4K08A

Periplasmic sensor domain of chemotaxis protein, adeh_3718
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
143
Chain Sequence
ARMLAERQAKVRALVEAAHGLVEHQGARAARGEISADEARRAALEALRALRYDGSEYFWVNDLEPRMVMHPTNPQLDGQDLSGYRDPNGKLLFQFVRTVRARGSGFVDYLWPKPGSTVPVPKISFVTQYQPWGWVVGSGLYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis sensory transducer
publication title Analysis of periplasmic sensor domains from Anaeromyxobacter dehalogenans 2CP-C: structure of one sensor domain from a histidine kinase and another from a chemotaxis protein.
pubmed doi rcsb
source organism Anaeromyxobacter dehalogenans
molecule tags Signaling protein
total genus 43
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4k08A00
3IS2B 1BYWA 5F6AA 3C2WA 2PDRA 1GSVA 4DJ2A 4EEPA 2R78A 3NOTC 4R38A 5HD5A 3SW1A 3NJAA 4HP9A 2Z6DA 3UMEA 2YKFA 2V1AA 4MN6A 1F9IA 2WKRA 5J7EA 2PD7A 5A8BA 4HNBA 2QJ5A 1S4SA 1XJ3A 4H6JB 4I3JA 3RH8B 1S66L 1Y28A 4LRZE 5DKLA 1UWPX 2GJ3A 3A0SA 1OT9A 2EA9A 1MZUA 2ZBBA 4HJ4A 4NXEA 4WUJA 3F1PA 3ICYA 4PKYA 3NOPC 3CWFA 2J80A 4R70A 5HD3A 2QKPA 1N9OA 4I3IA 1EW0A 3F1NA 3CLOA 3F1PB 4GHIB 1TS0A 2K7SA 2L1MA 3H9WA 3LIAA 2V9AA 5I5LA 3MXQA 3UB8A 2OOLA 2PD8A 2M1CA 2L4RA 2V1BA 3LICA 1LSWA 2PHYA 4M4XA 5HDDA 3E4QA 5G4ZA 1T1BA 4HOIA 4LRXC 4LPZA 4I38A 1V9ZA 5IS1A 1T1CA 5HZHA 2PR5A 2W27A 3UB6A 3ULFA 3BWLA 3EWKA 3GDIA 5HWWA 3E4OA 1OTAA 1NWZA 5DKKA 2QHKA 3A0RA 1XFNA 1LSXA 2B02A 5EFWA 4GCZA 5F68A 5HSQA 4H6JA 4EEUA 3IBRA 2OWHA 3UB9A 4L9EA 1LT0A 1D06A 1D7EA 4L9GA 4HJ3A 4HH2A 1OJ5A 3MR0A 5J4EA 1DP6A 4WN5A 1GSWA 1TS7A 2QWSA 5DJUA 3VOLA 1OJGA 4HY8A 2CMNA 2ZOIA 5HWVA 2D02A 4JGPA 1T19A 4GHIA 1JNUA 2V0UA 1GSXA 5AVEA 3LIFA 5G4YA 2Z6CA 1ODVA 3H82B 2ZOHA 1S1ZA 1XJ6A 1G28A 4KQDA 2D01A 4F3LA 1T18A 2H28A 1T1AA 3NOUC 1OT6A 4EQ1A 3VE4A 1XJ2A 5F5YA 1OTDA 5TBMB 4RQ9A 2JHEA 5IU1A 2PYPA 3MQOA 3HJIA 4E04A 4JGOA 1UGUA 3A0VA 1DRMA 1WA9A 4F3LB 3CAXA 4GW9A 3KX0X 4HP4A 3PHYA 3G6OA 3LIDA 1XFQA 1S67L 4HJ6A 4L9FA 3MJQA 4GS9A 3OLOA 3LIBA 4MN5A 3LI9A 1N9LA 4WLAA 3B33A 2L0WA 4HQAA 2VV8A 4BBVA 1XJ4A 1OTEA 2A24A 4I3AA 4R3AA 4GS9B 4NXBA 1LL8A 3LI8A 2INWA 2JN7A 5AVFA 5HDCA 3E4PA 2A24B 2KX6A 3K3DA 1P97A 3LUQA 4EETB 3H7WB 4DJ3A 4JGQA 1VB6A 3UMDA 4XT2A 3HJKA 1DP9A 4JGRA 3UE6A 3MFXA 4EESA 2BASA 1P0ZA 5F69A 3EEHA 4WL9A 3H82A 4XT2B 2P7JA 5KIZA 4NXGA 2WKQA 1X0OA 2KDKA 4KUOA 5TBMA 1N9NA 4EXOA 1F98A 3F1OA 4LRYC 3BY8A 1TS6A 4EW7A 2PYRA 4PKYG 2QJ7A 3LYXA 1LSVA 4HHDA 4BBUA 2VV7A 2VEAA 4LLOB 4NXFA 4R6LA 3K3CA 4HIAA 3NHQA 3MQQA 5HWTA 1S4RA 3F1OB 4I39A 1OTBA 2HV1A 1OTIA 4HI4A 3VE3A 3RTYA 3FC7A 1S1YA 3ZQ5A 3T50A 3P7NA 3C8CA 1UWNX 2YKHA 4YWZA 4I5SA 4HH3A 4BBTA 3D72A 2WKPA 3F1NB 4WF0A 2OWJA 1DP8A 3PYPA 4K08A 3LIEA 3H7WA 1V9YA 2VLGA 5DJTA 2I9VA 2VV6A 3IS2A 3GECA 3BY9A 1KOUA 1TS8A 4EERA 2V0WA 5J3WA 4B9OA 2PR6A 3FG8A 5HDSA 4KUKA 3UB7A 2W0NA
chains in the Genus database with same CATH superfamily
2VZWA 5CGXA 2R9WA 1MKIA 3KYQA 3C2WA 4EU0A 1NYMA 5GLDA 3BQ8A 1WE4A 3LCEA 3E2KA 1FCMA 4OLGA 4WEKA 1GSVA 4DJ2A 4WM9A 2EFXA 1H8YA 5M1AA 2Y2NA 5FQKA 4RX3A 3SW1A 5CEBA 4Y15A 1L3LA 1MWUA 3NIAA 3UB5P 1OPXA 2GNXA 4MN6A 3LR4A 3G34A 3T12B 4UA7A 4HNBA 5DF9A 3SH9A 4LRZE 4LCMA 3HLEA 4Y7PA 1JWVA 2BG1A 5DKLA 2JE5A 4HJ4A 4X55A 3GVBA 4OOLA 3VP2A 5CX7A 1PW1A 2Q9MA 5FI7A 2H0YA 1P9WA 2ZMAA 4PKYA 2Y2PA 2WAEA 1A0KA 3CWFA 1ONGA 4R70A 5HD3A 2ZC6B 4I3IA 1LL9A 5L07A 1EW0A 4IEDA 3I7JA 4G3KA 4QD4A 2P74A 1TS0A 3LIAA 5HPIA 5L10A 2V2FF 3WS5A 4R23A 5D3OA 3ZG9B 1HD8A 1PWCA 4GN2A 3CJMA 3NC8A 3OPRA 2ZD8A 2OLVA 3KSIA 4S2KA 1NXYA 1YSQA 2PHYA 4YNRA 3HUOA 3PTEA 3QP4A 2Y79A 4KZBA 1KGEA 3A3IA 5E2GA 3E4QA 3E98A 1K55A 4HOIA 1M40A 3CPTA 4DE3A 5AQ7A 4IUKA 3SZTA 2W27A 4S2NC 3ULFA 4LFUA 4OOMA 4N1XA 5HWWA 3E4OA 4KZ3A 1K0KA 5DKKA 3AGFA 3CMZA 3W2ZA 1LSXA 3W4OA 1J9MA 2B02A 2H0TA 2J3WA 3B3XA 1XA1A 4YOFA 3ZG5A 4H6JA 1YLYA 5CXWA 3TJZC 3ZFZA 3UB9A 2XLNA 4II7A 4HH2A 5J4EA 3T4QA 1DP6A 3LY4A 2Q0OA 2QWSA 4GDNA 2DRWA 2WGWB 5FAQA 3VOLA 4HESA 4JGPA 4BJPA 1T19A 2LB5A 2V0UA 5DF7A 5AQ9A 5AVEA 1E3UA 1S1ZA 1VETA 2D01A 4GNUA 4U0TA 3DWZA 4MCWA 1OT6A 2XA7M 1NRJA 5FAPA 3T4JA 5F5YA 4RA7A 5EOEA 1JWPA 2VGJA 3BYDA 1VEUA 4E04A 1MBLA 1E25A 4JGOA 4GB7A 1SKFA 1CEFA 1DRMA 2C6WB 2OLUA 5FQJA 1K54A 4LENA 3PBNA 4Q0IA 3PHYA 3OPHA 1XFQA 4HJ6A 4K0WA 5GLCA 4Y2FA 5CGSA 3LIBA 4MN5A 1XKZA 1PI5A 5E2FA 5MC7A 3B33A 4OOYA 1ERQA 1KVMA 4R3BA 1OTEA 3IHAA 3QNBA 2FH5A 4PHTA 3OC2A 2A24A 4G3WA 4RYEA 2EXAA 4R3AA 4DDSA 3MFDA 4OKPA 5FEFA 3LY3A 3TRCA 3UO9A 4WBGA 5FSRA 5HDCA 3QP2A 2ZQCA 4R4RA 3E4PA 2Q9NA 4DKIA 2A24B 3K3DA 1JVJA 3QP1A 4B4XA 3H7WB 1PRQA 4DJ3A 3UMDA 5F82A 4Z1WA 4UQIM 1XXMA 3TOIA 4LV3A 4DXCA 3MFXA 3VP0A 4PM5A 2BASA 5FDHA 1P0ZA 4JF6A 3VFHA 5CECA 1SKOA 5CERA 3MKFA 2P7JA 4MMNA 4IJGA 4FTXA 3GRJA 2ZL1A 5KIZA 1YM1A 1CK3A 2B18A 3PXPA 3VOZA 1K55C 1F98A 3F1OA 4FSFA 4LRYC 4EW7A 4MBHA 3ISGA 2A3UA 3BLSA 1LSVA 4E3JA 2ZL1B 3MMHA 3S7NA 3KSGA 5FEGA 3N8RA 4R6LA 1H5XA 4UAAA 1K6RA 3EQUA 1GA9A 2AVXA 3RJUA 5AQBA 3PBOA 1S4RA 3F1OB 3DBAA 4ZRRA 1OTIA 3CI6A 3DAVA 4KZ7A 3VE3A 1NRFA 3G4PA 1PIOA 1I5QA 2ZQ8A 2Y2IA 3B42A 4P6ZS 4H8RA 1S1YA 3IT9A 3ZQ5A 3N8LA 1LLBA 