4K0KF

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k0kF00
4DV1F 4B3TF 4DV0F 2UUCF 4X65F 4JI5F 2BVZA 4JI8F 4LF5F 4DV7F 4DV5F 2KJWA 4JI6F 4LFBF 4DR1F 1N36F 4JI3F 1J5EF 4DV2F 4OX9F 5AJ3F 4JI4F 1HNZF 4K0KF 4KHPF 1RISA 4LF6F 4DR7F 4X64F 1GH8A 4JYAF 1IBMF 4GKJF 4LF8F 4YHHF 3R3TA 3ZZPA 4LF9F 2UUAF 5BR8F 4GKKF 1VMBA 2UXDF 4DUYF 2BXJA 4DR3F 4NXMF 4JI0F 2B7CB 4DR6F 1QJHA 1XNRF 4X66F 4DR2F 1HNWF 2E5LF 2HHHF 4NXNF 5LMNF 1XMOF 1I94F 1F60B 4LF7F 4LFCF 5IWAF 1FJGF 2UUBF 1CQMA 4DR5F 2RJZA 2UU9F 4JV5F 4B3SF 2UXCF 1XMQF 4JI2F 4DUZF 1N33F 1FKAF 4LF4F 4AQYF 3T1YF 2F4VF 2VQFF 2ZM6F 1HNXF 1IBKF 4B3MF 2B7BB 5LMUF 4X62F 1CQNA 3T1HF 4DV6F 2VQEF 4B3RF 1XNQF 4JI7F 1N34F 3OTOF 2YY3A 1IBLF 1G7CB 4YY3F 2KJVA 4DR4F 4LFAF 1IJEB 4DV3F 4DV4F 1LOUA 2UXBF 1HR0F 2J5AA 1N32F 1G1XA 4JI1F 1IJFB 1B64A
chains in the Genus database with same CATH superfamily
5LXYA 4RW4A 3QT5A 1U09A 3FBCA 4DR3J 4ZN1A 5EDWA 5A2QU 1FO1A 1LW2B 3W3SA 7FD1A 4KO0A 1X4HA 2LXFA 2JH3A 4OI1A 1WACA 4QW9A 4I4BA 3Q8QB 1FKOB 4IH7A 3G86A 2FUG9 4G3IA 2QLJB 3M6XA 3T5HA 4ZLPA 1Q5VA 3TJ9A 2J7UA 4X2BA 1CLFA 2BJEA 2KYXA 2PMZD 3GJSB 4IFVB 2X3DA 1YKWA 4A8YA 4O3SA 4DFJA 1JJ4A 1HNIA 1U6ZA 4P6QA 3MPWA 1U24A 1X8DA 1SQGA 1YDLA 2FVQA 3NRBA 3C14A 4EUVA 1SPBP 2QMXA 2FQQB 1RTJB 3BSCA 4A47A 2HHUA 1IVZA 1CJVB 2BE7D 5KG2A 1OIAA 4OYMA 1Y3KA 3HSJA 1SC1B 2B4OA 3K2YA 2LDYA 1S1UB 3GONA 4P7VA 1HNVA 2CRLA 3T1HJ 2KFYA 1VBXA 3R3TA 3AA8A 3ULHA 3PEJA 5L46A 2GVDB 3EZUA 3IS9A 1GXLA 3R5CA 1QD1A 3OSNA 3O2IA 3TJAA 4F0MA 4UQGA 5LMNF 2RQKA 4NEYA 2V2KA 1NNDA 3DM2A 5CD4H 3D5MA 4NZ0A 5J1EB 4DR5F 1SJFA 2UVRA 4GVLA 4C6AA 3LP1B 5KT2A 4U7CA 1D8YA 3VGVA 2F65A 1U1NA 4J90A 4IKAA 3VV2B 4RNHA 1WSVA 5CYQB 4K5SA 3KLGA 4X84A 1X5SA 4J7CA 2FHJD 4NRUA 3M30A 3O5TB 3PTWA 1VRUA 3CCQS 5L1JA 3TZZA 4HH0A 4ZJQA 1PIEA 1SCJB 3MM5A 1L3UA 2FY8A 2HEKA 2BYCA 4G1QA 4XO0A 4OI2A 4DCOB 1GTHA 2RH3A 4NLYA 1LW0A 2QLXA 2WVEA 4HVZA 3BDPA 5D3GA 3N6LA 1N5QA 1UCNA 4DL0C 2CNLB 3SI8A 1RWKB 2NUHA 5B0CA 1HMVB 1OJ4A 3OTOJ 4JV1A 3C8YA 1IR0A 3SCIE 1HLWA 1T95A 1IR1A 3LALA 3EXYA 4N8OA 3ZZYA 5IT9U 1HKAA 4MK7A 5D0EA 5IC6B 2R8KA 3ET6B 2B5JA 2QL7B 4Y65A 1TQLA 2R7VA 3G8QA 1M90T 3HHLB 1QSSA 3NCQA 4I2QA 1YJWS 2RF2B 4ZS6A 2DHAA 2FYXA 1VJWA 4MKAA 1QVFR 4ZN3A 4LVNP 2O5DA 4RNOA 2Q1LA 3M8PA 1X4DA 1MU2B 1NSAA 1R6VA 2DHXA 3B4MA 1PJ6A 5KFKA 3NL0A 2ZOGA 1MSWD 1OPZA 4O3QA 2E7XA 3KLIB 1QTNB 3HJFA 5D78A 2W25A 1TKTA 5KT3A 2E29A 2WZ1A 1PSDA 2HIQA 4DF8A 2OPSA 4FYDA 3OVSA 2OSQA 1Y5IB 2R7OA 2AZ3A 1NM2A 1D0EA 3D6FB 1R31A 2GJIA 1R89A 3MTJA 5BJRA 3QZ7A 2H4WB 2OPPB 2HBRB 4M63A 2MTLA 1FWPA 4WF9Q 3VQTA 2NXNA 1JMTA 4KY3A 2GX8A 2AP6A 1UP1A 3U7JA 4F3MA 4QOTA 1V3ZA 1VIXA 3KJQB 5F9NA 4GKJJ 2GZOA 3AD9C 4F4ZA 3A3OB 3GSIA 4QIVA 4L73A 4MYUA 3AD7C 4C97A 2DK2A 2H54B 1MW7A 1SJ1A 2LEPA 1RA6A 4FYWB 1UVLA 4F26A 4NEZA 2Q6BA 4MIWA 1OQ3A 2H51B 2GHWA 2GQCA 3CO9A 3JSMB 3NS7B 2LDIA 3BGOP 4PPZA 2ADCA 4WU3A 3TUIC 2MEWA 2IYIA 1IQZA 4CLFA 2BJDA 2B7CB 3R9LA 4KYZA 3J81U 1S0NA 5K20B 1KFSA 3DRRA 2IMWP 4I6YA 2VJUA 3LW5C 1JLGA 1RP5A 1QTMA 3CXCR 3DXSX 3HF5A 3TOQA 4OYBA 3T3FA 5EWGA 2L9DA 1TKXA 3MMCB 3TA1A 5B08A 4NLGA 2VOPA 1Q0NA 4CO3A 5FDLB 4JI4J 4B9LA 4GMKA 2POKA 2A6OA 1HPZB 4I56A 4ED8A 4BBYA 1T9WA 3MMAB 1NLKL 2WONA 4P9SA 4WJBA 4CDIA 3I5AA 2UUCF 3CO0P 4X65F 1C1CA 2D74B 3WBZA 2XY5A 2RAQA 2AYBA 4U9RA 3OV7A 4ALZA 1TL7B 4FPRA 2FGOA 3SV4A 5ITHA 3MAQA 2KXFA 5ETPA 1NB2A 2FJVA 4ZVRB 1PYSB 4OZ0A 4LRFA 1VRQC 1YJ9S 2VUGA 1VMBA 3R97A 3SDEA 3PKMA 2WTFA 3UQSA 3N0VA 3MM9B 3DXBA 1RWPB 1Y5LB 3BH6B 3MUTP 1DLOB 1MWYA 4KB7A 1E6YB 3KLEA 4LRCA 2GVZB 3OW2R 4UOHA 2RJZA 3IRWP 3LGHA 2YQ3A 2BOAA 4AQYF 2CJKA 4KFBA 2CQBA 1IWGA 2ZM6F 