4K08A

Periplasmic sensor domain of chemotaxis protein, adeh_3718
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
143
Chain Sequence
b'ARMLAERQAKVRALVEAAHGLVEHQGARAARGEISADEARRAALEALRALRYDGSEYFWVNDLEPRMVMHPTNPQLDGQDLSGYRDPNGKLLFQFVRTVRARGSGFVDYLWPKPGSTVPVPKISFVTQYQPWGWVVGSGLYVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis sensory transducer
publication title Analysis of periplasmic sensor domains from Anaeromyxobacter dehalogenans 2CP-C: structure of one sensor domain from a histidine kinase and another from a chemotaxis protein.
pubmed doi rcsb
source organism Anaeromyxobacter dehalogenans
molecule tags Signaling protein
total genus 43
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4k08A00
4I39A 2V0UA 5HWWA 5I5LA 4JGOA 5HDDA 3P7NA 2PYRA 3BY8A 2VLGA 3FC7A 4EXOA 1LSXA 4HJ3A 3MJQA 1NWZA 1WA9A 4HI4A 2EA9A 3C2WA 3NJAA 1S4SA 1KOUA 4NXGA 2OWHA 1T18A 1GSVA 4JGPA 5IU1A 3K3CA 1GSWA 3A0VA 2H28A 3SW1A 4EW7A 2ZOIA 2BASA 2L4RA 5KIZA 5HSQA 3NOTC 3RTYA 2V1AA 1OTEA 4PKYA 2VV6A 3A0SA 4B9OA 1VB6A 5DJTA 5DKKA 4HH2A 2HV1A 5F6AA 2Z6DA 4LRZE 3K3DA 3IS2B 4I3AA 4LRYC 1T1CA 3HJKA 5TBMA 3GDIA 1F9IA 4GHIB 2QJ7A 1MZUA 5HZHA 1S1ZA 4PKYG 5HD5A 2PDRA 3IBRA 3VE3A 3IS2A 5HD3A 1EW0A 2WKQA 3H82A 4GW9A 4R6LA 3RH8B 5HWTA 1LSWA 5HDSA 4WL9A 1T1BA 5F5YA 2JHEA 3BY9A 1OTBA 3OLOA 4F3LB 4EEPA 4LRXC 2P7JA 2V1BA 4NXBA 3C8CA 3CLOA 5DKLA 1LSVA 5G4YA 4DJ2A 4R38A 1JNUA 4F3LA 1XFQA 4EESA 1X0OA 3MQOA 2INWA 1OTIA 2ZOHA 2D02A 2PHYA 4H6JA 5EFWA 3BWLA 2R78A 3UMEA 3PHYA 3KX0X 1P0ZA 4L9FA 3LIDA 2OWJA 4YWZA 1UGUA 1V9YA 1TS6A 2W27A 1S1YA 4GCZA 4EQ1A 1XJ3A 4HIAA 1UWNX 3H7WA 5A8BA 3T50A 1TS7A 5DJUA 3A0RA 4L9EA 4EETB 4K08A 4EEUA 1XJ2A 2PD7A 5TBMB 4KQDA 5F68A 2VV7A 4WLAA 3NHQA 5G4ZA 1UWPX 5AVEA 1XFNA 3LIEA 1DP6A 1V9ZA 3H82B 4JGRA 4NXFA 1DRMA 5HDCA 4NXEA 1P97A 3PYPA 4R3AA 2WKPA 2PR5A 4EERA 3LYXA 3F1OB 1T1AA 4DJ3A 5HWVA 3EEHA 3F1PA 2KX6A 1S4RA 2JN7A 4L9GA 3FG8A 3F1OA 4XT2A 1TS8A 1OJGA 4KUOA 3UMDA 3VOLA 4HP4A 2V9AA 3LI9A 1OT6A 1XJ4A 4HJ6A 3UB9A 1S66L 4HH3A 2Z6CA 4GS9A 2J80A 1N9NA 2GJ3A 3LIBA 3MXQA 5IS1A 4H6JB 3B33A 4I5SA 2OOLA 1N9OA 4HY8A 1GSXA 4JGQA 1D06A 5AVFA 4WN5A 4BBUA 4E04A 2W0NA 4HOIA 4HNBA 4BBVA 1N9LA 3MR0A 1T19A 3H9WA 3LIFA 5J7EA 2PYPA 4HQAA 3H7WB 1LT0A 1D7EA 1S67L 1G28A 2WKRA 4M4XA 4I3JA 4RQ9A 3GECA 3LIAA 3EWKA 2QHKA 4MN5A 3LICA 3NOUC 3F1NB 4KUKA 3ICYA 4HHDA 3UB7A 1LL8A 4LPZA 1TS0A 2VEAA 2YKFA 3F1NA 1OTDA 1OJ5A 4WF0A 2PR6A 2QKPA 3G6OA 1XJ6A 3UB6A 4HP9A 2PD8A 3UB8A 3MQQA 2B02A 2QWSA 4HJ4A 4WUJA 2QJ5A 3ULFA 3LI8A 3F1PB 4BBTA 1OTAA 2V0WA 4I3IA 2KDKA 3UE6A 2YKHA 5J3WA 3VE4A 1BYWA 3D72A 3HJIA 4XT2B 3E4QA 2A24B 2ZBBA 4I38A 2I9VA 4GS9B 2L0WA 3ZQ5A 2A24A 4GHIA 2K7SA 1OT9A 1DP9A 4R70A 3E4PA 1DP8A 4LLOB 2L1MA 3CAXA 1ODVA 3MFXA 2D01A 5J4EA 3E4OA 3NOPC 1Y28A 1F98A 5F69A 3LUQA 2VV8A 2M1CA 2CMNA 4MN6A 3CWFA
chains in the Genus database with same CATH superfamily
2XSSA 4QY6A 3QP4A 4UHUA 4JKTA 3PBNA 3PBQA 1W8YA 3V67A 2FH5A 3K2NA 3MJQA 5M19A 1BTLA 2EA9A 3KYEA 3O5YA 2HF6A 3NJAA 3RXWA 1FILA 1S4SA 1K56A 5FATA 2Y2MA 4Y0UA 4ID4A 1T18A 4JGPA 5IU1A 3ZDJA 5M18A 5EOEA 3SW1A 1LI0A 3IHBA 4EW7A 2V8FA 4YOFA 5CHMA 1ES4A 2V1AA 1OTEA 5E2EA 1SHVA 3A0SA 2XEPA 1BT5A 4JF4A 4QHCA 4PM7A 5G18A 3IWQA 1VEUA 5L10A 4C6YA 1NRJA 4Y7PA 2JE5A 2Z6DA 4LRZE 5FAQA 1KVLA 1T1CA 5LBRA 1LI9A 3GDIA 5L07A 2QJ7A 4YFMA 1MZUA 1D1JA 2Y4AA 4OOLA 4RA7A 5HD5A 1YSPA 3IS2A 3UY6A 3H82A 4Y3IA 4BENA 2EX9A 5IHVA 1G6AA 2NUTC 3N8SA 4KG6A 1LSWA 3W4QA 4N1HA 4MMNA 1WYCA 4OKPA 1T1BA 3CI6A 2DRWA 3GQZA 3BM6A 1CI8A 3D9YA 4LV0A 4F3LB 3ZG7B 2ZL1A 3N6IA 1CQAA 3KYQA 1BULA 3SS3A 2W1RA 4OQ0A 4P6BA 4NXBA 2ZM0A 5EUAA 4D60A 3CLOA 2W3EA 4F94A 4DJ2A 2HDRA 2M7UA 5EPHA 1JNUA 3FPVA 1L0GA 2XDMA 4ZTKA 1PW1A 1X0OA 3Q81A 2WAEA 3VOZA 3GMWA 2D02A 5FAPA 3DTIA 4MLLA 3G2ZA 4OVDA 5KSHA 2EWVA 3LIDA 1K54C 4ZAMA 2OWJA 3GVBA 4KZBA 1FCNA 3NBLA 2W27A 3SH8A 3WS1A 1E3UD 3LGOA 5E2HA 4GCZA 4MDZA 3N4IA 4HIAA 1UWNX 3QP8A 3H7WA 1MY8A 3S7PA 1GA0A 3UB5P 3S7OA 5DJUA 1FSWA 4M3KA 3T4SA 3UPNA 4EETB 4MEZA 1NXYA 1ESIA 2G2UA 5TBMB 4ZBEA 2W3HA 1QMEA 3QP1A 5G4ZA 1UWPX 3DTMA 3VP1A 4U0TA 3V50A 5FASA 5HW3A 3HUMA 1IYOA 1P97A 4JF6A 3U4LP 3S4XA 4X69A 1K57C 3NC8A 3BYDA 3QP6A 3D4FA 3F1OB 1JWVA 2ZMFA 3F1PA 1MWSA 4OOMA 2WGIA 2QYBA 1K55C 4DXBA 1VQQA 3KYZA 3S7QA 2EWWA 3EQVA 2XH9A 1OJGA 2VGLS 3VOLA 4HP4A 5CEDA 3MXRA 1OT6A 4WYYA 1AWIA 4UEYA 2KLIA 1KVMA 3MXSA 2GX5A 3B33A 5F82A 1MBLA 2O9CA 3IWIA 4I5SA 1N9OA 3EOIA 5FQIA 1GSXA 4GDBA 1RP5A 3TRCA 4BBUA 3E0YA 1CF0A 4R23A 4BLMA 1K56D 1FCOA 1T19A 3LIFA 3CJMA 1LT0A 1D7EA 5DF9A 1K6SA 4QU3A 4I3JA 4S2PA 3OZHA 1GCEA 3EWKA 3L7HA 4UQIS 2QHKA 4E3LA 1K0KA 1PRQA 3IX8A 3NOUC 1LL5A 3ICYA 3IHAA 5HAPA 1FSYA 2OV5A 2EXAA 3JVUA 2ZLYA 3V3SA 3T4JA 2GZAA 1G68A 1TS0A 1G6OA 3AGDA 1BZAA 4FH2A 1XGJA 4KZ8A 3G31A 3KSGA 5L8MA 1K38A 2K31A 4WUJA 5EVID 4CQHA 4RVAA 4Y2FA 4BBTA 4WMCD 1ZG4A 2Y2HA 4LGWA 5J3WA 4XT2B 3E4QA 4O01A 1K55A 3IQAA 1TVFA 2ZQDA 5E2GA 4I38A 2I9VA 2R9XA 1PYYA 5CEBA 3A3JA 5CXWA 1L0EA 3ZNTA 2WKIA 1ZHHB 3CPTB 2NUPC 2K7SA 1DP9A 4R4RA 4EBNA 2W3FA 3E4PA 1KE4A 3HUNA 3DBAA 4KZ7A 3BFDA 3VSLA 5TR7A 