4K0KF

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k0kF00
4DR5F 4DR6F 1CQNA 4JI4F 4DV6F 4JV5F 2VQEF 4GKJF 4LFAF 2YY3A 4NXMF 1B64A 1GH8A 2BVZA 4B3SF 4JI5F 4LF5F 1XNRF 4YY3F 4JI3F 1HNXF 4OX9F 4X64F 2HHHF 4DR2F 1XMOF 1HNWF 4NXNF 2B7CB 4JYAF 2J5AA 4GKKF 1FKAF 4DV3F 4X62F 4LFBF 1N32F 1QJHA 4B3RF 4JI6F 2UXDF 4DV1F 4DV5F 3T1YF 2UUAF 4LF9F 1G1XA 5LMNF 4DV4F 2E5LF 5AJ3F 2ZM6F 4B3MF 1F60B 2KJVA 5BR8F 1J5EF 4DUYF 2RJZA 2VQFF 1IJEB 1G7CB 1IJFB 3ZZPA 2UXCF 4JI7F 4LF4F 4JI8F 2KJWA 4B3TF 2F4VF 1VMBA 2UU9F 1IBLF 4YHHF 1N36F 1N33F 4KHPF 4DR7F 4DR3F 4AQYF 3T1HF 4LF6F 4DR4F 4X65F 4DV2F 1IBMF 2UUCF 4K0KF 4JI2F 4DUZF 1LOUA 5LMUF 4LF8F 1XNQF 4DV7F 1FJGF 1I94F 1HNZF 4X66F 3OTOF 2UXBF 2B7BB 1HR0F 4JI1F 1N34F 4JI0F 4LFCF 4DV0F 1XMQF 3R3TA 1RISA 1IBKF 5IWAF 1CQMA 2BXJA 4LF7F 2UUBF 4DR1F
chains in the Genus database with same CATH superfamily
2M4MA 1U48A 2Q6BA 1RTJA 4KQZA 1JK9B 1WKKA 1WF1A 3BH6B 4FKYA 5K8NA 2XS2A 1IM4A 1EQ0A 5IT0A 2KH9A 3OXFA 3UDCA 4M94A 2AHOB 4USHA 1KTVA 1VC5A 3DOMB 1GMVA 2XZWA 1H98A 5HQMA 3KWMA 4DL5A 5LL6d 2FC8A 2D3ZA 4PWDB 1MSWD 2HQDA 1MWZA 1YBUA 2B6AB 2Z8QA 1H72C 1TU0B 4ES3A 1UVMA 3M8RA 2GAGC 2D74B 1YJUA 1N5VA 1EHWA 1HD0A 1QE1B 1JKHB 1S9GA 1V5IB 2PEHA 3A3PB 3LP2B 4I56A 4WKYA 4PQUB 3GIMA 3CMAS 4LF6J 3SDEA 3I56S 2B9WA 2BMBA 3UCZP 2AKWB 4NEYA 1R8BA 2VPXB 4ZOSA 3CT9A 3J7A1 4JUZA 4O4RA 2APOA 3M7VA 1HI8A 4IR9A 2WVBA 2J0WA 1S5ZA 2BJ8A 2MZQA 4ALZA 1K73T 2AW0A 5KTQA 3Q2TC 4L72B 3F41A 2MB0B 4J9PA 3DYAA 4Y28C 1RWVB 2L9DA 5IM0B 2HNDB 4ED3A 1YI2S 4N77A 5KT6A 1Q81T 4DV5F 1E6YA 3F73A 2CQ2A 1ZAWA 1LWCA 2HIQA 4F4KA 5BYQA 1EQMA 4KV8B 3NMAA 3MAAA 4OZ5A 1J5OA 2CJAA 1VRUB 3EZUA 4LJMA 1FTRA 1K8AT 3DRSA 4J9KA 4J9LA 1U1PA 4ED7A 4YB1P 1BUXA 4FYVB 1CLFA 4V19X 4EUVA 4PQAA 4GVBB 2WBMA 3FCVA 4Y2KA 2DNOA 2JVRA 4IO1A 2RDDA 3IP0A 3MAAB 3VHQA 3W65A 2O67A 3PCOB 4I68A 3NCQA 4DEZA 1NK8A 4P52A 1IKWA 3N28A 3ZZPA 3DLKB 5GAEU 3EWGA 1ZZNA 1RHKB 4TU9A 2JHEA 5KT7A 2F9DA 3IG1B 3CTRA 2LVWA 3D5MA 1RTIA 1CJTA 4OI4A 2DRAA 4MJKA 1D8YA 2V94A 3C6TB 4LF4J 5K9FA 1R8AA 3CC4S 1G2EA 2DHHA 3D66A 3JSRA 2YVSA 3IA0A 1C1BA 1IM6A 3GJQB 3I0RB 3MMBB 3DLEB 4J90A 2IRXA 4NMLA 4Y0FA 1U1RA 1UA0A 4FPIA 1UJ6A 1V9OA 4MIAA 1JLQB 1UW9A 8RUCA 1RBLA 2VJVA 2FD2A 3ZZTA 3FSYA 4DR3F 1KEKA 1YJTA 4DS4A 5FDLB 3AD7C 3T1HF 3V6DA 1DLOA 4DV1J 5KFEA 1A6LA 2EFNA 2KVIA 7FDRA 1NK6A 5CAAA 2DNMA 2HNYA 2DR5A 1GTHA 2HQIA 2DRBA 2MSSA 4UOGA 1J5OB 1O0PA 1SUQB 2LEAA 2LA6A 1HL6A 1Y5NB 2W01A 5KFHA 2BJDA 5HJYA 1ZAVA 2KRBA 3Q8SB 1FESA 3KJFB 4H4MA 4ID5A 4BWJA 3BQ0A 3V6DB 4B9NA 1SQEA 5GADI 4IFVB 4ZHRA 3M32A 2YQ0A 3G2XA 2HW3A 4EWTA 2L9WA 2YNIB 1GAOA 3OT9A 2MQQA 1N48A 1D9DA 2AT1B 1O8BA 3R5BA 2CJ9A 1N0VC 1KRPA 3RR8A 3G71S 4C9DA 1WG1A 3TAPA 3CDUA 4K4UA 2VA3A 1SJ3P 3GB0A 4YQWA 1RTHB 2OD4A 5ETMA 3T9NA 3W62A 3NMRA 2XMMA 3TO8A 4AD6A 4LF7J 2AF6A 2JZ5A 1ICEB 4IKAA 4IG3A 5CA5A 2R8HA 3M2UB 3NCRA 3DOKB 2ADCA 3KLEA 3CDWA 1VDHA 4DS5A 1IKVA 3PW2A 2MGZA 3K5LA 1NU4A 2OO4A 2YY3A 4IOCQ 3VGVA 3X1LB 2K1RB 3IWXA 2NSBA 2QLJB 4RW4B 1NDCA 1CJKB 2VBXA 3W2WA 4X4QA 2IRYA 4YY3F 3PJXA 3OL8A 3OJSA 3DXBA 5IQ6A 4KB7A 2YH1A 2HZVA 1FA0A 1MROA 2MQNA 1BXNA 2V8VA 1NM2A 5DDPC 1M1GA 2V2QA 4NASA 4RU9A 4OZ2A 2RRBA 3R2CJ 1KHVA 2VF3A 1RE1B 1NUEA 2CZ9A 2DGQA 2KRRA 3ITHA 4OYWA 1HIYA 4F25A 3PX4A 1D9FA 2CFXA 5I3QA 1VHIA 5I4MA 2QEXS 4DMZA 5ADZA 2PFFB 1Z2LA 4DPUA 4C8MA 4KGKA 3MR7A 1RT4B 2I2YA 1AROP 1PIEA 2WRMA 2XMJA 2OEJA 4WU3A 4X62F 1FVSA 3TAMB 1DHMA 3LH2S 1V3ZA 3MD1A 4ILRA 2CQDA 5LJ3Y 1SC4B 2ALZA 4U7UD 1CJVA 3R7BB 1LK7A 4IG0A 4CO4A 1VR6A 2D9OA 5B0CA 1RWUA 1WHVA 1M90T 3G8QA 1BQXA 1RWOB 3H59A 4LREA 5L9NA 2ZH3A 2BW7A 1WKLA 3KLHB 4OV6A 4K4XA 1X4BA 1Q8LA 1SV5B 3B78A 2A6MA 2RF2A 3IC1A 3H8YA 3SQGB 2WVCA 5CYMA 3L4BC 2W4CA 4MKAA 3PY8A 4URGA 2PDAA 1XK8A 1TR0A 2OKQA 4YR0A 4M5DB 2BOAA 1CULB 4Z7YA 4ANEA 5HP1B 2JC1A 4HACA 1AYEA 3TUPA 4M8LA 3T9ZA 2IM0A 1GQEA 4U8VA 4I67A 1XQIA 1HW9A 3FK4A 2XC9A 3Q23A 2CNNB 2H5IB 3LP1A 4HH0A 4NLYA 1IVZA 4C48A 2KZZA 1MWYA 4LRFA 5C24B 4JI7F 3QAEA 4F4AA 4H4OB 2GJIA 1O5JA 3KLVA 2BDPA 4Q0BA 4FVMA 2KHCA 4QIWD 2H51B 4A47A 3WX8A 1HI1A 2NYHA 4YDXA 1XC9A 4FF4A 3MZIA 3EGZA 4ZJQA 1CJUB 2DGXA 3HULA 4LR8A 3J7YI 1S0NA 2XHWA 1ELOA 3E01B 2ZH5A 1LW2B 3NGDA 1TK8A 5KFUA 1KDNA 4OHVA 4FXWA 1PO6A 2FLPA 4B9TA 1KD1T 2ASDA 2ZZNA 4J9VA 3ZZUA 2L08A 4N8NA 3VAGA 2BW2A 2CNOB 3CMQA 1RHJB 2VASA 2Z57B 4ZJOA 2J8SA 1BWEA 4ZKAA 4P6QA 3HD2A 3PX0A 5HROB 4DUZF 2VODA 5C25B 4LF8F 1JJHA 4FYYB 2FHJD 4OJHA 5HMYA 4DSEA 3FZBA 1FVQA 1RHQB 4NE9C 1U2CA 3MEDB 4KKOB 4O3RA 5IC6B 2DNLA 4ERDA 2JVOA 3BH7B 4GO5X 2Q43A 2V69A 3OTEA 1HR0F 2HHTA 1NDKA 3K7RA 1X4EA 3VR1A 3DN9A 2HMIA 4OYMA 3HHLD 5J1EB 3OL9A 4OI6A 4OMFG 2KG0A 1S0MA 1CQMA 1MWQA 3EPGA 1N52B 1VHFA 2IC3B 2DHSA 2HRUA 3HFZB 1RKJA 2DHAA 1U1KA 2I9SA 1Y7PA 5EHHA 5KFTA 3K2YA 1JLCA 3P3DA 5M2RA 5CZVA 3MR2A 1JXLA 2FZCB 1WUUA 2W9CA 4ZS6A 1HBMA 3MEGB 4CTAB 3DLBA 1M0SA 4C8LA 4DHVA 2ACMA 4B9UA 2R2RA 5IQQA 3R6LB 2VQEF 3AB2B 3GYXB 1SQGA 3VV2B 1S79A 4AL6A 1FFSB 5D0RA 2RU9A 2OGUA 1RU1A 3T5HA 1X31C 1WD6A 4AUKA 4TN2A 2VHGA 1RAOA 