3R5AA 2UV8G 1NKBA 1CEZA 4MFBB 2CQ0A 4LIRA 2K1RB 2B51A 5J2QB 2CDRB 2AGQA 1JXLA 3CCVS 3QT8A 4DV3F 1QE1A 2I5JA 3BDEA 4CNZA 4A8KA 2XNQA 1KOOA 3OJSA 1UWBB 1SVDA 2M5YA 4FNIA 1CS4B 4LBIA 5MAOA 4P71A 2A6MA 4IOAQ 5J2MB 4MYTA 1PGZA 1WOPA 3BO4A 1APSA 2B0GA 2BA9A 4RZRA 4DFKA 3C6UB 2F1FA 2EK6A 4WP9A 5AE2A 4Q8FA 4KT0C 1TKZA 2FJWA 1L3TA 2VQFJ 1LWEB 3VVUA 1TFWA 3K89A 5LMUJ 3KJFB 2CADA 3KMQA 2MHEA 2OH2A 3CJTA 1LFPA 2ZUGA 2OFGX 5A0YB 4HEA9 1YZ6A 3QRPA 3POTA 1GQEA 1ZM4A 2XQCA 3KKFA 5I3PA 3VAIA 3IR5B 1C0UA 3BGRA 3M6UA 2ZE2A 1FWKA 3OL7A 4YN3B 3IGVA 4EI2A 2Z2YB 4IH6A 4JV5J 3FEXB 4USWA 4EGLA 3W63A 5DQHA 5KFXA 4KSEB 4OZ1A 4OI6A 1J2VA 3TNVA 3BYRA 4ERDA 4PWDB 4DWIA 3BQ0A 3E01B 1CULA 4HHJA 2C2MB 1EARA 1F5AA 2V8HA 2VQEJ 3IMQJ 5AT1B 4OYOA 4DSJA 1N34J 3VAFA 4UUWA 5F8LA 1QAYA 2GO9A 2MY8A 2E9TA 1QVGR 4OZLA 3DOLA 2NXJA 3RJMB 2FHJA 3NBPA 2P9GA 1P9QC 4F3QA 1S48A 3UI3A 4RW8B 4MK8A 5G4DA 4DG1B 4F4KA 3ZTOA 1NPRA 3PO5A 3W2VB 5E3AA 3EE3A 3ENWA 3SSSA 1SJRA 3GFZA 4ED1A 1EQ0A 2FZKB 4RNFA 2LA4A 3DOKB 1JNRB 1VBZA 2JEGA 5KFOA 3C19A 2OFHX 3T9ZA 1RT6B 2Z57B 3KHRA 2Y3YA 3BKTA 5HMZA 5I3UB 5CHCB 2V8GA 2N3LA 3B78A 2MY7A 4JI8F 3ELHA 1RZMA 1DRZA 4URGA 3SBMA 1FNMA 1QSYA 1HBUA 4IG3B 2FLNA 4O0IA 2C3YA 2VODA 1T03B 4NCAA 2EFGA 1WG1A 1S6QA 4A8XA 2Y8YA 1HD0A 3CCUS 2ZFHA 3THTA 1FEHA 1CVJA 8ATCB 3PX6A 2GHVC 4QR2A 1VI7A 3ETOA 5HLFB 3HX9A 4ZVFA 1S0OA 3EDQB 2VG6A 2IA0A 4LREA 3RBDA 2HBQB 3P4UB 1UVMA 1VRTA 4CLUA 2QO3A 4X4TA 1D1UA 2CPHA 2C2OB 1JJHA 1FWLA 4OLPA 3CJ4A 1VFJA 1RAFB 1LK5A 4RPFA 4DX8H 2GQQA 3CCES 1U02A 3SXLA 4TU9A 3GZ7A 4USHA 2AGPA 4OI3A 4O3NA 3VGSA 4OJ1A 1TELA 1SB6A 3JTPA 4LFAF 5ETNA 2XGQA 1S57A 4PZVA 2YNGB 4Y3CA 1KVIA 1U1QA 1T0TV 2CG8A 1B64A 1WHWA 3CC2S 5HMWA 3PIPQ 4J37A 1R8AA 5H1SV 1NHVA 2QMWA 3R5GA 4YR0A 5KOXA 4LSNA 3IC1A 1CJTA 3LWLA 4RNMA 2GO8A 3QT6A 1R0AA 2LKZA 3CCTA 3FRZA 4DPYA 4IG0A 3WIVA 3OFEA 8AT1B 2DGUA 4M5DA 3JTNA 1XMBA 2PFDA 2WVCA 4B9MA 1ELOA 3RZAA 2J8AA 2YWHA 4Q0BA 1H2UX 3I55S 4C8KA 4DL6A 1RT3A 1CJUA 3MFHA 2F4VF 1Y9OA 1IKYB 3G87A 3OHBA 3CJQA 4DV6F 1R43A 1NK4A 5A8WB 3MHYA 2VIHA 1WC4A 3IRXB 2DR8A 4ID5A 3GCXP 3CT9A 3CC4S 1RWMB 2VJVA 3CCMS 4DEZA 3DYAB 3FUYA 3T5KA 2IJRA 4LF5F 2KN4A 3FRYA 1JLEA 1WD6A 1FVSA 2FC9A 2HK3A 1N6QB 1K0VA 1FDNA 2XS5A 1OY8A 3GB0A 3F56A 3BGFA 3BKFA 3MM7B 1KLNA 4N47A 1X5PA 4RW7A 3KHHA 3DLKA 1DQAA 1R8HA 3P96A 1KP6A 4WZQA 1PBAA 4UQTA 2OPRB 3Q22A 5HVHA 4LF1A 1FCAA 3HVAA 3BN4A 3LOUA 3SCJE 4GVBA 1FKAF 1NXIA 4CH0S 2V0NA 4H4MA 1RT2A 3UNYA 2QLFB 2OD4A 1H7WA 3P45B 1NU4A 4ID8A 4P2XA 3PYFA 1J5OA 3HHDA 2RT3A 3QFHA 4XPEA 1WC3A 1I94J 2GS8A 5KFMA 1W26A 4NCGB 4W92B 3TUZC 3OUYA 5K8MA 3AB4B 5KG3A 1MG7A 4FP9A 4WFAQ 3T5JA 3VAGA 5DRKA 2DEIA 2V50A 3WDOA 2DNRA 4LMZA 3PYDA 3R2CJ 2U2FA 3HFKA 3HT0A 1W2BR 2MZJA 4FS1A 3L7OA 4DR7F 1Q16B 3W64A 1PC4A 4LF8F 1RHJB 2BMBA 2RSQA 2BM1A 1NMEB 2QJ3A 2A18A 1X4CA 3D67A 1AT1B 1VLOA 4NXMF 2RU3A 3L09A 2CQ1A 2B6AA 1G2EA 3OBIA 2EFQA 3CCSS 3HPOA 2YNFB 4NZ6A 5KFAA 2RRAA 3H4BA 3QWPA 4WYLA 2HK2A 1SUQA 2B8PA 4PCQA 4KAIA 3DMJA 2I1RA 2F8EX 1HQEA 3VAMA 2XMAA 3PZPA 3H59A 1YG0A 1UW4A 2F3JA 3KNGA 3RRHA 5CQGA 3BYPA 2N3OA 5I42A 2KVQE 1S0MA 5HI7A 5T7LA 1AYEA 1FRLA 2HBZB 4HL9A 1M5HA 3M1VA 3KJVA 3N79A 1K1QA 4KH1B 5GAEI 2XYPB 4R5PB 5ETSA 4JI6F 3KFWX 4TLQA 3SZ2A 4MJKA 4IFYA 4DPTA 1XEZA 4F36A 2ZD1B 3NS5A 2D1CA 4TY9A 4NI2B 3W1YC 3TVKA 2KI2A 2P9CA 1FX4A 1Z4UA 5HROB 4Q43A 1HBNB 2KG0A 3GSDA 2PI4A 4AQYJ 2FVRA 4F3OA 1ZPWX 2YKQA 2ZM6J 1HHQA 3P6YC 2JEIA 1TMJA 2LQ5A 3UR3C 2BRLA 2QL5B 2RDIA 3CDWA 1RT7B 3KK1B 2IJFA 3CUNA 3D68A 4K2XA 1O51A 5CZXA 3TAMB 1H72C 4A8WA 4DV3J 2UXCF 1OWXA 4USIA 4Y0FA 4NOHA 1R8PA 2E44A 3BGUA 3HFZB 3OR2A 4ZPCA 3OTDA 