1ODVA 2JBFA 3MFXA 2D01A 1IEMA 1MKIA 4Z9QA 3ZFZA 2J3WA 1G5UA 3SH7A 1RGZA 3WS0A 2XFTA 3AGEA 2EFXA 4JLFA 4I39A 3C4OA 2ZC4B 2ZMVA 3OBFA 1XXMA 2V0UA 3GRJA 4KQRA 4JGOA 3TOIA 5GL9A 3BRMA 4U3TA 2X71A 5FQJA 3BY8A 3N8LA 2HDSA 5DTSA 3FC7A 4KZAA 4WZ4A 4B93A 3UN7A 1FOFA 4X55A 4KG5A 1KOUA 4E3OA 3FYZA 5CRFA 2JKFA 1MWRA 4GD6A 1YQSA 2Q0OA 2WK0A 1NYYA 3G30A 2ZOIA 2BASA 4UA9A 3O88A 2L4RA 3HLFA 2JKGA 2JKTM 3RFBA 1XA1A 2IWDA 1OMEA 1I2SA 1W63M 4Q0IA 3BFCA 5TFQA 5A90A 1VB6A 5GLAA 4CLCB 4KQOA 3CUEA 2HV1A 4B88A 4FUWA 5MC7A 4OPQA 4QB8A 3HJKA 5HARA 5TBMA 3R7WB 1PWGA 3UE0A 2J7VA 2HZ5A 4WEJA 3T4KA 2Y2OA 3OPPA 2PBDP 5EM1A 3HVFA 3C4PA 4PKYG 3P98A 2LB9A 1JVJA 3VE3A 1EW0A 2WKQA 3AGFA 3WRZA 2HGVA 3Q7VB 1Z09A 4LCMA 5HWTA 3PBSA 1ONGA 1PWDA 4NG2A 1HVBA 1ZTUA 1KGEA 4EQIA 2JHEA 3BY9A 2DMWA 1OTBA 1J3WA 3ZYTA 1YLTA 1DJAA 3MZDA 3MBZA 2XK1A 3HCYA 2WGWB 2P7JA 2Z2LB 2V1BA 3BQAA 1I5QA 2VZWA 3C8CA 4GLQA 5DKLA 3IF6B 3VV4A 1XP4A 4UAAA 3W8KA 3MSHA 2XQZA 4WBGA 3IH8A 2PU4A 1SDNA 3BECA 3QNBA 4E3IA 4BL2A 3IH9A 2ZOHA 1KGFA 4ETXA 5CTMA 2HP6A 3TE8A 4NK3A 2R78A 3UMEA 1P0ZA 4PM6A 1ES5A 4D2OA 2ZD8A 4X68A 1CK3A 2IWCA 4BWIA 2DCFA 2P08A 1V9YA 2C5WB 3CMZA 3HBRA 4GNUA 5FQMA 1U60A 1P9RA 1XJ3A 4E3JA 3IX4A 3LR0A 2EX2A 3L9KA 2X02A 1E4DA 2XLNA 1YPRA 4L9EA 4N9KA 5E43A 4OP8A 3PBTA 2PAVP 1CJFA 4P6ZM 4EEUA 3ZGAB 3MZEA 3FKWA 2VV7A 2O9BA 3BJNA 3NHQA 1DP6A 3TJZC 1YMSA 4S2IA 3KSIA 4E3NA 3ITAA 3CITA 4NXEA 2XF3A 5EOOA 3PYPA 3GV9A 4CPKA 4R3AA 1JTGA 3SH9A 2VX8A 2WKPA 3ITBA 2VK3A 3PBRA 3RXXA 2EFUA 4EERA 2Z2MB 5GLBA 4E3KA 3WS2A 1ACFA 1CEGA 3EEHA 1GA9A 1ERMA 2W3DA 4CLCC 3NULA 4S2LA 3P01A 2XA7S 4JPMA 5HPIA 3CZDA 4XT2A 3LEQA 5FI6A 1SDEA 4K0WA 3T1SA 1Z6FA 3LI9A 5FEFA 3EGXC 1XJ4A 3UDFA 3OC2A 1S66L 2X01A 4R4SA 4HH3A 3W4PA 4EU0A 3LR4A 4OONA 1N9NA 2GJ3A 1NY0A 2WADA 4MCWA 3LIBA 3B3XA 5IS1A 3CPTA 4H6JB 1TF1A 4PM9A 1ERQA 2OOLA 1WE4A 3M2JA 4U0XA 3M6HA 3ZG0A 1BSGA 2Y2QA 5AVFA 3SZTA 4BJPA 4WN5A 3NDGA 4WELA 2IA2A 4KZ5A 1L0DA 2P04A 4GDNA 3G32A 4JBFA 4UA6A 1N9LA 4IUHA 2PYPA 4ZJ3A 2OLUA 4LENA 4HQAA 1S67L 1FR1A 1PFLA 3NECA 2WYXA 4EWFA 3DWZA 1ZC2A 3LIAA 3OCLA 3VP4A 3IF6C 2C6WB 4N9LA 3FWLA 4MN5A 1MKMA 3UE1A 3LICA 2V20A 1NLZA 2Y2KA 3F1NB 4KUKA 4P6ZS 2EX8A 4ZJ2A 4MBKA 2V2FF 4S2OA 3V5MA 4ZJ1A 1WYBA 4GB7A 5DVAA 4LPZA 3DAVA 5HAIA 3T12B 4JF5A 2VEAA 3B42A 2PR6A 4QWOA 3G6OA 4AFIA 3OPLA 1XJ6A 4IEDA 2XR0A 4MBFA 4JXWA 3MQQA 3NI9A 3ULFA 3M2KA 4N92A 5AQ9A 3VP0A 1OTAA 2V0WA 2RL3A 3UE6A 2XROA 4OLDA 3FKVA 3G4PA 1H8ZA 4HEFA 1ES2A 3VE4A 1VETB 4PM5A 5AJGA 3NDEA 2O9AA 3OCNA 3CG5A 3NCKA 3NY4A 4CLCA 4PPRA 3C7VA 2EX6A 1FR6A 3GSGA 2Q9NA 1ESUA 5FL3A 2V8CA 1FIKA 1HTZA 1VHMA 3Q82A 3R7WA 3S1YA 1STZA 1CEFA 5EECA 2A24A 1OT9A 4IVKA 4IUKA 3SS4A 2A2LA 1L3LA 2QZ6A 4JXSA 5AQ7A 3PXPA 3QNCA 5DFYA 4DDSA 3FPWA 4DE0A 2ZQAA 2H0TA 3Q7VA 2L1MA 4LLOB 4IBXA 3A3DA 1JWZA 5J4EA 1IYSA 1JWPA 4KZ9A 4ARZB 3E4OA 1LL9A 5TJJA 2HDUA 5F69A 4R1GA 2JKRM 5CGXA 2P9VB 5L2FA 2VV8A 4IBRA 3UPOA 2G7UA 3CWFA 3VMAA 3OOVA 1K54A 2V1ZA 1MXOA 3CHWP 5HWWA 1YAXA 1L2SA 3IF6A 3P7NA 4X6TA 3ZNYA 2OLVA 2VLGA 3BW6A 1NYMA 5A91A 4FH4A 4G3KA 2ZMAA 4OPZA 4FSFA 3C2WA 4GJ4A 3T1QB 4E6WA 3OPHA 3FZCA 1K4EA 3JYIA 2OWHA 2E8IA 3ZG5A 1ONHA 3K3CA 4KG2A 1PI4A 2K2NA 2ZM2A 4C75A 1F2KA 3Q07A 1GSWA 4X1LA 3N8RA 2H28A 4FCFA 1SCWA 5I94A 1XA7A 5HPFA 3IF5A 5KIZA 1ALQA 1XGIA 4PKYA 4DF6A 2VV6A 1PZPA 4B9OA 4LV2A 1P9WA 5DJTA 4O0PA 1S0WA 1K57A 4X1MA 4WZ5C 3ISGA 2VKSA 3K3DA 3IS2B 4I3AA 4LRYC 3A3IA 5EVIB 2LB5A 4GHIB 3QHYA 4S2MA 1NJ4A 2H5SA 2B18A 1NZOA 1GHPA 5HD3A 1LHYA 2UWXA 4GW9A 4R6LA 3RH8B 2P74A 2ACGA 3LY3A 5DF8A 3TG9A 3C7UA 1H8YA 4IVIA 4L0LA 5HDSA 1N9BA 3LY4A 3MF0A 4WL9A 4EBPA 3UO9A 5F5YA 1NLYA 5HL6A 4Y13A 1MPLA 3OLOA 2JKTI 3T1RA 1XX2A 1TD5A 4XUZA 4EEPA 4P87A 3OPRA 4LRXC 1Q2PA 1A0KA 4K91A 3HL9A 2ZQCA 4PAUA 5CX7A 2VGKA 1LSVA 1XKZA 5G4YA 1ZG6A 4R38A 4DN0A 4F3LA 2GNXA 2E8JA 1XFQA 2ZM8A 3HLBA 1EWZA 3Q7ZA 1Q2QA 1OTIA 2J8YA 4N1XA 3C5AA 3MS6A 3E98A 4DMZA 1NRFA 2OAQ1 4H6JA 5EFWA 5U47A 3BWLA 2XFSA 2Y91A 3PHYA 4DE3A 3MFDA 3IXGA 3KX0X 2B5RA 3UPPA 3TSGA 5CECA 3WS5A 1S6RA 2ZQ7A 4YWZA 1TS6A 1IKIA 5EE8A 3PBOA 5EVLA 4EQ1A 2J9OA 1EROA 2ZC3B 5A8BA 5DTTA 3W4OA 1SKOB 3T4LA 4EBLA 1MWUA 4R0QA 3VP2A 5CERA 2ZC6B 2FFFB 4QPRA 5J8XA 4DXCA 3O86A 5F68A 4Q8IA 3VFFA 4MNRA 1OPXA 3MQ0A 4PHTA 2Y8HA 3V39A 4WLAA 5AQBA 5AVEA 1XFNA 3LIEA 2VJWA 4IHQA 1V9ZA 4KZ6A 5TGFA 4WM9A 1E3UA 4NXFA 3EQUA 1NZUA 2HDQA 5HDCA 2Y2LA 2ZQ9A 3Q1FA 5K5BA 4Y15A 2WUQA 4BMWA 2BLSA 1ZKJA 1VM1A 3BFGA 2Y55A 2HJ9C 4NETA 3LYXA 1T1AA 5HWVA 4WEKA 4BD1A 2JN7A 4OLGA 2RCXA 2CC1A 4B4XA 3ZHHA 3FG8A 4R3JA 4S2JA 3F1OA 5FI7A 2A49A 2Y59A 5FQQA 5EVIC 2V9AA 3ZVWA 3MKFA 2HPBA 4KZ4A 1BLHA 3O3VA 4H8RA 2XRNA 5C5KA 3T4QA 3IX3A 3A3FA 3A3EA 1YLPA 3P09A 4Q0HA 1TDGA 2XGNA 2ZQ8A 2M7VA 1IFQA 1D06A 2QMIA 4E04A 1KE0A 4HOIA 2PT7A 4BBVA 4HBUA 4Q0JA 5EV0A 4YNRA 1ES3A 1CI9A 3MR0A 1K25A 5J7EA 4OQGA 4ARZA 3BQ8A 3E2LA 1JTDA 1G28A 3VFHA 5KSCA 4M4XA 2P9VA 4RQ9A 1W79A 3IXDA 1H5XA 4O7DA 4LCLA 3PAGA 4OQHA 3PR6A 3UB7A 1OTDA 1OJ5A 3LR5A 4RX3A 4LFUA 2QKPA 5EVEA 5FQ9A 1RCJA 3DTEA 5DF7A 4ESPA 1LLBA 5CHJA 3I7JA 1W7FA 3B47A 3UB8A 1YLYA 2QWSA 4HJ4A 2QJ5A 3BEBA 2EXBA 