2WKEA 2XK1A 3OCNA 3IF5A 3S1YA 1WYCA 2YKHA 1NZUA 1BLHA 2CC1A 2ZLYA 3A3EA 5CTMA 3T4TA 4OQHA 2J3TC 2OWJA 1Q2PA 3M6BA 3T1XA 3A3DA 1V9YA 4LV0A 2VLGA 4JXGA 5DJTA 2I9VA 3M2KA 3MSHA 3IS2A 3UDXA 4EERA 3KO6A 4NEED 4MEZA 2ZQAA 3LR3A 4KUKA 4ETZA 4KQRA 3DTIA 1FR6A 3UB7A 2G2WA 4JLFA 3FPVA 4G3VA 5FASA 3IS2B 2WZXA 4OLDA 1YPRA 5F6AA 3FV7A 2M7UA 1BUEA 2DCFA 2BLSA 4EEPA 2HP6A 5EM1A 2R78A 4R38A 5HD5A 5TGFA 3BFEA 2W1TB 3OZHA 2EXBA 3UMEA 2IWDA 1VHMA 2YKFA 5CRFA 1FR1A 1F9IA 5J7EA 5FQIA 2QJ5A 4I3JA 3RH8B 1S66L 3RXWA 5FI2A 4S2OA 2WADA 2VGKA 3S22A 1VQQA 4ARZA 2EX8A 1OT9A 2Y55A 2ZBBA 2XDMA 3F1PA 4KQOA 2DNSA 3O86A 1TDGA 4JXSA 2O9BA 1AXBA 3NOPC 5M18A 1N9OA 3DW0A 1IKIA 4E3MA 3F1NA 3F1PB 4BL3A 1NYYA 2XA7S 4WMCD 1JTGA 1KE3A 3T4KA 3H9WA 5L2FA 2V9AA 5JYOA 3BFCA 2H5SA 4IBRA 4WZ5C 4X69A 5C5KA 2WZZA 1K56D 2RL3A 1CF0A 4CPKA 4D2OA 4CJNA 2O9AA 5G4ZA 4P85A 1OMEA 4BMWA 4KG2A 4LRXC 4ETXA 3DTEA 4KZ6A 4Q0JA 5HAQA 2W3FA 1T1CA 1QMFA 4CLCC 3RFBA 5HZHA 2PR5A 3BWLA 2XD5A 3EWKA 2HGVA 5DVAA 4K0XA 4GZBA 5FA7A 1Z09A 3HLGA 4X53A 4BL2A 1ESIA 1NWZA 5L09A 5DTKA 1ESUA 3L7HA 5EFWA 3HUMA 4DRTA 1XGIA 3KYZA 3GV9A 3O3VA 3T4SA 5CHMA 3ZG7B 3IBRA 5EVID 1YSPA 2B95A 3FKWA 4UQIS 2WKHA 1Y4OA 5F1GA 4L9EA 4CQHA 1LT0A 2GZAA 4QB8A 5GLAA 3ZG8B 2WYXA 4HJ3A 4O0PA 4XUZA 4WN5A 2RCXA 1GHPA 4Y3IA 5F1FA 3OPPA 4QJGA 4JPMA 3KSHA 3IXHA 2QZ6A 4R3JA 1TS7A 4BD1A 3SS3A 4C6YA 4UA9A 4HY8A 5HWVA 2D02A 4MBKA 1JNUA 2PBDP 1EWZA 3S7PA 1ZKJA 1W5DA 3UE0A 3H82B 2ZOHA 2P9VB 4EQIA 3IBJA 3NDEA 1T1AA 2O9CA 3E0YA 2HF6A 4E6WA 5HAPA 3NOUC 1IELA 1YLTA 4N9KA 1J3WA 2HP5A 3D9YA 3PBRA 2PYPA 2Y2JA 2VGLS 4E3LA 3HJIA 3VV4A 3R7WA 3NULA 4X6TA 1WA9A 3TG9A 3U4LP 4OP5A 4GW9A 1XX2A 3TW8A 2DMWA 3BEBA 4QHCA 3IXDA 1F2KA 1TD5A 4DE2A 3OLOA 1CI8A 3R7WB 1N9LA 3V39A 1JWZA 4K91A 1NLYA 4HQAA 2HPBA 1EI5A 2VV8A 4KG5A 4EBPA 4O01A 1KE4A 3VMAA 3O87A 4OVDA 2O99A 1LL8A 4Y5FA 3HREA 3WS2A 1F5MA 1FOFA 4DDYA 4ZJ2A 5FATA 2V8FA 4E3IA 3KSFA 3WRTA 1ES3A 2KX6A 2E8JA 3ITBA 5KZHA 3GR2A 3M6HA 4GD8A 2PAVP 3MZEA 4F94A 1BZAA 1D1JA 4ID4A 4XT2A 2EFUA 4JGRA 2JKTI 4EUZA 4GLQA 2WGWA 5FDSA 4MLLA 5F69A 2XROA 2JKRM 4XT2B 4X68A 3Q81A 4KZ8A 5CGWA 2ZC5B 3DWKA 1QMEA 3V5MA 1XP4A 3D4FA 4YINA 2PYRA 4HHDA 4MNRA 2VV7A 3RXXA 3IXBA 5HARA 3UPOA 3OPLA 4KQQA 4NXFA 4FD8A 3NHQA 3VOYA 3SH8A 1K6SA 2K2NA 5HWTA 3PBQA 5HL1A 1STZA 1NLZA 4HI4A 4S2JA 1PNEA 4N92A 3PAEA 5L8MA 4Q8IA 2V1ZA 4MDZA 5J8XA 3K2NA 2EX2A 3ZVWA 4L0LA 2GDNA 4MBFA 3IWOA 1U60A 2M7VA 3P7NA 4KZ5A 4BENA 3C8CA 1UWNX 5DFYA 3N6IA 5E2HA 1SDNA 3NECA 2HP9A 3TSGA 5FI6A 2XR0A 3BFFA 1HLUP 2W3EA 4WF0A 1DP8A 4K08A 5EM0A 3H7WA 3HLFA 3MS6A 5G18A 1G6AA 4LV1A 1GHMA 4WMCA 1DJBA 3QHYA 3UY6A 1KVLA 4B9OA 2JKGA 1SDEA 2PR6A 3FG8A 1YQSA 2X71A 3EEAA 1I2WA 5U47A 2EX9A 3SS4A 1K4EA 1ES2A 3HBRA 5HL6A 2W0NA 4NG2A 3IH9A 1DJCA 4M3KA 1K56A 4XXRA 2K31A 1MY8A 2Y2LA 3HLBA 5M19A 2PDRA 1Q2QA 2WGIA 3NOTC 1PZPA 2Y8HA 3NJAA 2Z2LB 2VX8A 4HP9A 3ZNYA 1MWSA 3VSLA 2PU2A 4E3KA 1ZC2A 2V1AA 2VJWA 2ZM8A 2PD7A 2Y2QA 4PM6A 4X1LA 1S4SA 1XJ3A 3UE3A 3CUEA 3C30A 3A0SA 3IHBA 2EA9A 1ALQA 1FSWA 4NXEA 3IF6A 4Z9QA 4WUJA 3NBLA 3ITAA 3WS4A 4ZTKA 3DTKA 3GTCA 3ICYA 5EVIA 4QY5A 1YMSA 3UN7A 3EQVA 3V3RA 4DE1A 4UEYA 2QKPA 2PBYA 3MZFA 3QP6A 3IF6B 4GHIB 5K5BA 3ZDJA 2K7SA 5EVIB 3MXQA 5GLBA 4QWOA 1NJ4A 2XH9A 1IYQA 4EBNA 4Y0UA 2M1CA 2V1BA 3LICA 4S2PA 1SHVA 1IYPA 3SS5A 2EWWA 3NCKA 2ZQDA 5FQQA 4M4XA 4OPRA 4ZBEA 4ZDXA 1YLJA 4O8GA 1IYSA 4BLMA 4LPZA 2WGVA 3FZCA 2GX5A 3BLMA 1V9ZA 5IS1A 2PU4A 4RVAA 1HTZA 3UB6A 4A5RA 2XGNA 1IOUA 2W1TA 3MZDA 4DF6A 4EUVA 1W8QA 2J3TD 2QHKA 3B47A 4R1GA 3Q1FA 1DY6A 4E3NA 3IX4A 1PZOA 1K54C 5F68A 5HSQA 4FCFA 3NY4A 1TDLA 4DN0A 2OWHA 1NY0A 4FUWA 1BLSA 1D7EA 2HJEA 4L9GA 5FAOA 1L0FA 5HPFA 5EV0A 5GHYA 4HBUA 1W8YA 5EPHA 5DJUA 1JTDA 4GKUA 1FQGA 4PM7A 4WELA 2CMNA 4P0MA 5CHUA 1GSXA 2ZQ7A 1CEGA 4N9LA 3LIFA 3IQAA 2ZM0A 2Z6CA 4ESPA 2HDUA 1FCOA 3ZGAB 3OOVA 3C38A 1XJ6A 1G28A 4KQDA 4F3LA 1N4OA 5AJGA 1XPBA 2JC7A 3OCLA 2X02A 3IXGA 2VKSA 3G32A 1LI9A 4LV2A 4S2NA 1ACFA 1YKDA 4EQ1A 4FH4A 2HDRA 4IBXA 5TBMB 4BQMA 3NDGA 3MQOA 4IUHA 1UGUA 4F3LB 2VK3A 3CAXA 4Y17A 1ES5A 1BLPA 1EROA 3FKVA 4IVIA 3KX0X 4HP4A 3G6OA 1FCNA 1YMXA 4GD6A 3O5YA 4GDBA 2J9OA 4GS9A 1AWIA 4PPRA 1CQAA 1ZHHB 2ZC4B 2E8IA 3HUNA 3C4PA 3BM6A 5AQAA 3TE8A 3JVUA 3ZG0A 3AGEA 3DTMA 1HVBA 4GS9B 3M2JA 4NXBA 5GHZA 2INWA 2JN7A 1H8ZA 3N4IA 1MXOA 2P08A 5EVIC 1IYOA 1PWGA 2Y2OA 3WRZA 3C7VA 3IX3A 3LEZA 4PM8A 3Q7VA 4PAUA 3E2LA 1BTLA 4D60A 3AGDA 1P97A 3WS1A 5CHJA 3LUQA 2WK0A 4S2IA 2ZC7A 1VB6A 1PI4A 1L0DA 1VM1A 2V8CA 3BW6A 4Y0OA 3UE6A 1ES4A 3Q7VB 2WUQA 4N1HA 1MC0A 1IEMA 1WYBA 3HCYA 4FH2A 3UPPA 4U3TA 2PT7A 4CLCD 3GMWA 1PWDA 2QYBA 4FOFA 3SH7A 2OSUA 4WL9A 2ZJ9A 3H82A 5IT5A 2P9VA 4ZJ1A 3JYIA 5HX9A 2FZ0A 3MF0A 1KDWA 2QPNA 1X0OA 5EVLA 3U2AA 4KUOA 4OP8A 1N9NA 4EXOA 3IH8A 1YLPA 3EGDC 1W79A 4PKYG 2QJ7A 3LYXA 1YLZA 2J9PA 4JKTA 4O7DA 2VEAA 2R9XA 4LLOB 4KZ4A 5JYPA 4DXBA 3K3CA 1GCEA 3MQQA 4OQIA 1KGGA 4PMAA 4RX2A 4Q0HA 2HV1A 1TF1A 4NK3A 2UV0E 2XRNA 5HFOA 2XFSA 3P01A 3O88A 3T1QB 3RTYA 1CJFA 4P6ZM 1BT5A 3IWIA 4OPYA 2OV5A 4C75A 2IWCA 4DMZA 2XF3A 3T50A 5EECA 3W4QA 3G2YA 1IKGA 3GQZA 2HDSA 4IHQA 3LFVA 3KYEA 