2BR0A 1DTTB 3J80U 2DY1A 2JOQA 1YBTA 5D4NA 1UFWA 3FZ2A 2XO7A 2QSWA 1SL2A 1HYSB 2BJ3A 2VBYA 3C46A 5DQGA 1FRKA 3QLHA 1VQOS 1RTHA 5CYMA 3DGPB 4OYXA 4B3TF 2BBEA 2KTQA 3BKUA 3LP2B 2JWNA 1JLAB 4EBDA 4K4SA 1FFGB 1RISA 4ZPVR 4PYAA 2XSFA 2KVIA 2DIUA 5F3ZA 1S1XA 2AJ2A 3N5BA 2B9EA 3M9OB 2OEMA 2XNRA 2UXDF 2V68A 4J9UE 2PD1A 3M8SA 3EYZA 2V9KA 4I69A 4EMDA 4C9DA 1P1TA 5JJBA 2N7YA 3IBWA 2FB0A 1N0UA 1U8SA 2HAFA 2YBVA 4OIXA 4URSA 4JP8A 3IN5A 4UTGA 2YPZA 1YI2S 1KSPA 2J76E 1NZ8A 4FYYB 3OHAA 5GVQA 1UMJA 1IR2A 2HFSA 4TVAB 4ES1A 1TAUA 5D15A 5J2PA 3W62A 4RBVA 3BPDA 2QA1A 1RAJA 3RW7A 3ISNC 4DV1F 3Q24A 2W4PA 2MLZA 1TUGB 2H5JB 1F5BA 1T3OA 4DX5A 4DV2F 2M2BA 3HLUA 3KHGA 4MK9A 4A8OA 3U1LA 3PNIA 5F8IA 2XI2A 2FJBB 1IM6A 3PYEA 5HBMA 1SL1A 3M2UB 4WP3A 4FVCA 3RAMA 1LW2A 4E2FB 2ZH6A 4QU7A 2HW3A 1YJUA 3PR4A 4DUYF 1HBOB 1EP4B 2GW8A 1BQNB 3L7UA 1HNWF 3DRSA 3M8WA 2HHHF 1UZDA 3MEDB 2QFJA 1H6KX 1X4EA 2JLEA 3E8OA 4JYAJ 1GX6A 5ETKA 4F50A 1FRJA 3BBFA 1N48A 4HHUA 1UKUA 4IFVA 2QN6B 3QIPB 5THWA 4WYWA 4ZP8A 1T3NA 4F4WA 2HWHA 3HXMA 3RBZA 2J6TA 3Q8YA 1FT8A 4USTA 2RILA 2B9WA 4X4VA 5HK4A 1QAXA 2HVIA 5E33A 4FXVA 2C3OA 2YQ1A 1YITS 2JNJA 1B0VA 3MM6B 1N5YA 5DJBA 3OR1B 4WCEQ 1QUVA 1RTJA 4QCLA 1FERA 2C28A 2Z2LA 2ROPA 2ZOMA 1UJ5A 1CJVA 4OHZA 1SIZA 2HLTA 3CMAS 1U0HA 1FJEB 1UL3A 4JV2A 1S10A 2E1AA 2G1HA 2DR7A 5F41A 1S1UA 5D6GA 2OSRA 3ZNUA 2AJ4A 2G2OA 4YR2A 2ZH9A 5FJ4A 3NGKA 1U48A 1WEXA 4S0MA 2EWHA 1TFYA 2GVDA 2P9EA 3MEEA 3TWZA 1VQPS 3OXFA 4CLLA 3J7ZT 3S1TA 2DIVA 1YVFA 2JL9A 1V5VA 4YDDB 2ZVIA 2V4QA 5J1EA 2IDLA 3EPIA 5DG9A 2B9XA 4NLXA 3EUNA 2XYGB 3K57A 1KVKA 1L3KA 4FKYA 2C3PA 5A8RB 3LP0B 2ZHBA 3AJDA 3KUHA 5BXIA 4PXDA 2YXLA 2IVYA 2IA6A 2VBXA 5HATA 4N76A 3R2DJ 4GC6A 4E98A 4IRCA 4CLZA 3EVWA 2BKNA 1ZPVA 2WOMB 2V9WA 1RHMB 1N56A 3M05A 4WKRA 1YRUA 4PR6A 3KLFA 4A8SA 1VQ4S 2JEJA 2XMJA 1KLMA 3CJ2A 4C2MA 1YBAA 4DV6J 4HDHA 1EETB 1Z2ZA 3UDLA 5D0RA 1XMOF 4U8YA 4FNHA 1Y4ZB 4C0BA 1S79A 4KKOB 1WG5A 3QQCD 1FJ7A 1TL3B 1TUVA 1RHUB 1Q81T 1SQFA 4LF5J 2B7BB 3TVYA 4KPYA 1XTZA 4JI0J 1YX2A 3UN5A 3JAMY 2OD6A 4YY3F 3HVTB 4CLKA 4DXLA 3KHLA 3OTEA 4LFCJ 1H0HB 1HR0F 3TO8A 2W9CB 4NX9A 3M4XA 4DV5F 2QLBB 2YKNB 1N36F 4Y6IA 4YR3A 2RF2A 4PG7A 1JJ2R 2BX6A 1JJCB 3GFYA 1TL4A 2WW4A 4WE1B 4YS2A 1KBRA 4KHMA 3H5YA 1MU2A 3OQ2A 3P8BB 1BUXA 5B0EA 1ZBTA 2HMIB 2BE9B 5KG5A 1U45A 2F4FA 2W8LA 3GFXA 2C1EB 2VV5A 3KLIA 1FRXA 2RKIB 4NLTA 2LQ9A 3V81B 4PUOA 4LF4F 3D1HA 2EVZA 5KFWA 1FRHA 1X9MA 3ILJA 3OVAA 2L41A 2VPYB 2V94A 3TX0A 1QAIA 2FZGB 1IKWA 1RTIB 2OIHA 1S97A 3U27A 3J7AN 2ZDPA 4NLRA 4LF8J 2CQCA 3DLGB 2AU0A 3AT1B 3NOGA 2IC3B 2BE2A 2AV5A 3DLLQ 2WVDA 4ED3A 4JI3F 3IM9A 1FK9A 3G6YA 1N88A 5J1NA 4XIUA 2RD5C 4KGVB 4DQRA 1AUSL 4AYBD 1VQMS 2ATLA 2U1AA 2IAJB 1B70B 4R25A 4IR1A 3CJ0A 3MMJA 1UVJA 1WTFA 3MCMA 2L48A 2XHCA 3G82A 2KZZA 2UXBJ 2MQQA 2PA8D 3ZZZA 1MWZA 4ZIVA 2OTJS 1W25A 2HHXA 4X4RA 1XR7A 3AH6A 4A8FA 3SQGA 4B3OA 3JSMA 1TVRB 3U02A 4DUTA 1FJGF 3HZEA 4OYAA 3HHEA 2CJAA 1EQMA 5IV4A 1ITPA 1JLCB 3M8QB 2ZNYA 3GFHA 2VG7B 2PMWA 4PABA 3UR0A 3ADAC 3TX8A 3DRPA 1IBKF 2ZH3A 4JI6J 2RS8A 2XLJA 4EZ9A 3ZTPA 2IRXA 2D9PA 5IT4A 3S8SA 2LMIA 4ZVEA 2B56A 2OPQB 4ZHRA 1I51B 2Y8WA 1AUDA 3MM8B 4EYIB 2F7VA 1K9MT 3CCLS 1JWWA 3V2UC 4K4YA 3VVTA 2IM1A 2KL8A 3MEKA 1RAEB 2GMJA 3ONQA 5ETVA 2ZZMA 3ILLA 5HVGA 3JYTB 4Y2IA 3ZFVA 1I3OB 2UXCJ 5KFYA 4NPOA 3GJQB 3V4IA 4B17A 2DNZA 4GRSA 3QYYA 2K7JA 2GFFA 3QNWB 3G6ES 4I7FB 1KWMA 3EGVA 1HQ2A 2DH7A 3M2RA 1TL1B 3AODA 4CLWA 1S5ZA 2ZHOA 5KFQA 3UNGC 3A12A 4LSLA 3TA0A 3OVBA 3MMBA 4ENOA 1NK5A 2EPIA 5F8GA 1E6YA 4F4XA 1M1HA 3CD5A 3JQKA 3NP5A 5J1PA 1FA0A 4KR0B 5GAGI 3CTRA 5GMDA 4PKDB 2QZ8A 4J9KA 4R8UB 4ILRA 3PXGa 2RQMA 