1TEMA 4YINA 2KDKA 2W3GA 5FSRA 3M6BA 4JXVA 3ZVTA 2Y79A 3D72A 1PIOA 1HZOA 2ZBBA 3VP3A 4CLCE 5GHZA 4GS9B 5CHUA 4OH0A 5EVIA 4GHIA 5FQKA 2G2WA 3N7WA 5FI2A 4R70A 4WMCA 4ME4A 5A93A 4E6XA 4OPYA 4C3QA 4GOGA 3FV7A 3VSKA 3IWOA 5CGSA 3JPUA 4KENB 3E2KA 2Q9MA 1L0FA 3NOPC 4GZBA 3HLCA 1F98A 5FEGA 2VGLM 3SS5A 5JYOA 2M1CA 4EV4A 2CMNA 4MN6A 5L09A 3ZG9B 1H0MA 1E25A 2I72A 3U2AA 2O99A 5I5LA 1PZOA 5HDDA 1DJCA 2KOIA 1M40A 2PYRA 4KQQA 4QD4A 4EXOA 1IOUA 5GHYA 1LSXA 4HJ3A 3LO7A 1NWZA 4DE1A 1WA9A 4HI4A 3PTEA 2OAP1 2W1TB 2WGVA 3HREA 3QP2A 4NXGA 1YLWA 1O7EA 3WS4A 1GSVA 3IXBA 2VGJA 5D3OA 3RJUA 3UDIA 4UQIM 3A0VA 1FQGA 4Z1WA 2JKRI 3G34A 1YMXA 2XD1A 4ETZA 2Y2PA 3T4TA 4XXRA 3NOTC 5HSQA 3WRTA 3RTYA 3GR2A 1SKOA 4UA7A 5DKKA 4HH2A 1QMFA 5F6AA 3GTCA 2DNSA 3MKEA 4RX2A 4GKUA 1F9IA 3BLSA 1KGGA 4MN7A 4X25A 2WZZA 3EGDC 3JVVA 5HZHA 1S1ZA 3R4KA 1MWTA 2PDRA 3IBRA 3SOIA 3DW0A 4PMAA 4OOYA 4A5RA 4EUVA 5FDSA 2XD5A 4NEED 4XUXA 3T1XA 2QPNA 4E3MA 3EEAA 1BUEA 2HJEA 3W2ZA 1N4OA 5F1GA 5GLDA 2A3UA 1IKGA 1SZVA 4EUZA 3MZFA 3ZG8B 1DJBA 2J3TD 3ZCZA 3DTKA 1YLZA 5JYPA 2ZC5B 1KE3A 2AVXA 1RGYA 4EESA 3PAEA 5CTNA 2H10A 2WGWA 1GHIA 4DKIA 1H3QA 3MQOA 3V3RA 2INWA 3BFFA 5M1AA 4FD8A 4LV3A 5IT5A 1Y54A 2Y2JA 3D3OA 4GN2A 2PHYA 3C30A 2HP9A 3KSHA 3T4OA 2Y2IA 1W8QA 1W5DA 3G2YA 3NIAA 4L9FA 3C38A 4Y0TA 1UGUA 1YT4A 4OP5A 1S1YA 1C3BA 3BLMA 1J9MA 3T50A 4QJGA 1TS7A 4P0MA 3WWXA 3DWKA 1M6KA 1VEUB 3A0RA 1HLUP 1PNEA 4MBHA 3G35A 4DE2A 5GHXA 4RYEA 4K08A 5F83A 1IYPA 1XJ2A 2PD7A 4Y17A 4KQDA 1TDLA 2J9PA 1K4FA 5KMWA 1K6RA 4X56A 3H82B 4JGRA 1DRMA 1GHMA 1XPBA 4GD8A 4S2KA 3QP5A 4BD0A 4O8GA 4G3VA 2PBYA 3S22A 2WZXA 5FDHA 3CUEC 4ZRRA 2PR5A 5HX9A 4G3WA 4DJ3A 1IYQA 4FOFA 4P85A 2KX6A 2ZL1B 1S4RA 4BL3A 2O0YA 4BQMA 2PRFA 3HLGA 4B4ZA 4L9GA 1YM1A 4Y5FA 3KO6A 1TS8A 5E2FA 4KUOA 3UMDA 3UNWA 4FTXA 1YKDA 2OSUA 3UB9A 4HJ6A 4IJGA 2MJ6A 1YSQA 2Z6CA 3IT9A 3LR3A 4GS9A 1AXBA 4LV1A 2J80A 2WKHA 3MXQA 5A92A 3UE3A 4S2NC 1FCMA 4CJNA 1IELA 4HY8A 4JGQA 4ZDXA 5KZHA 1O07A 1HD8A 2W0NA 1PWCA 4HNBA 2R9WA 1YLJA 3H9WA 1DY6A 3LEZA 3H7WB 4Y0OA 1SKFA 1I2WA 2WKRA 4DDYA 3GECA 1KDSA 1BLCA 1W63Q 5HFOA 3IXHA 5CGWA 3HUOA 1PW8A 4HHDA 3HLEA 2UV0E 3O87A 3HLDA 1BLSA 1LL8A 2J3TC 2HP5A 1BLPA 1Y4OA 2YKFA 3F1NA 4WF0A 2FFYA 2IWBA 4DRTA 2H0YA 5AQAA 1MC0A 4WZ5A 5DTKA 2JC7A 4NKPA 2W1TA 4CLCD 3UB6A 3HLWA 3UDXA 4HP9A 2PD8A 2B02A 2GDNA 2Y2GA 5BOHA 5F1FA 4QY5A 2BTFP 4HBTA 2PU2A 3LI8A 3F1PB 3MMHA 1PI5A 4I3IA 2B95A 4OPRA 2YKHA 2WKEA 1BYWA 3HJIA 5FAOA 2A24B 3BFEA 2JCHA 4OQIA 3KSFA 4II7A 2L0WA 1VETA 5HL1A 3ZQ5A 3IBJA 2ZC7A 4R3BA 4X53A 5DFXA 4PM8A 3VOYA 1EI5A 4JXGA 1DP8A 5GLCA 1F5MA 4K0XA 2Y2NA 3CAXA 4S2NA 2WAFA 2VA0A 2XA7M 4HESA 5HAQA 5EM0A 1Y28A 3LCEA 1H8MA 3LFVA 5FA7A 3LUQA 2BG1A 2ZJ9A 3TW8A 4KZ3A 1KDWA 3S7NA 2FZ0A
chains in the Genus database with same CATH topology
4I39A 2XSSA 3OOVA 3U2AA 2ZMVA 3OBFA 2O99A 2V0UA 5HWWA 3PBNA 5I5LA 1YAXA 4JGOA 3PBQA 5HDDA 3P7NA 2KOIA 2PYRA 3BY8A 3BW6A 2VLGA 3FC7A 4EXOA 1IOUA 1LSXA 4HJ3A 3V67A 2FH5A 4G3KA 3K2NA 3MJQA 1NWZA 4B93A 1WA9A 4HI4A 2EA9A 4FSFA 3C2WA 3O5YA 2HF6A 4GJ4A 2OAP1 3NJAA 2W1TB 1S4SA 1KOUA 4NXGA 2OWHA 1T18A 1GSVA 4JGPA 5IU1A 3K3CA 2K2NA 4UQIM 1GSWA 3A0VA 2H28A 3SW1A 4Z1WA 2JKRI 4EW7A 4YOFA 2ZOIA 4ETZA 3T4TA 5HPFA 2BASA 2L4RA 5KIZA 5HSQA 3NOTC 3RTYA 2V1AA 3RFBA 2JKTM 1OTEA 4PKYA 2VV6A 3A0SA 1W63M 4B9OA 1P9WA 4Q0IA 1VB6A 5DJTA 4O0PA 4CLCB 5DKKA 1NRJA 4HH2A 4KQOA 3CUEA 2HV1A 5F6AA 2Z6DA 2VKSA 4LRZE 3K3DA 3IS2B 4I3AA 4LRYC 5MC7A 1T1CA 3HJKA 5LBRA 5TBMA 3GDIA 3R7WB 1F9IA 2LB5A 4GHIB 4WEJA 3T4KA 4MN7A 2QJ7A 1MZUA 3EGDC 3JVVA 5HZHA 1S1ZA 3R4KA 2B18A 4OOLA 4PKYG 2PDRA 3IBRA 5HD5A 2LB9A 1YSPA 3IS2A 5HD3A 3VE3A 1EW0A 2WKQA 3H82A 4Y3IA 4GW9A 4R6LA 3RH8B 2HGVA 4EUVA 2NUTC 5HWTA 3PBSA 1LSWA 4NEED 4L0LA 5HDSA 3MF0A 4WL9A 1ZTUA 4MMNA 3EEAA 1T1BA 5F5YA 1NLYA 2HJEA 2JHEA 3CI6A 3W2ZA 5HL6A 3BY9A 2DMWA 1OTBA 3OLOA 2JKTI 3ZYTA 4F3LB 1TD5A 4EEPA 3KYQA 4LRXC 3HCYA 2P7JA 2V1BA 2W1RA 3BQAA 4NXBA 2VZWA 2J3TD 3C8CA 3CLOA 4GLQA 4PAUA 5CX7A 5DKLA 1LSVA 2W3EA 3VV4A 5G4YA 4DJ2A 4R38A 4DN0A 2M7UA 1JNUA 4F3LA 2GNXA 3FPVA 1XFQA 4EESA 1X0OA 1H3QA 3MQOA 2INWA 5IT5A 1OTIA 3D3OA 2ZOHA 4ETXA 2D02A 2PHYA 3C30A 3E98A 4DMZA 2OAQ1 3KSHA 4H6JA 3TE8A 5EFWA 3T4OA 3BWLA 2R78A 3UMEA 3PHYA 5KSHA 3KX0X 1P0ZA 4L9FA 2EWVA 3LIDA 3C38A 2OWJA 4YWZA 4BWIA 2P08A 1UGUA 1V9YA 1TS6A 2W27A 3PBOA 1S1YA 4GCZA 4EQ1A 1P9RA 4MDZA 1XJ3A 4HIAA 1UWNX 3H7WA 3LR0A 5A8BA 3S7PA 3T50A 1TS7A 3T4LA 3S7OA 5DJUA 3A0RA 4L9EA 4QPRA 3T4SA 3PBTA 4EETB 4K08A 4P6ZM 4EEUA 1XJ2A 2PD7A 5TBMB 4KQDA 5F68A 2VV7A 2W3HA 4PHTA 1OPXA 2O9BA 3MQ0A 2Y8HA 3BJNA 4WLAA 3NHQA 5G4ZA 1UWPX 5AVEA 1XFNA 3LIEA 2VJWA 4IHQA 1DP6A 1V9ZA 3TJZC 3H82B 3KSIA 4JGRA 3EQUA 4NXFA 1DRMA 3CITA 5HDCA 4NXEA 1P97A 5K5BA 3PYPA 4O8GA 4BMWA 4G3VA 4R3AA 2HJ9C 2VX8A 2WKPA 3CUEC 4ZRRA 2PR5A 3PBRA 4EERA 3LYXA 3F1OB 4G3WA 1T1AA 4DJ3A 5HWVA 2ZMFA 3EEHA 4FOFA 4WEKA 3F1PA 2KX6A 1S4RA 4OOMA 2O0YA 2QYBA 2JN7A 2W3DA 4CLCC 3P01A 4L9GA 2XA7S 3KYZA 3FG8A 3S7QA 3F1OA 5HPIA 2EWWA 4Y5FA 3EQVA 3KO6A 1TS8A 4XT2A 1OJGA 4KUOA 2VGLS 3UMDA 3VOLA 4HP4A 2V9AA 3LI9A 1YKDA 3EGXC 1OT6A 1XJ4A 4HJ6A 3UB9A 