4K08A

Periplasmic sensor domain of chemotaxis protein, adeh_3718
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
143
Chain Sequence
ARMLAERQAKVRALVEAAHGLVEHQGARAARGEISADEARRAALEALRALRYDGSEYFWVNDLEPRMVMHPTNPQLDGQDLSGYRDPNGKLLFQFVRTVRARGSGFVDYLWPKPGSTVPVPKISFVTQYQPWGWVVGSGLYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of periplasmic sensor domains from Anaeromyxobacter dehalogenans 2CP-C: structure of one sensor domain from a histidine kinase and another from a chemotaxis protein.
pubmed doi rcsb
source organism Anaeromyxobacter dehalogenans
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis sensory transducer
total genus 43
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4k08A00
1JNUA 3E4OA 1XJ4A 3UB8A 2H28A 4EERA 3LIEA 2CMNA 1S4SA 2L1MA 3C8CA 4I38A 4MN6A 3ULFA 3IS2B 3F1PB 3F1OA 3KX0X 1VB6A 5HWTA 1S1ZA 1P97A 2QJ5A 3NHQA 1WA9A 2JHEA 3MFXA 1N9OA 3F1OB 4WF0A 3A0RA 4NXBA 3VE3A 2PYPA 3EWKA 3D72A 4HJ3A 3IBRA 3E4PA 3LIDA 5I5LA 5IU1A 2HV1A 3UMDA 5DKLA 1XJ6A 4JGOA 4F3LB 3RTYA 1TS7A 3G6OA 4HY8A 4HIAA 2PD8A 4LRXC 4L9GA 4M4XA 5HWWA 2I9VA 2L0WA 3LI8A 2ZOHA 3T50A 1LL8A 1BYWA 4WLAA 5IS1A 1S67L 3LYXA 2A24A 1DP6A 2OWJA 2D02A 2VLGA 3MQOA 4LPZA 2OOLA 3MR0A 3MQQA 4WUJA 5KIZA 2K7SA 4GS9A 1GSXA 1OTDA 1OTBA 3K3DA 3NOTC 4LRZE 5F6AA 1D06A 2QWSA 2W27A 4HH2A 4LLOB 5G4ZA 1OT6A 1DRMA 4I3JA 2B02A 3CLOA 4KUKA 5F69A 4XT2A 2QKPA 5HWVA 2KDKA 2WKQA 4GW9A 4HI4A 2ZBBA 2ZOIA 2D01A 1D7EA 5EFWA 3IS2A 3F1NB 2PR6A 3NOPC 4HNBA 4RQ9A 5HDCA 4L9EA 1OTEA 4KUOA 1N9LA 2V9AA 2VV7A 4GCZA 4HJ4A 2V0WA 4PKYG 1GSWA 2INWA 5AVEA 4DJ3A 3HJIA 3RH8B 5A8BA 2PD7A 2VEAA 3OLOA 2WKRA 2QJ7A 2Z6CA 4HP9A 4L9FA 4R38A 4K08A 3GDIA 5HDDA 1X0OA 4MN5A 3HJKA 3SW1A 1XJ2A 1KOUA 1TS6A 3A0VA 3K3CA 2W0NA 3PYPA 4NXGA 2BASA 3UB6A 3P7NA 5DKKA 1ODVA 1GSVA 2GJ3A 3LICA 5HD5A 4R70A 4B9OA 1OT9A 5TBMB 4GHIA 3PHYA 2PDRA 2YKHA 4WN5A 3VOLA 1UWPX 3FC7A 1DP9A 4EXOA 4EQ1A 1V9ZA 4JGPA 2V0UA 1TS8A 3MXQA 1XFNA 5DJUA 1T18A 4H6JA 3NOUC 3H82B 1OTAA 2VV8A 4HJ6A 3EEHA 1S4RA 2V1AA 4H6JB 4I3IA 4BBUA 1EW0A 3LIAA 4BBTA 3LI9A 1G28A 1LSXA 3NJAA 4E04A 3F1NA 3LIBA 1XJ3A 1P0ZA 2EA9A 1S66L 3UE6A 3GECA 4NXEA 4JGRA 5DJTA 1UWNX 2L4RA 3CWFA 4YWZA 2PHYA 5HZHA 3F1PA 3H9WA 4HQAA 3UMEA 3VE4A 4DJ2A 4EETB 1XFQA 1NWZA 1T19A 2OWHA 3FG8A 4GHIB 4WL9A 3BY9A 5F5YA 3LIFA 4F3LA 2J80A 3H7WA 4EEUA 1TS0A 2V1BA 3LUQA 1Y28A 3ZQ5A 1T1CA 5J7EA 1V9YA 3E4QA 4I3AA 5HD3A 1T1AA 2QHKA 1LSWA 3ICYA 4I5SA 4LRYC 1UGUA 4HOIA 4R3AA 4XT2B 3UB7A 4EEPA 4HP4A 5J4EA 2KX6A 3MJQA 5J3WA 2R78A 5TBMA 1N9NA 1S1YA 3H7WB 4KQDA 4EESA 2PYRA 3H82A 5G4YA 1DP8A 4GS9B 4R6LA 1MZUA 4I39A 1OJGA 4EW7A 2A24B 3A0SA 2PR5A 2P7JA 2JN7A 2Z6DA 4PKYA 3UB9A 1OJ5A 1F98A 4HH3A 3B33A 5HDSA 5AVFA 2WKPA 4JGQA 2YKFA 2M1CA 3BWLA 1OTIA 1T1BA 3C2WA 4HHDA 4NXFA 5F68A 3BY8A 2VV6A 1F9IA 3CAXA 1LT0A 4BBVA 1LSVA 5HSQA
chains in the Genus database with same CATH superfamily
2L1MA 5CHUA 3KX0X 3IWIA 4DE2A 3D72A 4MBFA 4Y0TA 1PRQA 5AQAA 1XJ6A 1N4OA 4E6WA 4S2IA 1LL8A 3IQAA 1TDLA 1E4DA 4G3WA 4ZAMA 4GS9A 4B4XA 3T4SA 1E25A 2Y2IA 2B02A 4RX3A 3E2LA 2ZL1B 2WADA 4C6YA 3HLFA 3PTEA 4E3KA 4PKYG 3HLBA 2V0WA 3NECA 3RH8B 2Z2LB 3ZHHA 4ID4A 4R38A 4MEZA 1DJAA 5GHXA 2UV0E 2JBFA 2WGWB 3HLGA 1Y54A 1MKIA 3ZCZA 1E3UD 1YMXA 1ONGA 2JKGA 2VX8A 4OLDA 4N1HA 4U0XA 5CEBA 3LIBA 1XJ3A 2EA9A 2I72A 4S2JA 5DJTA 3UO9A 3NIAA 4QPRA 1YT4A 2C5WB 3E98A 1V9YA 3PAEA 4NG2A 1P9RA 2IWCA 4XT2B 4EEPA 3IT9A 3ZVTA 3FZCA 4JXVA 4B93A 4UAAA 4KQDA 1YLPA 3GQZA 2A24B 3C2WA 4NXFA 3T1SA 5EVID 1PYYA 1LT0A 5EM0A 2HF6A 5JYPA 4EBNA 2WYXA 2X71A 3WRZA 3F1PB 1PWDA 1A0KA 3MFXA 2ZMFA 3Q81A 2PYPA 3G30A 3E4PA 4CLCC 3UY6A 4OONA 3DBAA 1IYQA 5HWWA 3AGEA 4P6BA 2ZOHA 3D4FA 1IYOA 2ZQ7A 4RVAA 4WZ5C 1NXYA 5TJJA 3OPLA 1MWRA 4HBUA 4X1LA 5A93A 1SKOB 3V3RA 5F82A 3ITAA 4KQOA 4CPKA 1CQAA 5LBRA 4KG5A 2ZQ8A 4OQIA 1ODVA 2GJ3A 2Y4AA 3OPPA 5FL3A 4S2KA 3NDGA 2DRWA 2HP9A 4EXOA 4JGPA 5CHMA 4DMZA 2ZC7A 3MS6A 1H8MA 3VP1A 4EQIA 3C5AA 4I3IA 3LIAA 4QWOA 3KSIA 3GVBA 1IKIA 1M6KA 2XLNA 3Q07A 1YLJA 4DXBA 2WGVA 2PU2A 3IH9A 4I3AA 3MXSA 5F1GA 2J3TC 3CMZA 1TVFA 4UQIM 4UA9A 2R9WA 3LY4A 4OPRA 1DJCA 4OVDA 1W63M 3LFVA 4HHDA 4ZDXA 4D60A 4NKPA 3MZFA 5CGSA 2EX6A 2XH9A 5FAOA 4Z1WA 4O8GA 2JKTI 4CLCB 4K91A 1C3BA 4ZTKA 3UMDA 1FIKA 3CUEC 3N6IA 5GHZA 4WLAA 5IS1A 2XA7S 4LLOB 5EV0A 4X56A 1JWZA 1ZG4A 2XGNA 3BJNA 4N92A 2JCHA 5EFWA 2WKEA 4RQ9A 4JF6A 4DE1A 4HJ4A 1IKGA 4L9FA 5FQQA 3UPOA 2O9BA 4JXGA 3C4OA 1K38A 2ZM2A 1HLUP 5KSHA 1NYYA 4IHQA 1XA7A 3TE8A 1FOFA 3BLMA 1KVLA 2Z2MB 4R23A 1MC0A 2HGVA 3UE0A 4UA7A 4II7A 3EEHA 1EW0A 3OCLA 2ZMAA 1M40A 4P87A 4EETB 4HQAA 1H3QA 1ACFA 1NWZA 3FG8A 5TR7A 4FSFA 2M7UA 4FH4A 1XKZA 2W1TB 1BLPA 4I5SA 4HEFA 3DAVA 5E2GA 3IXGA 3TJZC 4KZ3A 3U4LP 4U3TA 1KDSA 3V39A 2GNXA 2P7JA 5I94A 1ONHA 3PAGA 1PI4A 2J8YA 5CTNA 1S0WA 3FV7A 5A91A 2G7UA 1WA9A 3LO7A 1H5XA 3ZG5A 1O07A 3S1YA 1PWGA 1RGZA 2HV1A 4P85A 3G6OA 3ZFZA 4CLCD 4GB7A 3CZDA 2A24A 3FKWA 4YINA 1AXBA 2W27A 1FR1A 2K31A 3CLOA 5EVIC 1ERMA 5F69A 3IX4A 1P9WA 5E2FA 2Q0OA 3MBZA 2EFXA 1OTEA 2E8IA 1GHMA 3IF6A 3HLDA 3OLOA 1L3LA 5HAIA 2Y2MA 3SW1A 1KOUA 4Q0HA 1VETB 4C75A 1K57C 