4JI2J 5ETTA 5CYJA 1Q8IA 2CYYA 4QBUA 5LJ3Y 3NNCA 3WHIA 5RUBA 3K0JA 4C8YA 4C0HA 2MDAA 5C2GA 4WK1A 5J2NB 2MKCA 1REVB 1WKLA 2OP5A 1B3TA 1P1LA 2OMOA 2FLPA 3QWUA 1IBCB 1CS4A 5KFHA 2G2YA 4HDGA 4ZIWA 5J2MA 2MKSA 5KT5A 1U1PA 2XMUA 2AEFA 4I2PB 4ZVTB 4C8NA 1WKJA 5EWEA 4ZPTR 3I96A 1X60A 1ZOTA 2DGVA 2L9WA 2XMVA 3VHQA 1XMQF 1SC4B 4XK8C 3D6HB 3ISND 3MR5A 3D28A 4KC5A 1S9FA 2J7KA 4X62F 4F0KA 4KV8B 2CZ4A 5A0YA 5AE3A 4R0EA 1WELA 4OL8A 5E3RA 5HQLA 2BW2A 3HM9A 1UA0A 1S49A 2NREA 1LWXA 3FSYA 1VR6A 5F9LA 2XO6A 3D66A 2XWXA 4DV7F 1NB7A 1S99A 4Q44A 3HHNB 1HNWJ 5KFUA 4KGMA 5C25B 4UY85 2R7RA 2A10A 4NRTA 3FQLA 1A7GE 2QX0A 4QR0A 3NY0A 5LXRA 4AFFA 3PW7A 2CXEA 2NLWA 2CIMA 2WCXA 3QT7A 2EKYA 3E01A 1T9XA 2BDPA 2OELA 2QEXS 3M2VB 2PO4A 5CXTA 3H2LA 2DGTA 4YMEA 2BUNA 2HZVA 2XC9A 3MWBA 1S0VA 2YKMA 2P8IA 4DSIA 2EK1A 4L3KA 5AXNA 1YZ7A 3EZ5A 1KN6A 3RGIA 4ELUA 2GCFA 2IDEA 2RU9A 4RWWA 2BABA 3DU5A 1GMUA 2DNYA 4N7TA 3DI6B 2OGUA 4AXJA 3DOKA 2CJYB 4RX6A 2K3IA 2ZOFA 2J7WA 1RT6A 4X64F 3IAS9 2MKIA 4Y34A 4DU7A 3FGVA 1FD8A 2RUSA 2WAQD 3Q8RB 2AEMA 4IG3A 2ZH8A 1T03A 1OQ6A 1FXLA 3IG1B 5K8OA 1UTAA 2D69A 4TQRA 1JKHB 3PJXA 5K9FA 1HHTP 3G8SA 5AXLA 1TP7A 4U7UD 3FNNA 5A76A 5M2RA 1N5VA 1RAAB 2C3MA 3H8YA 2EFNA 1GX5A 2R2SA 1PYOB 1XN9A 4CCHA 4K4VA 5L9NA 5DLGA 2WRMA 4C11B 1WHYA 3MDFA 3HMJG 3Q8UA 2UU9J 3JSBA 7AT1B 4ZVSB 4DV0F 4RW4B 4J9MA 3F0NA 3CC7S 5CH7B 2EXUA 1Y10A 4J9NA 1XMOJ 4RUHA 5DDPC 1MROB 1XWLA 2CJQA 2HGNA 3M6VA 2YNGA 4ZOSA 2ROGA 1HI0P 3BF4A 4QWBA 5FLXU 1XQIA 2ZJRQ 4WIIA 5KFLA 2ZBRA 1RXOB 1M5SA 3H42A 5EX0A 3CCZA 2UV8A 4C48A 2AT1B 4TY8A 2N82B 2A0FB 2XZTB 1WEYA 2MZTA 3N6MA 2ZBIA 1FFWB 2VFUA 1WSRA 2JC0A 1HNZJ 2RMLA 1B99A 1ULRA 1RWVB 2QC3A 2QLWA 1X31C 5E3PA 5KG7A 2YWEA 5BR8J 4IQMA 4N5SA 1N36J 1FHTA 2Z2ZA 3C14B 2COLA 1BQMA 4I6AA 2HVZA 2YKAA 3CF5Q 2AGOA 4LF7J 1RAIB 5F3TA 1RACB 4ZJLA 2KFZA 2AKWB 2AX0A 1IKYA 4OHYA 2FJAB 2IM2A 2IM3A 3AQOA 4RNNA 3EGZA 4M5GA 3IO1A 4CI0B 1KFDA 3IRXA 1HNXJ 4B3MJ 2ZBQA 1HNVB 2MJNA 2AYMA 2RE1A 4FBUA 1RSCA 3ZZPA 5BYQA 2E7VA 2VG5A 3MGJA 3NMRA 1BC6A 2YWKA 5DQIA 3IS9B 4JI5J 2YKPA 1S9EA 4OX9J 2NZCA 4LIWA 3DM2B 3ICLA 3HSGA 3AQPA 4E8UA 2EFOA 3IGNA 3T9NA 2ABYA 2DRDA 1S9GB 1IWAA 2ZH1A 2MQNA 3IA0A 1Y3JA 2R8GA 4JI7F 2EW9A 4IOBA 2KKHA 3KLGB 4LRBA 1SKSA 3A8KA 2KM8C 1NJYA 3D3CJ 2DPJA 2DXDA 3QSIA 1VRUB 4EO6A 1NEEA 2DNQA 3TEHB 4P75A 1RTDA 1RKIA 2X51A 1YQHA 3JB9k 3DLEA 2V8VA 4ILLA 4HTIA 1BD6A 4YQWA 1PCAA 1RE1B 4G1QB 6AT1B 1ACMB 2FLOA 2DRAA 1LW0B 3PR5B 3AFGA 2LU2A 1N32J 5D3GB 1X5TA 2BJ1A 1UPPA 2CWKA 3HSDA 3T1AA 4DPOA 4J9LA 3H2VE 1XNRF 3QJLA 1FEEA 1S59A 3FMWA 4U8VA 2HNYA 2FY1A 3H5SA 2XM3A 3BQ1A 5JVHQ 2DKOB 4MKYA 3MOJB 3THPA 4OI4A 3RUBL 2IY5B 2XBPA 1VCTA 1R6YA 3M8YA 3CCWA 2YWGA 3W8PA 3I4PA 2EC0A 4G1PA 3NWRA 5IV3A 3TEGA 3OTBA 2UVVA 2H5EA 4IRKA 2J0SD 3CDAA 3M8PB 3W2WA 3VZHA 1QLNA 3I0SA 3HP6A 4F0HA 4Q45A 3W9HA 1K73T 1RT5B 2CPXA 1TTHB 2FHMA 4OYPA 2WVFA 2IFXA 4OYWA 4DDFA 2D41A 2E9ZA 1TKTB 3RB3A 1SV5A 2Z30B 4MTPA 2BV3A 4ZPWR 1V3SA 3TZXA 4CYUA 2HGMA 1UZHA 2ZD1A 3KG1A 4JB8B 3G71S 2HBYB 2IYGA 4QR1A 2D3UA 3GIRA 2ZH4A 4ZVHA 1HHSA 3UN2A 1HBNA 1HW9A 2JJ4D 4O3PA 4DUZF 1S12A 3ITHB 4OYIA 5T41A 2YWWA 5C24A 1RT7A 4OMFG 1R8BA 4WP8A 4EU0A 3NAIA 3G4SS 1WOSA 1D9AA 2MKJA 3QATA 1FTCA 2WK4A 4QIWD 1AA1B 3ENQA 3EM1A 1LWFB 1Q4RA 2V8DA 2MQOA 1NK0A 3IFEA 3PW2A 4X4UA 4CQ1A 1AB8A 3NNAA 4CTAA 4ZPDA 3CDEA 3MOZA 4KIAA 1XMQJ 1UAWA 2UUAF 1DFDA 2X1GA 3ZZRA 5E5NA 3LP2A 1JLAA 3HKZD 3GG0A 3N9UC 3PW5A 5HSPA 2E5LF 3OT9A 3W65A 4TKTA 1DQ8A 5SZTA 3K5PA 4K0KJ 2QA4S 4USMA 2CPJA 3I4HX 1D09B 1YRTA 4A48A 1KHVA 4C7QA 2HNDB 1GMWA 5LL6d 4I1TA 2LXIA 1ZA2B 2KHDA 1TKXB 3IWXA 2XYHB 1NHUA 4O0NA 2HS0A 3H40A 