1RCOB 3QNWB 2YWGA 4CLWA 2XGPA 2LKZA 1JLFB 3N6MA 4BBYA 4N47A 5AE2A 3V81A 4CCHA 3MMAB 4Y65A 3T6BA 4LF5F 4KH0B 2J0SD 1U6ZA 1PSDA 4ZK7M 3AJ1A 1OY6A 4QR0A 4WFXA 2IMOA 2QO3A 2G2YA 1PG5B 3SSRA 4C3MA 1DARA 4OX9J 3D0HE 3MEDA 4KKOA 3T6JA 4LVNP 4A8MP 2J7UA 3ENAA 1TMJA 2G1HA 1WOPA 2Y3YA 4X4NA 1OYDA 3TP2A 2J5AA 2GJ2A 4KO0B 2H48B 2Y9HA 1X4AA 5CD4H 5ETRA 5ITHA 1D9AA 2KO1A 2M8DB 2CG4A 2L3MA 1HARA 2V8HA 3ITHB 3PW4A 1TV6B 3HHEA 3MCNA 1NKCA 4JI2J 4PKDB 4JI7J 1KNZA 4DV1F 2XY5A 2DK2A 3VVUA 1Z2ZA 1JNRB 1TKZA 5EWFA 3MM8A 3TEGA 4M5JA 5T7LA 1HQEB 1C2PA 4N76A 2HZAA 2DY1A 3EM1A 4N7TA 2V8GA 3K0JA 1T03B 3VQTA 1B7YB 2RRNA 4DV4F 1U45A 1NK4A 3O8WA 3O2IA 1RAIB 4CLSA 3DXSX 2KTQA 5KG0A 2MGZB 3K17A 1Q5YA 4HEA9 1GMWA 3AJDA 4KFBA 2XI2A 2FVCA 4RNOA 4DQSA 3MFIA 4UZBA 1KC8T 4RW9B 2PA3A 2AU0A 3UN3A 4NLPA 4O44A 2BRLA 1NJXA 2UVWA 1R6VA 3PM9A 2R8GA 1WSRA 5MLCV 3SSSA 1YGYA 3W2VB 1TVRA 5A76A 3TANA 3PW0A 4DG1B 1KBRA 4PG6A 1WKJA 2WBRA 2Z2YB 3UDVA 2LQJA 3TW0A 4UT4A 2BJEA 1NK0A 4U7UK 3E01A 4ZPBA 4OZ1A 3ZXWA 5L46A 3T19A 2HG4A 1ZPWX 4RBVA 5DETA 3NLCA 2X1BA 3MM6A 2HQFA 4ECYA 2U1AA 2CDRB 1WC4A 1HBUB 1VBZA 2CXEA 2DH9A 1QUVA 2OIHA 1FF2A 2GX8A 2ZITA 2CWKA 2RKIB 2MY8A 1RWMB 3DU6A 2E44A 4FN5A 4Y2CA 1S0VA 2EC0A 3QBCA 1I1GA 4USMA 3VWSA 1OS5A 1I94F 3W64A 2UUTA 4AXJA 4YR2A 4X66F 4CLUA 5KG7A 2AEFA 5KOWA 4LRDA 3W9IA 3ZTRA 4ED0A 2AJQA 1T7PA 3UR0A 1XIQA 2H5EA 5BXIA 1ITPA 5KFBA 4DFPA 4O3SA 1YDLA 1NSPA 3GTYX 1X5SA 4OHWA 5KOXA 2LEBA 2DJWA 2MZ1A 3I55S 4C11B 5D3GA 2G2ZA 2HVHA 1AFJA 3VGTA 4M5KA 1FXRA 2OPSB 5DJBA 3LTOA 3DRXA 4OI0A 2QC3A 2RQ4A 1HHSA 2IJRA 4R0JA 3I5AA 4MT1A 2CVEA 5J2PB 2YQ1A 3HSJA 2DPJA 2HBRB 2DXEA 2FHMA 4C97A 3BSAA 5KAKA 1QSLA 4JV5F 1Q8BA 4XAKA 3L3CA 2ZH1A 3D6TB 4AL5A 2LP4A 3Q24A 4GKJF 1I3OB 4ZIWA 3G96A 2CQ0A 2QT7A 4GVBA 1JQGA 4KSEB 1HMVA 2ASYA 3FMWA 1ZTTA 2ATLA 3OVBA 1B64A 2M7SA 5KG6A 4AXIA 3OTDA 3MUTP 1S6QB 3K5PA 2AJFE 2CQPA 5J2QA 2UXDJ 3P8BB 4BCAA 1HNXF 1AXQA 4C2MA 2HRTA 4I6WA 1UL3A 4DR2F 3RW7A 4MIWA 4ECTA 4DDFA 1VQSA 4USVA 4ZVTB 1NXIA 1RU2A 2LEPA 4RW4A 5B0AA 3EVMA 3OVSA 1EKRA 1U0HB 4NZ6A 4XDDA 4J9SA 4QU7A 5IM0A 1VJQA 3IO1A 3JQMA 2XY6A 1U2FA 3EZ5A 2EVZA 1HBUA 5KFCA 1QD1A 4J7CA 1HYSA 1FHTA 2C2NA 1FK9B 1HBNB 3GV8B 2XO7A 3PV8A 1BWVA 4R25A 5HK4A 3S1TA 1NH7A 2XZDB 4ILLA 1LKZA 1PBUA 5KFPA 1VQ7S 2XCAA 2IFXA 2YNGB 4Q5VA 2X51A 1C4AA 2V6AA 2X3GA 4Q2MA 3OXGA 1KQFB 3VALA 2DPIA 4LF1A 4F0KA 3KTQA 1F2HA 4KHMA 3LPEA 4WFBQ 1T05B 2HYIB 1RT5B 1N5TA 4WE1A 1NK9A 5HI7A 1R0AA 1V5VA 4M63A 4TQRA 2J9DA 3NWRA 4ZPCA 1FD8A 3GCXP 1TTHB 3DHWC 2R7WA 2HFVA 2P9CA 3PJWA 4TYAA 1RTIB 3K57A 2G13A 4KH1B 1TZ0A 3NS5A 1A0OB 5AXKA 1IKWB 1Q7LB 2P9GA 4NL5A 2XCPA 3C15B 3MM5A 3H4BA 1LWFB 2QE5A 4DFJA 2WSFC 1RTJB 1SH0A 1OO0B 1T9WA 1ZA1B 3CIMA 3RZAA 4XPEA 1QTMA 3EICA 3EVWA 3N6LA 4ZCKA 3GU0A 3ZNJ1 2BACA 2V4RA 2AYMA 2WVEA 3FBCA 4V1Ak 1OMSA 9ATCB 1ZZFA 2EBGA 1JLGB 4X84A 1RHUB 2KN4A 2R7OA 3NAHA 2XO6A 1N33J 2IY5B 2C3UA 3DLJA 2HFUA 1TQLA 1TFWA 1UFLA 2F4VJ 1N54B 5EN1A 3IFEA 5U47A 2Q6CA 4JI3J 4DSIA 2E9RX 2ZOMA 5A8RA 3BZQA 3QPIA 1IQZA 3TRGA 3TQEA 1VQNS 4OL8A 3CJ3A 4LSNA 3DHXA 4HI1A 4OYXA 3I32A 2EK1A 4X4TA 5F0UA 4QZVB 3MPYA 1RT5A 3PO4A 1FNOA 3OR2B 3R8YA 1M5SA 1RGVA 3DM2B 5J2NB 3MFHA 2DNQA 3OTOF 2QV6A 2HHWA 1U2RA 2JEJA 2MZRA 4DV0J 2GIFA 4ED4A 1Y3JA 1GX5A 3PKYA 3M6WA 5HMWA 3AODA 3FSXA 1Q53A 3JTPA 2GFFA 3BKUA 3DRPA 3MM7B 4KIAA 1HNZJ 1REGX 3V4MA 2DGUA 1M5PC 5JJBA 5BJRA 4R5PA 3IRWP 5CHCB 4ZVFA 2HGMA 3D1QA 3W5ZA 4K50A 4YOEA 2EK6A 1UFWA 1FERA 2BABA 5DO2A 4O3NA 2LCWA 1E6YB 3BB5A 4F3MA 4CIOA 4PG8A 4CYUA 2J76E 3OLAA 1FCAA 2H4WB 3BGOP 3KG0A 5L1IA 4DR6F 1CQNA 3CIZA 3FBEA 4CTAA 4A46A 2HWIA 1CC8A 3JSMA 3HVRA 2V67A 2J8AA 2JX2A 4EBDA 2OJ3A 5K8PA 1JLGA 4J9OA 3TUZC 3VZIA 1C0TA 3CJRA 2PC6A 1OPIA 2GVDA 2HAFA 2IVYA 2NXCA 2VZ9A 5HLFA 1MNEA 1XTZA 2JWNA 2MQLA 3CCMS 4PYAA 2LECA 3NWGA 1JNZB 3ILJA 1WG5A 4DPYA 1S72S 4QPXA 4CM0A 1GFWB 3M2VA 2RB7A 1NH8A 3FBFA 3Q86A 4TLQA 1KVJA 1GH8A 2MKJA 4LMZA 1S6QA 2BVZA 3DMJB 4HDGA 5DDOC 3CJ2A 5SZTA 1K1QA 2FHJA 5CYQB 4DPWA 4ES1A 3HP6A 4LF5J 1P1TA 2QJ3A 3TUIC 3GFXA 3SI8A 5H9EJ 2VFTA 2XWYA 2X1GA 3GIRA 2QMXA 1RJJA 2B7CB 4PPZA 4DU7A 4LSLB 4Y2MA 4TQSA 4ANDA 4OX8A 3IM8A 3J7Z5 4GKJJ 3AA8A 3D54A 5G0RB 1ZOTA 3KK3B 5KG1A 4Z2XA 1FKAF 2VUGA 1NB2A 3Q22A 1FJEB 3FCHA 1BC6A 2VG6B 2ZVSA 3PNIA 3R2DJ 5KFGA 2PEBA 3KMQA 5D3GB 2UXDF 2RHQB 1FEHA 1WI6A 1WOOA 2GHVC 3HPOA 1GXUA 1T8EA 2ROGA 2V2ZA 1Q82T 2RQKA 2P8IA 3E8OA 3PYEA 3FRYA 4CI0B 1KLMA 3E3XA 5T7LB 4RUBA 4WP3A 4I4BA 1EKSA 1ACMB 4LF9F 3PXGa 1DAXA 3NRBA 2ASLA 3PYGA 2PMHA 5AJ3F 2GS8A 4ZLNA 1LV5A 2Z4PA 5A6PA 1PYOB 2KFZA 3DDNA 4WKRA 1L3SA 4DL7A 2Z58B 4ER8A 1EP4B 1PJ6A 1S6OA 2RAQA 2XEXA 4NLSA 1DZ5A 1S6UA 2E5GA 1URRA 1HD1A 2ZUGA 2WTFA 3CC2S 1F6TA 2ABYA 1Y0HA 2PE8A 1DTQA 2HBYB 1HBOB 2XQCA 2MQOA 1S4FA 2Q66A 3HSZA 4DF8A 1S1WA 5ETSA 2FHOB 1FDDA 2QL7B 4OZJA 4EI2A 3D0GE 4K2JA 1FD2A 1FRJA 1U26A 2FPHX 3G86A 3NGTA 4NZ7A 1VQMS 3KLHA 2XLKA 3PRBA 5T14A 4ECXA 1U1QA 4W4MA 1HA1A 1B0PA 1YRTA 4RW9A 1VOMA 3LGNA 1P9QC 1BQMB 2PA8D 3C8YA 4K8RA 4CM2A 2DH7A 4HLBA 4CO5A 2VIHA 2FLLA 3RR7A 