF4A 1RI5A 1USKA 1X3LA 5JH7B 1JF9A 5J4HA 1H2XA 3P0EA 5KTPA 4BN5A 2JGMA 5FJIA 1GUYA 1DAKA 2G6BA 3UOWA 1LI5A 2O0RA 1RLIA 4OBBA 1CJMA 1YGYA 1I24A 2OAGA 4MWEA 5ECWA 3MSCA 4JGBA 4E09A 4ZYVA 4PWZA 5B3LA 2QT9A 3PJEA 3ETDA 4KZPA 3MUEA 4YFYA 3BSYA 3JVDA 1IRIA 4DV2B 5JBIA 4Y3UA 3HB4X 3KB1A 3QNWA 3HCOA 3FF4A 4LA4A 5EMKA 4F5FA 1NVUQ 3UGJA 2CLFB 1IMJA 3PCXA 4X1YB 4CTKA 1P77A 3OCWA 4LPKA 4JT8A 3CKMA 2X8JA 3CWQA 2VMYA 3H7IA 4HSGA 4ETIA 4YJGB 1YQWA 4QEZA 5EINA 3ASVA 3PHLA 3NEJA 1YSCA 3E81A 4WK4B 1LDYA 3GBVA 4N49A 2P4EA 3OFVA 3NMUF 1TARA 1NMQA 2OV2A 1XVIA 3LC2O 4A73A 5BWLA 5E8RA 3E3NA 4NBTA 1ZW6A 1FK8A 3LVBA 2PUWA 4OCAA 4HBGA 2AX3A 3B1DA 4XYGA 1TA0A 2ABWA 1LH0A 1CUJA 1GCGA 2WZCA 3LKDA 4K2BA 3T3MB 4G0YA 1FQKA 1L5VA 3K1YA 1M6WA 2GFHA 3R8FA 3DP7A 4XUEA 1BGXT 4C5AA 1LX7A 3MAGA 3VR5A 3KO8A 1S01A 3G0DA 2O48X 4P38A 1Y7PA 2CMDA 2V6MA 3IOCA 4MQLA