4DXCA 3QNBA 2VKSA 3MF0A 1IELA 1IYSA 3E0YA 1G5UA 4PM8A 3VP4A 1YSPA 2ZC6B 4HBTA 4JF5A 3BFCA 3NOUC 3KYZA 2WKIA 2V1AA 2Y59A 4H6JB 1SHVA 3F1NA 4ME4A 3GECA 2XD1A 4RYEA 3SS5A 2JC7A 5A92A 4O01A 5M19A 3BY9A 5DTSA 5J7EA 1LL9A 1Z09A 1WE4A 4MNRA 2EXAA 5FQ9A 1ESIA 1K0KA 1ALQA 4EW7A 1MKMA 3HLWA 4HH3A 2DMWA 5HDSA 3B33A 2YKFA 4BLMA 3LEZA 1MWSA 4YNRA 3CPTB 1F9IA 3PBRA 2OSUA 1QMFA 5CRFA 4R4SA 4EERA 3BW6A 2Y2GA 3MKFA 4IUHA 4G3VA 1YKDA 2BG1A 3G2YA 4R3JA 3T1QB 3BEBA 2FFFB 1I2WA 2VJWA 4MBHA 4ETXA 1BZAA 2D02A 2GDNA 3IBJA 5HPFA 1BULA 3HCYA 4I3JA 4KUKA 4DF6A 5HFOA 2Y91A 5HWVA 5GHYA 2O9AA 4MLLA 3WS2A 2W1RA 2H0TA 4MN7A 3Q7ZA 2VEAA 2K2NA 1IOUA 3A0VA 1EWZA 3PYPA 4NXGA 5CHJA 4FD8A 4PM7A 1VM1A 2ZQ9A 5EE8A 2HPBA 2IA2A 3Q1FA 1QMEA 3UE3A 3PR6A 2O99A 3DTEA 3OZHA 1FCMA 3W2ZA 1W63Q 4JBFA 5FATA 2A49A 2ZD8A 2JE5A 1L0GA 2C6WB 4YWZA 5FSRA 5HZHA 3NC8A 2J3WA 4Y13A 3O86A 2ZMVA 3OC2A 4E6XA 3M6HA 3C7UA 2V1BA 1PIOA 3E2KA 2QHKA 1LSWA 1NRFA 2EX2A 4R3AA 4KZBA 1YAXA 2ZM8A 3T1XA 4EESA 3H82A 3T4TA 4R6LA 1OJGA 3UE1A 2VGKA 2WZXA 3BY8A 3CAXA 3O87A 2ZQCA 1FQGA 2HP5A 5TFQA 3C8CA 3NBLA 2M7VA 1H8YA 1Q2PA 3MFDA 4RA7A 4X68A 2DNSA 3LR4A 4JGOA 3RTYA 4L9GA 4OOLA 4YOFA 4PHTA 1S67L 4QY5A 3HUOA 5C5KA 5CGWA 1MPLA 2R9XA 3NOTC 3BQ8A 1XXMA 3EQVA 4OLGA 1L2SA 2HDQA 2EX8A 2LB5A 3IS2A 4ZJ3A 4KG6A 5AVEA 2PD7A 1J9MA 4HP9A 3QP1A 3SOIA 4DKIA 2GZAA 4EUZA 5A90A 5J8XA 1K55A 3UB6A 4LGWA 3GTCA 1H8ZA 2YKHA 3TW8A 2FFYA 2B5RA 3S7NA 3A3EA 4MCWA 1XFNA 1T18A 1Q2QA 3ZNTA 1ZHHB 1EI5A 2HP6A 4BBUA 2QPNA 3CHWP 1KVMA 2ZC5B 4KZ4A 4JGRA 3M2KA 1KGFA 4DJ2A 1GHPA 1MBLA 3A3JA 4F3LA 2V1ZA 1NZUA 3G32A 2J80A 4KZAA 3VOYA 3E4QA 3ISGA 5CTMA 3ICYA 2A2LA 4IJGA 2KX6A 3A3IA 3V50A 3PBNA 4LV0A 5FI6A 3VP2A 3UB9A 3BWLA 3VP3A 1MXOA 3FPVA 1XJ4A 2ZM0A 4I38A 4MN6A 2EFUA 3MZEA 2IWBA 4WZ5A 2XROA 5DKLA 3SH7A 4OPZA 4LRXC 2Y79A 3HLEA 1SDEA 3LEQA 3LYXA 4LPZA 5EOOA 4GDNA 2OOLA 1ES3A 2XFSA 4R4RA 5FASA 3RXWA 5HARA 3KSGA 5GLBA 3F1NB 4OP5A 5DF8A 3DWZA 4L9EA 5E2HA 3WRTA 3W8KA 5DF7A 4BMWA 4EWFA 5FAQA 1TS6A 3R7WB 1CJFA 3T4JA 4LCMA 1Z6FA 4GHIA 4P6ZM 4CLCA 2O9CA 4BENA 1HZOA 4WN5A 3ZNYA 1HD8A 1YLWA 5EM1A 5FDHA 1JTGA 2XFTA 2PRFA 3AGFA 2KLIA 3IF6B 3PBTA 4WEKA 4EUVA 3NJAA 2XRNA 3RJUA 2XR0A 4QD4A 4WMCD 2EX9A 2Y2OA 3WS4A 3M6BA 5L07A 4CJNA 5J4EA 4HOIA 2BLSA 1S1YA 3OPRA 2EWWA 4OQGA 3VSLA 2VA0A 3B42A 1F98A 5F1FA 1PW8A 5CECA 4BL3A 2J9OA 3HBRA 5DTTA 3LIEA 1S1ZA 3TOIA 2FZ0A 2HJ9C 4KQRA 1PZPA 4F3LB 4HY8A 4P0MA 5HL1A 2I9VA 2XF3A 4S2NC 3QNCA 1RGYA 4OPYA 1OTDA 2QWSA 4HH2A 3W4PA 1OT6A 1L0DA 4FTXA 2QKPA 1NJ4A 2D01A 3W4OA 3PBSA 1DY6A 4GCZA 3R4KA 2QJ7A 4ZJ2A 1K57A 3BRMA 4O7DA 4H8RA 4S2PA 2GX5A 3K3CA 3UDIA 3N7WA 1S6RA 2OAP1 4E3MA 4Y0OA 2UWXA 4IEDA 5L09A 2XA7M 1KE4A 1Y4OA 2V0UA 2HZ5A 1W8YA 3OCNA 3IF5A 1XP4A 3G34A 3EOIA 1YLZA 2VV8A 3SZTA 2V2FF 3LI9A 3S7PA 1KE0A 1S66L 4S2LA 3BFEA 3NY4A 3VE4A 3PXPA 3G2ZA 1XFQA 1T19A 1YPRA 4R3BA 4X53A 3R7WA 5DFYA 1UGUA 3Q82A 3PBOA 5EOEA 3TSGA 3GRJA 5TBMA 2ACGA 4L0LA 4N1XA 4I39A 2PR5A 3QP4A 2M1CA 1FSYA 4ZBEA 2JHEA 3VMAA 1BLCA 5L10A 1CI8A 3LIDA 1H0MA 1K56A 3WS1A 3T4KA 5M1AA 4Z9QA 5DTKA 3MQQA 4N9LA 4UA6A 4IBRA 3S22A 3VOZA 2EWVA 2X01A 3K3DA 5EVLA 3IX3A 1F5MA 3SH9A 4MBKA 3B3XA 4LV1A 1JWVA 2PR6A 3FPWA 1N9LA 5F83A 4E3JA 5K5BA 3V5MA 4P6ZS 1TEMA 3GSGA 5AJGA 2BASA 2Y8HA 2J3TD 4EU0A 2Q9MA 4M3KA 4DRTA 2HDSA 5EUAA 1V9ZA 1NLZA 1TS8A 3GR2A 1CK3A 1OPXA 1OTAA 3VSKA 3CWFA 5EVIA 3S7QA 4F94A 3T4QA 3DWKA 3DTMA 4K0WA 1RP5A 1T1AA 4IVKA 1BLHA 3H7WB 1GCEA 3T12B 3LY3A 1CEFA 1XA1A 3FKVA 3PBQA 1ZKJA 4QU3A 3ZDJA 3LGOA 1CEGA 1I5QA 1OTIA 1T1BA 3MSHA 4KZ7A 4ZJ1A 2Y2QA 3GV9A 2H28A 1S4SA 3F1OA 5E2EA 5HWTA 4B9OA 3G4PA 4QJGA 2QZ6A 4WF0A 3C30A 5EPHA 5GLAA 5I5LA 4S2MA 1NY0A 4PMAA 3FWLA 3IHBA 4M4XA 1E3UA 3HREA 3UN7A 2WGIA 1ES5A 3L9KA 1NRJA 2J7VA 4XT2A 2KDKA 4GW9A 5IHVA 5HDCA 4GJ4A 3JVVA 4YFMA 3RFBA 5CGXA 3GDIA 3UDFA 1X0OA 1XJ2A 5DVAA 1TD5A 2NUTC 4ARZB 1K25A 3C7VA 2MJ6A 5TBMB 3VFHA 2W3GA 1JTDA 2PDRA 1UWPX 2FH5A 2Y2LA 2WAFA 3MXQA 1BTLA 4HJ6A 1NYMA 4JXWA 2ZC3B 1LSXA 4NXEA 4EV4A 3D3OA 2PT7A 3BFDA 2X02A 5KSCA 3EGXC 4LRYC 4ZRRA 1JVJA 3UB7A 4LFUA 3MJQA 1K55C 5HAPA 1N9NA 3N8LA 3A3FA 1DP8A 4GS9B 1F2KA 5F68A 4Y15A 4X25A 3LIFA 4E3NA 4WEJA 4D2OA 2OLUA 1VB6A 4DE0A 2AVXA 3VE3A 3EWKA 3IBRA 4JXSA 4NEED 5IU1A 1XX2A 1CF0A 3BYDA 2L0WA 3T50A 5FEFA 4OP8A 5G18A 1YLTA 3Q7VB 2ZQDA 5MC7A 3OBFA 1KE3A 3DTIA 1BUEA 4WYYA 1OTBA 5G4ZA 4LRZE 1D06A 4RX2A 5FQMA 2W1TA 1EROA 4HNBA 1ZC2A 5CXWA 2WAEA 5DFXA 3HJKA 3IXHA 2PU4A 5DKKA 2PBDP 3KYQA 4BL2A 3LR3A 3EGDC 5FQKA 2W3HA 3P98A 4PPRA 4BBTA 5HSQA 1K4FA 1ZTUA 1P0ZA 1BT5A 3UE6A 2CC1A 2VGLS 3ZG9B 2V8CA 4S2OA 4KZ5A 4GHIB 4EEUA 3SS4A 3MKEA 1TF1A 2WGWA 4UHUA 4AFIA 4BQMA 5J3WA 3FYZA 2H0YA 4FUWA 2E8JA 4KENB 4PKYA 3O5YA 4PM6A 1OJ5A 4GD6A 2P74A 4JGQA 3ZG0A 3LCEA 2Y2PA 3UPPA 4R1GA 2ZJ9A 3LR0A 3O88A 2BTFP 3F1OB 4NXBA 4S2NA 4OPQA 4ETZA 4X69A 2PD8A 3QP8A 3LI8A 5L8MA 1D1JA 2O0YA 3IWQA 5FEGA 3MQOA 4BWIA 4A5RA 1XPBA 4FCFA 1K54A 1MWTA 1W8QA 2QMIA 3IXDA 3NCKA 3BQAA 2WKQA 1FCNA 1VEUB 4KZ9A 3ITBA 1PWCA 4KUOA 2VGLM 1GSWA 3VP0A 1HTZA 3HJIA 2Z6CA 4K08A 5EECA 1BSGA 1KDWA 4JLFA 2W3FA 3UNWA 5KMWA 1WYBA 5E43A 2IWDA 2HDRA 3BFGA 