2CQGA 3QJPA 4FF3A 1U09A 4KHPF 1MW7A 3MM9A 4L3NA 2ILYA 2ZDOA 3ILOA 3D3BJ 3L7UA 3LF0A 4K5RA 1T9YA 3QIDA 1U1OA 5F8GA 4HT5A 3BPSP 3POTA 4R8UB 1N8RT 2LXIA 1UEKA 1LFPA 4X65F 1YHQS 3V4IB 4UQGA 5LMUJ 4JOUA 5DGAA 2XGQA 1K0VA 3MI7X 3J81Y 1PCAA 4KGXB 4NLTA 1UCNA 4Q44A 1M5OC 4V19J 1VRQC 1N32J 1DQ9A 1VQ5S 4CZCA 2PI4A 5KG5A 1B4SA 4P2SA 5I3UA 4UTGA 4DL6A 1S1UA 1AB8A 2ROEA 4FS2A 2K2PA 3AXKA 1H0HB 2O01C 2BA9A 2OEKA 1SVDA 2C2RA 2BM1A 2CPYA 4DXLA 2MKCA 3Q8PB 3ULHA 2UXBJ 2YWFA 4IOBA 1C0UA 4GC6A 2K1RA 1DY3A 1PGZA 2M3DA 1DQ8A 3R7NB 4XDCA 2BE9B 2QGFB 1YBAA 5J2PA 2ZOGA 3R1HA 1LW0B 1RKIA 4RW6A 4OHYA 1GX6A 4WZQA 4PXBA 3T1AA 2N4CA 2BKOA 1JLEB 2MEWA 3HVTA 4ES2A 2B8PA 3FQKA 4TY8A 1LXJA 1FKOB 1W26A 2HKEA 4PWWA 3TR5A 1WJ9A 1U4BA 1SKSA 1XERA 2GO8A 4X2BA 3DDKA 4U67Q 2R7RA 1KLNA 3CGIA 4F4WA 1HNVB 1NZAA 1DQAA 1FX4A 2VL1A 4MTPA 3BBCA 3R5AA 3JAMU 3VAMA 2AGOA 2A2DA 1S1WB 2HGNA 1S1VB 2FZGB 4A4JA 2ASJA 5KT4A 2IBOA 1YJWS 3IWLA 1RAEB 2QSWA 4WIQA 2MKHA 5E3RA 4ICLB 3PDNA 2N7CA 1L3UA 2DIUA 3TARA 1VQ9S 4JI5F 4JI6J 1CJUA 3NP5A 4NXNJ 5IC4B 1LQ9A 2HHHF 2E7XA 3KJVA 5L39A 3ETMA 1HNWF 3IMQJ 1KP6A 2I0XA 3A13A 1J2VA 2IM3A 3DGPB 2YWWA 4QYRA 5AJ3J 3OHAA 1NLKL 2Z30B 5AE1A 4GRSA 1GXLA 4KY3A 2A1BA 2PSZA 1D0EA 4NCAA 1U6BA 4JYAF 4ZPAA 2JC0A 2HVIA 1TAUA 2AJ4A 2NYIA 3ZTSA 5HP1A 1OSCA 3LP0B 3N79A 3M8ZA 4FZVA 4JB8B 4R0EA 4B3RF 1UVKA 1SJQA 1NSKL 2J7KA 4U96A 3G4SS 4C7QA 2YH0A 3R5DA 3J80Y 5CYJA 2UP1A 3KK3A 3H5YA 4Q7AA 2CPEA 1LNQA 5C25A 1KVKA 2DKOB 4QR1A 2XYGB 2XLIA 2XHCA 1ZYQA 2XG8A 2H5JB 3MCSA 3CCJS 1OYEA 2XSFA 4E98A 1NO8A 2E5LF 1IWAA 4C8YA 3H4DA 3M1VA 2W2MP 4DFKA 1UP1A 4USWA 4RW6B 5G4DA 3CJKA 1NHVA 2YWEA 5HANA 3HDSA 4BC7A 4ECRA 4NLVA 3MEKA 1AZSB 5LXRA 3MR3A 3RYLA 3B8HA 2YKMA 1RT2B 2UV8A 4EK2A 4ZA1A 5IFMA 2LYVA 2RJZA 1SBRA 2RQCA 1U7LA 2P2CB 3M2VB 3P6YC 1OIAA 1TUWA 3W60A 1FJ7A 2NUUG 1ZETA 1NKBA 2GC8A 4HI2A 4DV5J 4LF4F 3MWBA 3IR6B 3VVTA 5LT5A 2ZJRQ 2ZWPA 5JVHQ 2KJWA 2NLWA 4ZPVR 4PPDA 2AYEA 3EZOA 3KNAA 4UQTA 2GQQA 3BGFA 2R8KA 4EZ9A 2Z0GA 3CEDA 3D9BA 3UFCX 1LK5A 1N33F 2FJAB 3EXYA 2ACYA 2CAJA 2MJUA 1CSJA 2J9CA 4NYZA 1S59A 4ZCLA 3VCDA 3W1YC 2JFDA 3DGVA 1NPKA 2MY7A 1UWAA 4IRDA 4ZVSB 4F67A 3QO9B 5KG3A 1NDPA 1YZ6A 3C46A 3RTVA 1RAAB 4EU0A 2M2BA 2W2NP 1KFSA 4CH0S 2XMAA 4DV7F 2OH2A 2XWXA 4XO0A 3VAKA 5DS7A 2L48A 1TVRB 4ECVA 3ET6A 1X0FA 3OR2A 4WTOB 2ZD1A 3AB4B 3HJVA 4K4TA 1WWHA 3G8TA 4IRKA 4DN9A 1L5UA 3N4WA 4G1PA 1M5VC 2QA2A 1ZH5A 2BBEA 4HHJA 2PN6A 4OX6A 3HMJG 1SL2A 1KQSR 1ZBTA 2FVRA 2DGWA 2ZOFA 3D6MB 4N56A 4LFCJ 1RT3A 2F3JA 2MKKA 3T1HJ 3GJTB 3K5NA 2BQUA 1ULRA 1VQLS 4CNZA 3PG9A 4FYWB 4NRTA 2CNKB 4Q43A 3OJUA 4DR5F 2IAJB 1SJ4P 1T03A 5DLGA 2VONA 5HATA 3UR3C 1R0CB 3WQPA 2A18A 2AMCB 1LXNA 2H9ZA 3CCES 2RQMA 4JYAJ 1YJNS 2E1RA 3B4DA 1WSVA 4ZVEA 2K3KA 2I38A 4K4YA 3TWZA 3J80U 3CCLS 3PYDA 2UXCJ 2KHDA 2RS8A 1E6VB 4EGLA 1Q4RA 4C0HA 1WACA 1QSSA 1R89A 4F8RA 4QCLA 3ELHA 2ZZTA 2OFGX 4PG4A 4LR9A 3KLEB 3BSCA 2MKYA 1F0XA 4H4KC 2YKAA 4HDHA 4USIA 3R9LA 5CYQA 5E3AA 2WB1D 3MR5A 4DCJB 5HROA 2CPFA 2E7WA 1EZZB 5FJ4A 4HL9A 4K7QA 4LSZB 1OJ4A 1HNXJ 5KFAA 2CVIA 2GIRA 3FJ2A 4DX6A 4OQJA 2EG1A 3SQGA 4DR7J 4PG5A 2QX0A 4BS2A 4KHPJ 1F3VA 4M5MA 4NI2B 3NBPB 1YWXA 3PEJA 2AYBA 4OYZA 1KN6A 2ZDPA 4YMEA 3KLGA 2C2ZB 4TKTA 2KM8C 4DX7A 3UDEA 1V3SA 1XN9A 2HWTA 4NLRA 5C2CA 2HBQB 2UV8G 4P7TA 1H2TZ 3UE2A 2AJ0A 3ICLA 4JI6F 3BR8A 1DBDA 2JLFA 1C0TB 5KFMA 4OYIA 2QZ8A 1LEOA 1RBAA 1X4HA 1S97A 2WW4A 4H4OA 1FTCA 1PJ7A 1T9XA 2B43A 1UJ4A 4ZDNA 4CRJA 1Q78A 3CJSA 4DZDA 5DG8A 2CJYB 2R7XA 3M8YA 1FNMA 4NLWA 2DNNA 4I0WA 3LQVA 5JVGQ 3KK1B 3DOLA 5HVHA 1JXVA 1UTAA 5KT2A 1DLOB 2ZH4A 4AE5A 3PFEA 3HHLB 5C5JA 3M2RB 3B54A 3GP9A 3QLHB 3SQOP 3R5JB 3NNCA 3M4XA 2B4PA 1RWXB 2UUWA 2W2QP 2DNPA 3NS7B 5AXMA 1GT8A 3NGRA 4QU6A 2F63A 2F1FA 4QWCA 2RF2B 4F26A 4F0MA 2C1EB 3TA0A 3EXCX 5KT5A 3TQ1A 1R7IA 2B9XA 3CDBA 4RPFA 1TUVA 3I9V9 4P2MA 4IDKB 4NA1A 2R7UA 5H9FK 2R2UA 4ETZA 1XBWA 4X64J 2IMWP 1C4CA 4P10A 2EEYA 3MEEA 3DLEA 4RBUA 3G9CA 3H20A 2YKNB 1FRXA 3N6NA 1IBLF 2DHXA 3OFFA 4FBTA 4LSNB 3EGVA 5F8LA 1BGXT 1Y11A 2ZBIA 4K2XA 2XMUA 2YNFA 4DL0C 4NX9A 2GQCA 5B0BA 5GAHI 1Q8IA 5A8WB 3VQSA 4K59A 1X8DA 4DV6J 3DC2A 3FFIA 4ED8A 2GMJA 3CJ8A 1U02A 1VK8A 3D4JA 4BWMA 3UN5A 1HNWJ 1Y00A 4LRBA 2V4JB 3M8WA 2G2OA 2R7QA 3H90A 2DXFA 4DX8H 2MHEA 3M32B 3T3FA 5LMUF 3T5LA 2Y8WA 2MJNA 3BKFA 1MU2B 3BPDA 2ZNZA 2E1MC 3WX4A 4W92B 2YNHB 1RA6A 1PJ5A 1CJKA 3F56A 4H4MB 4ID5B 4WJBA 3W2WB 3UD3P 2VG5A 3V4IA 1TK5A 2IPOB 4MYTA 3I4PA 3PW7A 3N01A 1FKPA 3JQKA 2YNFB 3W8GA 4QIVA 1VQPS 3LUYA 3MD3A 2HWHA 4OFZA 1XR6A 2Z56B 3R3TA 1SIZA 1FE4A 5IWAF 4F2SA 1SI9A 4X4VA 1FDAA 3JQJA 5KFQA 1XR7A 1NSQA 3FEXB 4M5IA 3BSOA 3SBMA 3QIPB 1YQHA 2BKPA 2ZH9A 1RYRA 4J9UE 3ONQA 1JIHA 3DFEA 3R27A 3WIVA 4DF4A 1FI4A 1TFYA 2UVRA 1F5AA 2KYXA 4LRAA 1WEZA 3CVKA 4F4ZA 2GGPA 1U25A 3WZ0A 4MKYA 4DV6F 4HVZA 3PJ9A 3V5RA 2O66A 4LRCA 1TL1B 1RADB 1Q79A 3JS9A 3NY0A 3CULA 2C3OA 1Z4UA 5F8IA 2OFHX 2RDJA 2ZBPA 1O6XA 3BN7A 4BC9A 2WONA 1GEHA 1NAQA 1U0HA 2WAQD 3KDNA 3VGUA 1DURA 3K8WA 3LAMA 2QRRA 1HWLA 2RVJA 3DLKA 2YKQA 4I7FA 3RBDA 2C2EA 2I8EA 