4YWZA 4I5SA 4HH3A 2JCHA 4BBTA 4UA6A 3ZYTA 2WKPA 3FYZA 4E3OA 3LIEA 2J8YA 3QNCA 3BECA 2VV6A 3ZCZA 3ZNTA 4HBTA 3T1SA 5BOHA 3WWXA 1ERMA 3D3OA 5HDSA 1MWRA 5GHXA 4WEJA 2Y4AA 4R4SA 3V50A 4BWIA 2FFYA 3PR6A 1BYWA 2XQZA 2ZMFA 1C3BA 1LL5A 2JBFA 4S2MA 4AFIA 3CPTB 3PBSA 4B93A 3C4OA 5F83A 3NI9A 4JBFA 2I72A 3MXRA 2W3GA 1H3QA 1MPLA 4IVKA 5DTSA 2ZMVA 1FILA 2Z6DA 3VFFA 3VP4A 1RP5A 3GSGA 1SCWA 2WKRA 5A8BA 4H6JB 1Y28A 1MWTA 3WS0A 1P9RA 2Y2GA 3LR0A 3MBZA 5EE8A 1UWPX 2GJ3A 3G31A 5DTTA 3CZDA 1MZUA 1TVFA 4U0XA 2IWBA 2P04A 3G35A 2IA2A 4P6BA 4JF4A 4E6XA 3S4XA 3N7WA 3VSKA 1W63Q 2J80A 1L0GA 1O07A 5TR7A 3Q7ZA 1ZG6A 2PRFA 1K25A 4B88A 2W1RA 3BQAA 2HZ5A 4JXWA 5DFXA 1O7EA 3CLOA 1M6KA 4CLCE 2L1MA 4NETA 2WKIA 4OPQA 3QP8A 4XUXA 5I5LA 3UB8A 1VETB 2OOLA 2PD8A 1ONHA 3FPWA 3FWLA 3ZHHA 4Y0TA 2L4RA 3N8SA 2XFTA 1LSWA 1PW8A 1VEUB 5A91A 4KENB 5HDDA 5KSCA 2NUTC 3L9KA 3V67A 3PAGA 1T1BA 4R0QA 2WAFA 4I38A 3C5AA 5DF8A 2ZQ9A 1KDSA 2Y59A 3Q82A 3T4LA 2Y91A 3GDIA 2KOIA 1HZOA 1OTAA 3A0RA 1XFNA 2OAP1 1TEMA 3BJNA 3V3SA 4GCZA 1L0EA 4OQ0A 4ZAMA 4QPRA 4EWFA 3LGOA 4EEUA 4NKPA 4JF5A 3EOIA 1D06A 4KZAA 2UWXA 1OJ5A 4WZ5A 4ME4A 3MR0A 2XSSA 2QMIA 1Z6FA 2LB9A 3ZVTA 2OAQ1 1GSWA 3S7QA 1K57A 1KGFA 4KG6A 3A3JA 1BULA 2X01A 1OJGA 4X56A 2ZOIA 4GHIA 1GA0A 2XEPA 5A93A 1SKOB 5G4YA 4X1MA 3CHWP 3BRMA 1ODVA 3JPUA 2HJ9C 3MQ0A 3G2ZA 2ZM2A 1T18A 2H28A 5A90A 4OQGA 1W7FA 4CLCA 4B4ZA 1LHYA 3HLWA 1NZOA 4C3QA 3VE4A 3OBFA 5FL3A 1XJ2A 5A92A 2G2UA 1OTDA 2A49A 4GJ4A 4RQ9A 2JHEA 5FQMA 1FIKA 5IU1A 2VGLM 1N9BA 5E2EA 2HDQA 3A0VA 1BSGA 4CLCB 5EOOA 5I94A 1YAXA 3LIDA 1S67L 4L9FA 1H0MA 3MJQA 2J7VA 2W3HA 1ZTUA 2C5WB 1KE0A 3LI9A 2O0YA 4WLAA 2MJ6A 2L0WA 5KMWA 1BLCA 1XJ4A 4BBVA 2Y2KA 3HVFA 3VP3A 3IX8A 4BD0A 1K4FA 3SOIA 4I3AA 1H8MA 1K38A 3EGXC 1RCJA 2ACGA 3LI8A 5TJJA 2JKRI 5AVFA 1CI9A 4MN7A 2VA0A 3A3FA 3QP5A 1Y54A 4EETB 4JGQA 4LGWA 3T4OA 1PYYA 3BFGA 3HJKA 5FQ9A 1XGJA 2JKFA 1DP9A 3S7OA 1E3UD 2BTFP 3LR5A 4EESA 2W3DA 4HEFA 5E43A 1XA7A 3EEHA 4GOGA 3JVVA 3MKEA 3LO7A 4DE0A 3CG5A 4QU3A 5KSHA 3W8KA 1S0WA 4NXGA 3IWQA 2H10A 4X25A 1IFQA 2WKQA 1DJAA 3G30A 2KDKA 1ZG4A 2EX6A 1I2SA 3UE1A 1YLWA 1YT4A 2JKTM 2EWVA 5TBMA 3BY8A 1TS6A 2V20A 3T1RA 4BBUA 1SZVA 4QY6A 3BFDA 2XD1A 4EBLA 3P98A 5EVEA 4PM9A 4HIAA 4OONA 1S6RA 3HLCA 2B5RA 4WYYA 4I39A 4ZJ3A 1LI0A 1G5UA 1OTBA 3MXSA 3VP1A 4UHUA 5CEDA 5HW3A 5LBRA 3P09A 1FSYA 4WZ4A 3FC7A 2NUPC 4ARZB 3CITA 1E4DA 1G6OA 1L2SA 3Q07A 3UDIA 2FFFB 4LCLA 3LEQA 3C7UA 1W63M 5IHVA 2KLIA 3HLDA 3W4PA 3D72A 5TFQA 4OPZA 3PBTA 3F1NB 5GL9A 3R4KA 3UPNA 3CUEC 1K57C 4JXVA 3PYPA 1GHIA 3UDFA 2G7UA 3IF6C 5EUAA 4P87A 4S2LA 4OH0A 2Y2MA 1G68A 1MKMA 2ZC3B 2Y2HA 3GECA 3BY9A 1KOUA 4YFMA 1TS8A 4KZ9A 2V0WA 4Y13A 5HAIA 1RGZA 1PFLA 5J3WA 5CTNA 2A2LA 1RGYA 4EV4A 3HL9A 2Z2MB 3UNWA
chains in the Genus database with same CATH topology
3IS2B 2VZWA 1BYWA 2ZMFA 5F6AA 3KYQA 3C2WA 4AFIA 4EU0A 2M7UA 2K31A 3BQ8A 3PBSA 4B93A 2PDRA 4WEKA 1GSVA 4DJ2A 4EEPA 2R78A 3NOTC 4R38A 5HD5A 2W3GA 1H3QA 2Y8HA 3SW1A 3NJAA 2W1TB 2VX8A 4HP9A 2ZMVA 2Z6DA 3UMEA 1VHMA 2YKFA 2V1AA 1OPXA 2GNXA 2VJWA 4MN6A 3LR4A 1F9IA 2WKRA 5J7EA 2PD7A 5A8BA 4HNBA 2QJ5A 5DF9A 1S4SA 1XJ3A 4H6JB 4I3JA 3RH8B 3UE3A 1S66L 1Y28A 4LRZE 1P9RA 3LR0A 3CUEA 5DKLA 3C30A 1UWPX 2GJ3A 4ARZA 3A0SA 1OT9A 2EA9A 1MZUA 2ZBBA 4HJ4A 4NXEA 4OOLA 4WUJA 3F1PA 4KQOA 5CX7A 2P04A 2IA2A 3ICYA 1P9WA 2O9BA 4PKYA 3NOPC 3CWFA 3EQVA 1W63Q 2J80A 4R70A 4UEYA 5HD3A 2QKPA 1N9OA 4I3IA 1EW0A 2W1RA 3BQAA 5DFXA 3F1NA 3CLOA 4G3KA 3F1PB 4GHIB 2XA7S 5K5BA 1TS0A 3T4KA 2K7SA 4CLCE 2L1MA 3H9WA 3LIAA 5HPIA 2V9AA 5I5LA 3MXQA 3UB8A 2OOLA 2PD8A 3FPWA 2M1CA 2L4RA 3KSIA 5C5KA 2V1BA 3LICA 1LSWA 1YSQA 2PHYA 4YNRA 2EWWA 2Y79A 4M4XA 2O9AA 5HDDA 3E4QA 5G4ZA 2NUTC 4O8GA 3V67A 3E98A 4BMWA 1T1BA 4HOIA 4LRXC 4LPZA 4ETXA 4Q0JA 2GX5A 4I38A 1V9ZA 2W3FA 5IS1A 1T1CA 4IUKA 3RFBA 4CLCC 5HZHA 2PR5A 2W27A 3UB6A 3ULFA 3BWLA 4OOMA 3EWKA 2HGVA 3T4LA 1IOUA 2W1TA 3GDIA 4EUVA 5HWWA 2KOIA 3E4OA 3PR6A 1OTAA 2J3TD 1NWZA 5DKKA 2QHKA 3B47A 3A0RA 1XFNA 3W2ZA 1LSXA 2OAP1 3BJNA 2B02A 5EFWA 4GCZA 2J3WA 4YOFA 5F68A 3KYZA 5HSQA 4H6JA 4QPRA 3T4SA 4EEUA 3IBRA 4NKPA 1YSPA 3TJZC 4DN0A 4UQIS 3EOIA 2OWHA 3UB9A 4L9EA 4CQHA 1LT0A 2GZAA 1D06A 1D7EA 2HJEA 4II7A 4L9GA 4HJ3A 4HH2A 1OJ5A 4O0PA 4ME4A 3MR0A 5J4EA 2XSSA 5HPFA 3T4QA 1DP6A 2LB9A 4WN5A 2OAQ1 4Y3IA 1GSWA 3S7QA 3KSHA 1TS7A 2QWSA 5DJUA 3VOLA 1OJGA 4HY8A 4WELA 2CMNA 2ZOIA 5HWVA 2D02A 4JGPA 4BJPA 1T19A 4GHIA 1JNUA 2LB5A 2V0UA 1GSXA 3S7PA 5AVEA 3LIFA 5G4YA 2Z6CA 1ODVA 3MQ0A 2HJ9C 3H82B 2ZOHA 1S1ZA 3OOVA 3C38A 1XJ6A 1G28A 4KQDA 3IBJA 2D01A 4F3LA 1T18A 2H28A 5AJGA 3OCLA 1T1AA 2O9CA 3E0YA 2HF6A 2VKSA 4CLCA 4MCWA 3NOUC 1OT6A 2XA7M 1YKDA 4EQ1A 3VE4A 1NRJA 3OBFA 5FL3A 1XJ2A 3T4JA 5F5YA 1OTDA 5TBMB 4GJ4A 4RQ9A 2JHEA 5IU1A 2VGLM 3PBRA 2PYPA 2VGLS 3MQOA 3HJIA 3VV4A 4E04A 4IUHA 3R7WA 4JGOA 1UGUA 3A0VA 1DRMA 1WA9A 4F3LB 3CAXA 4GW9A 3KX0X 4CLCB 3PBNA 3TW8A 2DMWA 4Q0IA 4HP4A 3PHYA 3G6OA 1YAXA 1XFQA 1S67L 3LIDA 4HJ6A 4L9FA 3MJQA 3O5YA 1TD5A 4Y2FA 4GS9A 3OLOA 2W3HA 1ZTUA 3LIBA 4MN5A 3R7WB 3LI9A 5MC7A 1N9LA 2O0YA 4WLAA 1ZHHB 3B33A 2MJ6A 2L0WA 1NLYA 4HQAA 2VV8A 4BBVA 1XJ4A 1OTEA 