4NXNJ 2R8HA 2YTCA 1FD2A 2KRBA 3VTIA 1LOUA 3GCWP 2WONB 4DL3A 1WC6A 4RR5A 4YUDA 4M94A 1LFWA 5KOWA 1H2VZ 4K2JA 1FDBA 1E6VA 1AROP 1FRMA 3DLHA 4XTTA 4QZVB 3K8VA 2RB7A 4WTOB 3AJ2A 1ZZNA 3SDEB 2H5IB 4LT6A 2DGSA 3PIOQ 1UVNA 2MQPA 5F0WA 4B9VA 3DOMA 5IQ6A 3M2UA 2HZCA 3A8IA 2W1BA 3MEGB 1N52B 3TRGA 4DCJB 3DNCA 4KFBB 2NCKL 1HBOA 1EP4A 2NYHA 1U0SA 1BQNA 2J0XA 1GK8A 1S1TA 2NZ4A 4BCAA 1YJVA 4IRDA 2V69A 4UZCA 2BZ2A 4DR6J 1NSPA 4X64J 3X3UA 1WC5A 2FIUA 4DI6A 3UD5A 1QE1B 4NYZA 1Q82T 2VL1A 4F7VA 3R8YA 4U96A 3HD1A 3VCDA 4LQ9A 5L9XA 3FJ2A 3Q8SB 3P5TL 5JVGQ 4FF1A 1IBLJ 2ZUAA 1BHNA 4Y28C 3W9JA 4C3MA 3MM6A 4NYPA 2C2NA 4LF9F 5HQMA 2ASJA 2IVFB 1HQUA 1I6JA 2J8SA 2PT0A 1FRIA 5GAHI 2HPUA 5KFDA 3V6DB 2D3O1 1RHKB 3MZIA 4LUBA 2I6WA 3EX7B 1T11A 4ED5A 1Y00A 4EYHB 3I82A 3T6BA 1EIYB 4KH0B 2GC8A 4B02A 2KG1A 3AOBA 1XNQF 3D0IE 3NGDA 3BGRB 3I56S 3IXQA 3I9V9 2VH7A 4DR2J 1VDHA 3NMAA 3LQVA 4WU2A 1D3WA 2V2ZA 5KT4A 3MR7A 1WC0A 2QIFA 2GQ2A 3K58A 1G1XA 2GA7A 4JUZA 5KT7A 2VOOA 1K47A 1PJ5A 4USVA 1NSQA 4PG4A 1D9DA 2FZCB 2ZZTA 4OI0A 2YVSA 2DXFA 3W7BA 4OHXA 5A8RA 2HQGA 3G9CA 3MFIA 5CD4A 4L76A 4P52A 1FX2A 5B0FA 5A2QY 3N28A 3DOLB 1YJNS 2CPFA 5L1LA 5EWFA 1NDPA 3R6GB 4WWSA 4ZP9A 3NBPB 2X1AA 2WOMA 1CSJA 4QWCA 3A3PB 2QA4G 2PDAA 1OYEA 2HHSA 3AHPA 4CM2A 3A8EA 5KFRA 3DN9A 1Q79A 4D3HA 4J9QA 1WEZA 3LO3A 1SKRA 1OPIA 4DLEA 2RDDA 3BPSP 4W98A 2ZC4A 3FSXA 1RHQB 2HFVA 4KKOA 3EWGA 3NLCA 4C8MA 3HDSA 3JSRA 4K4UA 2J0WA 3P5BP 3T6JA 2AJQA 2HQCA 3CGIA 5LM7E 2Y0SD 1S1VB 1AXQA 2RIJA 2AMCB 2KJWA 2UVUA 4ZVPB 4J91A 1VISA 1G6BA 3K7RA 3TUJC 3RR8A 2PEHA 3F44A 3GJTB 5KG6A 4LF6F 2V4JB 2ZZNA 3A8JA 1S6QB 3I5CA 2UVWA 2SXLA 2EFPA 2CJXB 1V9OA 4TU8A 2P6SA 3UD4P 2BJ7A 1NH7A 3W5YA 3BBCA 1SJ3P 2XULA 2LLZA 2MLYA 4UY8T 1O6XA 1BGXT 2YX4A 3HHLC 2M88A 3MPUB 2QGFB 2HMIA 5KG1A 1TV6A 3QAUA 1IBMJ 4ECRA 2RS2A 3HKWA 2D3ZA 4EBEA 3OTCA 3FCHA 3T1HF 3IP0A 4YB5A 1X9WA 2OTLS 3E3XA 1A6LA 2VDIA 3C6TB 2NPFA 2QYCA 1KRPA 1FXDA 1C1BA 5GADU 4B3SJ 2LVWA 9RUBA 2MGZB 8RUCA 4K50A 1RTIA 4H4KA 2R42A 2ZDOA 4OYZA 5KFZA 3O3LA 5KFGA 4KHPF 2QG9B 3K5LA 2WSEC 2YQ0A 3FFIB 2PE8A 4A8MP 4N56A 3C2PA 4LSNB 4O44B 1CJTB 4GKKF 3T5LA 3W5ZA 4DQPA 1NDKA 4JI1J 2W7OA 1VBKA 1RADB 4MAKA 4UOFA 3M6WA 3MPYA 5GAEU 5K8NA 3SCLE 4M5DB 1NK9A 4I6WA 4PQUA 1JIHA 3H2UB 4URQU 2X3GA 3NS6A 1AW0A 5HJYA 2V2QA 3C66A 3IAM9 1CJUB 1TVRA 3ILOA 1LXJA 3R5JB 3L7PA 2J0QD 4KHRA 4ID5B 4CLTA 3R1LA 2UUTA 3HVRA 4LSZB 4P2MA 5IT9Y 1NHKL 3NCRA 2DGOA 4IDKA 3PV8A 2GJ2A 2F8HA 2VICA 3VALA 2ASLA 3HI9A 2OPQA 4QU6A 1JLEB 2JRSA 2J9CA 5AJ3F 1OY9A 3AB2B 4ZCKA 1YIJS 2HZAA 2HNZA 4FN5A 4DPWA 4DPXA 4DUZJ 2GGPA 3PW0A 1RT4B 1F1BB 1XBWA 4RW7B 3DLKB 2LFVA 2C3UA 2XMKA 1CJKB 4CZCA 3RRKA 4CP5A 4N41A 1DTQA 3QMQA 3RBXA 4AL5A 3JYTA 3J81j 3TZWA 2NS1B 1Q7LB 1M5PC 3KNAA 2JLGA 2DTJA 2FVSA 1HW8A 3UW1A 4DL2A 3D3BJ 4I7FA 4H4MB 1RT2B 1AZSB 4J9VA 4ECTA 1U1OA 4KGKA 4LR9A 5LSLA 3KDOA 5M2PA 2ZC3A 1S1WA 3FQKA 2LQ8A 2HURA 1U1LA 1TL1A 2C2KB 5DG7A 1IKXB 1HIYA 2W9BA 1N5TA 3R27A 3N6NA 4LR8A 5B0AA 1U4BA 1RT1A 3OUYB 5E3CA 2L9NA 3LGNA 3LAMA 2BVZA 3HK2A 4MMOA 2E9RX 4DZDA 3GIIA 1X0PA 4OV6A 2DO0A 3MECB 4ECWA 4YB1P 4A46A 2R7TA 1Q7YT 3QGIA 1JLBB 3QRRA 3KLHA 1VBYA 2RDJA 4W90B 3GP9A 2B6AB 2Q3PA 1U2CA 4IYQA 2J6UA 1S6PA 3CJ5A 1SUQB 2HS4A 2MZRA 2DT9A 5ETMA 3DMJB 3T1YF 1RI7A 3C16B 1ZM9A 1F9FA 3VZIA 3UVJA 1HQEB 1WOOA 4U7UK 1KC8T 1AFJA 3MF5A 3J81Y 3CNQP 4FBTA 3LANA 1QM9A 5E0OA 1M5OC 5LMNJ 4RLEA 3GWCA 4DR5J 2OAUA 3SQOP 3UD3P 2G9OA 3PRBA 4WFBQ 4DR1F 4IFYB 3GIKA 1OO0B 3B4DA 2JVOA 2MMYA 2B4PA 4H4OB 4AL7A 4ZLNA 3MCNA 4NZ7A 3VAHA 2XCAA 3EDRB 3CULA 4X4OA 5C25A 1IXKA 1HFEL 2OUGA 3CJ3A 3TARA 1C0TB 3MAAB 2RRBA 1K0TA 4RW9B 1GEHA 1LWCB 