2EFVA 1IKYB 5A8KA 5AXNA 2FIUA 4BHQA 2R7SA 1SKUB 2E66A 2BJ3A 2Q3PA 4B9SA 2BX6A 3Q8VA 5D6GA 2C2DA 2BQ3A 1NZ8A 1XMQJ 5F3TA 4Q8EA 3VAJA 2F9JA 2YNHA 3H2VE 3L95X 2NQPA 2DGSA 2JOQA 1J5EJ 3FFIB 5DQGA 2J9EA 2B56A 5HMXA 2CQCA 1LWEA 5ETLA 3CD6S 3GCWP 2V4JA 1TAQA 4QIFA 1G3OA 1X4FA 4J37A 5IT9U 3H2LA 2BEFA 4DV3F 2GAHC 3AA9A 3MPDA 3S01A 2W25A 4L74A 3JSBA 4LBHA 4UOHA 3BQ2A 5F8JA 2HNDA 2AIRB 3L9ZA 1X5TA 1OQ3A 3SCIE 3Q0AA 1U24A 1FRHA 3NOGA 3RB0A 3HHLC 4IRCA 3PKMA 3FEYB 1VJWA 3ZZZA 2DY9A 3JTOA 2CKWA 1BE4A 3MTJA 1BHNA 3MECA 5DRKA 2DD8S 1G1XA 1Q0NA 2LDYA 2NUHA 1KR4A 2E5HA 3C6UA 3D67A 3HFVA 3AD8C 2ZHBA 2B5JA 3KJQB 4FP9A 4NLUA 3H2UB 2QIFA 1WC6A 3NEKA 1MMLA 1HPZB 3ILIA 3ZTQA 1VQ8S 1KSPA 3HI9A 5FLXY 1JLFA 3V81B 4KJIA 3DKDA 3KK1A 4H4KA 3U7JA 1RHRB 1N88A 3DRRA 4IFVA 1B0VA 1R8HA 2WSEC 3D3CJ 3GMGA 2XZTB 3ISND 2DTJA 3DOMA 2B3TB 1B70B 4L75A 2LMIA 5M2UA 1WTFA 2CA9A 3I4HX 3PZPA 2BV3A 6AT1B 3CNQP 4DV3J 4AL7A 2PMWA 2V34A 3US5A 2UU9F 1RAHB 1CS4A 2FYXA 3IR7B 4ZP9A 1RABB 4UUWA 2MKSA 3HSDA 2HNYB 3AOCA 3NGKA 3BYRA 3PX6A 3D68A 2FVPA 3MAQA 3AXMA 4TVAB 5KFRA 1B99A 3DRPB 2E5JA 3FMBA 4L73A 2JLEA 2HK2A 2P5VA 2POKA 4IUFA 4P9SA 2C3MA 4TYBA 3W2VA 2RRAA 2VG7B 1V3RA 2Z2MA 2A0FB 2K3IA 4PR6A 1AUSL 3G87A 3LANA 4HR2A 1VISA 3N5FA 2EFGA 3S6EA 4UZCA 4NCGA 3O5TB 4A8OA 4CQ1A 1AA1B 1UA1A 5CH7B 1S49A 4P72A 3OPKA 4RNMA 2OELA 3I87A 1PC4A 1F9EB 3AH6A 3EMTA 1R3NA 4KFBB 4J91A 4QOTA 4QW8A 3LWMA 1TK0A 4OI1A 3HK2A 3HVWA 2HRYA 4B9MA 4OJGA 3I5CA 1G6BA 1VBYA 4KHRA 3CC7S 1P9YA 5ETKA 1OY9A 1IUJA 3A3NB 4DUTA 5CD4A 1RZMA 2X1FA 1VQ4S 3WC0A 1JMTA 1RK8A 2H4YB 2JLGA 2CUYA 3MAHA 5KG2A 3CSKA 3VF0B 1IBKF 1HWKA 3KOAA 4FDFA 1WF0A 2DT9A 4DPOA 4FXVA 5ETTA 1LW2A 1TL5A 1MG7A 5THWA 4X4SA 3CJQA 1NNDA 4ZLJA 1HW8A 3UW1A 5J2MA 2MZJA 2A2CA 3OV7A 3I0SA 1U8WA 2PMZD 2NS1B 1NJWA 3OBIA 1HQUA 3M9NB 1I5OB 3QFWA 5EUHA 1H38A 3QT6A 3TZZA 1DTTA 5HN0A 2OTLS 1M5KC 1FWLA 3PR4A 2HHPA 1MN7A 3CMES 3TVYA 2UVUA 2DHGA 2J9DE 3O3LA 4B3SF 1MMNA 2D7SA 3IBWA 3MM6B 1U1NA 5HBMB 2OD6A 2KG1A 3CD7A 5GVQA 4DBQA 1VIOA 2BYCA 3AD9C 3D6HB 3HHDA 4DOZA 3AOAA 5DQHA 5KFJA 2J6UA 1IR0A 1NB7A 4E0DA 2VQFJ 4NXNF 4C3LA 2ZM6J 1ZPVA 2F65A 5IXUA 3NGSA 5A0YA 4C98A 2DO0A 3QIPA 2I6WA 3GIJA 2CQIA 4GKKF 1EIYB 2HFZA 4UOCA 1UWBB 1X7VA 3Q8RB 2NREA 1NHKL 2F8HA 3TAMA 1RHMB 1N32F 2HHSA 1QJHA 1FO1A 2DR8A 3DDIA 3MUVP 4MIBA 4PUOA 1HNIB 2DCUB 2M5YA 3I31A 3IBFB 2HBZB 3QSYB 4TY9A 2YQ3A 2EKNA 3QGPA 4FVCA 4EFAC 3M8PB 1XJWB 3PACA 3FCWA 4KYZA 2E9TA 1HQEA 3GYNA 4ENOA 2CPZA 2MKIA 5D4OA 3I82A 3J7ZT 5LMNF 1S0OA 2VKZG 1VC0A 3CCSS 1RLDA 3AT1B 1L3KA 2IVFB 3KUHA 1I6JA 1ZTWA 4EZ6A 3QRRA 4YHHJ 3J7YU 5A6WA 4CO3A 3P49B 3JYTA 3M30A 2VV5A 4AYBD 3M8PA 2BRKA 2WK4A 3N0VA 1N5QA 2A3JA 4GO7X 4RUHA 4WFNQ 2AJ1A 2VQEJ 1S1TA 2VQFF 1IJFB 1RSCA 1JX4A 3NAIA 4ID8A 4KC5A 1X9SA 3P5BP 1YJRA 2QG9B 2B5JB 1YIJS 3IRXA 4ZVUB 1YX2A 1IKVB 3Q2SC 4TY8B 4CDIA 1JLEA 3HVTB 3OVAA 4DUYJ 4F2RA 2Q1LA 2LU2A 4JI0J 4WFAQ 1JB0C 1H7WA 4G1IA 3M2UA 3J81U 1HHQA 1FWKA 1UETA 1KOHA 4ZVQB 5KFOA 1UVJA 2JDJA 4OHXA 5A0YB 3BGLA 3DMJA 2HFOA 2GHWA 3OSNA 1ZAXA 2RIJA 2XYPB 4ED2A 3CCZA 3WIUA 4P71A 1XMBA 5GAGI 3HSGA 1ZM3A 5F41A 5DG9A 2ZKTA 1IXKA 3K5OA 4AQYF 4DPTA 4K4ZA 5DG7A 3IXQA 2H3EB 1VLYA 2XB2D 2LA4A 2DRDA 1EB0A 3C3LA 2RILA 3HHLA 5K5MA 4IYQA 5D0EA 5C24A 4ZHRB 3PW5A 2W7PA 2EWHA 3W61A 4NA2A 3UWTA 3GSIA 2M52A 3IN5A 4ZCIA 2VICA 3HZGA 1NCLA 1FRLA 2QL5B 4WBFA 4YS2A 4KPYA 4PUOB 3UNYA 2ZC4A 1R6YA 5HVFA 1U0SA 4LVOP 1RT6A 1RI7A 4DQRA 1S1VA 2AQ4A 1KKHA 1SC1B 5L1LA 2GCFA 2W9CB 2OAUA 1Y10A 3KXDA 2FGOA 3PTWA 4ZP8A 2W8LA 4ECQA 5I42A 1SV5A 1HPZA 4PEOA 4CNYA 2LXFA 3NXZA 3I5BA 3GFZA 3MMJA 2H1YA 4NI2A 4A8XA 2W24A 1APSA 2XY7A 3CJKB 4HTJA 1KHWA 3TVZA 5CQGA 5D4NA 2CZ4A 2F8MA 2DEJA 3BBFA 1WG4A 1M1HA 3I0RA 4QYZK 4YUDA 3DI6A 1DJ0A 5D4PA 4W90B 3BS9A 3CO9A 3U27A 1VQKS 2R9LA 2CWXA 3O6QA 3OLBA 2WVFA 4USKA 2YKOA 4F3QA 1TUGB 1KVIA 2FB0A 3LW5C 2KZMA 1B3TA 1ZM2A 2ZC3A 2XNRA 1RWNB 3NGUA 2D3O1 1FRKA 4B02A 1A7GE 1TKDA 5J2MB 1WELA 5EWEA 1XR5A 3DU5A 1NKEA 2AD9A 2ZWOA 4M5NA 2Z2ZA 4OJ3A 3E51A 3H40A 1KLMB 2DNGA 1XMOF 1FXDA 1S9EB 4FF2A 2V68A 2IAJA 3Q8YA 4DR4J 4XPCA 3GR1A 3GFHA 3M8SA 2GW8A 1X9MA 3AJ2A 4QWEA 1SJFA 2KL8A 3CCQS 3D28A 1FEEA 1EJ7L 4DJBA 2RD5C 2N3OA 2QYGA 1T3OA 4B08A 3QMQA 2XM3A 2W9AA 2V9KA 2Z2LA 3QRPA 3AFGA 3PFOA 3T41A 1UWBA 3SV4A 1QVFR 2LQ8A 2OMLA 4QYZJ 3BKTA 1SCJB 1CC7A 1RWPB 2MYFA 4LSLA 5F9LA 2N82B 1SL0A 4B3SJ 1BLUA 5J1PA 3TVKA 2NZ4A 4USJC 1CPZA 4O0IA 4B9LA 2ZBRA 2NSCA 3NNHA 1PYSB 3H5XA 4WE1B 2HVDA 2IDEA 1C1CA 3KJNB 4HACB 4NYOA 1H3DA 2QLBB 1QAIA 1EAYC 3C14B 4ZPTR 2DR9A 1HR0J 2AYGA 2HAIA 3FUYA 2XMKA 2HVEA 2KT2A 2YNGA 4KGVB 1RB0A 2V9WA 5T41A 4LIWA 4EYHB 2ZZMA 4FXDA 2HQCA 1N36J 4GKKJ 1QE1A 5D8HB 2WSCC 3VGSA 1UKUA 1W2BR 4WZMA 1DTTB 3EE3A 1XMOJ 5A2QU 5BR8F 2VPYB 3QJLA 1D8ZA 2QMUB 4DN0A 4I1TA 1J5EF 1YLXA 3SIPB 2PI5A 2KYZA 4QPTA 3QGIA 1T3NA 3UN2A 5KFDA 2QLWA 3NOCA 1REVA 2DNZA 3PVXA 3RAQA 8ATCB 3MOJB 1WC0A 2SXLA 2HURA 2V8PA 1N0UA 4KAIA 3SCLE 3PIPQ 1M1KT 5KFIA 2GJFA 3UI3A 1X4GA 2EI5A 2BE7D 1HFEL 2UU9J 1JLQA 2CJBA 4B3TJ 3AHPA 5D77A 2HQ3A 1KQKA 