4O01A 3TE8A 3JVUA 2FH5A 4PHTA 3OC2A 2A24A 4G3WA 4I3AA 1H8MA 4R3AA 4GS9B 2O99A 4NXBA 1LL8A 3EGXC 4Y5FA 3LI8A 2INWA 2JN7A 1F5MA 3TRCA 5TJJA 2P08A 2JKRI 5AVFA 3KSFA 5HDCA 4MN7A 2VA0A 4PAUA 3E4PA 2A24B 2KX6A 3K3DA 1P97A 3LUQA 4EETB 3H7WB 4DJ3A 4JGQA 1VB6A 3T4OA 3UMDA 4XT2A 3HJKA 1DP9A 4JGRA 4Z1WA 2JKTI 4UQIM 3S7OA 3BW6A 3UE6A 4GLQA 3MFXA 1MC0A 3LR5A 3HCYA 4EESA 2BASA 2W3DA 1P0ZA 5F69A 2XROA 2PT7A 4CLCD 2JKRM 3EEHA 2QYBA 3JVVA 4FOFA 4WL9A 3H82A 4XT2B 5IT5A 2P7JA 4MMNA 4IJGA 5KSHA 5KIZA 2FZ0A 4NXGA 3MF0A 1IFQA 2WKQA 1X0OA 2B18A 3PXPA 2KDKA 3U2AA 4KUOA 5TBMA 2JKTM 1N9NA 2EWVA 4EXOA 1F98A 3F1OA 4FSFA 4LRYC 3BY8A 1TS6A 4EW7A 3EGDC 2PYRA 4PKYG 2QJ7A 3LYXA 1LSVA 4HHDA 4BBUA 2VV7A 3MMHA 2VEAA 3S7NA 3KSGA 4LLOB 4NXFA 4R6LA 3K3CA 4HIAA 3EQUA 3NHQA 3MQQA 2K2NA 3PBOA 5HWTA 1S4RA 3F1OB 4I39A 1OTBA 3PBQA 3DBAA 2HV1A 4Q0HA 1STZA 1NLZA 1OTIA 1TF1A 3CI6A 4HI4A 4ZRRA 3VE3A 5LBRA 2XRNA 3P01A 5L8MA 4MDZA 3RTYA 3K2NA 3B42A 3FC7A 4P6ZM 2NUPC 4ARZB 4P6ZS 3CITA 1S1YA 4DMZA 4L0LA 3ZQ5A 1G6OA 2M7VA 3T50A 3P7NA 3C8CA 1UWNX 3OCNA 5DFYA 4IHQA 2YKHA 1W63M 3LFVA 4YWZA 4I5SA 4HH3A 2KLIA 4BBTA 3ZYTA 3D72A 2WKPA 3PBTA 3F1NB 3T4TA 3R4KA 2J3TC 2W3EA 3CUEC 4WF0A 2OWJA 1DP8A 3PYPA 4K08A 3LIEA 3H7WA 1V9YA 2G7UA 2VLGA 5DJTA 2I9VA 2VV6A 3IS2A 1MKMA 3GECA 3BY9A 1KOUA 1TS8A 4EERA 3KO6A 2V0WA 4NEED 3D3OA 5J3WA 4B9OA 2A2LA 2PR6A 3FG8A 5HDSA 4WEJA 3LR3A 3EEAA 4KUKA 4ETZA 4BWIA 5HL6A 3UB7A 2W0NA 3FPVA 4G3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IS2 B;  1BYW A;  5F6A A;  3C2W A;  2PDR A;  1GSV A;  4DJ2 A;  4EEP A;  2R78 A;  3NOT C;  4R38 A;  5HD5 A;  3SW1 A;  3NJA A;  4HP9 A;  2Z6D A;  3UME A;  2YKF A;  2V1A A;  4MN6 A;  1F9I A;  2WKR A;  5J7E A;  2PD7 A;  5A8B A;  4HNB A;  2QJ5 A;  1S4S A;  1XJ3 A;  4H6J B;  4I3J A;  3RH8 B;  1S66 L;  1Y28 A;  4LRZ E;  5DKL A;  1UWP X;  2GJ3 A;  3A0S A;  1OT9 A;  2EA9 A;  1MZU A;  2ZBB A;  4HJ4 A;  4NXE A;  4WUJ A;  3F1P A;  3ICY A;  4PKY A;  3NOP C;  3CWF A;  2J80 A;  4R70 A;  5HD3 A;  2QKP A;  1N9O A;  4I3I A;  1EW0 A;  3F1N A;  3CLO A;  3F1P B;  4GHI B;  1TS0 A;  2K7S A;  2L1M A;  3H9W A;  3LIA A;  2V9A A;  5I5L A;  3MXQ A;  3UB8 A;  2OOL A;  2PD8 A;  2M1C A;  2L4R A;  2V1B A;  3LIC A;  1LSW A;  2PHY A;  4M4X A;  5HDD A;  3E4Q A;  5G4Z A;  1T1B A;  4HOI A;  4LRX C;  4LPZ A;  4I38 A;  1V9Z A;  5IS1 A;  1T1C A;  5HZH A;  2PR5 A;  2W27 A;  3UB6 A;  3ULF A;  3BWL A;  3EWK A;  3GDI A;  5HWW A;  3E4O A;  1OTA A;  1NWZ A;  5DKK A;  2QHK A;  3A0R A;  1XFN A;  1LSX A;  2B02 A;  5EFW A;  4GCZ A;  5F68 A;  5HSQ A;  4H6J A;  4EEU A;  3IBR A;  2OWH A;  3UB9 A;  4L9E A;  1LT0 A;  1D06 A;  1D7E A;  4L9G A;  4HJ3 A;  4HH2 A;  1OJ5 A;  3MR0 A;  5J4E A;  1DP6 A;  4WN5 A;  1GSW A;  1TS7 A;  2QWS A;  5DJU A;  3VOL A;  1OJG A;  4HY8 A;  2CMN A;  2ZOI A;  5HWV A;  2D02 A;  4JGP A;  1T19 A;  4GHI A;  1JNU A;  2V0U A;  1GSX A;  5AVE A;  3LIF A;  5G4Y A;  2Z6C A;  1ODV A;  3H82 B;  2ZOH A;  1S1Z A;  1XJ6 A;  1G28 A;  4KQD A;  2D01 A;  4F3L A;  1T18 A;  2H28 A;  1T1A A;  3NOU C;  1OT6 A;  4EQ1 A;  3VE4 A;  1XJ2 A;  5F5Y A;  1OTD A;  5TBM B;  4RQ9 A;  2JHE A;  5IU1 A;  2PYP A;  3MQO A;  3HJI A;  4E04 A;  4JGO A;  1UGU A;  3A0V A;  1DRM A;  1WA9 A;  4F3L B;  3CAX A;  4GW9 A;  3KX0 X;  4HP4 A;  3PHY A;  3G6O A;  3LID A;  1XFQ A;  1S67 L;  4HJ6 A;  4L9F A;  3MJQ A;  4GS9 A;  3OLO A;  3LIB A;  4MN5 A;  3LI9 A;  1N9L A;  4WLA A;  3B33 A;  2L0W A;  4HQA A;  2VV8 A;  4BBV A;  1XJ4 A;  1OTE A;  2A24 A;  4I3A A;  4R3A A;  4GS9 B;  4NXB A;  1LL8 A;  3LI8 A;  2INW A;  2JN7 A;  5AVF A;  5HDC A;  3E4P A;  2A24 B;  2KX6 A;  3K3D A;  1P97 A;  3LUQ A;  4EET B;  3H7W B;  4DJ3 A;  4JGQ A;  1VB6 A;  3UMD A;  4XT2 A;  3HJK A;  1DP9 A;  4JGR A;  3UE6 A;  3MFX A;  4EES A;  2BAS A;  1P0Z A;  5F69 A;  3EEH A;  4WL9 A;  3H82 A;  4XT2 B;  2P7J A;  5KIZ A;  4NXG A;  2WKQ A;  1X0O A;  2KDK A;  4KUO A;  5TBM A;  1N9N A;  4EXO A;  1F98 A;  3F1O A;  4LRY C;  3BY8 A;  1TS6 A;  4EW7 A;  2PYR A;  4PKY G;  2QJ7 A;  3LYX A;  1LSV A;  4HHD A;  4BBU A;  2VV7 A;  2VEA A;  4LLO B;  4NXF A;  4R6L A;  3K3C A;  4HIA A;  3NHQ A;  3MQQ A;  5HWT A;  1S4R A;  3F1O B;  4I39 A;  1OTB A;  2HV1 A;  1OTI A;  4HI4 A;  3VE3 A;  3RTY A;  3FC7 A;  1S1Y A;  3ZQ5 A;  3T50 A;  3P7N A;  3C8C A;  1UWN X;  2YKH A;  4YWZ A;  4I5S A;  4HH3 A;  4BBT A;  3D72 A;  2WKP A;  3F1N B;  4WF0 A;  2OWJ A;  1DP8 A;  3PYP A;  4K08 A;  3LIE A;  3H7W A;  1V9Y A;  2VLG A;  5DJT A;  2I9V A;  2VV6 A;  3IS2 A;  3GEC A;  3BY9 A;  1KOU A;  1TS8 A;  4EER A;  2V0W A;  5J3W A;  4B9O A;  2PR6 A;  3FG8 A;  5HDS A;  4KUK A;  3UB7 A;  2W0N A; 
#chains in the Genus database with same CATH topology