3CD6S 1N33F 3H0PA 1TR0A 4LJMA 4CO5A 3OR2B 3CWJA 5JUMA 3V6KA 4LQ3A 1SKWA 5KFNA 1R0BG 1NSKL 1RWWB 2VFTA 1VQSA 1FKPA 2X7IA 2B8QA 4ICLA 3Q2SC 3BGLA 1U26A 4ELVA 1OS5A 4TYAA 1LEOA 3OL9A 4LF9J 3T19A 2CPYA 3QLHB 2I38A 2GHPA 1RTHB 1MWQA 4OX6A 3TQEA 3IBCB 3ZZUA 2HQFA 2F9DA 2MZ1A 4FDFA 1R0CB 4WTYA 1NO8A 1P8GA 2CG4A 4ITSA 2GAGC 3UCGA 4KGXB 1UEVA 3DI6A 2F9JA 2VA2A 1VQ5S 4HLBA 1S1XB 3QJPA 4AL6A 2ZWPA 2LYVA 4BDPA 2HGLA 3Q8PB 3H4DA 5DG8A 1RUSA 2MZQA 5KAKA 2VDHA 1C4AA 1KQGB 2B4VA 4ZLJA 2CZVC 5DDQC 1JLQA 4I0WA 5EX3A 5CCMA 3PVXA 1Q53A 3D0HE 4I67A 1EB0A 5H9EJ 4X4SA 4QIFA 3PO4A 1F3FA 3OD2A 5EUHA 3GLJA 3A13A 4KRWA 1IKVA 3CDBA 4FPIA 4TLRA 1RQ0A 4DR4F 5J2PB 4MIAA 4ZLLA 4TYBA 3MURP 3PCOB 3FSIA 2HFOA 4CO2A 3RW6A 1KVJA 4MIBA 1NJXA 1UFKA 4N8NA 3KK2B 2J6SA 4C11A 4CLSA 2K2PA 2DNOA 5C2CA 2AJ0A 5HBMB 2R7WA 1OSDA 4FYXB 4M95A 1VGYA 2YNIA 1F9HA 2ALYB 1SJ4P 1CPZA 1U49A 1MROA 2CNKB 3BBBA 3DRSB 4HKQA 4IH5A 1G3OA 4Q5VA 4JV5F 3BEGB 2GNKA 2I9SA 1HL6A 1UVKA 2CFXA 3HO1A 2IPOB 3HFVA 1JXVA 1N8RT 3CPWR 2HQIA 2VQEF 2V4RA 2AIRB 2FHOB 2DD8S 2BRKA 1N34F 4ED0A 4LF6J 2H9ZA 1I5OB 2QYGA 3I9ZA 1VHFA 1XERA 3CJKB 1YHQS 4OZ3A 5IXUA 2MHNA 1N5YB 4GO5X 3GIMA 2F5GA 4D3GA 2A3JA 2HRTA 3PHTA 4WIQA 1T9YA 4PQAA 3TP2A 2MXYA 4F02A 2GJFA 5GADI 1T05A 3MCSA 3HHLD 1U0HB 3VGTA 4MT1A 3KXDA 1EZZB 4QYZJ 1BWEA 2Y1IA 1VQNS 4N77A 3KUEA 2UUCJ 4X65J 2CAJA 1UEUA 3SMZA 4RBUA 4NLPA 2CKWA 3PW4A 3EICA 4CO4A 2UUBF 2DVIA 2XMMA 3MTKA 2B9YA 2MSSA 2AYGA 3MEEB 5KTQA 2ZH2A 3PHEA 1WTBA 4DS5A 3QO9B 1IM4A 3JSYA 2PIIA 1Q1KA 5M2UA 1VS3A 2DGQA 4KHPJ 1TK5A 2R7SA 4WXOA 5AXMA 2OEJA 4YFUA 1L5UA 3I87A 1RBAA 4RU9A 1UWAA 3GR0A 5K14B 5HANA 1S9GA 1DAXA 2HRYA 3KUGA 4GKKJ 1DURA 2XZWA 3HHKA 2FJDB 3GYXB 1F2HA 1YGYA 1BLUA 1GMVA 2PEBA 2KO1A 2ROEA 4PEOA 3O6QA 4ZVUB 1GH8A 1KHWA 5I3QA 4ZDNA 1RLDA 4ED6A 4DQIA 5B0GA 2W7PA 2W9AA 4O4GA 1YTYA 5HJXA 3T41A 1KR4A 3KLFB 4DSFA 3EJMA 1KLMB 1NCLA 1S4EA 2FDNA 5G0RB 2R3VA 4PG8A 5IWAF 3DLBA 1YBUA 2NXCA 2DH8A 1RTZA 2M8DB 4NLSA 5DM6Q 5F8HA 5H9EK 3AXMA 2W8KA 1NDCA 4UF4A 4ECQA 3OXGA 5AJ3J 4ED7A 2WW8A 2A1BA 1ZS6A 2H4YB 3BREA 1F5CA 4FF3A 3JS9A 3HT3A 5C42A 4YB7A 1ICEB 1Y11A 5D4PA 1J27A 2YPYA 1RAGB 5C5JA 4F2SA 1JB0C 1HWKA 3ZC4A 3C15B 1D8ZA 1NJWA 3IR6B 3SV3A 3OLBA 2JEFA 2AX1A 3OJUA 3W9IA 2CVIA 5GMEA 4ZJOA 1S6OA 2LU1A 2FJXA 5GAGU 2M70A 2J9DE 4V19J 4Z2XA 2XS7A 1EKRA 2PMHA 3MPVA 2Z4PA 1G4CA 1RT5A 2XHWA 4OZ2A 2A2CA 5HP1A 1IQTA 3RB0A 1TMMA 3J7A1 1TL5A 4DHVA 3Q0AA 1KDNA 4PUOB 4EFAC 4ZKAA 4ETZA 5DDRC 2QSFA 4HT5A 2FVCA 2B43A 2BJ9A 3LTOA 4B9TA 1N4LA 6FDRA 1IKWB 4C0OC 2QRRA 2RQCA 2E5IA 4QW8A 2UZAA 2ACMA 1JQGA 2PSZA 4DZ6A 3H5UA 1BE4A 5DS7A 4Y2CA 5L8RC 3QZ8A 4FXWA 3ITHA 4C8ZA 2ILZA 1RU2A 1WDDA 5ETOA 1KQKA 1Q8KA 1RWUA 1KTQA 3KWMA 1S72S 2BE2B 2VKRA 3EXCX 3MI7X 4PXEA 5IOLA 1RBLA 2OJ3A 1FK9B 1S6UA 1X0FA 2Z56B 1LWFA 2W24A 2MKKA 1FKOA 5JMNA 1K44A 3SFGA 1H38A 1RHRB 2HWIA 2Y1RI 4QYZK 4PPDA 5IQQA 1U25A 3T1YJ 3G82B 3JQJA 1N5SA 2CQIA 4AE5A 3CE8A 3ETMA 2E5JA 2ZJQQ 2G0CA 4NLOA 2C2RA 3BB5A 2R7QA 1B7FA 4JI8J 2HFUA 2WB1D 1I94F 4ZVOB 2HHTA 3SQGB 4B3OB 3DCAA 3RB6A 1YJ7A 4RWXA 1CQMA 4X4NA 2PFFB 3CMQA 5T14A 2FJEB 1S7HA 1SC3B 2GV1A 1U1RA 4NYOA 2QTWA 1DQ9A 2B4UA 2V63A 4DSKA 3PG9A 3R7SB 3DRPB 4DR1J 3MXHP 1GNKA 2HIYA 1H73A 4AXIA 2HNDA 4ZHRB 5D77A 2ASDA 3LUYA 1SKUB 1VIOA 3KYLA 2V2VA 4H54A 2VU5A 1FE4A 4OX8A 5FD1A 3UE2A 5DDOC 2E7WA 1QUPA 3V6JA 5DGBA 2AZ1A 2EG1A 1WF2A 3ILIA 2FHKA 1U8WA 4RBTA 2NSBA 4B08A 4L75A 1HWLA 4IO1A 3L95X 3WX4A 1N33J 5MLCV 3RU0A 3KG4A 4LFAJ 3V4IB 1PO6A 3UO0A 2YH1A 3RTVA 3PFEA 2DR5A 1CBKA 2E66A 2RQ4A 2C2ZB 1QJHA 1LV5A 3M2RB 2CQHA 3A3NB 3N4WA 3UDCA 2I0XA 3ZNJ1 2A2DA 3LP1A 2X1BA 3J7Z5 4LSLB 1EX8A 