3PHYA 3I7JA 4CQHA 1AWIA 3V67A 3HUNA 1K4EA 1BLSA 3ZG7B 2DCFA 5M18A 1S4RA 2OAQ1 1VHMA 3IXBA 2P08A 3RXXA 4LV2A 2WK0A 4X55A 3F1PA 1WYCA 3UMEA 3CI6A 3OPHA 2Y2JA 2OWHA 4O0PA 1TS0A 1Y28A 1G6OA 2P9VA 3T4LA 1VEUA 1ZG6A 3HUMA 4E3LA 3T4OA 2Q9NA 4WELA 1IFQA 2LB9A 4IVIA 3S7OA 5G4YA 4EBLA 3A0SA 2Z6DA 1L0EA 2P04A 4X1MA 4OQ0A 3BLSA 2VV6A 4XXRA 2CMNA 3BM6A 3NI9A 2W3DA 3ZG8B 3IWOA 1P97A 4GZBA 1N9OA 3A0RA 3MMHA 4HJ3A 2WUQA 4LV3A 4QHCA 4HIAA 3IX8A 3CJMA 1W5DA 1DP6A 2VLGA 3MR0A 4GN2A 1NZOA 5CERA 4K0XA 2XQZA 2J9PA 4HI4A 2ZOIA 4HESA 1LI9A 1CI9A 2XD5A 4ESPA 3SH8A 3QP5A 4WBGA 2V8FA 2WKRA 4JPMA 4Y17A 5HDDA 4WZ4A 4MN5A 3A3DA 1DJBA 4PM9A 1TDGA 4N9KA 2W0NA 5FA7A 2OV5A 2EXBA 4B88A 5HAQA 2VK3A 4G3KA 4LCLA 1L0FA 1MY8A 4Q0IA 2ZL1A 3VOLA 3Q7VA 1STZA 3KSHA 3MXRA 1OMEA 4JF4A 3VV4A 2XK1A 4GOGA 4DN0A 2ZQAA 3HLCA 3N8RA 2PHYA 5CEDA 3C38A 3H9WA 3WWXA 3H7WA 3WS5A 1K6SA 3QP2A 5HD3A 4UQIS 5KZHA 2W3EA 1YLYA 4EBPA 1RCJA 1ESUA 1SKOA 5EVIB 2JN7A 3KSFA 5AVFA 4OKPA 2ZLYA 3KO6A 5AQBA 4OOMA 2H5SA 3UB8A 3P01A 3ULFA 5L2FA 1KGEA 5TGFA 5FQJA 1IEMA 2JKRI 4QB8A 1PZOA 1U60A 1TS7A 4CLCE 4BJPA 3BECA 1ES2A 1N9BA 3UDXA 5KIZA 4DE3A 1GSXA 5F6AA 4MMNA 4GLQA 4ARZA 1DRMA 2B18A 4IBXA 1LI0A 4OH0A 3HVFA 3G31A 3BFFA 5U47A 3NOPC 3G35A 5A8BA 2JKFA 2B95A 1GHIA 2VGJA 4X6TA 1YMSA 4XUZA 4Q8IA 1FCOA 2Y2NA 4FH2A 1YM1A 1LL5A 2V20A 1W7FA 5AQ7A 3ZYTA 2XSSA 2NUPC 1K56D 3O3VA 4H6JA 3H82B 3K2NA 3JPUA 1K6RA 1GA9A 1UWNX 3AGDA 5F5YA 4MDZA 5BOHA 1VETA 1LLBA 3TG9A 5IT5A 3LR5A 4HP4A 1LHYA 3MZDA 2R78A 5FQIA 1FR6A 2PYRA 2WKPA 1VQQA 4UEYA 3QP6A 3V3SA 5HW3A 3C4PA 4GKUA 4Y2FA 3NHQA 5FI2A 3SS3A 4NETA 1PW1A 2PAVP 4GD8A 4IUKA 5HPIA 5FI7A 3P09A 3M2JA 1BYWA 2OWJA 4PM5A 4WUJA 3CUEA 1FILA 5GLDA 4Y7PA 1IYPA 4XUXA 4BD1A 3JVUA 1YQSA 1O7EA 1YSQA 1D7EA 4Y5FA 3B47A 2V9AA 2VV7A 3NDEA 3TRCA 1XGJA 3UB5P 3VFFA 3U2AA 5FDSA 5EVEA 3P7NA 3LICA 4R70A 3DTKA 2WZZA 2QYBA 3IF6C 3CITA 4FOFA 4C3QA 3FC7A 1DP9A 4NK3A 4DDSA 3IHAA 1PNEA 4Y0UA 3T1RA 4E04A 1MWUA 1G28A 1JWPA 3N4IA 3L7HA 2L4RA 2XDMA 2A3UA 4WL9A 4R0QA 3LUQA 3ZQ5A 1SDNA 5HL6A 4KZ8A 3HL9A 4KQQA 3N8SA 1HVBA 1MZUA 1G6AA 2Y2KA 3CPTA 3D9YA 4DDYA 4JKTA 4OQHA 4WMCA 1KGGA 1SCWA 1JNUA 3E4OA 2JKTM 3IS2B 2QJ5A 2HJEA 2H10A 4E3IA 4Y3IA 3MQ0A 2RL3A 1ES4A 4WM9A 4KZ6A 4LENA 3ZVWA 5CX7A 3OOVA 1K54C 2JKRM 2Y2HA 5FAPA 2K7SA 4E3OA 1PI5A 2VZWA 2KOIA 3W4QA 2OLVA 2ZBBA 4BD0A 4DJ3A 5JYOA 2INWA 1SZVA 2WKHA 3KYEA 3GMWA 4PAUA 4Q0JA 4KG2A 1XGIA 2ZC4B 5AQ9A 1GSVA 5HX9A 2G2UA 2XEPA 5HD5A 1OT9A 5D3OA 1GA0A 4OOYA 4EQ1A 2P9VB 5DJUA 3JYIA 1PFLA 5DF9A 1FSWA 3IH8A 3NULA 2RCXA 1ERQA 2PBYA 2Y55A 4B4ZA 1I2SA 4GDBA 2G2WA 1T1CA 3WS0A 3CG5A 3ZGAB 3EQUA 5GL9A 4U0TA 1SKFA 1J3WA 3EEAA 3DW0A 5GLCA 2HDUA 4GNUA 1W79A 3QHYA 3UPNA 4QY6A 1NLYA 1G68A 4BBVA 3S4XA 1LSVA
chains in the Genus database with same CATH topology
4EERA 3BW6A 2CMNA 2L1MA 4IUHA 4G3VA 2W3DA 3KX0X 1P97A 2JHEA 1N9OA 3A0RA 3MMHA 1YKDA 3D72A 4HJ3A 3LIDA 1XJ6A 4HIAA 3T4KA 1LL8A 2VJWA 4ETXA 1DP6A 2VLGA 2D02A 4G3WA 3MR0A 3MQQA 3IBJA 5HPFA 4GS9A 2EWVA 3K3DA 3T4SA 3HCYA 1F5MA 4I3JA 2B02A 4KUKA 5HWVA 4HI4A 2ZOIA 2O9AA 2W1RA 2PR6A 3FPWA 4MN7A 4PKYG 1N9LA 2V0WA 3RH8B 2VEAA 2K2NA 2WKRA 5K5BA 4R38A 1IOUA 5HDDA 4MN5A 4P6ZS 3A0VA 5AJGA 2W0NA 3PYPA 4NXGA 2BASA 2Y8HA 2J3TD 4EU0A 4G3KA 4Q0IA 2VX8A 2IA2A 3VOLA 1STZA 1V9ZA 3UE3A 1NLZA 3PR6A 1TS8A 3KSHA 2O99A 3W2ZA 1OPXA 1OTAA 1W63Q 3VV4A 4DN0A 3LIBA 1XJ3A 2EA9A 5DJTA 4YWZA 3CWFA 2PHYA 5HZHA 2J3WA 3C38A 3H9WA 3S7QA 2ZMVA 4QPRA 3OC2A 3T4QA 3H7WA 3E98A 2V1BA 1V9YA 1P9RA 5HD3A 1T1AA 2QHKA 1LSWA 4UQIS 4R3AA 4XT2B 4EEPA 2W3EA 4B93A 1YAXA 4KQDA 3H7WB 4EESA 3H82A 3T4TA 4R6LA 1OJGA 2A24B 2JN7A 3KSFA 3PBQA 5AVFA 3C2WA 1OTIA 1T1BA 4NXFA 3BY8A 3CAXA 3KO6A 1LT0A 2HF6A 4OOMA 3UB8A 2H28A 1S4SA 3C8CA 3P01A 3ULFA 2M7VA 3F1PB 3F1OA 5HWTA 4B9OA 3MFXA 2JKRI 4WF0A 2ZMFA 3C30A 2PYPA 3E4PA 4CLCC 5I5LA 3LR4A 3DBAA 4JGOA 3RTYA 1TS7A 5HWWA 4CLCE 4L9GA 4M4XA 4BJPA 2ZOHA 4OOLA 4YOFA 4PHTA 1S67L 5C5KA 5KIZA 1GSXA 5F6AA 1NRJA 3NOTC 3BQ8A 4MMNA 4GLQA 4ARZA 1DRMA 2B18A 3EQVA 4XT2A 5TJJA 2KDKA 4GW9A 2LB5A 3IS2A 3NOPC 5HDCA 5AVEA 5A8BA 4KQOA 2PD7A 4GJ4A 3JVVA 3RFBA 4HP9A 5LBRA 3GDIA 1X0OA 2GZAA 1XJ2A 1TD5A 3UB6A 2NUTC 1ODVA 4ARZB 2GJ3A 2MJ6A 5FL3A 5TBMB 2W3GA 2PDRA 2YKHA 3ZYTA 1UWPX 2FH5A 3TW8A 2XSSA 4EXOA 2NUPC 4JGPA 3S7NA 4MCWA 4DMZA 3MXQA 1XFNA 1T18A 1H8MA 4H6JA 1ZHHB 3H82B 4HJ6A 3K2NA 4I3IA 4BBUA 3LIAA 3KSIA 1LSXA 4NXEA 4JGRA 1UWNX 4DJ2A 5F5YA 3D3OA 4F3LA 2PT7A 2J80A 4MDZA 3E4QA 4I3AA 3EGXC 5IT5A 4LRYC 3ICYA 4ZRRA 3LR5A 2A2LA 3UB7A 4HP4A 2J3TC 4IJGA 2KX6A 3MJQA 2R78A 1N9NA 2PYRA 3PBNA 1DP8A 4GS9B 4UQIM 3UB9A 2WKPA 5F68A 3BWLA 1W63M 3LFVA 4HHDA 4UEYA 4NKPA 3LIFA 3FPVA 4WEJA 1XJ4A 4I38A 4MN6A 4Y2FA 1VB6A 4Z1WA 3NHQA 4O8GA 3VE3A 2JKTI 3EWKA 4CLCB 3IBRA 4NEED 5IU1A 3UMDA 2XROA 5DKLA 3CUEC 4LRXC 2Y79A 4IUKA 5HPIA 2L0WA 3T50A 1BYWA 4WLAA 5IS1A 3LYXA 5MC7A 4LPZA 2OWJA 3OBFA 2OOLA 2XA7S 3CUEA 4WUJA 1OTBA 5G4ZA 4LRZE 1D06A 4LLOB 3JVUA 3BJNA 3KSGA 1YSQA 2W1TA 1D7EA 5EFWA 4Y5FA 3F1NB 3B47A 4HNBA 4RQ9A 4L9EA 2V9AA 2VV7A 4HJ4A 3TRCA 4L9FA 3U2AA 2O9BA 5DFXA 3HJKA 4BMWA 1TS6A 3R7WB 3T4JA 5KSHA 3P7NA 5DKKA 