 2VZW A;  5CGX A;  2R9W A;  1MKI A;  3KYQ A;  3C2W A;  4EU0 A;  1NYM A;  5GLD A;  3BQ8 A;  1WE4 A;  3LCE A;  3E2K A;  1FCM A;  4OLG A;  4WEK A;  1GSV A;  4DJ2 A;  4WM9 A;  2EFX A;  1H8Y A;  5M1A A;  2Y2N A;  5FQK A;  4RX3 A;  3SW1 A;  5CEB A;  4Y15 A;  1L3L A;  1MWU A;  3NIA A;  3UB5 P;  1OPX A;  2GNX A;  4MN6 A;  3LR4 A;  3G34 A;  3T12 B;  4UA7 A;  4HNB A;  5DF9 A;  3SH9 A;  4LRZ E;  4LCM A;  3HLE A;  4Y7P A;  1JWV A;  2BG1 A;  5DKL A;  2JE5 A;  4HJ4 A;  4X55 A;  3GVB A;  4OOL A;  3VP2 A;  5CX7 A;  1PW1 A;  2Q9M A;  5FI7 A;  2H0Y A;  1P9W A;  2ZMA A;  4PKY A;  2Y2P A;  2WAE A;  1A0K A;  3CWF A;  1ONG A;  4R70 A;  5HD3 A;  2ZC6 B;  4I3I A;  1LL9 A;  5L07 A;  1EW0 A;  4IED A;  3I7J A;  4G3K A;  4QD4 A;  2P74 A;  1TS0 A;  3LIA A;  5HPI A;  5L10 A;  2V2F F;  3WS5 A;  4R23 A;  5D3O A;  3ZG9 B;  1HD8 A;  1PWC A;  4GN2 A;  3CJM A;  3NC8 A;  3OPR A;  2ZD8 A;  2OLV A;  3KSI A;  4S2K A;  1NXY A;  1YSQ A;  2PHY A;  4YNR A;  3HUO A;  3PTE A;  3QP4 A;  2Y79 A;  4KZB A;  1KGE A;  3A3I A;  5E2G A;  3E4Q A;  3E98 A;  1K55 A;  4HOI A;  1M40 A;  3CPT A;  4DE3 A;  5AQ7 A;  4IUK A;  3SZT A;  2W27 A;  4S2N C;  3ULF A;  4LFU A;  4OOM A;  4N1X A;  5HWW A;  3E4O A;  4KZ3 A;  1K0K A;  5DKK A;  3AGF A;  3CMZ A;  3W2Z A;  1LSX A;  3W4O A;  1J9M A;  2B02 A;  2H0T A;  2J3W A;  3B3X A;  1XA1 A;  4YOF A;  3ZG5 A;  4H6J A;  1YLY A;  5CXW A;  3TJZ C;  3ZFZ A;  3UB9 A;  2XLN A;  4II7 A;  4HH2 A;  5J4E A;  3T4Q A;  1DP6 A;  3LY4 A;  2Q0O A;  2QWS A;  4GDN A;  2DRW A;  2WGW B;  5FAQ A;  3VOL A;  4HES A;  4JGP A;  4BJP A;  1T19 A;  2LB5 A;  2V0U A;  5DF7 A;  5AQ9 A;  5AVE A;  1E3U A;  1S1Z A;  1VET A;  2D01 A;  4GNU A;  4U0T A;  3DWZ A;  4MCW A;  1OT6 A;  2XA7 M;  1NRJ A;  5FAP A;  3T4J A;  5F5Y A;  4RA7 A;  5EOE A;  1JWP A;  2VGJ A;  3BYD A;  1VEU A;  4E04 A;  1MBL A;  1E25 A;  4JGO A;  4GB7 A;  1SKF A;  1CEF A;  1DRM A;  2C6W B;  2OLU A;  5FQJ A;  1K54 A;  4LEN A;  3PBN A;  4Q0I A;  3PHY A;  3OPH A;  1XFQ A;  4HJ6 A;  4K0W A;  5GLC A;  4Y2F A;  5CGS A;  3LIB A;  4MN5 A;  1XKZ A;  1PI5 A;  5E2F A;  5MC7 A;  3B33 A;  4OOY A;  1ERQ A;  1KVM A;  4R3B A;  1OTE A;  3IHA A;  3QNB A;  2FH5 A;  4PHT A;  3OC2 A;  2A24 A;  4G3W A;  4RYE A;  2EXA A;  4R3A A;  4DDS A;  3MFD A;  4OKP A;  5FEF A;  3LY3 A;  3TRC A;  3UO9 A;  4WBG A;  5FSR A;  5HDC A;  3QP2 A;  2ZQC A;  4R4R A;  3E4P A;  2Q9N A;  4DKI A;  2A24 B;  3K3D A;  1JVJ A;  3QP1 A;  4B4X A;  3H7W B;  1PRQ A;  4DJ3 A;  3UMD A;  5F82 A;  4Z1W A;  4UQI M;  1XXM A;  3TOI A;  4LV3 A;  4DXC A;  3MFX A;  3VP0 A;  4PM5 A;  2BAS A;  5FDH A;  1P0Z A;  4JF6 A;  3VFH A;  5CEC A;  1SKO A;  5CER A;  3MKF A;  2P7J A;  4MMN A;  4IJG A;  4FTX A;  3GRJ A;  2ZL1 A;  5KIZ A;  1YM1 A;  1CK3 A;  2B18 A;  3PXP A;  3VOZ A;  1K55 C;  1F98 A;  3F1O A;  4FSF A;  4LRY C;  4EW7 A;  4MBH A;  3ISG A;  2A3U A;  3BLS A;  1LSV A;  4E3J A;  2ZL1 B;  3MMH A;  3S7N A;  3KSG A;  5FEG A;  3N8R A;  4R6L A;  1H5X A;  4UAA A;  1K6R A;  3EQU A;  1GA9 A;  2AVX A;  3RJU A;  5AQB A;  3PBO A;  1S4R A;  3F1O B;  3DBA A;  4ZRR A;  1OTI A;  3CI6 A;  3DAV A;  4KZ7 A;  3VE3 A;  1NRF A;  3G4P A;  1PIO A;  1I5Q A;  2ZQ8 A;  2Y2I A;  3B42 A;  4P6Z S;  4H8R A;  1S1Y A;  3IT9 A;  3ZQ5 A;  3N8L A;  1LLB A;  2WKE A;  2XK1 A;  3OCN A;  3IF5 A;  3S1Y A;  1WYC A;  2YKH A;  1NZU A;  1BLH A;  2CC1 A;  2ZLY A;  3A3E A;  5CTM A;  3T4T A;  4OQH A;  2J3T C;  2OWJ A;  1Q2P A;  3M6B A;  3T1X A;  3A3D A;  1V9Y A;  4LV0 A;  2VLG A;  4JXG A;  5DJT A;  2I9V A;  3M2K A;  3MSH A;  3IS2 A;  3UDX A;  4EER A;  3KO6 A;  4NEE D;  4MEZ A;  2ZQA A;  3LR3 A;  4KUK A;  4ETZ A;  4KQR A;  3DTI A;  1FR6 A;  3UB7 A;  2G2W A;  4JLF A;  3FPV A;  4G3V A;  5FAS A;  3IS2 B;  2WZX A;  4OLD A;  1YPR A;  5F6A A;  3FV7 A;  2M7U A;  1BUE A;  2DCF A;  2BLS A;  4EEP A;  2HP6 A;  5EM1 A;  2R78 A;  4R38 A;  5HD5 A;  5TGF A;  3BFE A;  2W1T B;  3OZH A;  2EXB A;  3UME A;  2IWD A;  1VHM A;  2YKF A;  5CRF A;  1FR1 A;  1F9I A;  5J7E A;  5FQI A;  2QJ5 A;  4I3J A;  3RH8 B;  1S66 L;  3RXW A;  5FI2 A;  4S2O A;  2WAD A;  2VGK A;  3S22 A;  1VQQ A;  4ARZ A;  2EX8 A;  1OT9 A;  2Y55 A;  2ZBB A;  2XDM A;  3F1P A;  4KQO A;  2DNS A;  3O86 A;  1TDG A;  4JXS A;  2O9B A;  1AXB A;  3NOP C;  5M18 A;  1N9O A;  3DW0 A;  1IKI A;  4E3M A;  3F1N A;  3F1P B;  4BL3 A;  1NYY A;  2XA7 S;  4WMC D;  1JTG A;  1KE3 A;  3T4K A;  3H9W A;  5L2F A;  2V9A A;  5JYO A;  3BFC A;  2H5S A;  4IBR A;  4WZ5 C;  4X69 A;  5C5K A;  2WZZ A;  1K56 D;  2RL3 A;  1CF0 A;  4CPK A;  4D2O A;  4CJN A;  2O9A A;  5G4Z A;  4P85 A;  1OME A;  4BMW A;  4KG2 A;  4LRX C;  4ETX A;  3DTE A;  4KZ6 A;  4Q0J A;  5HAQ A;  2W3F A;  1T1C A;  1QMF A;  4CLC C;  3RFB A;  5HZH A;  2PR5 A;  3BWL A;  2XD5 A;  3EWK A;  2HGV A;  5DVA A;  4K0X A;  4GZB A;  5FA7 A;  1Z09 A;  3HLG A;  4X53 A;  4BL2 A;  1ESI A;  1NWZ A;  5L09 A;  5DTK A;  1ESU A;  3L7H A;  5EFW A;  3HUM A;  4DRT A;  1XGI A;  3KYZ A;  3GV9 A;  3O3V A;  3T4S A;  5CHM A;  3ZG7 B;  3IBR A;  5EVI D;  1YSP A;  2B95 A;  3FKW A;  4UQI S;  2WKH A;  1Y4O A;  5F1G A;  4L9E A;  4CQH A;  1LT0 A;  2GZA A;  4QB8 A;  5GLA A;  3ZG8 B;  2WYX A;  4HJ3 A;  4O0P A;  4XUZ A;  4WN5 A;  2RCX A;  1GHP A;  4Y3I A;  5F1F A;  3OPP A;  4QJG A;  4JPM A;  3KSH A;  3IXH A;  2QZ6 A;  4R3J A;  1TS7 A;  4BD1 A;  3SS3 A;  4C6Y A;  4UA9 A;  4HY8 A;  5HWV A;  2D02 A;  4MBK A;  1JNU A;  2PBD P;  1EWZ A;  3S7P A;  1ZKJ A;  1W5D A;  3UE0 A;  3H82 B;  2ZOH A;  2P9V