4IJGA 2XRNA 1S66L 3OC2A 5C5KA 2MJ6A 1YSQA 4HH3A 2Z6CA 3LR3A 4GS9A 4UEYA 3T4QA 4EU0A 3LR4A 2J80A 2KLIA 1N9NA 2GJ3A 4MCWA 3LIBA 3MXQA 5IS1A 2GX5A 3UE3A 4H6JB 3B33A 4Q0HA 2O9CA 1TF1A 4I5SA 2OOLA 1N9OA 3EOIA 4HY8A 2M7VA 1GSXA 1IFQA 4JGQA 1D06A 5AVFA 4BJPA 4WN5A 3TRCA 4BBUA 4WELA 2IA2A 4E04A 2W0NA 4HOIA 2P04A 4HNBA 2PT7A 4BBVA 3E0YA 4Q0JA 1N9LA 4YNRA 3MR0A 1T19A 4IUHA 3H9WA 3LIFA 5J7EA 2PYPA 4HQAA 3H7WB 1LT0A 4ARZA 1D7EA 3BQ8A 1S67L 5DF9A 1G28A 2WKRA 4M4XA 4I3JA 4RQ9A 3GECA 3LIAA 3EWKA 3OCLA 1W63Q 4UQIS 2QHKA 4MN5A 1MKMA 3LICA 1NLZA 3F1NB 3NOUC 4KUKA 3ICYA 3PR6A 4P6ZS 4HHDA 3JVUA 3UB7A 3T4JA 1LL8A 2J3TC 4LPZA 2GZAA 1TS0A 2VEAA 1G6OA 2YKFA 3B42A 1OTDA 1OJ5A 3F1NA 3LR5A 2PR6A 4WF0A 2QKPA 1MC0A 3G6OA 4NKPA 2W1TA 3KSGA 4CLCD 4AFIA 5L8MA 1XJ6A 3UB6A 4HP9A 2PD8A 3B47A 3UB8A 3MQQA 2B02A 2QWSA 4HJ4A 2K31A 4WUJA 2QJ5A 4CQHA 3ULFA 3LI8A 3F1PB 4Y2FA 3MMHA 4BBTA 1OTAA 2V0WA 4I3IA 2KDKA 3UE6A 2XROA 2W3GA 2YKHA 5J3WA 3VE4A 5AJGA 1BYWA 2Y79A 3D72A 2O9AA 3HJIA 4XT2B 3E4QA 2A24B 2ZBBA 3OCNA 4O01A 4CLCA 4I38A 2I9VA 4CLCE 3KSFA 4GS9B 4II7A 5FL3A 2L0WA 3ZQ5A 1VHMA 3R7WA 1STZA 2A24A 4GHIA 1ZHHB 2NUPC 2K7SA 3IBJA 1OT9A 1DP9A 4R70A 4IUKA 2A2LA 4ME4A 2W3FA 3E4PA 5DFXA 3PXPA 3DBAA 5DFYA 1DP8A 3FPWA 4LLOB 1F5MA 2L1MA 3CAXA 1ODVA 3MFXA 2VA0A 2D01A 5J4EA 2XA7M 4ARZB 3E4OA 3NOPC 2J3WA 1Y28A 1H8MA 1F98A 3LFVA 5F69A 5TJJA 2JKRM 2VGLM 3LUQA 2VV8A 2M1CA 3TW8A 2CMNA 4MN6A 2G7UA 3S7NA 3CWFA 2FZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I39 A;  2V0U A;  5HWW A;  5I5L A;  4JGO A;  5HDD A;  3P7N A;  2PYR A;  3BY8 A;  2VLG A;  3FC7 A;  4EXO A;  1LSX A;  4HJ3 A;  3MJQ A;  1NWZ A;  1WA9 A;  4HI4 A;  2EA9 A;  3C2W A;  3NJA A;  1S4S A;  1KOU A;  4NXG A;  2OWH A;  1T18 A;  1GSV A;  4JGP A;  5IU1 A;  3K3C A;  1GSW A;  3A0V A;  2H28 A;  3SW1 A;  4EW7 A;  2ZOI A;  2BAS A;  2L4R A;  5KIZ A;  5HSQ A;  3NOT C;  3RTY A;  2V1A A;  1OTE A;  4PKY A;  2VV6 A;  3A0S A;  4B9O A;  1VB6 A;  5DJT A;  5DKK A;  4HH2 A;  2HV1 A;  5F6A A;  2Z6D A;  4LRZ E;  3K3D A;  3IS2 B;  4I3A A;  4LRY C;  1T1C A;  3HJK A;  5TBM A;  3GDI A;  1F9I A;  4GHI B;  2QJ7 A;  1MZU A;  5HZH A;  1S1Z A;  4PKY G;  5HD5 A;  2PDR A;  3IBR A;  3VE3 A;  3IS2 A;  5HD3 A;  1EW0 A;  2WKQ A;  3H82 A;  4GW9 A;  4R6L A;  3RH8 B;  5HWT A;  1LSW A;  5HDS A;  4WL9 A;  1T1B A;  5F5Y A;  2JHE A;  3BY9 A;  1OTB A;  3OLO A;  4F3L B;  4EEP A;  4LRX C;  2P7J A;  2V1B A;  4NXB A;  3C8C A;  3CLO A;  5DKL A;  1LSV A;  5G4Y A;  4DJ2 A;  4R38 A;  1JNU A;  4F3L A;  1XFQ A;  4EES A;  1X0O A;  3MQO A;  2INW A;  1OTI A;  2ZOH A;  2D02 A;  2PHY A;  4H6J A;  5EFW A;  3BWL A;  2R78 A;  3UME A;  3PHY A;  3KX0 X;  1P0Z A;  4L9F A;  3LID A;  2OWJ A;  4YWZ A;  1UGU A;  1V9Y A;  1TS6 A;  2W27 A;  1S1Y A;  4GCZ A;  4EQ1 A;  1XJ3 A;  4HIA A;  1UWN X;  3H7W A;  5A8B A;  3T50 A;  1TS7 A;  5DJU A;  3A0R A;  4L9E A;  4EET B;  4K08 A;  4EEU A;  1XJ2 A;  2PD7 A;  5TBM B;  4KQD A;  5F68 A;  2VV7 A;  4WLA A;  3NHQ A;  5G4Z A;  1UWP X;  5AVE A;  1XFN A;  3LIE A;  1DP6 A;  1V9Z A;  3H82 B;  4JGR A;  4NXF A;  1DRM A;  5HDC A;  4NXE A;  1P97 A;  3PYP A;  4R3A A;  2WKP A;  2PR5 A;  4EER A;  3LYX A;  3F1O B;  1T1A A;  4DJ3 A;  5HWV A;  3EEH A;  3F1P A;  2KX6 A;  1S4R A;  2JN7 A;  4L9G A;  3FG8 A;  3F1O A;  4XT2 A;  1TS8 A;  1OJG A;  4KUO A;  3UMD A;  3VOL A;  4HP4 A;  2V9A A;  3LI9 A;  1OT6 A;  1XJ4 A;  4HJ6 A;  3UB9 A;  1S66 L;  4HH3 A;  2Z6C A;  4GS9 A;  2J80 A;  1N9N A;  2GJ3 A;  3LIB A;  3MXQ A;  5IS1 A;  4H6J B;  3B33 A;  4I5S A;  2OOL A;  1N9O A;  4HY8 A;  1GSX A;  4JGQ A;  1D06 A;  5AVF A;  4WN5 A;  4BBU A;  4E04 A;  2W0N A;  4HOI A;  4HNB A;  4BBV A;  1N9L A;  3MR0 A;  1T19 A;  3H9W A;  3LIF A;  5J7E A;  2PYP A;  4HQA A;  3H7W B;  1LT0 A;  1D7E A;  1S67 L;  1G28 A;  2WKR A;  4M4X A;  4I3J A;  4RQ9 A;  3GEC A;  3LIA A;  3EWK A;  2QHK A;  4MN5 A;  3LIC A;  3NOU C;  3F1N B;  4KUK A;  3ICY A;  4HHD A;  3UB7 A;  1LL8 A;  4LPZ A;  1TS0 A;  2VEA A;  2YKF A;  3F1N A;  1OTD A;  1OJ5 A;  4WF0 A;  2PR6 A;  2QKP A;  3G6O A;  1XJ6 A;  3UB6 A;  4HP9 A;  2PD8 A;  3UB8 A;  3MQQ A;  2B02 A;  2QWS A;  4HJ4 A;  4WUJ A;  2QJ5 A;  3ULF A;  3LI8 A;  3F1P B;  4BBT A;  1OTA A;  2V0W A;  4I3I A;  2KDK A;  3UE6 A;  2YKH A;  5J3W A;  3VE4 A;  1BYW A;  3D72 A;  3HJI A;  4XT2 B;  3E4Q A;  2A24 B;  2ZBB A;  4I38 A;  2I9V A;  4GS9 B;  2L0W A;  3ZQ5 A;  2A24 A;  4GHI A;  2K7S A;  1OT9 A;  1DP9 A;  4R70 A;  3E4P A;  1DP8 A;  4LLO B;  2L1M A;  3CAX A;  1ODV A;  3MFX A;  2D01 A;  5J4E A;  3E4O A;  3NOP C;  1Y28 A;  1F98 A;  5F69 A;  3LUQ A;  2VV8 A;  2M1C A;  2CMN A;  4MN6 A;  3CWF A; 
#chains in the Genus database with same CATH topology