3QFWA 1REGX 3MMBB 5CYQA 3TJ8A 4ZCIA 2CPIA 5ETRA 3MEGA 2PI5A 2DNNA 5D0GA 2O3DA 4ED2A 4EWTA 3J80Y 2XS2A 3NXZA 2KT2A 1YRXA 2F4VJ 2XLKA 2XY6A 3H25A 1MMDA 3G6VA 2F8MA 4CO0A 4UUXA 2CUYA 1IUJA 2ATCB 2IRYA 2H3EB 1FDAA 1VQ9S 4P73A 3M32B 1YLXA 2WSCC 5C7PA 2XMTA 2GMHA 2NXUA 2N4DA 2W2QP 1Q86T 1S7IA 2P6TA 1HMVA 3HVWA 2DXEA 3QGPA 4QYRA 3SFUA 4RW6B 2R7UA 4DR4J 3CD7A 3VGUA 1RWOB 3ET6A 2CWXA 1H3DA 4WFNQ 1XK8A 1T9VA 3FKBA 2ZH7A 4RL1A 3CW2C 3HHLA 2JZ5A 3CDUA 1UW9A 1VOMA 3KTQA 1HARA 3V6DA 3LPYA 5FIIA 3NAHA 3PRVA 2CQ4A 1NJZA 3AOAA 1HBMB 3AD8C 4OLOA 4M5MA 3PYGA 3A4TA 3GJRB 2KZMA 2DBBA 2LECA 2IMOA 2YNHB 2WHOA 5KG4A 3VAKA 2VPZB 2D3OR 2OHDA 1A9NB 4TNOA 2V6AA 4OJHA 5HMXA 2CZ9A 4M5KA 1N0VC 3RYLA 1M5VC 3DHXA 2K06A 1ZAVA 4CIOA 1JLFB 2H65B 4Q2LA 2ZNZA 1PAUB 2G0IA 9ATCB 4YP3A 4O3RA 3NG8A 2HHVA 4WFXA 3E2EA 4DR7J 4K4TA 1IN0A 2GAHC 3KOAA 2OPPA 4Y2AA 1F6TA 2VPWB 1VQ6S 4V19X 3GILA 4YDXA 2M8HA 1C4CA 3U1MA 3AA9A 4GC7A 2YKMB 3BJYA 2G0JA 4NXMJ 2M52A 1VC0A 2OMLA 2F40A 1G7CB 2BANB 4FYVB 4IUFA 2R2TA 1BQXA 4USUA 1MN9A 4M8LA 4CT8A 1EKSA 4XPCA 3CIMA 2CPDA 4LBHA 3DRYA 4DLGA 2IVMA 3Q83A 2I2YA 5IS2A 3FEZA 2LXUA 3RBEA 4ETXA 4JYAF 1U47A 4WZMA 4HTJA 3IBFB 4P74A 2UUBJ 1S1VA 1RU1A 5K8PA 4FF4A 1FVQA 3B82A 4WBFA 4OQJA 1RKJA 2GIQA 3SSQA 5U47A 4QJVA 2JDJA 2O67A 3TAPA 2DHHA 2V4JA 4ZITA 2AF6A 4X4PA 4NCBA 3FMBA 3W66A 3P49B 2MJUA 1YK9A 1NKCA 4OZJA 3NOCA 3MMCA 1NPKA 3JXOA 3EPGA 1RCXB 2KXNB 2DITA 1NRKA 2RNEA 3G6XA 5FDLA 2AD9A 6FD1A 1PJ7A 3BV8A 2XG8A 1OSCA 5E41A 1FI4A 1W7WA 2MLXA 2G4BA 3I32A 1HPZA 3BH7B 4QWAA 2RUGA 3MMAA 4TU7A 1M1GA 3AAWB 2ADBA 1Z2LA 5CABA 4OJGA 1PYTA 3WC0A 4NE9C 3U1NA 3C6TA 4F8RA 4Z7CA 2HFNA 1TL7A 2DISA 2LEAA 3CIZA 2W4CA 4FXDA 4OFZA 5IWAJ 1YJTA 1RK8A 3KG0A 2VBZA 5KFVA 2MGZA 3Q2TC 2MQLA 2CPZA 1U1KA 2K7KA 3SEOA 4K4WA 1PKUA 1Z1ZA 4TY8B 3MM9A 3DKDA 1NK8A 4B3TJ 2O66A 4PWUA 1DLOA 2AJ1A 3FFIA 2GVZA 4A4JA 3LF0A 3I0RB 4DQQA 4O44A 3GPAA 5HN0A 4H4KC 2CQ2A 5A6PA 1ZAWA 3QSYB 5IM0B 4CH7A 1NPPA 3QAEA 4WFYA 1R7IA 2UXDJ 5KFTA 4MFBA 1B0PA 1H7XA 2BACA 3PJ9A 1BQMB 4ELTA 2K1RA 5J2QA 4KQZA 5ADZA 4DJBA 4BHQA 4ECYA 2M4MA 4ES3A 4HACB 3GYNA 1SH2A 3FEYB 2G1DA 1T7PA 4IQXA 1UWBA 1FJCA 2YX1A 1F0XA 3A1YG 2DR6A 5SUHA 3VAJA 2LEBA 4QPXA 1L3SA 1X4FA 1MMLA 1XC9A 3NKYA 4OHVA 3C6UA 1XR6A 1V6HA 2VG5B 4MH8A 1WI8A 2DNHA 3OXLA 1F9EB 3M8ZA 3KK3B 1TKDA 1BY9A 1X9SA 1LWEA 4DV1J 4JI0F 1UETA 1RWXB 2XEXA 5KFFA 1S9EB 1VQ7S 4DV2J 4LFCF 4FKXA 1RT4A 2BOPA 1OY6A 2MZSA 4DMZA 1ZM3A 4K4XA 2M9KA 2M3DA 1CJKA 1WKKA 3FVYA 1TAQA 1FNXH 4OHWA 3D0GE 4XDCA 3BO2A 3TI0A 4B3RF 4DUYJ 1SBRA 4TXSA 3IWLA 2YX7A 1AFIA 5DGAA 3WZ0A 2HHHJ 3UN3A 3CEDA 3FZBA 1AZSA 1NK6A 2ZEJA 3MUMP 2NSCA 3PKYA 4NLQA 2HSEB 2IBOA 2RHSB 3TW0A 2CJ9A 1NK7A 1SL0A 1IKXA 1RTDB 4PWDA 3DLEB 4C3LA 1RYSA 3NGSA 2Z8QA 3UDVA 5KFJA 4R0JA 3GU0A 1VC6A 2P2CB 2RVJA 3JQMA 3EVMA 1FXRA 1P9YA 2RRNA 4CLYA 2QE5A 3MECA 1OYDA 1JNZB 1Y0HA 2WVBA 4QIGA 3AOCA 2HNYB 2X1FA 1JLBA 4RW8A 2R8JA 5L38A 4DG1A 3W2VA 2EKNA 3M9NB 2KT5A 1RAHB 1BWVA 4L6V3 1OMSA 1HWUA 1EJ7L 3BSNA 5A8KB 3TZYA 2KRRA 2DNMA 3MAHA 2WB4A 1GMWD 4NL5A 3R7NB 2VC1A 2C42A 5DETA 3C16A 2MB0B 5I3UA 2UXBF 4DFMA 4K8RA 3W2WB 3F73A 2XSJB 1P6TA 3I0SB 5B0BA 2ZH5A 2O01C 3IWNC 3O1LA 4FVMA 4CM0A 3B8HA 1NKEA 1NH8A 2DGXA 1HI1A 4CRJA 1T8EA 1X5OA 1SV5B 1LKZA 4G65A 2DRBA 2Z0GA 1RYRA 4V1Ak 4L3NA 4CYUB 4P7TA 3RG6A 1M1KT 3TA2A 2AEJA 5HLFA 2PC6A 4P72A 4ECZA 3S6EA 4H4OA 3OL6A 3GQCA 3LPEA 4C3KA 1UA1A 4F25A 3AXKA 1ZM2A 3HSZA 5C24B 4ECVA 3LAKA 1C0TA 3KJNB 3MAAA 1U2FA 4WXWA 4RW9A 1LWCA 3H20A 2KU7A 4KO0B 4Q7AA 1URNA 2L3MA 2KHCA 3B6BA 2QL9B 5GAHU 3PDNA 4U6PA 2DNPA 2BEFA 1HWJA 2KYZA 1O5JA 4ZPBA 4M1KA 4ECSA 4CTAB 4NLWA 5HAOA 4NLDA 3PACA 