B;  4EQI A;  3IBJ A;  3NDE A;  1T1A A;  2O9C A;  3E0Y A;  2HF6 A;  4E6W A;  5HAP A;  3NOU C;  1IEL A;  1YLT A;  4N9K A;  1J3W A;  2HP5 A;  3D9Y A;  3PBR A;  2PYP A;  2Y2J A;  2VGL S;  4E3L A;  3HJI A;  3VV4 A;  3R7W A;  3NUL A;  4X6T A;  1WA9 A;  3TG9 A;  3U4L P;  4OP5 A;  4GW9 A;  1XX2 A;  3TW8 A;  2DMW A;  3BEB A;  4QHC A;  3IXD A;  1F2K A;  1TD5 A;  4DE2 A;  3OLO A;  1CI8 A;  3R7W B;  1N9L A;  3V39 A;  1JWZ A;  4K91 A;  1NLY A;  4HQA A;  2HPB A;  1EI5 A;  2VV8 A;  4KG5 A;  4EBP A;  4O01 A;  1KE4 A;  3VMA A;  3O87 A;  4OVD A;  2O99 A;  1LL8 A;  4Y5F A;  3HRE A;  3WS2 A;  1F5M A;  1FOF A;  4DDY A;  4ZJ2 A;  5FAT A;  2V8F A;  4E3I A;  3KSF A;  3WRT A;  1ES3 A;  2KX6 A;  2E8J A;  3ITB A;  5KZH A;  3GR2 A;  3M6H A;  4GD8 A;  2PAV P;  3MZE A;  4F94 A;  1BZA A;  1D1J A;  4ID4 A;  4XT2 A;  2EFU A;  4JGR A;  2JKT I;  4EUZ A;  4GLQ A;  2WGW A;  5FDS A;  4MLL A;  5F69 A;  2XRO A;  2JKR M;  4XT2 B;  4X68 A;  3Q81 A;  4KZ8 A;  5CGW A;  2ZC5 B;  3DWK A;  1QME A;  3V5M A;  1XP4 A;  3D4F A;  4YIN A;  2PYR A;  4HHD A;  4MNR A;  2VV7 A;  3RXX A;  3IXB A;  5HAR A;  3UPO A;  3OPL A;  4KQQ A;  4NXF A;  4FD8 A;  3NHQ A;  3VOY A;  3SH8 A;  1K6S A;  2K2N A;  5HWT A;  3PBQ A;  5HL1 A;  1STZ A;  1NLZ A;  4HI4 A;  4S2J A;  1PNE A;  4N92 A;  3PAE A;  5L8M A;  4Q8I A;  2V1Z A;  4MDZ A;  5J8X A;  3K2N A;  2EX2 A;  3ZVW A;  4L0L A;  2GDN A;  4MBF A;  3IWO A;  1U60 A;  2M7V A;  3P7N A;  4KZ5 A;  4BEN A;  3C8C A;  1UWN X;  5DFY A;  3N6I A;  5E2H A;  1SDN A;  3NEC A;  2HP9 A;  3TSG A;  5FI6 A;  2XR0 A;  3BFF A;  1HLU P;  2W3E A;  4WF0 A;  1DP8 A;  4K08 A;  5EM0 A;  3H7W A;  3HLF A;  3MS6 A;  5G18 A;  1G6A A;  4LV1 A;  1GHM A;  4WMC A;  1DJB A;  3QHY A;  3UY6 A;  1KVL A;  4B9O A;  2JKG A;  1SDE A;  2PR6 A;  3FG8 A;  1YQS A;  2X71 A;  3EEA A;  1I2W A;  5U47 A;  2EX9 A;  3SS4 A;  1K4E A;  1ES2 A;  3HBR A;  5HL6 A;  2W0N A;  4NG2 A;  3IH9 A;  1DJC A;  4M3K A;  1K56 A;  4XXR A;  2K31 A;  1MY8 A;  2Y2L A;  3HLB A;  5M19 A;  2PDR A;  1Q2Q A;  2WGI A;  3NOT C;  1PZP A;  2Y8H A;  3NJA A;  2Z2L B;  2VX8 A;  4HP9 A;  3ZNY A;  1MWS A;  3VSL A;  2PU2 A;  4E3K A;  1ZC2 A;  2V1A A;  2VJW A;  2ZM8 A;  2PD7 A;  2Y2Q A;  4PM6 A;  4X1L A;  1S4S A;  1XJ3 A;  3UE3 A;  3CUE A;  3C30 A;  3A0S A;  3IHB A;  2EA9 A;  1ALQ A;  1FSW A;  4NXE A;  3IF6 A;  4Z9Q A;  4WUJ A;  3NBL A;  3ITA A;  3WS4 A;  4ZTK A;  3DTK A;  3GTC A;  3ICY A;  5EVI A;  4QY5 A;  1YMS A;  3UN7 A;  3EQV A;  3V3R A;  4DE1 A;  4UEY A;  2QKP A;  2PBY A;  3MZF A;  3QP6 A;  3IF6 B;  4GHI B;  5K5B A;  3ZDJ A;  2K7S A;  5EVI B;  3MXQ A;  5GLB A;  4QWO A;  1NJ4 A;  2XH9 A;  1IYQ A;  4EBN A;  4Y0U A;  2M1C A;  2V1B A;  3LIC A;  4S2P A;  1SHV A;  1IYP A;  3SS5 A;  2EWW A;  3NCK A;  2ZQD A;  5FQQ A;  4M4X A;  4OPR A;  4ZBE A;  4ZDX A;  1YLJ A;  4O8G A;  1IYS A;  4BLM A;  4LPZ A;  2WGV A;  3FZC A;  2GX5 A;  3BLM A;  1V9Z A;  5IS1 A;  2PU4 A;  4RVA A;  1HTZ A;  3UB6 A;  4A5R A;  2XGN A;  1IOU A;  2W1T A;  3MZD A;  4DF6 A;  4EUV A;  1W8Q A;  2J3T D;  2QHK A;  3B47 A;  4R1G A;  3Q1F A;  1DY6 A;  4E3N A;  3IX4 A;  1PZO A;  1K54 C;  5F68 A;  5HSQ A;  4FCF A;  3NY4 A;  1TDL A;  4DN0 A;  2OWH A;  1NY0 A;  4FUW A;  1BLS A;  1D7E A;  2HJE A;  4L9G A;  5FAO A;  1L0F A;  5HPF A;  5EV0 A;  5GHY A;  4HBU A;  1W8Y A;  5EPH A;  5DJU A;  1JTD A;  4GKU A;  1FQG A;  4PM7 A;  4WEL A;  2CMN A;  4P0M A;  5CHU A;  1GSX A;  2ZQ7 A;  1CEG A;  4N9L A;  3LIF A;  3IQA A;  2ZM0 A;  2Z6C A;  4ESP A;  2HDU A;  1FCO A;  3ZGA B;  3OOV A;  3C38 A;  1XJ6 A;  1G28 A;  4KQD A;  4F3L A;  1N4O A;  5AJG A;  1XPB A;  2JC7 A;  3OCL A;  2X02 A;  3IXG A;  2VKS A;  3G32 A;  1LI9 A;  4LV2 A;  4S2N A;  1ACF A;  1YKD A;  4EQ1 A;  4FH4 A;  2HDR A;  4IBX A;  5TBM B;  4BQM A;  3NDG A;  3MQO A;  4IUH A;  1UGU A;  4F3L B;  2VK3 A;  3CAX A;  4Y17 A;  1ES5 A;  1BLP A;  1ERO A;  3FKV A;  4IVI A;  3KX0 X;  4HP4 A;  3G6O A;  1FCN A;  1YMX A;  4GD6 A;  3O5Y A;  4GDB A;  2J9O A;  4GS9 A;  1AWI A;  4PPR A;  1CQA A;  1ZHH B;  2ZC4 B;  2E8I A;  3HUN A;  3C4P A;  3BM6 A;  5AQA A;  3TE8 A;  3JVU A;  3ZG0 A;  3AGE A;  3DTM A;  1HVB A;  4GS9 B;  3M2J A;  4NXB A;  5GHZ A;  2INW A;  2JN7 A;  1H8Z A;  3N4I A;  1MXO A;  2P08 A;  5EVI C;  1IYO A;  1PWG A;  2Y2O A;  3WRZ A;  3C7V A;  3IX3 A;  3LEZ A;  4PM8 A;  3Q7V A;  4PAU A;  3E2L A;  1BTL A;  4D60 A;  3AGD A;  1P97 A;  3WS1 A;  5CHJ A;  3LUQ A;  2WK0 A;  4S2I A;  2ZC7 A;  1VB6 A;  1PI4 A;  1L0D A;  1VM1 A;  2V8C A;  3BW6 A;  4Y0O A;  3UE6 A;  1ES4 A;  3Q7V B;  2WUQ A;  4N1H A;  1MC0 A;  1IEM A;  1WYB A;  3HCY A;  4FH2 A;  3UPP A;  4U3T A;  2PT7 A;  4CLC D;  3GMW A;  1PWD A;  2QYB A;  4FOF A;  3SH7 A;  2OSU A;  4WL9 A;  2ZJ9 A;  3H82 A;  5IT5 A;  2P9V A;  4ZJ1 A;  3JYI A;  5HX9 A;  2FZ0 A;  3MF0 A;  1KDW A;  2QPN A;  1X0O A;  5EVL A;  3U2A A;  4KUO A;  4OP8 A;  1N9N A;  4EXO A;  3IH8 A;  1YLP A;  3EGD C;  1W79 A;  4PKY G;  2QJ7 A;  3LYX A;  1YLZ A;  2J9P A;  4JKT A;  4O7D A;  2VEA A;  2R9X A;  4LLO B;  4KZ4 A;  5JYP A;  4DXB A;  3K3C A;  1GCE A;  3MQQ A;  4OQI