 2XSS A;  4QY6 A;  3QP4 A;  4UHU A;  4JKT A;  3PBN A;  3PBQ A;  1W8Y A;  3V67 A;  2FH5 A;  3K2N A;  3MJQ A;  5M19 A;  1BTL A;  2EA9 A;  3KYE A;  3O5Y A;  2HF6 A;  3NJA A;  3RXW A;  1FIL A;  1S4S A;  1K56 A;  5FAT A;  2Y2M A;  4Y0U A;  4ID4 A;  1T18 A;  4JGP A;  5IU1 A;  3ZDJ A;  5M18 A;  5EOE A;  3SW1 A;  1LI0 A;  3IHB A;  4EW7 A;  2V8F A;  4YOF A;  5CHM A;  1ES4 A;  2V1A A;  1OTE A;  5E2E A;  1SHV A;  3A0S A;  2XEP A;  1BT5 A;  4JF4 A;  4QHC A;  4PM7 A;  5G18 A;  3IWQ A;  1VEU A;  5L10 A;  4C6Y A;  1NRJ A;  4Y7P A;  2JE5 A;  2Z6D A;  4LRZ E;  5FAQ A;  1KVL A;  1T1C A;  5LBR A;  1LI9 A;  3GDI A;  5L07 A;  2QJ7 A;  4YFM A;  1MZU A;  1D1J A;  2Y4A A;  4OOL A;  4RA7 A;  5HD5 A;  1YSP A;  3IS2 A;  3UY6 A;  3H82 A;  4Y3I A;  4BEN A;  2EX9 A;  5IHV A;  1G6A A;  2NUT C;  3N8S A;  4KG6 A;  1LSW A;  3W4Q A;  4N1H A;  4MMN A;  1WYC A;  4OKP A;  1T1B A;  3CI6 A;  2DRW A;  3GQZ A;  3BM6 A;  1CI8 A;  3D9Y A;  4LV0 A;  4F3L B;  3ZG7 B;  2ZL1 A;  3N6I A;  1CQA A;  3KYQ A;  1BUL A;  3SS3 A;  2W1R A;  4OQ0 A;  4P6B A;  4NXB A;  2ZM0 A;  5EUA A;  4D60 A;  3CLO A;  2W3E A;  4F94 A;  4DJ2 A;  2HDR A;  2M7U A;  5EPH A;  1JNU A;  3FPV A;  1L0G A;  2XDM A;  4ZTK A;  1PW1 A;  1X0O A;  3Q81 A;  2WAE A;  3VOZ A;  3GMW A;  2D02 A;  5FAP A;  3DTI A;  4MLL A;  3G2Z A;  4OVD A;  5KSH A;  2EWV A;  3LID A;  1K54 C;  4ZAM A;  2OWJ A;  3GVB A;  4KZB A;  1FCN A;  3NBL A;  2W27 A;  3SH8 A;  3WS1 A;  1E3U D;  3LGO A;  5E2H A;  4GCZ A;  4MDZ A;  3N4I A;  4HIA A;  1UWN X;  3QP8 A;  3H7W A;  1MY8 A;  3S7P A;  1GA0 A;  3UB5 P;  3S7O A;  5DJU A;  1FSW A;  4M3K A;  3T4S A;  3UPN A;  4EET B;  4MEZ A;  1NXY A;  1ESI A;  2G2U A;  5TBM B;  4ZBE A;  2W3H A;  1QME A;  3QP1 A;  5G4Z A;  1UWP X;  3DTM A;  3VP1 A;  4U0T A;  3V50 A;  5FAS A;  5HW3 A;  3HUM A;  1IYO A;  1P97 A;  4JF6 A;  3U4L P;  3S4X A;  4X69 A;  1K57 C;  3NC8 A;  3BYD A;  3QP6 A;  3D4F A;  3F1O B;  1JWV A;  2ZMF A;  3F1P A;  1MWS A;  4OOM A;  2WGI A;  2QYB A;  1K55 C;  4DXB A;  1VQQ A;  3KYZ A;  3S7Q A;  2EWW A;  3EQV A;  2XH9 A;  1OJG A;  2VGL S;  3VOL A;  4HP4 A;  5CED A;  3MXR A;  1OT6 A;  4WYY A;  1AWI A;  4UEY A;  2KLI A;  1KVM A;  3MXS A;  2GX5 A;  3B33 A;  5F82 A;  1MBL A;  2O9C A;  3IWI A;  4I5S A;  1N9O A;  3EOI A;  5FQI A;  1GSX A;  4GDB A;  1RP5 A;  3TRC A;  4BBU A;  3E0Y A;  1CF0 A;  4R23 A;  4BLM A;  1K56 D;  1FCO A;  1T19 A;  3LIF A;  3CJM A;  1LT0 A;  1D7E A;  5DF9 A;  1K6S A;  4QU3 A;  4I3J A;  4S2P A;  3OZH A;  1GCE A;  3EWK A;  3L7H A;  4UQI S;  2QHK A;  4E3L A;  1K0K A;  1PRQ A;  3IX8 A;  3NOU C;  1LL5 A;  3ICY A;  3IHA A;  5HAP A;  1FSY A;  2OV5 A;  2EXA A;  3JVU A;  2ZLY A;  3V3S A;  3T4J A;  2GZA A;  1G68 A;  1TS0 A;  1G6O A;  3AGD A;  1BZA A;  4FH2 A;  1XGJ A;  4KZ8 A;  3G31 A;  3KSG A;  5L8M A;  1K38 A;  2K31 A;  4WUJ A;  5EVI D;  4CQH A;  4RVA A;  4Y2F A;  4BBT A;  4WMC D;  1ZG4 A;  2Y2H A;  4LGW A;  5J3W A;  4XT2 B;  3E4Q A;  4O01 A;  1K55 A;  3IQA A;  1TVF A;  2ZQD A;  5E2G A;  4I38 A;  2I9V A;  2R9X A;  1PYY A;  5CEB A;  3A3J A;  5CXW A;  1L0E A;  3ZNT A;  2WKI A;  1ZHH B;  3CPT B;  2NUP C;  2K7S A;  1DP9 A;  4R4R A;  4EBN A;  2W3F A;  3E4P A;  1KE4 A;  3HUN A;  3DBA A;  4KZ7 A;  3BFD A;  3VSL A;  5TR7 A;  1ODV A;  2JBF A;  3MFX A;  2D01 A;  1IEM A;  1MKI A;  4Z9Q A;  3ZFZ A;  2J3W A;  1G5U A;  3SH7 A;  1RGZ A;  3WS0 A;  2XFT A;  3AGE A;  2EFX A;  4JLF A;  4I39 A;  3C4O A;  2ZC4 B;  2ZMV A;  3OBF A;  1XXM A;  2V0U A;  3GRJ A;  4KQR A;  4JGO A;  3TOI A;  5GL9 A;  3BRM A;  4U3T A;  2X71 A;  5FQJ A;  3BY8 A;  3N8L A;  2HDS A;  5DTS A;  3FC7 A;  4KZA A;  4WZ4 A;  4B93 A;  3UN7 A;  1FOF A;  4X55 A;  4KG5 A;  1KOU A;  4E3O A;  3FYZ A;  5CRF A;  2JKF A;  1MWR A;  4GD6 A;  1YQS A;  2Q0O A;  2WK0 A;  1NYY A;  3G30 A;  2ZOI A;  2BAS A;  4UA9 A;  3O88 A;  2L4R A;  3HLF A;  2JKG A;  2JKT M;  3RFB A;  1XA1 A;  2IWD A;  1OME A;  1I2S A;  1W63 M;  4Q0I A;  3BFC A;  5TFQ A;  5A90 A;  1VB6 A;  5GLA A;  4CLC B;  4KQO A;  3CUE A;  2HV1 A;  4B88 A;  4FUW A;  5MC7 A;  4OPQ A;  4QB8 A;  3HJK A;  5HAR A;  5TBM A;  3R7W B;  1PWG A;  3UE0 A;  2J7V A;  2HZ5 A;  4WEJ A;  3T4K A;  2Y2O A;  3OPP A;  2PBD P;  5EM1 A;  3HVF A;  3C4P A;  4PKY G;  3P98 A;  2LB9 A;  1JVJ A;  3VE3 A;  1EW0 A;  2WKQ A;  3AGF A;  3WRZ A;  2HGV A;  3Q7V B;  1Z09 A;  4LCM A;  5HWT A;  3PBS A;  1ONG A;  1PWD A;  4NG2 A;  1HVB A;  1ZTU A;  1KGE A;  4EQI A;  2JHE A;  3BY9 A;  2DMW A;  1OTB A;  1J3W A;  3ZYT A;  1YLT A;  1DJA A;  3MZD A;  3MBZ A;  2XK1 A;  3HCY A;  2WGW B;  2P7J A;  2Z2L B;  2V1B A;  3BQA A;  1I5Q A;  2VZW A;  3C8C A;  4GLQ A;  5DKL A;  3IF6 B;  3VV4 A;  1XP4 A;  4UAA A;  3W8K A;  3MSH A;  2XQZ A;  4WBG A;  3IH8 A;  2PU4 A;  1SDN A;  3BEC A;  3QNB A;  4E3I A;  4BL2 A;  3IH9 A;  2ZOH A;  1KGF A;  4ETX A;  5CTM A;  2HP6 A;  3TE8 A;  4NK3 A;  2R78 A;  3UME A;  1P0Z A;  4PM6 A;  1ES5 A;  4D2O A;  2ZD8 A;  4X68 A;  1CK3 A;  2IWC A;  4BWI A;  2DCF A;  2P08 A;  1V9Y A;  2C5W B;  3CMZ A;  3HBR A;  4GNU A;  5FQM A;  1U60 A;  1P9R A;  1XJ3 A;  4E3J A;  3IX4 A;  3LR0 A;  2EX2 A;  3L9K A;  2X02 A;  1E4D A;  2XLN A;  1YPR A;  4L9E A;  4N9K A;  5E43 A;  4OP8 A;  3PBT A;  2PAV P;  1CJF A;  4P6Z M;  4EEU A;  3ZGA B;  3MZE A;  3FKW A;  2VV7 A;  2O9B A;  3BJN A;  3NHQ A;  1DP6 A;  3TJZ C;  1YMS A;  4S2I A;  3KSI A;  4E3N A;  3ITA A;  3CIT A;  4NXE A;  2XF3 A;  5EOO A;  3PYP A;  3GV9 A;  4CPK A;  4R3A A;  1JTG A;  3SH9 A;  