3LICA 4R70A 3KYQA 4GHIA 4P6ZM 4CLCA 2O9CA 2QYBA 4IHQA 3CITA 4FOFA 3LR3A 4WN5A 3FC7A 1DP9A 3TE8A 3EGDC 2W3HA 1MC0A 2HGVA 2KLIA 3PBTA 4II7A 3EEHA 4WEKA 4BBTA 5HSQA 1EW0A 4E04A 4EUVA 3NJAA 1G28A 1ZTUA 3OCLA 1P0ZA 2XRNA 3UE6A 2VGLS 2L4RA 4EETB 4HQAA 1H3QA 1NWZA 4GHIB 3FG8A 4WL9A 4FSFA 2M7UA 4EEUA 3LUQA 3ZQ5A 1TF1A 2W1TB 4I5SA 5HL6A 4AFIA 5J4EA 4HOIA 5J3WA 3TJZC 1S1YA 2EWWA 1MZUA 2VA0A 3B42A 2GNXA 4PKYA 3O5YA 2P7JA 1OJ5A 1F98A 4JGQA 1JNUA 3E4OA 3LR0A 3LIEA 2JKTM 3IS2B 1S1ZA 2G7UA 2HJEA 2QJ5A 1WA9A 2FZ0A 3F1OB 4NXBA 2HJ9C 4Y3IA 3MQ0A 2HV1A 4ETZA 4F3LB 3G6OA 4HY8A 2PD8A 5CX7A 3OOVA 4CLCD 2I9VA 3LI8A 5L8MA 2O0YA 2JKRM 2A24A 3MQOA 4BWIA 2K7SA 1OTDA 2QWSA 2W27A 2K31A 4HH2A 1OT6A 3CLOA 5F69A 2VZWA 2KOIA 2QKPA 3BQAA 2WKQA 1P9WA 2ZBBA 2D01A 3PBSA 1OTEA 4KUOA 4GCZA 3R4KA 4DJ3A 2VGLM 1GSWA 2INWA 3HJIA 3OLOA 2Z6CA 2QJ7A 4PAUA 4K08A 4Q0JA 3SW1A 1KOUA 2GX5A 3K3CA 2W3FA 4Q0HA 1GSVA 5HD5A 2OAP1 1OT9A 3PHYA 2VKSA 3MF0A 2XA7M 4CQHA 3E0YA 3V67A 4EQ1A 2V0UA 1YSPA 5DJUA 3OCNA 3EOIA 3NOUC 2VV8A 3KYZA 5DF9A 1S4RA 2V1AA 4H6JB 3LI9A 3S7PA 2OAQ1 3F1NA 1VHMA 4ME4A 1S66L 2P08A 3GECA 3F1PA 4O01A 3VE4A 3PXPA 3CI6A 3UMEA 1XFQA 1T19A 2OWHA 3BY9A 4O0PA 1TS0A 1Y28A 5J7EA 1T1CA 1G6OA 3R7WA 3T4LA 5DFYA 3EQUA 1UGUA 3PBOA 3T4OA 4WELA 1IFQA 3EEAA 5TBMA 2LB9A 3S7OA 4L0LA 5G4YA 4I39A 4EW7A 3A0SA 2PR5A 1MKMA 2Z6DA 2P04A 4HH3A 2DMWA 5HDSA 3B33A 2YKFA 2M1CA 4YNRA 1NLYA 2VV6A 1F9IA 3PBRA 4BBVA 1LSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNU A;  3E4O A;  1XJ4 A;  3UB8 A;  2H28 A;  4EER A;  3LIE A;  2CMN A;  1S4S A;  2L1M A;  3C8C A;  4I38 A;  4MN6 A;  3ULF A;  3IS2 B;  3F1P B;  3F1O A;  3KX0 X;  1VB6 A;  5HWT A;  1S1Z A;  1P97 A;  2QJ5 A;  3NHQ A;  1WA9 A;  2JHE A;  3MFX A;  1N9O A;  3F1O B;  4WF0 A;  3A0R A;  4NXB A;  3VE3 A;  2PYP A;  3EWK A;  3D72 A;  4HJ3 A;  3IBR A;  3E4P A;  3LID A;  5I5L A;  5IU1 A;  2HV1 A;  3UMD A;  5DKL A;  1XJ6 A;  4JGO A;  4F3L B;  3RTY A;  1TS7 A;  3G6O A;  4HY8 A;  4HIA A;  2PD8 A;  4LRX C;  4L9G A;  4M4X A;  5HWW A;  2I9V A;  2L0W A;  3LI8 A;  2ZOH A;  3T50 A;  1LL8 A;  1BYW A;  4WLA A;  5IS1 A;  1S67 L;  3LYX A;  2A24 A;  1DP6 A;  2OWJ A;  2D02 A;  2VLG A;  3MQO A;  4LPZ A;  2OOL A;  3MR0 A;  3MQQ A;  4WUJ A;  5KIZ A;  2K7S A;  4GS9 A;  1GSX A;  1OTD A;  1OTB A;  3K3D A;  3NOT C;  4LRZ E;  5F6A A;  1D06 A;  2QWS A;  2W27 A;  4HH2 A;  4LLO B;  5G4Z A;  1OT6 A;  1DRM A;  4I3J A;  2B02 A;  3CLO A;  4KUK A;  5F69 A;  4XT2 A;  2QKP A;  5HWV A;  2KDK A;  2WKQ A;  4GW9 A;  4HI4 A;  2ZBB A;  2ZOI A;  2D01 A;  1D7E A;  5EFW A;  3IS2 A;  3F1N B;  2PR6 A;  3NOP C;  4HNB A;  4RQ9 A;  5HDC A;  4L9E A;  1OTE A;  4KUO A;  1N9L A;  2V9A A;  2VV7 A;  4GCZ A;  4HJ4 A;  2V0W A;  4PKY G;  1GSW A;  2INW A;  5AVE A;  4DJ3 A;  3HJI A;  3RH8 B;  5A8B A;  2PD7 A;  2VEA A;  3OLO A;  2WKR A;  2QJ7 A;  2Z6C A;  4HP9 A;  4L9F A;  4R38 A;  4K08 A;  3GDI A;  5HDD A;  1X0O A;  4MN5 A;  3HJK A;  3SW1 A;  1XJ2 A;  1KOU A;  1TS6 A;  3A0V A;  3K3C A;  2W0N A;  3PYP A;  4NXG A;  2BAS A;  3UB6 A;  3P7N A;  5DKK A;  1ODV A;  1GSV A;  2GJ3 A;  3LIC A;  5HD5 A;  4R70 A;  4B9O A;  1OT9 A;  5TBM B;  4GHI A;  3PHY A;  2PDR A;  2YKH A;  4WN5 A;  3VOL A;  1UWP X;  3FC7 A;  1DP9 A;  4EXO A;  4EQ1 A;  1V9Z A;  4JGP A;  2V0U A;  1TS8 A;  3MXQ A;  1XFN A;  5DJU A;  1T18 A;  4H6J A;  3NOU C;  3H82 B;  1OTA A;  2VV8 A;  4HJ6 A;  3EEH A;  1S4R A;  2V1A A;  4H6J B;  4I3I A;  4BBU A;  1EW0 A;  3LIA A;  4BBT A;  3LI9 A;  1G28 A;  1LSX A;  3NJA A;  4E04 A;  3F1N A;  3LIB A;  1XJ3 A;  1P0Z A;  2EA9 A;  1S66 L;  3UE6 A;  3GEC A;  4NXE A;  4JGR A;  5DJT A;  1UWN X;  2L4R A;  3CWF A;  4YWZ A;  2PHY A;  5HZH A;  3F1P A;  3H9W A;  4HQA A;  3UME A;  3VE4 A;  4DJ2 A;  4EET B;  1XFQ A;  1NWZ A;  1T19 A;  2OWH A;  3FG8 A;  4GHI B;  4WL9 A;  3BY9 A;  5F5Y A;  3LIF A;  4F3L A;  2J80 A;  3H7W A;  4EEU A;  1TS0 A;  2V1B A;  3LUQ A;  1Y28 A;  3ZQ5 A;  1T1C A;  5J7E A;  1V9Y A;  3E4Q A;  4I3A A;  5HD3 A;  1T1A A;  2QHK A;  1LSW A;  3ICY A;  4I5S A;  4LRY C;  1UGU A;  4HOI A;  4R3A A;  4XT2 B;  3UB7 A;  4EEP A;  4HP4 A;  5J4E A;  2KX6 A;  3MJQ A;  5J3W A;  2R78 A;  5TBM A;  1N9N A;  1S1Y A;  3H7W B;  4KQD A;  4EES A;  2PYR A;  3H82 A;  5G4Y A;  1DP8 A;  4GS9 B;  4R6L A;  1MZU A;  4I39 A;  1OJG A;  4EW7 A;  2A24 B;  3A0S A;  2PR5 A;  2P7J A;  2JN7 A;  2Z6D A;  4PKY A;  3UB9 A;  1OJ5 A;  1F98 A;  4HH3 A;  3B33 A;  5HDS A;  5AVF A;  2WKP A;  4JGQ A;  2YKF A;  2M1C A;  3BWL A;  1OTI A;  1T1B A;  3C2W A;  4HHD A;  4NXF A;  5F68 A;  3BY8 A;  2VV6 A;  1F9I A;  3CAX A;  1LT0 A;  4BBV A;  1LSV A;  5HSQ A; 
#chains in the Genus database with same CATH topology