A;  1KGG A;  4PMA A;  4RX2 A;  4Q0H A;  2HV1 A;  1TF1 A;  4NK3 A;  2UV0 E;  2XRN A;  5HFO A;  2XFS A;  3P01 A;  3O88 A;  3T1Q B;  3RTY A;  1CJF A;  4P6Z M;  1BT5 A;  3IWI A;  4OPY A;  2OV5 A;  4C75 A;  2IWC A;  4DMZ A;  2XF3 A;  3T50 A;  5EEC A;  3W4Q A;  3G2Y A;  1IKG A;  3GQZ A;  2HDS A;  4IHQ A;  3LFV A;  3KYE A;  4YWZ A;  4I5S A;  4HH3 A;  2JCH A;  4BBT A;  4UA6 A;  3ZYT A;  2WKP A;  3FYZ A;  4E3O A;  3LIE A;  2J8Y A;  3QNC A;  3BEC A;  2VV6 A;  3ZCZ A;  3ZNT A;  4HBT A;  3T1S A;  5BOH A;  3WWX A;  1ERM A;  3D3O A;  5HDS A;  1MWR A;  5GHX A;  4WEJ A;  2Y4A A;  4R4S A;  3V50 A;  4BWI A;  2FFY A;  3PR6 A;  1BYW A;  2XQZ A;  2ZMF A;  1C3B A;  1LL5 A;  2JBF A;  4S2M A;  4AFI A;  3CPT B;  3PBS A;  4B93 A;  3C4O A;  5F83 A;  3NI9 A;  4JBF A;  2I72 A;  3MXR A;  2W3G A;  1H3Q A;  1MPL A;  4IVK A;  5DTS A;  2ZMV A;  1FIL A;  2Z6D A;  3VFF A;  3VP4 A;  1RP5 A;  3GSG A;  1SCW A;  2WKR A;  5A8B A;  4H6J B;  1Y28 A;  1MWT A;  3WS0 A;  1P9R A;  2Y2G A;  3LR0 A;  3MBZ A;  5EE8 A;  1UWP X;  2GJ3 A;  3G31 A;  5DTT A;  3CZD A;  1MZU A;  1TVF A;  4U0X A;  2IWB A;  2P04 A;  3G35 A;  2IA2 A;  4P6B A;  4JF4 A;  4E6X A;  3S4X A;  3N7W A;  3VSK A;  1W63 Q;  2J80 A;  1L0G A;  1O07 A;  5TR7 A;  3Q7Z A;  1ZG6 A;  2PRF A;  1K25 A;  4B88 A;  2W1R A;  3BQA A;  2HZ5 A;  4JXW A;  5DFX A;  1O7E A;  3CLO A;  1M6K A;  4CLC E;  2L1M A;  4NET A;  2WKI A;  4OPQ A;  3QP8 A;  4XUX A;  5I5L A;  3UB8 A;  1VET B;  2OOL A;  2PD8 A;  1ONH A;  3FPW A;  3FWL A;  3ZHH A;  4Y0T A;  2L4R A;  3N8S A;  2XFT A;  1LSW A;  1PW8 A;  1VEU B;  5A91 A;  4KEN B;  5HDD A;  5KSC A;  2NUT C;  3L9K A;  3V67 A;  3PAG A;  1T1B A;  4R0Q A;  2WAF A;  4I38 A;  3C5A A;  5DF8 A;  2ZQ9 A;  1KDS A;  2Y59 A;  3Q82 A;  3T4L A;  2Y91 A;  3GDI A;  2KOI A;  1HZO A;  1OTA A;  3A0R A;  1XFN A;  2OAP 1;  1TEM A;  3BJN A;  3V3S A;  4GCZ A;  1L0E A;  4OQ0 A;  4ZAM A;  4QPR A;  4EWF A;  3LGO A;  4EEU A;  4NKP A;  4JF5 A;  3EOI A;  1D06 A;  4KZA A;  2UWX A;  1OJ5 A;  4WZ5 A;  4ME4 A;  3MR0 A;  2XSS A;  2QMI A;  1Z6F A;  2LB9 A;  3ZVT A;  2OAQ 1;  1GSW A;  3S7Q A;  1K57 A;  1KGF A;  4KG6 A;  3A3J A;  1BUL A;  2X01 A;  1OJG A;  4X56 A;  2ZOI A;  4GHI A;  1GA0 A;  2XEP A;  5A93 A;  1SKO B;  5G4Y A;  4X1M A;  3CHW P;  3BRM A;  1ODV A;  3JPU A;  2HJ9 C;  3MQ0 A;  3G2Z A;  2ZM2 A;  1T18 A;  2H28 A;  5A90 A;  4OQG A;  1W7F A;  4CLC A;  4B4Z A;  1LHY A;  3HLW A;  1NZO A;  4C3Q A;  3VE4 A;  3OBF A;  5FL3 A;  1XJ2 A;  5A92 A;  2G2U A;  1OTD A;  2A49 A;  4GJ4 A;  4RQ9 A;  2JHE A;  5FQM A;  1FIK A;  5IU1 A;  2VGL M;  1N9B A;  5E2E A;  2HDQ A;  3A0V A;  1BSG A;  4CLC B;  5EOO A;  5I94 A;  1YAX A;  3LID A;  1S67 L;  4L9F A;  1H0M A;  3MJQ A;  2J7V A;  2W3H A;  1ZTU A;  2C5W B;  1KE0 A;  3LI9 A;  2O0Y A;  4WLA A;  2MJ6 A;  2L0W A;  5KMW A;  1BLC A;  1XJ4 A;  4BBV A;  2Y2K A;  3HVF A;  3VP3 A;  3IX8 A;  4BD0 A;  1K4F A;  3SOI A;  4I3A A;  1H8M A;  1K38 A;  3EGX C;  1RCJ A;  2ACG A;  3LI8 A;  5TJJ A;  2JKR I;  5AVF A;  1CI9 A;  4MN7 A;  2VA0 A;  3A3F A;  3QP5 A;  1Y54 A;  4EET B;  4JGQ A;  4LGW A;  3T4O A;  1PYY A;  3BFG A;  3HJK A;  5FQ9 A;  1XGJ A;  2JKF A;  1DP9 A;  3S7O A;  1E3U D;  2BTF P;  3LR5 A;  4EES A;  2W3D A;  4HEF A;  5E43 A;  1XA7 A;  3EEH A;  4GOG A;  3JVV A;  3MKE A;  3LO7 A;  4DE0 A;  3CG5 A;  4QU3 A;  5KSH A;  3W8K A;  1S0W A;  4NXG A;  3IWQ A;  2H10 A;  4X25 A;  1IFQ A;  2WKQ A;  1DJA A;  3G30 A;  2KDK A;  1ZG4 A;  2EX6 A;  1I2S A;  3UE1 A;  1YLW A;  1YT4 A;  2JKT M;  2EWV A;  5TBM A;  3BY8 A;  1TS6 A;  2V20 A;  3T1R A;  4BBU A;  1SZV A;  4QY6 A;  3BFD A;  2XD1 A;  4EBL A;  3P98 A;  5EVE A;  4PM9 A;  4HIA A;  4OON A;  1S6R A;  3HLC A;  2B5R A;  4WYY A;  4I39 A;  4ZJ3 A;  1LI0 A;  1G5U A;  1OTB A;  3MXS A;  3VP1 A;  4UHU A;  5CED A;  5HW3 A;  5LBR A;  3P09 A;  1FSY A;  4WZ4 A;  3FC7 A;  2NUP C;  4ARZ B;  3CIT A;  1E4D A;  1G6O A;  1L2S A;  3Q07 A;  3UDI A;  2FFF B;  4LCL A;  3LEQ A;  3C7U A;  1W63 M;  5IHV A;  2KLI A;  3HLD A;  3W4P A;  3D72 A;  5TFQ A;  4OPZ A;  3PBT A;  3F1N B;  5GL9 A;  3R4K A;  3UPN A;  3CUE C;  1K57 C;  4JXV A;  3PYP A;  1GHI A;  3UDF A;  2G7U A;  3IF6 C;  5EUA A;  4P87 A;  4S2L A;  4OH0 A;  2Y2M A;  1G68 A;  1MKM A;  2ZC3 B;  2Y2H A;  3GEC A;  3BY9 A;  1KOU A;  4YFM A;  1TS8 A;  4KZ9 A;  2V0W A;  4Y13 A;  5HAI A;  1RGZ A;  1PFL A;  5J3W A;  5CTN A;  2A2L A;  1RGY A;  4EV4 A;  3HL9 A;  2Z2M B;  3UNW A; 
#chains in the Genus database with same CATH homology