3WHIA 5J1EA 5A8WA 2YKMB 5GAEI 3G6XA 7FD1A 2KXNB 4NRUA 2E1CA 4LF6F 5EDWA 5BYRA 5LSRA 2Y0SD 4LF8J 2UUCF 2IA6A 4WYWA 5IS2A 4DL2A 2E5IA 3TZWA 1YITS 2YPYA 1P6TA 3KKFA 4M95A 3Q83A 3U1MA 2LQBA 2QA1A 2FY8A 4I69A 5BR8J 3PO5A 3N5BA 2ATCB 3B4MA 4ZP7A 1K47A 1Y9OA 3QT5A 1RT1B 4CT9A 1R8CA 2JNJA 2ZBQA 4AFFA 2HLTA 2KXHA 4FS1A 2HLUA 3HD1A 4RNHA 2J0XA 2RMLA 1RT7B 4ELVA 2HNZA 3IM9A 4CLFA 2IIHA 2XSJB 4J9NA 1UVLA 1VQOS 4B3OB 2JH3A 2XTJP 2R7VA 2FDNA 1SXLA 3VZHA 4ELUA 2BE2B 3BGRA 3FC9A 2GVDB 5EX0A 4Y00A 1HYSB 2KM8B 4N8OA 1RACB 3DGPA 3THTA 3OFGA 3HF5A 1LWXA 3A4TA 3DYAB 4A8WA 2G1DA 5LSOA 3KLFB 3W5YA 1S48A 2EFPA 2IYGA 2M0GB 4NEZA 4QBUA 4J9RA 4F4YA 1JLBA 2OHDA 4USTA 5D0HA 3JXOA 2ZH7A 3QFHA 1YSJA 4LFAF 1S77D 2L41A 2VBZA 3H7HB 4XK8C 4IH6A 2W9BA 3VTIA 1T9TA 1T02A 3C6UB 1WI8A 4RLEA 4RWXA 5EX3A 3RBZA 3NBPA 5HQ8A 5IT4A 1S9GB 3GYGA 1N4LA 2ZEJA 3LP2A 5KFYA 4ED6A 4O3PA 3M6VA 4IOAQ 2XNQA 2WHOA 4NOHA 4URSA 3BSNA 4ZVOB 1JJ4A 3OFHA 1IWGA 2W9BB 1H2UX 2JRSA 5B08A 1CVJA 2IRUA 2QA4G 3MURP 1HKAA 4DFMA 3C2PA 3UCUP 1H2VZ 3PR5B 5E7OB 5ETQA 3UNGC 4ED1A 3LO3A 5C2GA 1N5YA 2DGOA 3GR0A 5GMEA 1NK7A 3KG1A 3W7BA 3D7SB 3W8PA 4G3IA 1PC5A 1TELA 4ZP6A 3HJFA 4YEAA 2MLZA 1P27B 3M6UA 2BE2A 2OLWA 5BYSA 3HKWA 1S7IA 2EXUA 4IQMA 5E3PA 2FVSA 3CD5A 1H7XA 2QSFA 4NYPA 4B3OA 2GHPA 3V2UC 2XSJA 1YJVA 4FKXA 3C15A 2DEIA 3MM5B 2HEKA 3TJ9A 4GVLA 5C42A 5IWAJ 1RP5A 4RNNA 2HQGA 7AT1B 3CJ4A 5IV3A 1WEXA 2BQRA 4ECSA 3JB9k 1F60B 3ZZOA 4ZN1A 1SH2A 4LUBA 3DLHA 1T11A 2QFIA 2AWZA 1UJ5A 2R3VA 3HVAA 2N3LA 5I3PA 1S12A 4CLZA 2YKNA 2J6TA 2ZE2B 4OIXA 4ZMMA 1BQMA 2B9YA 2M70A 4DZ6A 1T05A 2IDLA 8AT1B 3GQCA 3A1YG 3HT3A 2VU5A 3GZ7A 4QJVA 5B09A 2A10A 1XNRJ 4O4GB 5GAGU 2W4PA 1R0AB 2HK3A 2F4VF 1TL1A 1IQTA 3CXCR 4P2XA 3D1HA 4S0MA 3MMAA 2PGCA 1P8GA 2ZBCA 2ZE2A 1N5SA 2GVZB 3B82A 3NS6A 5A2QY 3K59A 1N36F 1I51B 2BOPA 2YBVA 4PG7A 4ZITA 3SXLA 2X7IA 2G0IA 3QATA 2YPZA 5A8RB 2W2OP 3SV3A 4PABA 4WP9A 2FUG9 2HVZA 3OR1A 2PIIA 3KK2A 2W8KA 2VDHA 2W2PP 4MK7A 3GV7B 2AX1A 4A8KA 1AFIA 4BLGA 4JI2F 1SUQA 1W25A 1QM9A 1GXTA 3CE8A 2MTLA 2OPRB 2YWKA 3UQSA 1B0TA 4LT6A 3RW6A 1Z1ZA 1S99A 3TJ8A 3M9OB 3CDEA 3G82B 2NCKL 1QAXA 2VC0A 3GE9A 4YN3B 1TL3A 4DV4J 3MM8B 4JI8J 1L3TA 3OQ2A 3QT7A 4JI0F 2WOMA 4LF9J 2VG6A 4YB6A 2DNRA 1RT2A 4OYPA 5K8MA 2KKHA 1R0BG 5L9XA 1IKXA 2YX1A 3HX9A 3RRGA 2B8QA 3FDSA 1BD6A 2WW8A 3GFYA 4PYDA 5RUBA 4I2QA 1MLAA 2I5JA 2JSXA 2OEMA 3IBCB 2VJUA 1WNEA 2DYAA 1IN0A 2OPQB 3BYPA 4GMKA 4WYLA 4OZ0A 2AV5A 3U1NA 4ZN3A 5JMNA 4OLPA 4IO9Q 4C0OC 1U6FA 4PXCA 1TKTB 3M8QA 4JI4F 3DI6B 3RAXA 4N5SA 4C11A 1SH3A 2DGTA 4FNHA 2WVDA 2V4QA 4WCEQ 2I5JB 3QYYA 2VFVA 2COLA 2G9OA 3IAM9 4DQQA 1EX8A 1TMMA 1QDUB 3HLUA 2FTRA 2MLXA 1DFDA 1TL7A 4Q2LA 2O3DA 6FD1A 2PFDA 1JLBB 5DZ6A 4CWBA 2CQHA 4RW8B 3THVA 1SC3B 5HJXA 3QZ8A 3PHEA 4DWIA 3AQOA 1TKZB 2IYIA 2RDIA 2P9EA 1F2GA 5CZXA 1YJ9S 4A48A 3JSMB 2OPRA 4NZ0A 3GJSB 3J7AN 1H74A 2CPXA 3BDEA 3DOLB 3LP1B 1RT3B 4ZVRB 5CCMA 2AGQA 2ZH6A 3KK2B 2LLZA 4PAAA 2AEJA 4LFAJ 5KFSA 5AXLA 1JLCB 4KO0A 4F4XA 1RTDA 2GIQA 5LSLA 1Y4ZB 4CP5A 2D41A 4JI4J 4P74A 2KFNA 3T5KA 1PILA 3SMZA 3G6VA 3MDFA 3X3UA 2C3YA 3KHRA 4CLLA 2BJ1A 5F8HA 4A8QA 1S9FA 2ZJPQ 3IAS9 3EGWB 4L3KA 3R7SB 1SIWB 1SKWA 5K14A 2A6OA 2RHSB 3C14A 4ZPDA 2BM0A 5AE3A 3KMSA 2XS7A 3MXHP 1EETB 2HFNA 5DLFA 2HHQA 2VBWA 2NXJA 4OZLA 4X4RA 2VOOA 4Y3CA 3TA1A 3PYFA 4WK1A 4WTYA 4KGMA 4NLOA 2FC9A 3OTCA 4I64A 3ZC4A 4B3MF 2OPSA 3IS9A 1FDNA 4ED5A 2HZCA 4G1QA 5KFXA 4DV7J 1QAYA 3M9MB 1C0UB 5DM6Q 2NXUA 1Q86T 1MMDA 1W2IA 4EBEA 1G7CB 1Q95G 2YXLA 4JBCA 5DDRC 3SYZA 2AX0A 3QRQA 3P4UB 4TU8A 4RBTA 1YK9A 3ILLA 9RUBA 3CF5Q 4MFBA 4Y2IA 5H9FJ 4GC7A 3RB6A 1YBTA 2HS4A 4X4PA 4A8FA 1RWKB 2BJ9A 1ZA2B 3EGNA 1WC1A 2QA4S 2IC3A 1WOSA 4WPAA 3ZTOA 2G0CA 2AGPA 1GTEA 5HVGA 1S6PB 1SC6A 2VC1A 1ZS6A 1X4CA 2DCLA 2H54B 1GK8A 1RXOB 4LFBJ 1VLOA 2QLXA 3F0NA 3GG1A 1ZM9A 4WWSA 4O3OA 3WBZA 3EX7B 1GMWD 2DNYA 4G1QB 4U8YA 3KUGA 2HMIB 3BN4A 2MQ8A 3FVYA 4ZJLA 2P6TA 4DSKA 4OV1A 4YP3A 4OYBA 5GMKa 3TX0A 1IBMJ 4C8ZA 2BANB 1ROFA 5IOLA 1CG2A 2CPJA 4DSFA 5G0RA 3IRXB 4Y6IA 4WXWA 5B0FA 3GSDA 3UO0A 3LWLA 2J0QD 2IM1A 2YWHA 4M5DA 1LOUA 4B3RJ 1WORA 3SZ2A 1Y5LB 4RW7A 2ZD1B 1NHUA 2HSEB 3CW2C 4G6VB 2NR0A 1D3WA 2B7BB 3W66A 1R31A 1S1XB 1TKXB 5D15A 2EW9A 3CCRS 4B9VA 1KS2A 4HH1A 1FDBA 3OL7A 2C2OB 5KFVA 1RCXB 2UUAJ 4MK9A 3BREA 4DV0F 2WOMB 5I42B 2C28A 3LPYA 1Y5IB 5L8RC 2ILZA 3HKZD 4PXDA 2K8GA 2BANA 4K4WA 4MH8A 3G82A 3ENVA 2KI2A 4OZNA 2JL9A 2ZVIA 4CO0A 5HLFB 5E0OA 4CT8A 3RB4A 3QJJA 2JFKA 1RT4A 1SPBP 5E2QA 4CLYA 4NWBA 3KUEA 4P2FA 1X0PA 1M5HA 1FJCA 2EFOA 2RT3A 2XS5A 3R5CA 5CABA 4LQ9A 3D2WA 2KVQE 3HM9A 4ZIVA 4OYOA 2FHKA 3MHYA 4MFBB 3GONA 4M5GA 3NNAA 4IR1A 1UW4A 1WDTA 4C3KA 3EVOA 1F5BA 2KFYA 2ADBA 3W63A 2CYYA 2MZTA 5B7WA 4E8UA 2W1BA 4RUAA 4OI2A 3R1LA 1YJ7A 2UZAA 4JI3F 3A8IA 2R7TA 1R8PA 5HMZA 5CXTA 1AZSA 1NEEA 1FKOA 1WC3A 3RAMA 3MM9B 5HL7Q 2BUNA 3FEZA 4DR4F 3H42A 4LQ3A 3BR9A 3CJ0A 3ZZYA 4FBUA 2OP5A 4WF9Q 1OPZA 4EMDA 1K1SA 1HQUB 1SJRA 3A8EA 3BV8A 3KDOA 3LGMA 2IA0A 4M1KA 5K20B 4LF2A 1XNQF 4H54A 1YKWA 2FJDB 1Q5VA 2MQMA 4NA3A 3S7RA 4RNFA 