 2L1M A;  5CHU A;  3KX0 X;  3IWI A;  4DE2 A;  3D72 A;  4MBF A;  4Y0T A;  1PRQ A;  5AQA A;  1XJ6 A;  1N4O A;  4E6W A;  4S2I A;  1LL8 A;  3IQA A;  1TDL A;  1E4D A;  4G3W A;  4ZAM A;  4GS9 A;  4B4X A;  3T4S A;  1E25 A;  2Y2I A;  2B02 A;  4RX3 A;  3E2L A;  2ZL1 B;  2WAD A;  4C6Y A;  3HLF A;  3PTE A;  4E3K A;  4PKY G;  3HLB A;  2V0W A;  3NEC A;  3RH8 B;  2Z2L B;  3ZHH A;  4ID4 A;  4R38 A;  4MEZ A;  1DJA A;  5GHX A;  2UV0 E;  2JBF A;  2WGW B;  3HLG A;  1Y54 A;  1MKI A;  3ZCZ A;  1E3U D;  1YMX A;  1ONG A;  2JKG A;  2VX8 A;  4OLD A;  4N1H A;  4U0X A;  5CEB A;  3LIB A;  1XJ3 A;  2EA9 A;  2I72 A;  4S2J A;  5DJT A;  3UO9 A;  3NIA A;  4QPR A;  1YT4 A;  2C5W B;  3E98 A;  1V9Y A;  3PAE A;  4NG2 A;  1P9R A;  2IWC A;  4XT2 B;  4EEP A;  3IT9 A;  3ZVT A;  3FZC A;  4JXV A;  4B93 A;  4UAA A;  4KQD A;  1YLP A;  3GQZ A;  2A24 B;  3C2W A;  4NXF A;  3T1S A;  5EVI D;  1PYY A;  1LT0 A;  5EM0 A;  2HF6 A;  5JYP A;  4EBN A;  2WYX A;  2X71 A;  3WRZ A;  3F1P B;  1PWD A;  1A0K A;  3MFX A;  2ZMF A;  3Q81 A;  2PYP A;  3G30 A;  3E4P A;  4CLC C;  3UY6 A;  4OON A;  3DBA A;  1IYQ A;  5HWW A;  3AGE A;  4P6B A;  2ZOH A;  3D4F A;  1IYO A;  2ZQ7 A;  4RVA A;  4WZ5 C;  1NXY A;  5TJJ A;  3OPL A;  1MWR A;  4HBU A;  4X1L A;  5A93 A;  1SKO B;  3V3R A;  5F82 A;  3ITA A;  4KQO A;  4CPK A;  1CQA A;  5LBR A;  4KG5 A;  2ZQ8 A;  4OQI A;  1ODV A;  2GJ3 A;  2Y4A A;  3OPP A;  5FL3 A;  4S2K A;  3NDG A;  2DRW A;  2HP9 A;  4EXO A;  4JGP A;  5CHM A;  4DMZ A;  2ZC7 A;  3MS6 A;  1H8M A;  3VP1 A;  4EQI A;  3C5A A;  4I3I A;  3LIA A;  4QWO A;  3KSI A;  3GVB A;  1IKI A;  1M6K A;  2XLN A;  3Q07 A;  1YLJ A;  4DXB A;  2WGV A;  2PU2 A;  3IH9 A;  4I3A A;  3MXS A;  5F1G A;  2J3T C;  3CMZ A;  1TVF A;  4UQI M;  4UA9 A;  2R9W A;  3LY4 A;  4OPR A;  1DJC A;  4OVD A;  1W63 M;  3LFV A;  4HHD A;  4ZDX A;  4D60 A;  4NKP A;  3MZF A;  5CGS A;  2EX6 A;  2XH9 A;  5FAO A;  4Z1W A;  4O8G A;  2JKT I;  4CLC B;  4K91 A;  1C3B A;  4ZTK A;  3UMD A;  1FIK A;  3CUE C;  3N6I A;  5GHZ A;  4WLA A;  5IS1 A;  2XA7 S;  4LLO B;  5EV0 A;  4X56 A;  1JWZ A;  1ZG4 A;  2XGN A;  3BJN A;  4N92 A;  2JCH A;  5EFW A;  2WKE A;  4RQ9 A;  4JF6 A;  4DE1 A;  4HJ4 A;  1IKG A;  4L9F A;  5FQQ A;  3UPO A;  2O9B A;  4JXG A;  3C4O A;  1K38 A;  2ZM2 A;  1HLU P;  5KSH A;  1NYY A;  4IHQ A;  1XA7 A;  3TE8 A;  1FOF A;  3BLM A;  1KVL A;  2Z2M B;  4R23 A;  1MC0 A;  2HGV A;  3UE0 A;  4UA7 A;  4II7 A;  3EEH A;  1EW0 A;  3OCL A;  2ZMA A;  1M40 A;  4P87 A;  4EET B;  4HQA A;  1H3Q A;  1ACF A;  1NWZ A;  3FG8 A;  5TR7 A;  4FSF A;  2M7U A;  4FH4 A;  1XKZ A;  2W1T B;  1BLP A;  4I5S A;  4HEF A;  3DAV A;  5E2G A;  3IXG A;  3TJZ C;  4KZ3 A;  3U4L P;  4U3T A;  1KDS A;  3V39 A;  2GNX A;  2P7J A;  5I94 A;  1ONH A;  3PAG A;  1PI4 A;  2J8Y A;  5CTN A;  1S0W A;  3FV7 A;  5A91 A;  2G7U A;  1WA9 A;  3LO7 A;  1H5X A;  3ZG5 A;  1O07 A;  3S1Y A;  1PWG A;  1RGZ A;  2HV1 A;  4P85 A;  3G6O A;  3ZFZ A;  4CLC D;  4GB7 A;  3CZD A;  2A24 A;  3FKW A;  4YIN A;  1AXB A;  2W27 A;  1FR1 A;  2K31 A;  3CLO A;  5EVI C;  1ERM A;  5F69 A;  3IX4 A;  1P9W A;  5E2F A;  2Q0O A;  3MBZ A;  2EFX A;  1OTE A;  2E8I A;  1GHM A;  3IF6 A;  3HLD A;  3OLO A;  1L3L A;  5HAI A;  2Y2M A;  3SW1 A;  1KOU A;  4Q0H A;  1VET B;  4C75 A;  1K57 C;  4DXC A;  3QNB A;  2VKS A;  3MF0 A;  1IEL A;  1IYS A;  3E0Y A;  1G5U A;  4PM8 A;  3VP4 A;  1YSP A;  2ZC6 B;  4HBT A;  4JF5 A;  3BFC A;  3NOU C;  3KYZ A;  2WKI A;  2V1A A;  2Y59 A;  4H6J B;  1SHV A;  3F1N A;  4ME4 A;  3GEC A;  2XD1 A;  4RYE A;  3SS5 A;  2JC7 A;  5A92 A;  4O01 A;  5M19 A;  3BY9 A;  5DTS A;  5J7E A;  1LL9 A;  1Z09 A;  1WE4 A;  4MNR A;  2EXA A;  5FQ9 A;  1ESI A;  1K0K A;  1ALQ A;  4EW7 A;  1MKM A;  3HLW A;  4HH3 A;  2DMW A;  5HDS A;  3B33 A;  2YKF A;  4BLM A;  3LEZ A;  1MWS A;  4YNR A;  3CPT B;  1F9I A;  3PBR A;  2OSU A;  1QMF A;  5CRF A;  4R4S A;  4EER A;  3BW6 A;  2Y2G A;  3MKF A;  4IUH A;  4G3V A;  1YKD A;  2BG1 A;  3G2Y A;  4R3J A;  3T1Q B;  3BEB A;  2FFF B;  1I2W A;  2VJW A;  4MBH A;  4ETX A;  1BZA A;  2D02 A;  2GDN A;  3IBJ A;  5HPF A;  1BUL A;  3HCY A;  4I3J A;  4KUK A;  4DF6 A;  5HFO A;  2Y91 A;  5HWV A;  5GHY A;  2O9A A;  4MLL A;  3WS2 A;  2W1R A;  2H0T A;  4MN7 A;  3Q7Z A;  2VEA A;  2K2N A;  1IOU A;  3A0V A;  1EWZ A;  3PYP A;  4NXG A;  5CHJ A;  4FD8 A;  4PM7 A;  1VM1 A;  2ZQ9 A;  5EE8 A;  2HPB A;  2IA2 A;  3Q1F A;  1QME A;  3UE3 A;  3PR6 A;  2O99 A;  3DTE A;  3OZH A;  1FCM A;  3W2Z A;  1W63 Q;  4JBF A;  5FAT A;  2A49 A;  2ZD8 A;  2JE5 A;  1L0G A;  2C6W B;  4YWZ A;  5FSR A;  5HZH A;  3NC8 A;  2J3W A;  4Y13 A;  3O86 A;  2ZMV A;  3OC2 A;  4E6X A;  3M6H A;  3C7U A;  2V1B A;  1PIO A;  3E2K A;  2QHK A;  1LSW A;  1NRF A;  2EX2 A;  4R3A A;  4KZB A;  1YAX A;  2ZM8 A;  3T1X A;  4EES A;  3H82 A;  3T4T A;  4R6L A;  1OJG A;  3UE1 A;  2VGK A;  2WZX A;  3BY8 A;  3CAX A;  3O87 A;  2ZQC A;  1FQG A;  2HP5 A;  5TFQ A;  3C8C A;  3NBL A;  2M7V A;  1H8Y A;  1Q2P A;  3MFD A;  4RA7 A;  4X68 A;  2DNS A;  3LR4 A;  4JGO A;  3RTY A;  4L9G A;  4OOL A;  4YOF A;  4PHT A;  1S67 L;  4QY5 A;  3HUO A;  5C5K A;  5CGW A;  1MPL A;  2R9X A;  3NOT C;  3BQ8 A;  1XXM A;  3EQV A;  4OLG A;  1L2S A;  2HDQ A;  2EX8 A;  2LB5 A;  3IS2 A;  4ZJ3 A;  4KG6 A;  5AVE A;  2PD7 A;  1J9M A;  4HP9 A;  3QP1 A;  3SOI A;  4DKI A;  2GZA A;  4EUZ A;  5A90 A;  5J8X A;  1K55 A;  3UB6 A;  4LGW A;  3GTC A;  1H8Z A;  2YKH A;  3TW8 A;  2FFY A;  2B5R A;  3S7N A;  3A3E A;  4MCW A;  1XFN A;  1T18 A;  1Q2Q