2VX8 A;  2WKP A;  3ITB A;  2VK3 A;  3PBR A;  3RXX A;  2EFU A;  4EER A;  2Z2M B;  5GLB A;  4E3K A;  3WS2 A;  1ACF A;  1CEG A;  3EEH A;  1GA9 A;  1ERM A;  2W3D A;  4CLC C;  3NUL A;  4S2L A;  3P01 A;  2XA7 S;  4JPM A;  5HPI A;  3CZD A;  4XT2 A;  3LEQ A;  5FI6 A;  1SDE A;  4K0W A;  3T1S A;  1Z6F A;  3LI9 A;  5FEF A;  3EGX C;  1XJ4 A;  3UDF A;  3OC2 A;  1S66 L;  2X01 A;  4R4S A;  4HH3 A;  3W4P A;  4EU0 A;  3LR4 A;  4OON A;  1N9N A;  2GJ3 A;  1NY0 A;  2WAD A;  4MCW A;  3LIB A;  3B3X A;  5IS1 A;  3CPT A;  4H6J B;  1TF1 A;  4PM9 A;  1ERQ A;  2OOL A;  1WE4 A;  3M2J A;  4U0X A;  3M6H A;  3ZG0 A;  1BSG A;  2Y2Q A;  5AVF A;  3SZT A;  4BJP A;  4WN5 A;  3NDG A;  4WEL A;  2IA2 A;  4KZ5 A;  1L0D A;  2P04 A;  4GDN A;  3G32 A;  4JBF A;  4UA6 A;  1N9L A;  4IUH A;  2PYP A;  4ZJ3 A;  2OLU A;  4LEN A;  4HQA A;  1S67 L;  1FR1 A;  1PFL A;  3NEC A;  2WYX A;  4EWF A;  3DWZ A;  1ZC2 A;  3LIA A;  3OCL A;  3VP4 A;  3IF6 C;  2C6W B;  4N9L A;  3FWL A;  4MN5 A;  1MKM A;  3UE1 A;  3LIC A;  2V20 A;  1NLZ A;  2Y2K A;  3F1N B;  4KUK A;  4P6Z S;  2EX8 A;  4ZJ2 A;  4MBK A;  2V2F F;  4S2O A;  3V5M A;  4ZJ1 A;  1WYB A;  4GB7 A;  5DVA A;  4LPZ A;  3DAV A;  5HAI A;  3T12 B;  4JF5 A;  2VEA A;  3B42 A;  2PR6 A;  4QWO A;  3G6O A;  4AFI A;  3OPL A;  1XJ6 A;  4IED A;  2XR0 A;  4MBF A;  4JXW A;  3MQQ A;  3NI9 A;  3ULF A;  3M2K A;  4N92 A;  5AQ9 A;  3VP0 A;  1OTA A;  2V0W A;  2RL3 A;  3UE6 A;  2XRO A;  4OLD A;  3FKV A;  3G4P A;  1H8Z A;  4HEF A;  1ES2 A;  3VE4 A;  1VET B;  4PM5 A;  5AJG A;  3NDE A;  2O9A A;  3OCN A;  3CG5 A;  3NCK A;  3NY4 A;  4CLC A;  4PPR A;  3C7V A;  2EX6 A;  1FR6 A;  3GSG A;  2Q9N A;  1ESU A;  5FL3 A;  2V8C A;  1FIK A;  1HTZ A;  1VHM A;  3Q82 A;  3R7W A;  3S1Y A;  1STZ A;  1CEF A;  5EEC A;  2A24 A;  1OT9 A;  4IVK A;  4IUK A;  3SS4 A;  2A2L A;  1L3L A;  2QZ6 A;  4JXS A;  5AQ7 A;  3PXP A;  3QNC A;  5DFY A;  4DDS A;  3FPW A;  4DE0 A;  2ZQA A;  2H0T A;  3Q7V A;  2L1M A;  4LLO B;  4IBX A;  3A3D A;  1JWZ A;  5J4E A;  1IYS A;  1JWP A;  4KZ9 A;  4ARZ B;  3E4O A;  1LL9 A;  5TJJ A;  2HDU A;  5F69 A;  4R1G A;  2JKR M;  5CGX A;  2P9V B;  5L2F A;  2VV8 A;  4IBR A;  3UPO A;  2G7U A;  3CWF A;  3VMA A;  3OOV A;  1K54 A;  2V1Z A;  1MXO A;  3CHW P;  5HWW A;  1YAX A;  1L2S A;  3IF6 A;  3P7N A;  4X6T A;  3ZNY A;  2OLV A;  2VLG A;  3BW6 A;  1NYM A;  5A91 A;  4FH4 A;  4G3K A;  2ZMA A;  4OPZ A;  4FSF A;  3C2W A;  4GJ4 A;  3T1Q B;  4E6W A;  3OPH A;  3FZC A;  1K4E A;  3JYI A;  2OWH A;  2E8I A;  3ZG5 A;  1ONH A;  3K3C A;  4KG2 A;  1PI4 A;  2K2N A;  2ZM2 A;  4C75 A;  1F2K A;  3Q07 A;  1GSW A;  4X1L A;  3N8R A;  2H28 A;  4FCF A;  1SCW A;  5I94 A;  1XA7 A;  5HPF A;  3IF5 A;  5KIZ A;  1ALQ A;  1XGI A;  4PKY A;  4DF6 A;  2VV6 A;  1PZP A;  4B9O A;  4LV2 A;  1P9W A;  5DJT A;  4O0P A;  1S0W A;  1K57 A;  4X1M A;  4WZ5 C;  3ISG A;  2VKS A;  3K3D A;  3IS2 B;  4I3A A;  4LRY C;  3A3I A;  5EVI B;  2LB5 A;  4GHI B;  3QHY A;  4S2M A;  1NJ4 A;  2H5S A;  2B18 A;  1NZO A;  1GHP A;  5HD3 A;  1LHY A;  2UWX A;  4GW9 A;  4R6L A;  3RH8 B;  2P74 A;  2ACG A;  3LY3 A;  5DF8 A;  3TG9 A;  3C7U A;  1H8Y A;  4IVI A;  4L0L A;  5HDS A;  1N9B A;  3LY4 A;  3MF0 A;  4WL9 A;  4EBP A;  3UO9 A;  5F5Y A;  1NLY A;  5HL6 A;  4Y13 A;  1MPL A;  3OLO A;  2JKT I;  3T1R A;  1XX2 A;  1TD5 A;  4XUZ A;  4EEP A;  4P87 A;  3OPR A;  4LRX C;  1Q2P A;  1A0K A;  4K91 A;  3HL9 A;  2ZQC A;  4PAU A;  5CX7 A;  2VGK A;  1LSV A;  1XKZ A;  5G4Y A;  1ZG6 A;  4R38 A;  4DN0 A;  4F3L A;  2GNX A;  2E8J A;  1XFQ A;  2ZM8 A;  3HLB A;  1EWZ A;  3Q7Z A;  1Q2Q A;  1OTI A;  2J8Y A;  4N1X A;  3C5A A;  3MS6 A;  3E98 A;  4DMZ A;  1NRF A;  2OAQ 1;  4H6J A;  5EFW A;  5U47 A;  3BWL A;  2XFS A;  2Y91 A;  3PHY A;  4DE3 A;  3MFD A;  3IXG A;  3KX0 X;  2B5R A;  3UPP A;  3TSG A;  5CEC A;  3WS5 A;  1S6R A;  2ZQ7 A;  4YWZ A;  1TS6 A;  1IKI A;  5EE8 A;  3PBO A;  5EVL A;  4EQ1 A;  2J9O A;  1ERO A;  2ZC3 B;  5A8B A;  5DTT A;  3W4O A;  1SKO B;  3T4L A;  4EBL A;  1MWU A;  4R0Q A;  3VP2 A;  5CER A;  2ZC6 B;  2FFF B;  4QPR A;  5J8X A;  4DXC A;  3O86 A;  5F68 A;  4Q8I A;  3VFF A;  4MNR A;  1OPX A;  3MQ0 A;  4PHT A;  2Y8H A;  3V39 A;  4WLA A;  5AQB A;  5AVE A;  1XFN A;  3LIE A;  2VJW A;  4IHQ A;  1V9Z A;  4KZ6 A;  5TGF A;  4WM9 A;  1E3U A;  4NXF A;  3EQU A;  1NZU A;  2HDQ A;  5HDC A;  2Y2L A;  2ZQ9 A;  3Q1F A;  5K5B A;  4Y15 A;  2WUQ A;  4BMW A;  2BLS A;  1ZKJ A;  1VM1 A;  3BFG A;  2Y55 A;  2HJ9 C;  4NET A;  3LYX A;  1T1A A;  5HWV A;  4WEK A;  4BD1 A;  2JN7 A;  4OLG A;  2RCX A;  2CC1 A;  4B4X A;  3ZHH A;  3FG8 A;  4R3J A;  4S2J A;  3F1O A;  5FI7 A;  2A49 A;  2Y59 A;  5FQQ A;  5EVI C;  2V9A A;  3ZVW A;  3MKF A;  2HPB A;  4KZ4 A;  1BLH A;  3O3V A;  4H8R A;  2XRN A;  5C5K A;  3T4Q A;  3IX3 A;  3A3F A;  3A3E A;  1YLP A;  3P09 A;  4Q0H A;  1TDG A;  2XGN A;  2ZQ8 A;  2M7V A;  1IFQ A;  1D06 A;  2QMI A;  4E04 A;  1KE0 A;  4HOI A;  2PT7 A;  4BBV A;  4HBU A;  4Q0J A;  5EV0 A;  4YNR A;  1ES3 A;  1CI9 A;  3MR0 A;  1K25 A;  5J7E A;  4OQG A;  4ARZ A;  3BQ8 A;  3E2L A;  1JTD A;  1G28 A;  3VFH A;  5KSC A;  4M4X