2VOPA 3RJMB 3UPFA 4MYUA 3I96A 4QR2A 5LOQA 4NLGA 2K7KA 2CQ1A 1QVGR 1UPPA 2B4UA 2MDAA 4PWUA 1YTYA 3LAKA 3HFKA 4YR3A 2UVVA 1NBEB 1FRMA 2B0GA 2G0JA 1K44A 4MAKA 4QWBA 4ILMA 5E5NA 2YNIA 1MROB 4DLEA 5IZHA 2CNLB 2VFRA 2WB4A 2GA7A 2V8DA 4F7VA 4DL4A 4ZCMA 1T0TV 4I7FB 2VKRA 3PHTA 3OR1B 4OHZA 4C8KA 4M5HA 2MLYA 3MPVA 3QSIA 1HNIA 2NXNA 3SFGA 5B0DA 1SJ1A 3MMCB 3RBXA 1CULA 3IS9B 2IHR1 4NLXA 2X1AA 3RG6A 4MK8A 4PZVA 3EPIA 1UPMB 5B0EA 3QZ7A 3M6XA 5SUHA 2RS2A 1AW0A 2LQ5A 3DOKA 2WONB 1TL7B 1WHWA 2OUGA 5FDLA 4RUCA 3G6ES 1Q1KA 3HHKA 5IT9Y 5DDQC 5KT3A 3RRKA 1A9NB 2VB6A 5KFZA 2UXCF 2OPPB 3GPAA 1S4EA 1RTHA 2PT0A 2GV1A 2MZSA 4MKVA 4Z37A 2EG2A 2ZKUA 5C7PA 2DVIA 2IBKA 1QUPA 1FFGB 1HNVA 3CCUS 1KWMA 4ZPWR 2ZUAA 2DGVA 1HBOA 2D1CA 2B6AA 3K8VA 2W7AA 2MPUA 4O44B 1MN9A 2H65B 4IH5A 5HBMA 4DX5A 3L09A 2R2TA 1JJCB 1RTDB 4JI1J 2C22A 5IV4A 3FSIA 5E41A 4DR2J 2LDIA 5JUMA 1XEZA 3J81j 3KYLA 2J7WA 1RQ0A 4PCQA 4WFYA 4DR7F 5L1JA 5E3CA 2D69A 1RYSA 2C2KB 2CQBA 3MOZA 4Y34A 5J1NA 1X60A 2CADA 1S7HA 4B3TF 3MF5A 1PKUA 3OFEA 1YRXA 1F9FA 2NZCA 1KOOA 2KT3A 4KPCA 1TL3B 3CO0P 3DLLQ 4C8OA 2RU3A 6FDRA 3LA0A 2AZ3A 4WIIA 3VAFA 1URNA 4DSJA 5B0GA 4TNOA 3TOQA 2KXFA 2UXBF 2V50A 5KFNA 1UVNA 2V63A 4LIRA 2QN6B 2NXEA 1NJYA 4KV8A 3ENWA 1UFKA 1CBKA 3SCJE 2HNZB 2C3PA 4LFCF 1XMQF 5DQIA 5HAOA 3OTOJ 2CJQA 1NDLA 1RISA 1PAUB 2IM2A 3SFUA 2HGLA 4UOFA 1N6QB 1X5PA 2F7VA 3MEEB 4DR5J 2FY1A 2KU7A 4Y2AA 5CCLA 2XMWA 3ZNUA 1WTBA 3FKBA 1YVFA 3FBBA 4KR0B 5M2PA 1EARA 4WP8A 3GLJA 2PD1A 2VPZB 2JJ4D 3C6TA 4MMOA 1U49A 4JV1A 3L7OA 4B3MJ 4FYDA 3QAUA 1DTQB 2OPPA 3ETOA 2ZH8A 1OY8A 3JSYA 4OX7A 4U9RA 1WF2A 2E29A 3D1OA 4L6V3 1LFWA 4F36A 4RZRA 1J27A 1VCTA 5KG4A 1R27B 2CQ4A 2HHHJ 4I6YA 1YRUA 1OWXA 3EUNA 1S76D 3KLIB 3I0SB 3SCKE 1L3VA 4FYXB 3HXMA 4JI5J 3UD4P 2C42A 1LWCB 2XULA 4NPOA 4U6PA 2B4VA 2EFQA 1V6HA 1JJ2R 2VDIA 1X5OA 2OI2A 1NPRA 4WFZA 2DISA 4RO0A 3QQCD 3W3SA 2FVQA 4WXOA 1FWPA 2EKYA 3KLGB 2IJFA 3SSQA 4QQBA 3ADAC 4OZ3A 2CIMA 3MM7A 2AZ1A 1FE0A 3M05A 1AT1B 2GGPB 4LFBF 1F1BB 3H5UA 3RB3A 4JV5J 2D3OR 1RDRA 4RWWA 4F02A 3KG4A 1VBKA 3CJ5A 4OYAA 1WDDA 2HFSA 4CO2A 4A8SA 1VIXA 1RT7A 3QWPA 4XIUA 3RRHA 4QW9A 2C2MB 3C16B 3I6PA 2QYCA 1ZM4A 4RU2A 3T1YF 1U1LA 3LGHA 2OSRA 4IG3B 4O3QA 1C1BB 3MMBA 1RT1A 3QGGA 5F3ZA 4QWAA 1NJZA 3DCAA 1FT8A 2ZM6F 3L7PA 2HHXA 2CPDA 2OTJS 4YFUA 1FKPB 4ZVHA 4IDKA 2QFJA 3PRVA 1PBAA 4QIEA 2PO4A 4CLTA 1F3FA 4TXSA 3P45B 3JAMY 1PYTA 1KTQA 1IJEB 2GZOA 2NPIA 3DRSB 3BM7A 5KFLA 1VS3A 2CPHA 3B6BA 3C66A 3THPA 5GAHU 4DQPA 4X65J 3FGVA 3KNGA 2FLNA 5EGYA 4I6AA 2XMTA 2DXDA 4K0KJ 4KT0C 1N34J 2CQ3A 4X62J 3BDPA 3W5XA 3OHBA 3BF4A 3R5GA 3CUNA 3MPWA 5H9EK 2E7VA 2CDQA 1HHTP 1Q16B 2DNHA 2OSQA 1P1LA 4O23A 1LWFA 3EJMA 4X66J 2ZH2A 4EYIB 2ZJQQ 4ELTA 2D3UA 3KLIA 4WK3A 3SEOA 2BZ2A 1H73A 3Q8UA 4YDDB 1VQ6S 1NSAA 1XWLA 3H25A 1VBXA 3GG0A 1QLNA 3TYTA 3GWCA 3D0IE 4QIGA 4KGZB 3U1LA 5J2QB 2RUSA 1IBMF 2D9PA 3TEHB 2MXYA 1AUDA 1Q7YT 4DR1J 1F5CA 1TKXA 4ATNA 1C1CB 1UZDA 2M88A 3GIKA 5LXYA 3A8KA 3W9JA 2DNKA 2O5DA 4RW7B 5E3QA 3DM2A 2O1PA 3HZEA 5ETPA 2W7OA 5J2NA 4K4SA 3CCWA 3TAQA 5LM7E 2ALYB 3H98A 3MMCA 1JKHA 1VQYA 4JI1F 3TUJC 2ZNYA 2OMOA 3ZTPA 3CPWR 3QWUA 1FK9A 1HBNA 3BQ1A 1K9MT 4LBPA 2M9KA 5HQLA 4C6AA 5KFWA 4M5LA 1E6VA 2F4FA 4ECZA 3KLFA 2CPIA 4CLKA 1N56A 4C4WA 4LF7F 3QT8A 4NLQA 2HHVA 2XLJA 3HCXA 1RWWB 2F40A 3TI0A 1RAGB 1RUSA 4RJVA 2QMWA 1S9EA 2KT5A 1MU2A 3W9HA 4ECWA 5C42B 4QWDA 3FNNA 3ZZRA 1IR2A 2E1AA 3ISZA 5KFFA 4FNIA 3O1LA 3K58A 2R2SA 1IKYA 2GQ2A 5A8KB 1FXLA 1UAWA 4DUZJ 1REVB 2Q79A 3CDAA 3OXLA 1O51A 4NXMF 1HMVB 1B7FA 4OJ1A 4WU2A 2RSQA 2U2FA 3AOBA 3D6FB 3UCGA 1N5YB 4HHUA 4X4UA 3RUBL 3BJYA 3OUYA 2DR6A 1XNRF 4K5SA 3UVJB 4X64F 2HS0A 2VFUA 3FZ2A 3TA2A 2UUBJ 1FX2A 2R8JA 2RUGA 3C16A 1X4DA 4F0HA 4Q45A 4E2FB 4KTQA 4DU8A 1H6KX 3ET6B 2Y8YA 1PAEX 3U02A 4ZLLA 4DPXA 3DRYA 1G4CA 4PQUA 2GMLA 1R43A 1NRKA 1WHYA 3BEGB 3BGUA 3LOUA 3QO9A 3KHGA 4J9MA 1QAJA 2JEGA 4OLOA 3CJTA 2YX4A 2W4DA 2LFVA 4DR6J 4CH7A 1FFWB 1FRIA 3V6KA 4IFYB 2CJXB 3OTBA 3M2RA 2QLFB 2V5HG 3QLHA 4OI3A 1TL4A 3MUMP 2XBPA 3DLGB 3OSPA 4ANCA 2E9ZA 1JLAB 2FJBB 3AY0A 4YB7A 3Q89A 3GJRB 3WDOA 3KHLA 5L1KA 2RKIA 4EO8A 3IGVA 1HBMB 2AP6A 3MEGA 2R4FA 4URQU 4UW2A 1UEUA 3MGJA 4JP8A 5GMDA 1NK5A 2FLOA 5ETNA 4X4OA 4YB5A 1U47A 4F3OA 3RU0A 1OQ6A 2P6SA 2K7JA 3A8JA 3DRRB 2ERRA 2AJ2A 3BGRB 4N41A 4K4VA 4D3HA 1VRTB 4B17A 4P75A 5DZ7A 2KJVA 2E5LJ 4JV2A 1FJGJ 1RA7A 1VFJA 4RL1A 3AQPA 2YX7A 5D4LA 2Y1LB 2NPFA 4I2PA 3ZFVA 2EPIA 4USUA 4U7CA 1S1XA 3OL6A 1BY9A 2VH7A 2HS3A 3R97A 2R8IA 1HWIA 1VYAA 4DL3A 2FJEB 4JI8F 1RAFB 4MKBA 2B51A 2R42A 3MECB 3NCPA 4ETXA 1RTZA 3MR6A 1KFDA 3BBBA 1N6QA 1DRZA 4TU7A 2GO9A 3UVJA 2BKNA 4NMXA 1CJTB 4ZVPB 3OUYB 1VGYA 3OW2R 4DCOB 4UY8T 3EYZA 5E33A 4ITSA 4D3GA 2F8EX 3RGIA 5FLXU 4P7VA 2J6SA 2FJWA 1UMJA 3MPUB 2HIYA 3I9ZA 2VD3A 3S8SA 4CLPA 1IKXB 3GV5B 1BMQB 2VA2A 4IQXA 2EC2A 4HKQA 2FQQB 3NKYA 4DV2F 1LWEB 5D78A 5KFKA 4DLGA 4FF1A 2DITA 1BQNB 5LJ5Y 3K5MA 1WC5A 2DIVA 1NMEB 1D1UA 4K0KF 3JYTB 5L38A 1FNXH 5EWGA 1FJGF 1W7WA 2LXUA 2QTWA 1S1UB 4U95A 1JWWA 3WC2A 4DI6A 5H1SV 2CG8A 2FGCA 2RE1A 2VPWB 