A;  3ZNT A;  1ZHH B;  1EI5 A;  2HP6 A;  4BBU A;  2QPN A;  3CHW P;  1KVM A;  2ZC5 B;  4KZ4 A;  4JGR A;  3M2K A;  1KGF A;  4DJ2 A;  1GHP A;  1MBL A;  3A3J A;  4F3L A;  2V1Z A;  1NZU A;  3G32 A;  2J80 A;  4KZA A;  3VOY A;  3E4Q A;  3ISG A;  5CTM A;  3ICY A;  2A2L A;  4IJG A;  2KX6 A;  3A3I A;  3V50 A;  3PBN A;  4LV0 A;  5FI6 A;  3VP2 A;  3UB9 A;  3BWL A;  3VP3 A;  1MXO A;  3FPV A;  1XJ4 A;  2ZM0 A;  4I38 A;  4MN6 A;  2EFU A;  3MZE A;  2IWB A;  4WZ5 A;  2XRO A;  5DKL A;  3SH7 A;  4OPZ A;  4LRX C;  2Y79 A;  3HLE A;  1SDE A;  3LEQ A;  3LYX A;  4LPZ A;  5EOO A;  4GDN A;  2OOL A;  1ES3 A;  2XFS A;  4R4R A;  5FAS A;  3RXW A;  5HAR A;  3KSG A;  5GLB A;  3F1N B;  4OP5 A;  5DF8 A;  3DWZ A;  4L9E A;  5E2H A;  3WRT A;  3W8K A;  5DF7 A;  4BMW A;  4EWF A;  5FAQ A;  1TS6 A;  3R7W B;  1CJF A;  3T4J A;  4LCM A;  1Z6F A;  4GHI A;  4P6Z M;  4CLC A;  2O9C A;  4BEN A;  1HZO A;  4WN5 A;  3ZNY A;  1HD8 A;  1YLW A;  5EM1 A;  5FDH A;  1JTG A;  2XFT A;  2PRF A;  3AGF A;  2KLI A;  3IF6 B;  3PBT A;  4WEK A;  4EUV A;  3NJA A;  2XRN A;  3RJU A;  2XR0 A;  4QD4 A;  4WMC D;  2EX9 A;  2Y2O A;  3WS4 A;  3M6B A;  5L07 A;  4CJN A;  5J4E A;  4HOI A;  2BLS A;  1S1Y A;  3OPR A;  2EWW A;  4OQG A;  3VSL A;  2VA0 A;  3B42 A;  1F98 A;  5F1F A;  1PW8 A;  5CEC A;  4BL3 A;  2J9O A;  3HBR A;  5DTT A;  3LIE A;  1S1Z A;  3TOI A;  2FZ0 A;  2HJ9 C;  4KQR A;  1PZP A;  4F3L B;  4HY8 A;  4P0M A;  5HL1 A;  2I9V A;  2XF3 A;  4S2N C;  3QNC A;  1RGY A;  4OPY A;  1OTD A;  2QWS A;  4HH2 A;  3W4P A;  1OT6 A;  1L0D A;  4FTX A;  2QKP A;  1NJ4 A;  2D01 A;  3W4O A;  3PBS A;  1DY6 A;  4GCZ A;  3R4K A;  2QJ7 A;  4ZJ2 A;  1K57 A;  3BRM A;  4O7D A;  4H8R A;  4S2P A;  2GX5 A;  3K3C A;  3UDI A;  3N7W A;  1S6R A;  2OAP 1;  4E3M A;  4Y0O A;  2UWX A;  4IED A;  5L09 A;  2XA7 M;  1KE4 A;  1Y4O A;  2V0U A;  2HZ5 A;  1W8Y A;  3OCN A;  3IF5 A;  1XP4 A;  3G34 A;  3EOI A;  1YLZ A;  2VV8 A;  3SZT A;  2V2F F;  3LI9 A;  3S7P A;  1KE0 A;  1S66 L;  4S2L A;  3BFE A;  3NY4 A;  3VE4 A;  3PXP A;  3G2Z A;  1XFQ A;  1T19 A;  1YPR A;  4R3B A;  4X53 A;  3R7W A;  5DFY A;  1UGU A;  3Q82 A;  3PBO A;  5EOE A;  3TSG A;  3GRJ A;  5TBM A;  2ACG A;  4L0L A;  4N1X A;  4I39 A;  2PR5 A;  3QP4 A;  2M1C A;  1FSY A;  4ZBE A;  2JHE A;  3VMA A;  1BLC A;  5L10 A;  1CI8 A;  3LID A;  1H0M A;  1K56 A;  3WS1 A;  3T4K A;  5M1A A;  4Z9Q A;  5DTK A;  3MQQ A;  4N9L A;  4UA6 A;  4IBR A;  3S22 A;  3VOZ A;  2EWV A;  2X01 A;  3K3D A;  5EVL A;  3IX3 A;  1F5M A;  3SH9 A;  4MBK A;  3B3X A;  4LV1 A;  1JWV A;  2PR6 A;  3FPW A;  1N9L A;  5F83 A;  4E3J A;  5K5B A;  3V5M A;  4P6Z S;  1TEM A;  3GSG A;  5AJG A;  2BAS A;  2Y8H A;  2J3T D;  4EU0 A;  2Q9M A;  4M3K A;  4DRT A;  2HDS A;  5EUA A;  1V9Z A;  1NLZ A;  1TS8 A;  3GR2 A;  1CK3 A;  1OPX A;  1OTA A;  3VSK A;  3CWF A;  5EVI A;  3S7Q A;  4F94 A;  3T4Q A;  3DWK A;  3DTM A;  4K0W A;  1RP5 A;  1T1A A;  4IVK A;  1BLH A;  3H7W B;  1GCE A;  3T12 B;  3LY3 A;  1CEF A;  1XA1 A;  3FKV A;  3PBQ A;  1ZKJ A;  4QU3 A;  3ZDJ A;  3LGO A;  1CEG A;  1I5Q A;  1OTI A;  1T1B A;  3MSH A;  4KZ7 A;  4ZJ1 A;  2Y2Q A;  3GV9 A;  2H28 A;  1S4S A;  3F1O A;  5E2E A;  5HWT A;  4B9O A;  3G4P A;  4QJG A;  2QZ6 A;  4WF0 A;  3C30 A;  5EPH A;  5GLA A;  5I5L A;  4S2M A;  1NY0 A;  4PMA A;  3FWL A;  3IHB A;  4M4X A;  1E3U A;  3HRE A;  3UN7 A;  2WGI A;  1ES5 A;  3L9K A;  1NRJ A;  2J7V A;  4XT2 A;  2KDK A;  4GW9 A;  5IHV A;  5HDC A;  4GJ4 A;  3JVV A;  4YFM A;  3RFB A;  5CGX A;  3GDI A;  3UDF A;  1X0O A;  1XJ2 A;  5DVA A;  1TD5 A;  2NUT C;  4ARZ B;  1K25 A;  3C7V A;  2MJ6 A;  5TBM B;  3VFH A;  2W3G A;  1JTD A;  2PDR A;  1UWP X;  2FH5 A;  2Y2L A;  2WAF A;  3MXQ A;  1BTL A;  4HJ6 A;  1NYM A;  4JXW A;  2ZC3 B;  1LSX A;  4NXE A;  4EV4 A;  3D3O A;  2PT7 A;  3BFD A;  2X02 A;  5KSC A;  3EGX C;  4LRY C;  4ZRR A;  1JVJ A;  3UB7 A;  4LFU A;  3MJQ A;  1K55 C;  5HAP A;  1N9N A;  3N8L A;  3A3F A;  1DP8 A;  4GS9 B;  1F2K A;  5F68 A;  4Y15 A;  4X25 A;  3LIF A;  4E3N A;  4WEJ A;  4D2O A;  2OLU A;  1VB6 A;  4DE0 A;  2AVX A;  3VE3 A;  3EWK A;  3IBR A;  4JXS A;  4NEE D;  5IU1 A;  1XX2 A;  1CF0 A;  3BYD A;  2L0W A;  3T50 A;  5FEF A;  4OP8 A;  5G18 A;  1YLT A;  3Q7V B;  2ZQD A;  5MC7 A;  3OBF A;  1KE3 A;  3DTI A;  1BUE A;  4WYY A;  1OTB A;  5G4Z A;  4LRZ E;  1D06 A;  4RX2 A;  5FQM A;  2W1T A;  1ERO A;  4HNB A;  1ZC2 A;  5CXW A;  2WAE A;  5DFX A;  3HJK A;  3IXH A;  2PU4 A;  5DKK A;  2PBD P;  3KYQ A;  4BL2 A;  3LR3 A;  3EGD C;  5FQK A;  2W3H A;  3P98 A;  4PPR A;  4BBT A;  5HSQ A;  1K4F A;  1ZTU A;  1P0Z A;  1BT5 A;  3UE6 A;  2CC1 A;  2VGL S;  3ZG9 B;  2V8C A;  4S2O A;  4KZ5 A;  4GHI B;  4EEU A;  3SS4 A;  3MKE A;  1TF1 A;  2WGW A;  4UHU A;  4AFI A;  4BQM A;  5J3W A;  3FYZ A;  2H0Y A;  4FUW A;  2E8J A;  4KEN B;  4PKY A;  3O5Y A;  4PM6 A;  1OJ5 A;  4GD6 A;  2P74 A;  4JGQ A;  3ZG0 A;  3LCE A;  2Y2P A;  3UPP A;  4R1G A;  2ZJ9 A;  3LR0 A;  3O88 A;  2BTF P;  3F1O B;  4NXB A;  4S2N A;  4OPQ A;  4ETZ A;  4X69 A;  2PD8 A;  3QP8 A;  3LI8 A;  5L8M A;  1D1J A;  2O0Y A;  3IWQ A;  5FEG A;  3MQO A;  4BWI