A;  2P9V A;  4RQ9 A;  1W79 A;  3IXD A;  1H5X A;  4O7D A;  4LCL A;  3PAG A;  4OQH A;  3PR6 A;  3UB7 A;  1OTD A;  1OJ5 A;  3LR5 A;  4RX3 A;  4LFU A;  2QKP A;  5EVE A;  5FQ9 A;  1RCJ A;  3DTE A;  5DF7 A;  4ESP A;  1LLB A;  5CHJ A;  3I7J A;  1W7F A;  3B47 A;  3UB8 A;  1YLY A;  2QWS A;  4HJ4 A;  2QJ5 A;  3BEB A;  2EXB A;  1TEM A;  4YIN A;  2KDK A;  2W3G A;  5FSR A;  3M6B A;  4JXV A;  3ZVT A;  2Y79 A;  3D72 A;  1PIO A;  1HZO A;  2ZBB A;  3VP3 A;  4CLC E;  5GHZ A;  4GS9 B;  5CHU A;  4OH0 A;  5EVI A;  4GHI A;  5FQK A;  2G2W A;  3N7W A;  5FI2 A;  4R70 A;  4WMC A;  4ME4 A;  5A93 A;  4E6X A;  4OPY A;  4C3Q A;  4GOG A;  3FV7 A;  3VSK A;  3IWO A;  5CGS A;  3JPU A;  4KEN B;  3E2K A;  2Q9M A;  1L0F A;  3NOP C;  4GZB A;  3HLC A;  1F98 A;  5FEG A;  2VGL M;  3SS5 A;  5JYO A;  2M1C A;  4EV4 A;  2CMN A;  4MN6 A;  5L09 A;  3ZG9 B;  1H0M A;  1E25 A;  2I72 A;  3U2A A;  2O99 A;  5I5L A;  1PZO A;  5HDD A;  1DJC A;  2KOI A;  1M40 A;  2PYR A;  4KQQ A;  4QD4 A;  4EXO A;  1IOU A;  5GHY A;  1LSX A;  4HJ3 A;  3LO7 A;  1NWZ A;  4DE1 A;  1WA9 A;  4HI4 A;  3PTE A;  2OAP 1;  2W1T B;  2WGV A;  3HRE A;  3QP2 A;  4NXG A;  1YLW A;  1O7E A;  3WS4 A;  1GSV A;  3IXB A;  2VGJ A;  5D3O A;  3RJU A;  3UDI A;  4UQI M;  3A0V A;  1FQG A;  4Z1W A;  2JKR I;  3G34 A;  1YMX A;  2XD1 A;  4ETZ A;  2Y2P A;  3T4T A;  4XXR A;  3NOT C;  5HSQ A;  3WRT A;  3RTY A;  3GR2 A;  1SKO A;  4UA7 A;  5DKK A;  4HH2 A;  1QMF A;  5F6A A;  3GTC A;  2DNS A;  3MKE A;  4RX2 A;  4GKU A;  1F9I A;  3BLS A;  1KGG A;  4MN7 A;  4X25 A;  2WZZ A;  3EGD C;  3JVV A;  5HZH A;  1S1Z A;  3R4K A;  1MWT A;  2PDR A;  3IBR A;  3SOI A;  3DW0 A;  4PMA A;  4OOY A;  4A5R A;  4EUV A;  5FDS A;  2XD5 A;  4NEE D;  4XUX A;  3T1X A;  2QPN A;  4E3M A;  3EEA A;  1BUE A;  2HJE A;  3W2Z A;  1N4O A;  5F1G A;  5GLD A;  2A3U A;  1IKG A;  1SZV A;  4EUZ A;  3MZF A;  3ZG8 B;  1DJB A;  2J3T D;  3ZCZ A;  3DTK A;  1YLZ A;  5JYP A;  2ZC5 B;  1KE3 A;  2AVX A;  1RGY A;  4EES A;  3PAE A;  5CTN A;  2H10 A;  2WGW A;  1GHI A;  4DKI A;  1H3Q A;  3MQO A;  3V3R A;  2INW A;  3BFF A;  5M1A A;  4FD8 A;  4LV3 A;  5IT5 A;  1Y54 A;  2Y2J A;  3D3O A;  4GN2 A;  2PHY A;  3C30 A;  2HP9 A;  3KSH A;  3T4O A;  2Y2I A;  1W8Q A;  1W5D A;  3G2Y A;  3NIA A;  4L9F A;  3C38 A;  4Y0T A;  1UGU A;  1YT4 A;  4OP5 A;  1S1Y A;  1C3B A;  3BLM A;  1J9M A;  3T50 A;  4QJG A;  1TS7 A;  4P0M A;  3WWX A;  3DWK A;  1M6K A;  1VEU B;  3A0R A;  1HLU P;  1PNE A;  4MBH A;  3G35 A;  4DE2 A;  5GHX A;  4RYE A;  4K08 A;  5F83 A;  1IYP A;  1XJ2 A;  2PD7 A;  4Y17 A;  4KQD A;  1TDL A;  2J9P A;  1K4F A;  5KMW A;  1K6R A;  4X56 A;  3H82 B;  4JGR A;  1DRM A;  1GHM A;  1XPB A;  4GD8 A;  4S2K A;  3QP5 A;  4BD0 A;  4O8G A;  4G3V A;  2PBY A;  3S22 A;  2WZX A;  5FDH A;  3CUE C;  4ZRR A;  2PR5 A;  5HX9 A;  4G3W A;  4DJ3 A;  1IYQ A;  4FOF A;  4P85 A;  2KX6 A;  2ZL1 B;  1S4R A;  4BL3 A;  2O0Y A;  4BQM A;  2PRF A;  3HLG A;  4B4Z A;  4L9G A;  1YM1 A;  4Y5F A;  3KO6 A;  1TS8 A;  5E2F A;  4KUO A;  3UMD A;  3UNW A;  4FTX A;  1YKD A;  2OSU A;  3UB9 A;  4HJ6 A;  4IJG A;  2MJ6 A;  1YSQ A;  2Z6C A;  3IT9 A;  3LR3 A;  4GS9 A;  1AXB A;  4LV1 A;  2J80 A;  2WKH A;  3MXQ A;  5A92 A;  3UE3 A;  4S2N C;  1FCM A;  4CJN A;  1IEL A;  4HY8 A;  4JGQ A;  4ZDX A;  5KZH A;  1O07 A;  1HD8 A;  2W0N A;  1PWC A;  4HNB A;  2R9W A;  1YLJ A;  3H9W A;  1DY6 A;  3LEZ A;  3H7W B;  4Y0O A;  1SKF A;  1I2W A;  2WKR A;  4DDY A;  3GEC A;  1KDS A;  1BLC A;  1W63 Q;  5HFO A;  3IXH A;  5CGW A;  3HUO A;  1PW8 A;  4HHD A;  3HLE A;  2UV0 E;  3O87 A;  3HLD A;  1BLS A;  1LL8 A;  2J3T C;  2HP5 A;  1BLP A;  1Y4O A;  2YKF A;  3F1N A;  4WF0 A;  2FFY A;  2IWB A;  4DRT A;  2H0Y A;  5AQA A;  1MC0 A;  4WZ5 A;  5DTK A;  2JC7 A;  4NKP A;  2W1T A;  4CLC D;  3UB6 A;  3HLW A;  3UDX A;  4HP9 A;  2PD8 A;  2B02 A;  2GDN A;  2Y2G A;  5BOH A;  5F1F A;  4QY5 A;  2BTF P;  4HBT A;  2PU2 A;  3LI8 A;  3F1P B;  3MMH A;  1PI5 A;  4I3I A;  2B95 A;  4OPR A;  2YKH A;  2WKE A;  1BYW A;  3HJI A;  5FAO A;  2A24 B;  3BFE A;  2JCH A;  4OQI A;  3KSF A;  4II7 A;  2L0W A;  1VET A;  5HL1 A;  3ZQ5 A;  3IBJ A;  2ZC7 A;  4R3B A;  4X53 A;  5DFX A;  4PM8 A;  3VOY A;  1EI5 A;  4JXG A;  1DP8 A;  5GLC A;  1F5M A;  4K0X A;  2Y2N A;  3CAX A;  4S2N A;  2WAF A;  2VA0 A;  2XA7 M;  4HES A;  5HAQ A;  5EM0 A;  1Y28 A;  3LCE A;  1H8M A;  3LFV A;  5FA7 A;  3LUQ A;  2BG1 A;  2ZJ9 A;  3TW8 A;  4KZ3 A;  1KDW A;  3S7N A;  2FZ0 A; 
#chains in the Genus database with same CATH homology