 3IS2 B;  2VZW A;  1BYW A;  2ZMF A;  5F6A A;  3KYQ A;  3C2W A;  4AFI A;  4EU0 A;  2M7U A;  2K31 A;  3BQ8 A;  3PBS A;  4B93 A;  2PDR A;  4WEK A;  1GSV A;  4DJ2 A;  4EEP A;  2R78 A;  3NOT C;  4R38 A;  5HD5 A;  2W3G A;  1H3Q A;  2Y8H A;  3SW1 A;  3NJA A;  2W1T B;  2VX8 A;  4HP9 A;  2ZMV A;  2Z6D A;  3UME A;  1VHM A;  2YKF A;  2V1A A;  1OPX A;  2GNX A;  2VJW A;  4MN6 A;  3LR4 A;  1F9I A;  2WKR A;  5J7E A;  2PD7 A;  5A8B A;  4HNB A;  2QJ5 A;  5DF9 A;  1S4S A;  1XJ3 A;  4H6J B;  4I3J A;  3RH8 B;  3UE3 A;  1S66 L;  1Y28 A;  4LRZ E;  1P9R A;  3LR0 A;  3CUE A;  5DKL A;  3C30 A;  1UWP X;  2GJ3 A;  4ARZ A;  3A0S A;  1OT9 A;  2EA9 A;  1MZU A;  2ZBB A;  4HJ4 A;  4NXE A;  4OOL A;  4WUJ A;  3F1P A;  4KQO A;  5CX7 A;  2P04 A;  2IA2 A;  3ICY A;  1P9W A;  2O9B A;  4PKY A;  3NOP C;  3CWF A;  3EQV A;  1W63 Q;  2J80 A;  4R70 A;  4UEY A;  5HD3 A;  2QKP A;  1N9O A;  4I3I A;  1EW0 A;  2W1R A;  3BQA A;  5DFX A;  3F1N A;  3CLO A;  4G3K A;  3F1P B;  4GHI B;  2XA7 S;  5K5B A;  1TS0 A;  3T4K A;  2K7S A;  4CLC E;  2L1M A;  3H9W A;  3LIA A;  5HPI A;  2V9A A;  5I5L A;  3MXQ A;  3UB8 A;  2OOL A;  2PD8 A;  3FPW A;  2M1C A;  2L4R A;  3KSI A;  5C5K A;  2V1B A;  3LIC A;  1LSW A;  1YSQ A;  2PHY A;  4YNR A;  2EWW A;  2Y79 A;  4M4X A;  2O9A A;  5HDD A;  3E4Q A;  5G4Z A;  2NUT C;  4O8G A;  3V67 A;  3E98 A;  4BMW A;  1T1B A;  4HOI A;  4LRX C;  4LPZ A;  4ETX A;  4Q0J A;  2GX5 A;  4I38 A;  1V9Z A;  2W3F A;  5IS1 A;  1T1C A;  4IUK A;  3RFB A;  4CLC C;  5HZH A;  2PR5 A;  2W27 A;  3UB6 A;  3ULF A;  3BWL A;  4OOM A;  3EWK A;  2HGV A;  3T4L A;  1IOU A;  2W1T A;  3GDI A;  4EUV A;  5HWW A;  2KOI A;  3E4O A;  3PR6 A;  1OTA A;  2J3T D;  1NWZ A;  5DKK A;  2QHK A;  3B47 A;  3A0R A;  1XFN A;  3W2Z A;  1LSX A;  2OAP 1;  3BJN A;  2B02 A;  5EFW A;  4GCZ A;  2J3W A;  4YOF A;  5F68 A;  3KYZ A;  5HSQ A;  4H6J A;  4QPR A;  3T4S A;  4EEU A;  3IBR A;  4NKP A;  1YSP A;  3TJZ C;  4DN0 A;  4UQI S;  3EOI A;  2OWH A;  3UB9 A;  4L9E A;  4CQH A;  1LT0 A;  2GZA A;  1D06 A;  1D7E A;  2HJE A;  4II7 A;  4L9G A;  4HJ3 A;  4HH2 A;  1OJ5 A;  4O0P A;  4ME4 A;  3MR0 A;  5J4E A;  2XSS A;  5HPF A;  3T4Q A;  1DP6 A;  2LB9 A;  4WN5 A;  2OAQ 1;  4Y3I A;  1GSW A;  3S7Q A;  3KSH A;  1TS7 A;  2QWS A;  5DJU A;  3VOL A;  1OJG A;  4HY8 A;  4WEL A;  2CMN A;  2ZOI A;  5HWV A;  2D02 A;  4JGP A;  4BJP A;  1T19 A;  4GHI A;  1JNU A;  2LB5 A;  2V0U A;  1GSX A;  3S7P A;  5AVE A;  3LIF A;  5G4Y A;  2Z6C A;  1ODV A;  3MQ0 A;  2HJ9 C;  3H82 B;  2ZOH A;  1S1Z A;  3OOV A;  3C38 A;  1XJ6 A;  1G28 A;  4KQD A;  3IBJ A;  2D01 A;  4F3L A;  1T18 A;  2H28 A;  5AJG A;  3OCL A;  1T1A A;  2O9C A;  3E0Y A;  2HF6 A;  2VKS A;  4CLC A;  4MCW A;  3NOU C;  1OT6 A;  2XA7 M;  1YKD A;  4EQ1 A;  3VE4 A;  1NRJ A;  3OBF A;  5FL3 A;  1XJ2 A;  3T4J A;  5F5Y A;  1OTD A;  5TBM B;  4GJ4 A;  4RQ9 A;  2JHE A;  5IU1 A;  2VGL M;  3PBR A;  2PYP A;  2VGL S;  3MQO A;  3HJI A;  3VV4 A;  4E04 A;  4IUH A;  3R7W A;  4JGO A;  1UGU A;  3A0V A;  1DRM A;  1WA9 A;  4F3L B;  3CAX A;  4GW9 A;  3KX0 X;  4CLC B;  3PBN A;  3TW8 A;  2DMW A;  4Q0I A;  4HP4 A;  3PHY A;  3G6O A;  1YAX A;  1XFQ A;  1S67 L;  3LID A;  4HJ6 A;  4L9F A;  3MJQ A;  3O5Y A;  1TD5 A;  4Y2F A;  4GS9 A;  3OLO A;  2W3H A;  1ZTU A;  3LIB A;  4MN5 A;  3R7W B;  3LI9 A;  5MC7 A;  1N9L A;  2O0Y A;  4WLA A;  1ZHH B;  3B33 A;  2MJ6 A;  2L0W A;  1NLY A;  4HQA A;  2VV8 A;  4BBV A;  1XJ4 A;  1OTE A;  4O01 A;  3TE8 A;  3JVU A;  2FH5 A;  4PHT A;  3OC2 A;  2A24 A;  4G3W A;  4I3A A;  1H8M A;  4R3A A;  4GS9 B;  2O99 A;  4NXB A;  1LL8 A;  3EGX C;  4Y5F A;  3LI8 A;  2INW A;  2JN7 A;  1F5M A;  3TRC A;  5TJJ A;  2P08 A;  2JKR I;  5AVF A;  3KSF A;  5HDC A;  4MN7 A;  2VA0 A;  4PAU A;  3E4P A;  2A24 B;  2KX6 A;  3K3D A;  1P97 A;  3LUQ A;  4EET B;  3H7W B;  4DJ3 A;  4JGQ A;  1VB6 A;  3T4O A;  3UMD A;  4XT2 A;  3HJK A;  1DP9 A;  4JGR A;  4Z1W A;  2JKT I;  4UQI M;  3S7O A;  3BW6 A;  3UE6 A;  4GLQ A;  3MFX A;  1MC0 A;  3LR5 A;  3HCY A;  4EES A;  2BAS A;  2W3D A;  1P0Z A;  5F69 A;  2XRO A;  2PT7 A;  4CLC D;  2JKR M;  3EEH A;  2QYB A;  3JVV A;  4FOF A;  4WL9 A;  3H82 A;  4XT2 B;  5IT5 A;  2P7J A;  4MMN A;  4IJG A;  5KSH A;  5KIZ A;  2FZ0 A;  4NXG A;  3MF0 A;  1IFQ A;  2WKQ A;  1X0O A;  2B18 A;  3PXP A;  2KDK A;  3U2A A;  4KUO A;  5TBM A;  2JKT M;  1N9N A;  2EWV A;  4EXO A;  1F98 A;  3F1O A;  4FSF A;  4LRY C;  3BY8 A;  1TS6 A;  4EW7 A;  3EGD C;  2PYR A;  4PKY G;  2QJ7 A;  3LYX A;  1LSV A;  4HHD A;  4BBU A;  2VV7 A;  3MMH A;  2VEA A;  3S7N A;  3KSG A;  4LLO B;  4NXF A;  4R6L A;  3K3C A;  4HIA A;  3EQU A;  3NHQ A;  3MQQ A;  2K2N A;  3PBO A;  5HWT A;  1S4R A;  3F1O B;  4I39 A;  1OTB A;  3PBQ A;  3DBA A;  2HV1 A;  4Q0H A;  1STZ A;  1NLZ A;  1OTI A;  1TF1 A;  3CI6 A;  4HI4 A;  4ZRR A;  3VE3 A;  5LBR A;  2XRN A;  3P01 A;  5L8M A;  4MDZ A;  3RTY A;  3K2N A;  3B42 A;  3FC7 A;  4P6Z M;  2NUP C;  4ARZ B;  4P6Z S;  3CIT A;  1S1Y A;  4DMZ A;  4L0L A;  3ZQ5 A;  1G6O A;  2M7V A;  3T50 A;  3P7N A;  3C8C A;  1UWN X;  3OCN A;  5DFY A;  4IHQ A;  2YKH A;  1W63 M;  3LFV A;  4YWZ A;  4I5S A;  4HH3 A;  2KLI A;  4BBT A;  3ZYT A;  3D72 A;  2WKP A;  3PBT A;  3F1N B;  3T4T A;  3R4K A;  2J3T C;  2W3E A;  3CUE C;  4WF0 A;  2OWJ A;  1DP8 A;  3PYP A;  4K08 A;  3LIE A;  3H7W A;  1V9Y A;  2G7U A;  2VLG A;  5DJT A;  2I9V A;  2VV6 A;  3IS2 A;  1MKM A;  3GEC A;  3BY9 A;  1KOU A;  1TS8 A;  4EER A;  3KO6 A;  2V0W A;  4NEE D;  3D3O A;  5J3W A;  4B9O A;  2A2L A;  2PR6 A;  3FG8 A;  5HDS A;  4WEJ A;  3LR3 A;  3EEA A;  4KUK A;  4ETZ A;  4BWI A;  5HL6 A;  3UB7 A;  2W0N A;  3FPV A;  4G3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...