A;  4A5R A;  1XPB A;  4FCF A;  1K54 A;  1MWT A;  1W8Q A;  2QMI A;  3IXD A;  3NCK A;  3BQA A;  2WKQ A;  1FCN A;  1VEU B;  4KZ9 A;  3ITB A;  1PWC A;  4KUO A;  2VGL M;  1GSW A;  3VP0 A;  1HTZ A;  3HJI A;  2Z6C A;  4K08 A;  5EEC A;  1BSG A;  1KDW A;  4JLF A;  2W3F A;  3UNW A;  5KMW A;  1WYB A;  5E43 A;  2IWD A;  2HDR A;  3BFG A;  3PHY A;  3I7J A;  4CQH A;  1AWI A;  3V67 A;  3HUN A;  1K4E A;  1BLS A;  3ZG7 B;  2DCF A;  5M18 A;  1S4R A;  2OAQ 1;  1VHM A;  3IXB A;  2P08 A;  3RXX A;  4LV2 A;  2WK0 A;  4X55 A;  3F1P A;  1WYC A;  3UME A;  3CI6 A;  3OPH A;  2Y2J A;  2OWH A;  4O0P A;  1TS0 A;  1Y28 A;  1G6O A;  2P9V A;  3T4L A;  1VEU A;  1ZG6 A;  3HUM A;  4E3L A;  3T4O A;  2Q9N A;  4WEL A;  1IFQ A;  2LB9 A;  4IVI A;  3S7O A;  5G4Y A;  4EBL A;  3A0S A;  2Z6D A;  1L0E A;  2P04 A;  4X1M A;  4OQ0 A;  3BLS A;  2VV6 A;  4XXR A;  2CMN A;  3BM6 A;  3NI9 A;  2W3D A;  3ZG8 B;  3IWO A;  1P97 A;  4GZB A;  1N9O A;  3A0R A;  3MMH A;  4HJ3 A;  2WUQ A;  4LV3 A;  4QHC A;  4HIA A;  3IX8 A;  3CJM A;  1W5D A;  1DP6 A;  2VLG A;  3MR0 A;  4GN2 A;  1NZO A;  5CER A;  4K0X A;  2XQZ A;  2J9P A;  4HI4 A;  2ZOI A;  4HES A;  1LI9 A;  1CI9 A;  2XD5 A;  4ESP A;  3SH8 A;  3QP5 A;  4WBG A;  2V8F A;  2WKR A;  4JPM A;  4Y17 A;  5HDD A;  4WZ4 A;  4MN5 A;  3A3D A;  1DJB A;  4PM9 A;  1TDG A;  4N9K A;  2W0N A;  5FA7 A;  2OV5 A;  2EXB A;  4B88 A;  5HAQ A;  2VK3 A;  4G3K A;  4LCL A;  1L0F A;  1MY8 A;  4Q0I A;  2ZL1 A;  3VOL A;  3Q7V A;  1STZ A;  3KSH A;  3MXR A;  1OME A;  4JF4 A;  3VV4 A;  2XK1 A;  4GOG A;  4DN0 A;  2ZQA A;  3HLC A;  3N8R A;  2PHY A;  5CED A;  3C38 A;  3H9W A;  3WWX A;  3H7W A;  3WS5 A;  1K6S A;  3QP2 A;  5HD3 A;  4UQI S;  5KZH A;  2W3E A;  1YLY A;  4EBP A;  1RCJ A;  1ESU A;  1SKO A;  5EVI B;  2JN7 A;  3KSF A;  5AVF A;  4OKP A;  2ZLY A;  3KO6 A;  5AQB A;  4OOM A;  2H5S A;  3UB8 A;  3P01 A;  3ULF A;  5L2F A;  1KGE A;  5TGF A;  5FQJ A;  1IEM A;  2JKR I;  4QB8 A;  1PZO A;  1U60 A;  1TS7 A;  4CLC E;  4BJP A;  3BEC A;  1ES2 A;  1N9B A;  3UDX A;  5KIZ A;  4DE3 A;  1GSX A;  5F6A A;  4MMN A;  4GLQ A;  4ARZ A;  1DRM A;  2B18 A;  4IBX A;  1LI0 A;  4OH0 A;  3HVF A;  3G31 A;  3BFF A;  5U47 A;  3NOP C;  3G35 A;  5A8B A;  2JKF A;  2B95 A;  1GHI A;  2VGJ A;  4X6T A;  1YMS A;  4XUZ A;  4Q8I A;  1FCO A;  2Y2N A;  4FH2 A;  1YM1 A;  1LL5 A;  2V20 A;  1W7F A;  5AQ7 A;  3ZYT A;  2XSS A;  2NUP C;  1K56 D;  3O3V A;  4H6J A;  3H82 B;  3K2N A;  3JPU A;  1K6R A;  1GA9 A;  1UWN X;  3AGD A;  5F5Y A;  4MDZ A;  5BOH A;  1VET A;  1LLB A;  3TG9 A;  5IT5 A;  3LR5 A;  4HP4 A;  1LHY A;  3MZD A;  2R78 A;  5FQI A;  1FR6 A;  2PYR A;  2WKP A;  1VQQ A;  4UEY A;  3QP6 A;  3V3S A;  5HW3 A;  3C4P A;  4GKU A;  4Y2F A;  3NHQ A;  5FI2 A;  3SS3 A;  4NET A;  1PW1 A;  2PAV P;  4GD8 A;  4IUK A;  5HPI A;  5FI7 A;  3P09 A;  3M2J A;  1BYW A;  2OWJ A;  4PM5 A;  4WUJ A;  3CUE A;  1FIL A;  5GLD A;  4Y7P A;  1IYP A;  4XUX A;  4BD1 A;  3JVU A;  1YQS A;  1O7E A;  1YSQ A;  1D7E A;  4Y5F A;  3B47 A;  2V9A A;  2VV7 A;  3NDE A;  3TRC A;  1XGJ A;  3UB5 P;  3VFF A;  3U2A A;  5FDS A;  5EVE A;  3P7N A;  3LIC A;  4R70 A;  3DTK A;  2WZZ A;  2QYB A;  3IF6 C;  3CIT A;  4FOF A;  4C3Q A;  3FC7 A;  1DP9 A;  4NK3 A;  4DDS A;  3IHA A;  1PNE A;  4Y0U A;  3T1R A;  4E04 A;  1MWU A;  1G28 A;  1JWP A;  3N4I A;  3L7H A;  2L4R A;  2XDM A;  2A3U A;  4WL9 A;  4R0Q A;  3LUQ A;  3ZQ5 A;  1SDN A;  5HL6 A;  4KZ8 A;  3HL9 A;  4KQQ A;  3N8S A;  1HVB A;  1MZU A;  1G6A A;  2Y2K A;  3CPT A;  3D9Y A;  4DDY A;  4JKT A;  4OQH A;  4WMC A;  1KGG A;  1SCW A;  1JNU A;  3E4O A;  2JKT M;  3IS2 B;  2QJ5 A;  2HJE A;  2H10 A;  4E3I A;  4Y3I A;  3MQ0 A;  2RL3 A;  1ES4 A;  4WM9 A;  4KZ6 A;  4LEN A;  3ZVW A;  5CX7 A;  3OOV A;  1K54 C;  2JKR M;  2Y2H A;  5FAP A;  2K7S A;  4E3O A;  1PI5 A;  2VZW A;  2KOI A;  3W4Q A;  2OLV A;  2ZBB A;  4BD0 A;  4DJ3 A;  5JYO A;  2INW A;  1SZV A;  2WKH A;  3KYE A;  3GMW A;  4PAU A;  4Q0J A;  4KG2 A;  1XGI A;  2ZC4 B;  5AQ9 A;  1GSV A;  5HX9 A;  2G2U A;  2XEP A;  5HD5 A;  1OT9 A;  5D3O A;  1GA0 A;  4OOY A;  4EQ1 A;  2P9V B;  5DJU A;  3JYI A;  1PFL A;  5DF9 A;  1FSW A;  3IH8 A;  3NUL A;  2RCX A;  1ERQ A;  2PBY A;  2Y55 A;  4B4Z A;  1I2S A;  4GDB A;  2G2W A;  1T1C A;  3WS0 A;  3CG5 A;  3ZGA B;  3EQU A;  5GL9 A;  4U0T A;  1SKF A;  1J3W A;  3EEA A;  3DW0 A;  5GLC A;  2HDU A;  4GNU A;  1W79 A;  3QHY A;  3UPN A;  4QY6 A;  1NLY A;  1G68 A;  4BBV A;  3S4X A;  1LSV A; 
#chains in the Genus database with same CATH homology