5K8OA 1TV6A 4C0BA 2G4BA 5F8NA 3EDRB 3BO3A 2ZHAA 1RLCL 2YTCA 2DR7A 1JLAA 2N7YA 4CH1A 5LMNJ 2WZ1A 2MQPA 4NCBA 2HHUA 1RAJA 2DB1A 3CCVS 1QY7A 3DNCA 2ZFHA 5D0GA 2AEMA 3O44A 5GADU 2RNEA 2GNKA 2UUBF 2DO4A 3C19A 4RKUC 4DR1F 3CCTA 1T95A 1GMUA 3H0PA 1SB6A 4PXEA 2MHNA 3G6YA 2BR0A 2UUCJ 1K0TA 1EETA 3H5SA 3Q8QB 3IR5B 2VBYA 4A8YA 2YKPA 3JTNA 4I2PB 4O4GA 4DG1A 1UVIA 4L76A 1X9WA 4DQIA 4J5OA 1CJVB 4IG0B 1EP4A 3UD5A 2FJXA 5AT1B 1VK3A 4XTTA 1IBLJ 3N9UC 4PWDA 1S57A 5HSPA 1I94J 4HT7A 3TNVA 4RX6A 3MCMA 1OSDA 4UUXA 3A12A 2QL9B 1CS4B 4CO1A 2LU1A 4OX9F 4DR3J 1Q8KA 3KJVB 2DH8A 2LQ9A 3LALA 4IH7A 3PIOQ 4ZLPA 3F44A 5HO4A 3HHNB 2KB2A 3IGNA 2XI3A 3V6HA 1HQ2A 4ICLA 3A3OB 3V6JA 4EBCA 1S6PA 5FIIA 3MCOA 5F8MA 1RBOB 4W98A 3FRZA 4RW8A 1BQNA 3PRDA 4NXMJ 3ENQA 1HLWA 3R6GB 2EBEA 4HTIA 3CWJA 4DCPB 1KONA 3POTB 4R8UA 2IJNA 4Z7CA 1XNQJ 3ZO7A 3EDQB 3M1VB 2OPQA 3KHHA 1T9VA 2K06A 4KBIA 5JXSA 1TP7A 2X3DA 4KRWA 3AAWB 1KQGB 4LBIA 1NPPA 2B9EA 1TKTA 3M8QB 4O0NA 1T94A 3TZYA 4RR5A 1NJIT 2UUAF 4F04B 4ECUA 1GNKA 1S1TB 2V2VA 2XMVA 5CYMB 2I1RA 4AT1B 3CB4A 4I2QB 3IG1A 3FQLA 3VAHA 4P73A 3M30B 1HWUA 1JXEA 2RH3A 4EO6A 4KE5A 2MSTA 2MMYA 1F9HA 1U8SA 2Y1RI 3KFWX 1T9UA 2IVMA 3NG8A 5FD1A 5K14B 5I3UB 5F9NA 4J9QA 4DUYF 2VFSA 2HPUA 3T5JA 4Q8FA 3TZXA 2Y1JA 4DV2J 1D09B 3RBEA 1Y3KA 2WCXA 1VRTA 1S10A 1RT6B 1WHXA 2E1PA 4CYUB 4UY85 1HWJA 4YY3J 3BO4A 3UDLA 4Q0BB 1VRUA 2ZHOA 1WEYA 1IR1A 1VMBA 3OD2A 4FPRA 4IFYA 1VI7A 3P5TL 1HI0P 3ISNC 1UZHA 4HHHA 1QSYA 2M8HA 2JEIA 4AQYJ 4EEYA 4YHHF 3QGHA 3K89A 3DLGA 3P96A 3T1YJ 3HO1A 2N4DA 5DGBA 4HYKA 3HT0A 4R5PB 2JEFA 2B4OA 2V2KA 3GILA 5ETOA 2CRLA 2ROPA 5ETVA 2GVZA 5MAOA 1SKRA 1YG0A 1SQFA 2FZKB 4LR7A 3PEHA 3TX8A 2XYHB 3NL0A 3GIIA 4F50A 1SL1A 2FJVA 5F0WA 3SDEB 3E2EA 3IWNC 3CD0A 4G65A 4PRFA 4BDPA 1YZ7A 1HNZF 4C8NA 3ZZ0A 3TJAA 1LW0A 3MTKA 2BJ7A 1VC6A 4NCGB 1UEVA 4UF4A 1N34F 2CZVC 2F5GA 2KDOA 2L9NA 4JV0A 4DSLA 2DBBA 3VAIA 2GMHA 3LP0A 1QTNB 2Y0BB 4ZVGA 2BXJA 4TLRA 2Y1IA 1CEZA 2VG7A 3G8SA 3BO2A 5DM7Q 2V0NA 2VG5B 1IBKJ 2CJKA 4NLDA 1IBCB 1U1MA
chains in the Genus database with same CATH topology
2M4MA 1U48A 2Q6BA 1RTJA 4KQZA 1JK9B 1WF1A 5K8NA 2XS2A 1IM4A 5IT0A 2KH9A 3OXFA 3UDCA 4M94A 4USHA 1KTVA 1VC5A 2XZWA 1H98A 3KWMA 4DL5A 5LL6d 2FC8A 2D3ZA 4PWDB 1MSWD 1MWZA 2B6AB 2Z8QA 4ES3A 1UVMA 3M8RA 2D74B 1YJUA 1N5VA 3LP2B 1HD0A 1QE1B 1JKHB 1S9GA 2PEHA 4WKYA 4PQUB 4I56A 3GIMA 3CMAS 3SDEA 3I56S 2B9WA 3UCZP 1R8BA 2VPXB 4ZOSA 3CT9A 3J7A1 4JUZA 4O4RA 2APOA 1HI8A 4IR9A 2J0WA 2MZQA 4ALZA 1K73T 2AW0A 5KTQA 3Q2TC 4L72B 3F41A 2MB0B 4J9PA 3DYAA 4Y28C 2L9DA 5IM0B 2HNDB 4ED3A 1YI2S 4N77A 5KT6A 1Q81T 4DV5F 1E6YA 3F73A 2CQ2A 1ZAWA 1LWCA 2HIQA 4F4KA 5BYQA 4KV8B 3NMAA 4OZ5A 1J5OA 2CJAA 1VRUB 3EZUA 4LJMA 1FTRA 1K8AT 3DRSA 4J9KA 4J9LA 1U1PA 4ED7A 4YB1P 1CLFA 4V19X 4EUVA 4PQAA 3G6ES 2WBMA 4Y2KA 2DNOA 2JVRA 4IO1A 5EGYA 1YJWS 4DEZA 2O67A 4I68A 3NCQA 1NK8A 1IKWA 3N28A 3ZZPA 3DLKB 5GAEU 1ZZNA 4TU9A 2JHEA 5KT7A 2F9DA 3IG1B 3CTRA 2LVWA 3D5MA 1RTIA 4OI4A 2DRAA 4MJKA 1D8YA 2V94A 3C6TB 1G2EA 5K9FA 1R8AA 3CC4S 3JSRA 2YVSA 3IA0A 1C1BA 3MMBB 3I0RB 1U1RA 4B3TF 3DLEB 4NMLA 2IRXA 4Y0FA 1UA0A 4MIAA 1UJ6A 1V9OA 1JLQB 2FD2A 3ZZTA 3FSYA 4DR3F 1KEKA 1YJTA 4DS4A 5FDLB 3T1HF 3V6DA 1DLOA 5KFEA 1A6LA 2EFNA 2KVIA 7FDRA 1NK6A 2DNMA 2HNYA 2DR5A 1GTHA 2HQIA 2DRBA 2MSSA 1J5OB 1O0PA 1SUQB 2LEAA 2LA6A 1HL6A 1Y5NB 5KFHA 2BJDA 1ZAVA 2KRBA 3Q8SB 1FESA 4H4MA 4ID5A 4BWJA 3BQ0A 3V6DB 4B9NA 1SQEA 5GADI 4IFVB 4ZHRA 3M32A 2HW3A 4EWTA 2L9WA 2YNIB 1GAOA 2MQQA 1N48A 1D9DA 1O8BA 3R5BA 2CJ9A 1N0VC 1KRPA 3RR8A 3G71S 4C9DA 1WG1A 3TAPA 3CDUA 4K4UA 2VA3A 1SJ3P 3GB0A 4YQWA 1RTHB 2OD4A 3T9NA 3NMRA 2XMMA 3TO8A 2AF6A 2JZ5A 4IKAA 4IG3A 5CA5A 2R8HA 3M2UB 3NCRA 3DOKB 2ADCA 3KLEA 3CDWA 4DS5A 1IKVA 3PW2A 2MGZA 3K5LA 1NU4A 2OO4A 2YY3A 4IOCQ 3X1LB 2K1RB 3IWXA 2NSBA 4RW4B 2VBXA 3W2WA 4X4QA 2IRYA 4YY3F 3PJXA 3OL8A 3OJSA 3DXBA 5IQ6A 4KB7A 2YH1A 1FA0A 2V8VA 1MROA 2MQNA 5DDPC 4RU9A 2RRBA 1KHVA 2DGQA 4F25A 2KRRA 3ITHA 3PX4A 1D9FA 2CFXA 5I3QA 5I4MA 2QEXS 4DMZA 5ADZA 2PFFB 1Z2LA 4C8MA 4KGKA 1RT4B 2I2YA 1AROP 2WRMA 2XMJA 4WU3A 4X62F 1FVSA 3TAMB 1DHMA 3LH2S 1V3ZA 3MD1A 4ILRA 2CQDA 5LJ3Y 2ALZA 4IG0A 1LK7A 4CO4A 5B0CA 2D9OA 1RWUA 1WHVA 1M90T 3G8QA 1BQXA 3H59A 5L9NA 2ZH3A 4K4XA 3KLHB 1X4BA 1Q8LA 1SV5B 3B78A 2RF2A 3IC1A 3SQGB 3H8YA 5CYMA 2W4CA 4MKAA 3PY8A 4URGA 2PDAA 1XK8A 1TR0A 2OKQA 4YR0A 4M5DB 5HP1B 2JC1A 4M8LA 3T9ZA 2IM0A 1GQEA 4I67A 1HW9A 2XC9A 3Q23A 4HH0A 3LP1A 4NLYA 2KZZA 1MWYA 5C24B 4JI7F 3QAEA 4H4OB 2GJIA 1O5JA 3KLVA 2BDPA 4Q0BA 4FVMA 2KHCA 4QIWD 4A47A 1HI1A 4YDXA 1XC9A 4FF4A 3MZIA 3EGZA 2DGXA 3J7YI 1S0NA 2XHWA 1ELOA 3E01B 2ZH5A 1LW2B 3NGDA 1TK8A 5KFUA 4OHVA 1PO6A 4FXWA 2FLPA 4B9TA 2ASDA 2ZZNA 3ZZUA 2L08A 4N8NA 3VAGA 2BW2A 1BWEA 2VASA 4ZKAA 4P6QA 3PX0A 5HROB 4DUZF 2VODA 5C25B 4LF8F 1JJHA 4DSEA 2FHJD 4OJHA 5HMYA 3FZBA 1FVQA 3MEDB 4KKOB 4O3RA 2DNLA 4ERDA 2JVOA 4GO5X 2HHTA 2Q43A 1HR0F 3OTEA 3K7RA 1X4EA 3VR1A 3DN9A 5J1EB 3HHLD 3OL9A 4OI6A 4OMFG 2KG0A 1S0MA 1CQMA 3EPGA 1N52B 1VHFA 2DHSA 2IC3B 2HRUA 1RKJA 2DHAA 1U1KA 2I9SA 1Y7PA 