 4I39 A;  2XSS A;  3OOV A;  3U2A A;  2ZMV A;  3OBF A;  2O99 A;  2V0U A;  5HWW A;  3PBN A;  5I5L A;  1YAX A;  4JGO A;  3PBQ A;  5HDD A;  3P7N A;  2KOI A;  2PYR A;  3BY8 A;  3BW6 A;  2VLG A;  3FC7 A;  4EXO A;  1IOU A;  1LSX A;  4HJ3 A;  3V67 A;  2FH5 A;  4G3K A;  3K2N A;  3MJQ A;  1NWZ A;  4B93 A;  1WA9 A;  4HI4 A;  2EA9 A;  4FSF A;  3C2W A;  3O5Y A;  2HF6 A;  4GJ4 A;  2OAP 1;  3NJA A;  2W1T B;  1S4S A;  1KOU A;  4NXG A;  2OWH A;  1T18 A;  1GSV A;  4JGP A;  5IU1 A;  3K3C A;  2K2N A;  4UQI M;  1GSW A;  3A0V A;  2H28 A;  3SW1 A;  4Z1W A;  2JKR I;  4EW7 A;  4YOF A;  2ZOI A;  4ETZ A;  3T4T A;  5HPF A;  2BAS A;  2L4R A;  5KIZ A;  5HSQ A;  3NOT C;  3RTY A;  2V1A A;  3RFB A;  2JKT M;  1OTE A;  4PKY A;  2VV6 A;  3A0S A;  1W63 M;  4B9O A;  1P9W A;  4Q0I A;  1VB6 A;  5DJT A;  4O0P A;  4CLC B;  5DKK A;  1NRJ A;  4HH2 A;  4KQO A;  3CUE A;  2HV1 A;  5F6A A;  2Z6D A;  2VKS A;  4LRZ E;  3K3D A;  3IS2 B;  4I3A A;  4LRY C;  5MC7 A;  1T1C A;  3HJK A;  5LBR A;  5TBM A;  3GDI A;  3R7W B;  1F9I A;  2LB5 A;  4GHI B;  4WEJ A;  3T4K A;  4MN7 A;  2QJ7 A;  1MZU A;  3EGD C;  3JVV A;  5HZH A;  1S1Z A;  3R4K A;  2B18 A;  4OOL A;  4PKY G;  2PDR A;  3IBR A;  5HD5 A;  2LB9 A;  1YSP A;  3IS2 A;  5HD3 A;  3VE3 A;  1EW0 A;  2WKQ A;  3H82 A;  4Y3I A;  4GW9 A;  4R6L A;  3RH8 B;  2HGV A;  4EUV A;  2NUT C;  5HWT A;  3PBS A;  1LSW A;  4NEE D;  4L0L A;  5HDS A;  3MF0 A;  4WL9 A;  1ZTU A;  4MMN A;  3EEA A;  1T1B A;  5F5Y A;  1NLY A;  2HJE A;  2JHE A;  3CI6 A;  3W2Z A;  5HL6 A;  3BY9 A;  2DMW A;  1OTB A;  3OLO A;  2JKT I;  3ZYT A;  4F3L B;  1TD5 A;  4EEP A;  3KYQ A;  4LRX C;  3HCY A;  2P7J A;  2V1B A;  2W1R A;  3BQA A;  4NXB A;  2VZW A;  2J3T D;  3C8C A;  3CLO A;  4GLQ A;  4PAU A;  5CX7 A;  5DKL A;  1LSV A;  2W3E A;  3VV4 A;  5G4Y A;  4DJ2 A;  4R38 A;  4DN0 A;  2M7U A;  1JNU A;  4F3L A;  2GNX A;  3FPV A;  1XFQ A;  4EES A;  1X0O A;  1H3Q A;  3MQO A;  2INW A;  5IT5 A;  1OTI A;  3D3O A;  2ZOH A;  4ETX A;  2D02 A;  2PHY A;  3C30 A;  3E98 A;  4DMZ A;  2OAQ 1;  3KSH A;  4H6J A;  3TE8 A;  5EFW A;  3T4O A;  3BWL A;  2R78 A;  3UME A;  3PHY A;  5KSH A;  3KX0 X;  1P0Z A;  4L9F A;  2EWV A;  3LID A;  3C38 A;  2OWJ A;  4YWZ A;  4BWI A;  2P08 A;  1UGU A;  1V9Y A;  1TS6 A;  2W27 A;  3PBO A;  1S1Y A;  4GCZ A;  4EQ1 A;  1P9R A;  4MDZ A;  1XJ3 A;  4HIA A;  1UWN X;  3H7W A;  3LR0 A;  5A8B A;  3S7P A;  3T50 A;  1TS7 A;  3T4L A;  3S7O A;  5DJU A;  3A0R A;  4L9E A;  4QPR A;  3T4S A;  3PBT A;  4EET B;  4K08 A;  4P6Z M;  4EEU A;  1XJ2 A;  2PD7 A;  5TBM B;  4KQD A;  5F68 A;  2VV7 A;  2W3H A;  4PHT A;  1OPX A;  2O9B A;  3MQ0 A;  2Y8H A;  3BJN A;  4WLA A;  3NHQ A;  5G4Z A;  1UWP X;  5AVE A;  1XFN A;  3LIE A;  2VJW A;  4IHQ A;  1DP6 A;  1V9Z A;  3TJZ C;  3H82 B;  3KSI A;  4JGR A;  3EQU A;  4NXF A;  1DRM A;  3CIT A;  5HDC A;  4NXE A;  1P97 A;  5K5B A;  3PYP A;  4O8G A;  4BMW A;  4G3V A;  4R3A A;  2HJ9 C;  2VX8 A;  2WKP A;  3CUE C;  4ZRR A;  2PR5 A;  3PBR A;  4EER A;  3LYX A;  3F1O B;  4G3W A;  1T1A A;  4DJ3 A;  5HWV A;  2ZMF A;  3EEH A;  4FOF A;  4WEK A;  3F1P A;  2KX6 A;  1S4R A;  4OOM A;  2O0Y A;  2QYB A;  2JN7 A;  2W3D A;  4CLC C;  3P01 A;  4L9G A;  2XA7 S;  3KYZ A;  3FG8 A;  3S7Q A;  3F1O A;  5HPI A;  2EWW A;  4Y5F A;  3EQV A;  3KO6 A;  1TS8 A;  4XT2 A;  1OJG A;  4KUO A;  2VGL S;  3UMD A;  3VOL A;  4HP4 A;  2V9A A;  3LI9 A;  1YKD A;  3EGX C;  1OT6 A;  1XJ4 A;  4HJ6 A;  3UB9 A;  4IJG A;  2XRN A;  1S66 L;  3OC2 A;  5C5K A;  2MJ6 A;  1YSQ A;  4HH3 A;  2Z6C A;  3LR3 A;  4GS9 A;  4UEY A;  3T4Q A;  4EU0 A;  3LR4 A;  2J80 A;  2KLI A;  1N9N A;  2GJ3 A;  4MCW A;  3LIB A;  3MXQ A;  5IS1 A;  2GX5 A;  3UE3 A;  4H6J B;  3B33 A;  4Q0H A;  2O9C A;  1TF1 A;  4I5S A;  2OOL A;  1N9O A;  3EOI A;  4HY8 A;  2M7V A;  1GSX A;  1IFQ A;  4JGQ A;  1D06 A;  5AVF A;  4BJP A;  4WN5 A;  3TRC A;  4BBU A;  4WEL A;  2IA2 A;  4E04 A;  2W0N A;  4HOI A;  2P04 A;  4HNB A;  2PT7 A;  4BBV A;  3E0Y A;  4Q0J A;  1N9L A;  4YNR A;  3MR0 A;  1T19 A;  4IUH A;  3H9W A;  3LIF A;  5J7E A;  2PYP A;  4HQA A;  3H7W B;  1LT0 A;  4ARZ A;  1D7E A;  3BQ8 A;  1S67 L;  5DF9 A;  1G28 A;  2WKR A;  4M4X A;  4I3J A;  4RQ9 A;  3GEC A;  3LIA A;  3EWK A;  3OCL A;  1W63 Q;  4UQI S;  2QHK A;  4MN5 A;  1MKM A;  3LIC A;  1NLZ A;  3F1N B;  3NOU C;  4KUK A;  3ICY A;  3PR6 A;  4P6Z S;  4HHD A;  3JVU A;  3UB7 A;  3T4J A;  1LL8 A;  2J3T C;  4LPZ A;  2GZA A;  1TS0 A;  2VEA A;  1G6O A;  2YKF A;  3B42 A;  1OTD A;  1OJ5 A;  3F1N A;  3LR5 A;  2PR6 A;  4WF0 A;  2QKP A;  1MC0 A;  3G6O A;  4NKP A;  2W1T A;  3KSG A;  4CLC D;  4AFI A;  5L8M A;  1XJ6 A;  3UB6 A;  4HP9 A;  2PD8 A;  3B47 A;  3UB8 A;  3MQQ A;  2B02 A;  2QWS A;  4HJ4 A;  2K31 A;  4WUJ A;  2QJ5 A;  4CQH A;  3ULF A;  3LI8 A;  3F1P B;  4Y2F A;  3MMH A;  4BBT A;  1OTA A;  2V0W A;  4I3I A;  2KDK A;  3UE6 A;  2XRO A;  2W3G A;  2YKH A;  5J3W A;  3VE4 A;  5AJG A;  1BYW A;  2Y79 A;  3D72 A;  2O9A A;  3HJI A;  4XT2 B;  3E4Q A;  2A24 B;  2ZBB A;  3OCN A;  4O01 A;  4CLC A;  4I38 A;  2I9V A;  4CLC E;  3KSF A;  4GS9 B;  4II7 A;  5FL3 A;  2L0W A;  3ZQ5 A;  1VHM A;  3R7W A;  1STZ A;  2A24 A;  4GHI A;  1ZHH B;  2NUP C;  2K7S A;  3IBJ A;  1OT9 A;  1DP9 A;  4R70 A;  4IUK A;  2A2L A;  4ME4 A;  2W3F A;  3E4P A;  5DFX A;  3PXP A;  3DBA A;  5DFY A;  1DP8 A;  3FPW A;  4LLO B;  1F5M A;  2L1M A;  3CAX A;  1ODV A;  3MFX A;  2VA0 A;  2D01 A;  5J4E A;  2XA7 M;  4ARZ B;  3E4O A;  3NOP C;  2J3W A;  1Y28 A;  1H8M A;  1F98 A;  3LFV A;  5F69 A;  5TJJ A;  2JKR M;  2VGL M;  3LUQ A;  2VV8 A;  2M1C A;  3TW8 A;  2CMN A;  4MN6 A;  2G7U A;  3S7N A;  3CWF A;  2FZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...