 4EER A;  3BW6 A;  2CMN A;  2L1M A;  4IUH A;  4G3V A;  2W3D A;  3KX0 X;  1P97 A;  2JHE A;  1N9O A;  3A0R A;  3MMH A;  1YKD A;  3D72 A;  4HJ3 A;  3LID A;  1XJ6 A;  4HIA A;  3T4K A;  1LL8 A;  2VJW A;  4ETX A;  1DP6 A;  2VLG A;  2D02 A;  4G3W A;  3MR0 A;  3MQQ A;  3IBJ A;  5HPF A;  4GS9 A;  2EWV A;  3K3D A;  3T4S A;  3HCY A;  1F5M A;  4I3J A;  2B02 A;  4KUK A;  5HWV A;  4HI4 A;  2ZOI A;  2O9A A;  2W1R A;  2PR6 A;  3FPW A;  4MN7 A;  4PKY G;  1N9L A;  2V0W A;  3RH8 B;  2VEA A;  2K2N A;  2WKR A;  5K5B A;  4R38 A;  1IOU A;  5HDD A;  4MN5 A;  4P6Z S;  3A0V A;  5AJG A;  2W0N A;  3PYP A;  4NXG A;  2BAS A;  2Y8H A;  2J3T D;  4EU0 A;  4G3K A;  4Q0I A;  2VX8 A;  2IA2 A;  3VOL A;  1STZ A;  1V9Z A;  3UE3 A;  1NLZ A;  3PR6 A;  1TS8 A;  3KSH A;  2O99 A;  3W2Z A;  1OPX A;  1OTA A;  1W63 Q;  3VV4 A;  4DN0 A;  3LIB A;  1XJ3 A;  2EA9 A;  5DJT A;  4YWZ A;  3CWF A;  2PHY A;  5HZH A;  2J3W A;  3C38 A;  3H9W A;  3S7Q A;  2ZMV A;  4QPR A;  3OC2 A;  3T4Q A;  3H7W A;  3E98 A;  2V1B A;  1V9Y A;  1P9R A;  5HD3 A;  1T1A A;  2QHK A;  1LSW A;  4UQI S;  4R3A A;  4XT2 B;  4EEP A;  2W3E A;  4B93 A;  1YAX A;  4KQD A;  3H7W B;  4EES A;  3H82 A;  3T4T A;  4R6L A;  1OJG A;  2A24 B;  2JN7 A;  3KSF A;  3PBQ A;  5AVF A;  3C2W A;  1OTI A;  1T1B A;  4NXF A;  3BY8 A;  3CAX A;  3KO6 A;  1LT0 A;  2HF6 A;  4OOM A;  3UB8 A;  2H28 A;  1S4S A;  3C8C A;  3P01 A;  3ULF A;  2M7V A;  3F1P B;  3F1O A;  5HWT A;  4B9O A;  3MFX A;  2JKR I;  4WF0 A;  2ZMF A;  3C30 A;  2PYP A;  3E4P A;  4CLC C;  5I5L A;  3LR4 A;  3DBA A;  4JGO A;  3RTY A;  1TS7 A;  5HWW A;  4CLC E;  4L9G A;  4M4X A;  4BJP A;  2ZOH A;  4OOL A;  4YOF A;  4PHT A;  1S67 L;  5C5K A;  5KIZ A;  1GSX A;  5F6A A;  1NRJ A;  3NOT C;  3BQ8 A;  4MMN A;  4GLQ A;  4ARZ A;  1DRM A;  2B18 A;  3EQV A;  4XT2 A;  5TJJ A;  2KDK A;  4GW9 A;  2LB5 A;  3IS2 A;  3NOP C;  5HDC A;  5AVE A;  5A8B A;  4KQO A;  2PD7 A;  4GJ4 A;  3JVV A;  3RFB A;  4HP9 A;  5LBR A;  3GDI A;  1X0O A;  2GZA A;  1XJ2 A;  1TD5 A;  3UB6 A;  2NUT C;  1ODV A;  4ARZ B;  2GJ3 A;  2MJ6 A;  5FL3 A;  5TBM B;  2W3G A;  2PDR A;  2YKH A;  3ZYT A;  1UWP X;  2FH5 A;  3TW8 A;  2XSS A;  4EXO A;  2NUP C;  4JGP A;  3S7N A;  4MCW A;  4DMZ A;  3MXQ A;  1XFN A;  1T18 A;  1H8M A;  4H6J A;  1ZHH B;  3H82 B;  4HJ6 A;  3K2N A;  4I3I A;  4BBU A;  3LIA A;  3KSI A;  1LSX A;  4NXE A;  4JGR A;  1UWN X;  4DJ2 A;  5F5Y A;  3D3O A;  4F3L A;  2PT7 A;  2J80 A;  4MDZ A;  3E4Q A;  4I3A A;  3EGX C;  5IT5 A;  4LRY C;  3ICY A;  4ZRR A;  3LR5 A;  2A2L A;  3UB7 A;  4HP4 A;  2J3T C;  4IJG A;  2KX6 A;  3MJQ A;  2R78 A;  1N9N A;  2PYR A;  3PBN A;  1DP8 A;  4GS9 B;  4UQI M;  3UB9 A;  2WKP A;  5F68 A;  3BWL A;  1W63 M;  3LFV A;  4HHD A;  4UEY A;  4NKP A;  3LIF A;  3FPV A;  4WEJ A;  1XJ4 A;  4I38 A;  4MN6 A;  4Y2F A;  1VB6 A;  4Z1W A;  3NHQ A;  4O8G A;  3VE3 A;  2JKT I;  3EWK A;  4CLC B;  3IBR A;  4NEE D;  5IU1 A;  3UMD A;  2XRO A;  5DKL A;  3CUE C;  4LRX C;  2Y79 A;  4IUK A;  5HPI A;  2L0W A;  3T50 A;  1BYW A;  4WLA A;  5IS1 A;  3LYX A;  5MC7 A;  4LPZ A;  2OWJ A;  3OBF A;  2OOL A;  2XA7 S;  3CUE A;  4WUJ A;  1OTB A;  5G4Z A;  4LRZ E;  1D06 A;  4LLO B;  3JVU A;  3BJN A;  3KSG A;  1YSQ A;  2W1T A;  1D7E A;  5EFW A;  4Y5F A;  3F1N B;  3B47 A;  4HNB A;  4RQ9 A;  4L9E A;  2V9A A;  2VV7 A;  4HJ4 A;  3TRC A;  4L9F A;  3U2A A;  2O9B A;  5DFX A;  3HJK A;  4BMW A;  1TS6 A;  3R7W B;  3T4J A;  5KSH A;  3P7N A;  5DKK A;  3LIC A;  4R70 A;  3KYQ A;  4GHI A;  4P6Z M;  4CLC A;  2O9C A;  2QYB A;  4IHQ A;  3CIT A;  4FOF A;  3LR3 A;  4WN5 A;  3FC7 A;  1DP9 A;  3TE8 A;  3EGD C;  2W3H A;  1MC0 A;  2HGV A;  2KLI A;  3PBT A;  4II7 A;  3EEH A;  4WEK A;  4BBT A;  5HSQ A;  1EW0 A;  4E04 A;  4EUV A;  3NJA A;  1G28 A;  1ZTU A;  3OCL A;  1P0Z A;  2XRN A;  3UE6 A;  2VGL S;  2L4R A;  4EET B;  4HQA A;  1H3Q A;  1NWZ A;  4GHI B;  3FG8 A;  4WL9 A;  4FSF A;  2M7U A;  4EEU A;  3LUQ A;  3ZQ5 A;  1TF1 A;  2W1T B;  4I5S A;  5HL6 A;  4AFI A;  5J4E A;  4HOI A;  5J3W A;  3TJZ C;  1S1Y A;  2EWW A;  1MZU A;  2VA0 A;  3B42 A;  2GNX A;  4PKY A;  3O5Y A;  2P7J A;  1OJ5 A;  1F98 A;  4JGQ A;  1JNU A;  3E4O A;  3LR0 A;  3LIE A;  2JKT M;  3IS2 B;  1S1Z A;  2G7U A;  2HJE A;  2QJ5 A;  1WA9 A;  2FZ0 A;  3F1O B;  4NXB A;  2HJ9 C;  4Y3I A;  3MQ0 A;  2HV1 A;  4ETZ A;  4F3L B;  3G6O A;  4HY8 A;  2PD8 A;  5CX7 A;  3OOV A;  4CLC D;  2I9V A;  3LI8 A;  5L8M A;  2O0Y A;  2JKR M;  2A24 A;  3MQO A;  4BWI A;  2K7S A;  1OTD A;  2QWS A;  2W27 A;  2K31 A;  4HH2 A;  1OT6 A;  3CLO A;  5F69 A;  2VZW A;  2KOI A;  2QKP A;  3BQA A;  2WKQ A;  1P9W A;  2ZBB A;  2D01 A;  3PBS A;  1OTE A;  4KUO A;  4GCZ A;  3R4K A;  4DJ3 A;  2VGL M;  1GSW A;  2INW A;  3HJI A;  3OLO A;  2Z6C A;  2QJ7 A;  4PAU A;  4K08 A;  4Q0J A;  3SW1 A;  1KOU A;  2GX5 A;  3K3C A;  2W3F A;  4Q0H A;  1GSV A;  5HD5 A;  2OAP 1;  1OT9 A;  3PHY A;  2VKS A;  3MF0 A;  2XA7 M;  4CQH A;  3E0Y A;  3V67 A;  4EQ1 A;  2V0U A;  1YSP A;  5DJU A;  3OCN A;  3EOI A;  3NOU C;  2VV8 A;  3KYZ A;  5DF9 A;  1S4R A;  2V1A A;  4H6J B;  3LI9 A;  3S7P A;  2OAQ 1;  3F1N A;  1VHM A;  4ME4 A;  1S66 L;  2P08 A;  3GEC A;  3F1P A;  4O01 A;  3VE4 A;  3PXP A;  3CI6 A;  3UME A;  1XFQ A;  1T19 A;  2OWH A;  3BY9 A;  4O0P A;  1TS0 A;  1Y28 A;  5J7E A;  1T1C A;  1G6O A;  3R7W A;  3T4L A;  5DFY A;  3EQU A;  1UGU A;  3PBO A;  3T4O A;  4WEL A;  1IFQ A;  3EEA A;  5TBM A;  2LB9 A;  3S7O A;  4L0L A;  5G4Y A;  4I39 A;  4EW7 A;  3A0S A;  2PR5 A;  1MKM A;  2Z6D A;  2P04 A;  4HH3 A;  2DMW A;  5HDS A;  3B33 A;  2YKF A;  2M1C A;  4YNR A;  1NLY A;  2VV6 A;  1F9I A;  3PBR A;  4BBV A;  1LSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...