5EHHA 5KFTA 3K2YA 1JLCA 3P3DA 5M2RA 5CZVA 3MR2A 1JXLA 2W9CA 4ZS6A 1HBMA 3MEGB 4CTAB 3DLBA 1M0SA 4C8LA 4DHVA 4B9UA 2R2RA 5IQQA 2VQEF 3AB2B 3GYXB 4AL6A 1S79A 2RU9A 3T5HA 1WD6A 4AUKA 4TN2A 2YWGA 2XGPA 2LKZA 1JLFB 3N6MA 4BBYA 4N47A 5AE2A 3V81A 4CCHA 3MMAB 4Y65A 3T6BA 4LF5F 2J0SD 1U6ZA 1PSDA 4ZK7M 3AJ1A 4QR0A 4WFXA 2IMOA 2QO3A 3SSRA 4C3MA 1DARA 3D0HE 3MEDA 4KKOA 3T6JA 4LVNP 4A8MP 2J7UA 4X4NA 3TP2A 2J5AA 2GJ2A 4KO0B 1X4AA 5CD4H 5ITHA 1D9AA 2KO1A 2M8DB 2CG4A 2L3MA 1HARA 2V8HA 3ITHB 3PW4A 1TV6B 3HHEA 1NKCA 4PKDB 1KNZA 4DV1F 2XY5A 2DK2A 1Z2ZA 1JNRB 1TKZA 5EWFA 3MM8A 5T7LA 1HQEB 1C2PA 4N76A 2V8GA 3K0JA 1T03B 3VQTA 4DV4F 2RRNA 1U45A 1NK4A 3O8WA 3O2IA 3DXSX 2KTQA 5KG0A 2MGZB 4HEA9 4KFBA 2XI2A 2FVCA 4RNOA 4DQSA 3MFIA 1KC8T 4RW9B 2PA3A 2AU0A 4NLPA 4O44A 2BRLA 1NJXA 2UVWA 3PM9A 2R8GA 5MLCV 3SSSA 1YGYA 3W2VB 1TVRA 3TANA 4DG1B 4PG6A 2WBRA 2LQJA 3TW0A 2BJEA 1NK0A 4U7UK 3E01A 4ZPBA 4OZ1A 3T19A 2HG4A 1ZPWX 4RBVA 5DETA 3NLCA 2X1BA 3MM6A 4ECYA 2U1AA 1HBUB 1VBZA 2DH9A 1QUVA 2OIHA 1FF2A 2GX8A 2ZITA 2RKIB 3DU6A 2MY8A 4FN5A 4Y2CA 2E44A 2EC0A 1S0VA 1I1GA 3VWSA 1OS5A 1I94F 2UUTA 4AXJA 4YR2A 4X66F 5KG7A 5KOWA 4ED0A 2AJQA 1T7PA 3UR0A 2H5EA 5KFBA 4DFPA 4O3SA 4OHWA 2LEBA 1X5SA 5KOXA 2DJWA 2MZ1A 3I55S 4C11B 5D3GA 2HVHA 1AFJA 1FXRA 2OPSB 5DJBA 3DRXA 4OI0A 2RQ4A 1HHSA 4R0JA 3I5AA 2CVEA 5J2PB 4JV5F 2DPJA 2FHMA 4C97A 3BSAA 5KAKA 1QSLA 1Q8BA 4XAKA 3L3CA 2ZH1A 4AL5A 3Q24A 4GKJF 3G96A 2CQ0A 2QT7A 4KSEB 1HMVA 2ASYA 3FMWA 1ZTTA 2ATLA 3OVBA 1B64A 2M7SA 5KG6A 4AXIA 3OTDA 3MUTP 1S6QB 3K5PA 2AJFE 2CQPA 5J2QA 4BCAA 1HNXF 1AXQA 4C2MA 4I6WA 4DR2F 1UL3A 3RW7A 4MIWA 4ECTA 4DDFA 1VQSA 5B0AA 2ZH6A 2LEPA 4RW4A 3OVSA 4QU7A 4NZ6A 4XDDA 5IM0A 3IO1A 2XY6A 1U2FA 3EZ5A 2EVZA 1HBUA 5KFCA 1FHTA 1HYSA 3PV8A 1FK9B 1HBNB 3GV8B 2XO7A 4R25A 3S1TA 1NH7A 4ILLA 1LKZA 5KFPA 1VQ7S 2XCAA 2IFXA 2YNGB 4Q5VA 2X51A 1C4AA 2X3GA 4Q2MA 1KQFB 3OXGA 3VALA 2DPIA 3KTQA 1T05B 4KHMA 4WFBQ 2HYIB 1RT5B 1N5TA 4WE1A 1NK9A 5HI7A 1R0AA 4M63A 4TQRA 2J9DA 4ZPCA 1FD8A 2R7WA 3DHWC 4TYAA 2P9CA 3PJWA 1RTIB 3K57A 2G13A 1TZ0A 3NS5A 5AXKA 1IKWB 1Q7LB 2P9GA 4NL5A 2XCPA 3MM5A 3H4BA 1LWFB 2QE5A 4DFJA 2WSFC 1RTJB 1SH0A 1OO0B 3RZAA 3CIMA 4XPEA 1QTMA 3N6LA 4ZCKA 2V4RA 2BACA 2AYMA 2C2RA 1ZZFA 2EBGA 1JLGB 4X84A 2KN4A 2R7OA 3NAHA 2C3UA 3DLJA 1TQLA 1TFWA 1UFLA 1N54B 5EN1A 3IFEA 5U47A 2Q6CA 4DSIA 2E9RX 2ZOMA 5A8RA 3BZQA 3QPIA 1IQZA 3TRGA 4OL8A 1VQNS 3CJ3A 4LSNA 3DHXA 4HI1A 3I32A 2EK1A 4X4TA 5F0UA 4QZVB 3MPYA 1RT5A 1FNOA 3OR2B 1M5SA 1RGVA 3DM2B 5J2NB 3MFHA 2DNQA 3OTOF 2QV6A 2HHWA 1U2RA 2JEJA 2MZRA 1Y3JA 1GX5A 3PKYA 3M6WA 5HMWA 3FSXA 1Q53A 3JTPA 2GFFA 3MM7B 3DRPA 4KIAA 3V4MA 2DGUA 5JJBA 5BJRA 4R5PA 3IRWP 5CHCB 4ZVFA 2HGMA 3D1QA 4K50A 4YOEA 2EK6A 1UFWA 1FERA 2BABA 5DO2A 4O3NA 2LCWA 1E6YB 3BB5A 4F3MA 4CIOA 4PG8A 3PW0A 2J76E 3OLAA 1FCAA 3KG0A 5L1IA 4DR6F 1CQNA 3CIZA 4CTAA 4A46A 2HWIA 1CC8A 3JSMA 3HVRA 2OJ3A 2J8AA 2JX2A 4EBDA 5K8PA 1JLGA 4J9OA 3TUZC 3VZIA 1C0TA 2PC6A 1OPIA 5HLFA 2IVYA 2VZ9A 1MNEA 1XTZA 2JWNA 2MQLA 3CCMS 1S72S 2LECA 3NWGA 1JNZB 1WG5A 4QPXA 3M2VA 4TLQA 2RB7A 1NH8A 1KVJA 1GH8A 2MKJA 4LMZA 1S6QA 2BVZA 3DMJB 4HDGA 5DDOC 3CJ2A 5SZTA 1K1QA 2FHJA 5CYQB 4ES1A 3HP6A 1P1TA 3TUIC 3SI8A 3GFXA 5H9EJ 2VFTA 2XWYA 2X1GA 2QMXA 1RJJA 2B7CB 4PPZA 4TQSA 4LSLB 4Y2MA 4OX8A 3J7Z5 3AA8A 3D54A 5G0RB 1ZOTA 3KK3B 5KG1A 4Z2XA 1FKAF 2VUGA 3Q22A 1FJEB 3FCHA 1BC6A 2VG6B 2ZVSA 3PNIA 5KFGA 3KMQA 5D3GB 2UXDF 1FEHA 1WI6A 2GHVC 3HPOA 1T8EA 1GXUA 2ROGA 1Q82T 2RQKA 3E8OA 3FRYA 4CI0B 1KLMA 3E3XA 5T7LB 4I4BA 4LF9F 3PXGa 1DAXA 3NRBA 2ASLA 5AJ3F 2PMHA 1LV5A 2KFZA 2Z4PA 5A6PA 3DDNA 1L3SA 4DL7A 1EP4B 1S6OA 2XEXA 4NLSA 1DZ5A 1S6UA 2E5GA 1URRA 1HD1A 2ZUGA 2WTFA 3CC2S 2ABYA 1Y0HA 2PE8A 1DTQA 1HBOB 2MQOA 1S4FA 2Q66A 4DF8A 1S1WA 2FHOB 1FDDA 4OZJA 3D0GE 1FD2A 1FRJA 1U26A 2FPHX 3G86A 4NZ7A 1VQMS 2XLKA 3KLHA 3PRBA 5T14A 4ECXA 1U1QA 1HA1A 1B0PA 1YRTA 4RW9A 1VOMA 3LGNA 1P9QC 1BQMB 2PA8D 3C8YA 2FLLA 3RR7A 2DH7A 4HLBA 4CO5A 2CQGA 3QJPA 4FF3A 1U09A 4KHPF 1MW7A 3MM9A 4L3NA 2ILYA 2ZDOA 3LF0A 4K5RA 4J9SA 1U1OA 1M5OC 3QIDA 5F8GA 4HT5A 3POTA 4R8UB 1N8RT 2LXIA 1LFPA 4X65F 1YHQS 3V4IB 4UQGA 5DGAA 4JOUA 2XGQA 1K0VA 3MI7X 3J81Y 4NLTA 4V19J 4Q44A 1DQ9A 1VQ5S 4CZCA 5KG5A 4P2SA 5I3UA 4DL6A 1S1UA 4FS2A 2ROEA 2K2PA 1H0HB 2O01C 2BA9A 2BM1A 2CPYA 2MKCA 3Q8PB 3ULHA 2YWFA 4IOBA 1C0UA 4GC6A 2K1RA 1PGZA 2M3DA 1DQ8A 4XDCA 3R1HA 1YBAA 5J2PA 2ZOGA 1LW0B 1RKIA 4RW6A 4OHYA 1GX6A 4WZQA 4PXBA 3T1AA 2N4CA 1JLEB 3HVTA 4ES2A 3FQKA 4TY8A 3TR5A 1LXJA 1FKOB 1U4BA 1SKSA 4X2BA 1XERA 2GO8A 3DDKA 4U67Q 2R7RA 1KLNA 3CGIA 4F4WA 1HNVB 1NZAA 1DQAA 2VL1A 4MTPA 2AGOA 3R5AA 3VAMA 2A2DA 1S1WB 2HGNA 1S1VB 4A4JA 2ASJA 5KT4A 2IBOA 3IWLA 2QSWA 5E3RA 2MKHA 4ICLB 3PDNA 2N7CA 1L3UA 2DIUA 3TARA 1VQ9S 4JI5F 3NP5A 2HHHF 1LQ9A 2E7XA 3KJVA 5L39A 1HNWF 2I0XA 1J2VA 2IM3A 4QYRA 3OHAA 1D0EA 1U6BA 4NCAA 1GXLA 2A1BA 2PSZA 2HVIA 4JYAF 4ZPAA 2JC0A 1TAUA 2AJ4A 2NYIA 5HP1A 1OSCA 3LP0B 3N79A 4FZVA 4R0EA 4B3RF 1UVKA 1SJQA 2J7KA 3G4SS 4C7QA 2YH0A 3R5DA 3J80Y 5CYJA 2UP1A 3KK3A 3H5YA 4Q7AA 2CPEA 5C25A 2XLIA