4Z37A 2YKOA 2ZBCA 1VLYA 4YY3J 2G2ZA 2FC8A 2MSTA 2ZVSA 3PX0A 1HR0J 4ER8A 1HNIB 2XMWA 2MKHA 1SQEA 4X66F 4DV5J 1GFWB 2VA3A 2WSFC 5HQ8A 3EVOA 4DSEA 2ZJPQ 2APOA 1SC6A 3JAMU 4AUKA 4JI2F 3QGHA 4WKYA 1RABB 4I68A 2NXEA 1KNZA 2HHWA 2JFKA 3EMTA 4GO7X 5A8WA 4NLUA 4OZ5A 2E1PA 3H5XA 2JFDA 2KXHA 3BSAA 3VQSA 2K8GA 1T9TA 3DYAA 4CH1A 4W4MA 1UPMB 4LF4J 3US5A 4PXBA 4JV0A 1N6QA 3PY8A 2M7SA 3DLJA 1E6VB 2V5HG 4EBCA 1FF2A 5E2QA 2FLLA 2EC2A 3MM7A 1WG4A 2VD3A 3ZZTA 1GT8A 3MUVP 2VB6A 3GV5B 4ZMMA 1KS2A 2BXJA 3KK2A 3LWMA 4PRFA 5ETQA 3NNHA 4LR7A 4G6VB 2OPRA 4UZBA 3OFFA 3DOMB 1MN7A 5KT6A 4JI3J 1F60B 1GXTA 2Y0BB 3B54A 1LQ9A 3GV8B 3TQ1A 1FESA 2Q43A 2C22A 2DCUB 3M30B 4HR2A 1S1TB 3N01A 1ZETA 4L72B 4DS4A 5IFMA 3TUPA 1QDUB 3MM5B 2IRUA 3Q89A 2OO4A 3UPFA 1FJGJ 4NCGA 5B7WA 2J5AA 3W8GA 2BQUA 3QPIA 1IJFB 3Q86A 2Q79A 2W7AA 3QIDA 1KQSR 2VZ9A 2BQ3A 3I5BA 3KLVA 3J7YU 1IBKJ 3BSOA 4YB6A 1Y7PA 3D1QA 5KG0A 1CC8A 2EG2A 5F0UA 3CJKA 2BQRA 3CB4A 4WK3A 3D4JA 1UJ6A 2XCPA 2ZKUA 4Q8EA 3WIUA 1DHMA 2B5JB 1PBUA 3BQ2A 1SJQA 1HQUB 1R8CA 2YNFA 1Q95G 1VJQA 1KOHA 4O23A 4I2QB 5HO4A 5L1IA 2CPEA 1DY3A 3K5OA 5F8MA 2XB2D 3ENVA 3QRQA 3F41A 3GG1A 3GR1A 1B7YB 2H48B 2CVEA 1JK9B 2JLFA 3CVKA 1S4FA 1KKHA 2F63A 2EBEA 3D6TB 1MLAA 2GIRA 4RUCA 3RAQA 3HULA 1NUEA 3QO9A 3FDSA 2KH9A 4R5PA 1VK8A 5D4OA 1RCOB 1RWNB 2LQJA 4B9SA 1RGVA 3I31A 4LFBF 1MNEA 2Q66A 3FBEA 3RB4A 1FFSB 1WF0A 2OPSB 2UP1A 4P10A 3DFEA 4NI2A 5K14A 1SH3A 5HROA 4RJVA 1QSLA 4NMLA 4IOCQ 2Z2MA 5L1KA 3HZGA 5AE1A 4L74A 3SSRA 2DH9A 3GTYX 4UT4A 3G96A 3KK1A 2PGCA 2PN6A 3M8RA 4HT7A 1VQ8S 1HD1A 3UFCX 3TAMA 2ILYA 2XZDB 5FLXY 3X1LB 4NWBA 2UU9F 3SCKE 1KEKA 4ZCMA 2R2RA 1TUWA 3BO3A 1VQYA 4M5LA 2HVHA 2DB1A 4EZ6A 1DTTA 5DO2A 5G0RA 3DGVA 1HWIA 4DN9A 2ACYA 1DZ5A 2HQ3A 2YY3A 1PAEX 1HYSA 1JXEA 4QWEA 1CC7A 5IT0A 3DGPA 2FVPA 4BWMA 3MPDA 1BMQB 1SIWB 1HNZF 4DSLA 1R3NA 2QT7A 4RKUC 4X62J 4KTQA 2DHGA 3NGUA 5BYSA 1Y5NB 4J9SA 3QBCA 3DRRB 5EGYA 4YHHF 3Q23A 4Y00A 1JLGB 1X4GA 3VWSA 3C15A 3CJSA 3R5BA 3D9BA 5BR8F 3UCUP 3PRDA 4JBCA 3O44A 2DCLA 1MMNA 2W2PP 3SYZA 1ZTWA 4ANCA 2CQPA 2CQ3A 1Q78A 3FCVA 3UWTA 1XIQA 4B3RJ 5D4LA 4DV7J 4MKBA 4LF7F 2IBKA 5BYRA 2DYAA 3R7BB 4HHHA 3KMSA 1TV6B 3DC2A 1FDDA 2B3TB 4QWDA 3R6LB 1HNXF 4B3MF 2QMUB 4ECXA 3CMES 2XI3A 3D2WA 1C1CB 3WX8A 1Q8BA 3NWGA 3QJJA 2KB2A 2IIHA 3NEKA 2D9OA 4CNYA 1C1BB 2XLIA 4F4AA 4PAAA 2BW7A 2HYIB 4JI5F 1TZ0A 4DBQA 4OX9F 4WPAA 2CQGA 5B09A 1O8BA 1VC5A 3AJ1A 4CWBA 1T9UA 3S01A 3KLEB 4E0DA 4U95A 5KFEA 3V4MA 3FK4A 4NA3A 2IHR1 3BN7A 3V6HA 2JVRA 2OEKA 5CCLA 1LXNA 3WQPA 3CCJS 2QA2A 3TYTA 2CNOB 4Y2MA 5CAAA 3C3LA 3MEDA 4OX7A 4ZVQB 4PQUB 2VC0A 3H7HB 4KE5A 2MPUA 2W2NP 3D6MB 2I5JB 3QIPA 4G1IA 1NDLA 4DQSA 4BS2A 3IR7B 4RO0A 3V5RA 1WHVA 4ZP7A 4IO9Q 5F8NA 4NA1A 3DDNA 2LQBA 1SI9A 1PG5B 4DV4F 1VQKS 4Y2KA 1LK7A 2HKEA 5EHHA 1N32F 4RUAA 4IDKB 2HHPA 3D7SB 2ZBPA 3EZOA 3OR1A 1TKZB 3P3DA 5JXSA 3K17A 5HL7Q 4TN2A 4DX6A 2CDQA 4F04B 1XR5A 4DF4A 2HNZB 2HG4A 3ZZOA 4XDDA 2GGPB 1K8AT 3DDKA 2BM0A 4LRDA 4TQSA 2CQDA 1K1SA 2QFIA 4BC9A 1HI8A 3POTB 1RLCL 2MQ8A 4DV0J 2R7XA 1T94A 1DTQB 1UEKA 1YWXA 4BWJA 5HVFA 4FZVA 3TANA 1C0UB 2FD2A 2DGWA 2ZE2B 4ZA1A 1ZZFA 1S77D 1FE0A 2JX2A 3K8WA 2DJWA 2AHOB 1URRA 2M0GB 1H2TZ 2G13A 3I6PA 3M9MB 4KBIA 4QIEA 1S1WB 1ZA1B 1ZTTA 1GAOA 3GE9A 2W9BB 1CULB 2OI2A 5D0HA 2D7SA 1IJEB 2VPXB 2C2EA 1RT1B 4J9PA 5CA5A 3IM8A 4DOZA 1U6FA 3LP0A 3KDNA 1UVIA 1J5EF 4X66J 2VASA 1KQFB 3AY0A 2V34A 1U6BA 2Y1JA 3MCOA 4ZCLA 4EO8A 4YOEA 1H74A 2OKQA 4ECUA 5A6WA 4OZNA 2Y9HA 1SXLA 2MQMA 3KLHB 3PX4A 2NQPA 3CCRS 3TR5A 2ASYA 3W60A 2C2DA 4UOGA 4DR3F 1ZH5A 4ILMA 5KFIA 1SH0A 1EETA 1LNQA 5GMKa 1RAOA 2BJ8A 3MR3A 2VONA 1S6PB 5IC4B 1DARA 3G8TA 3M32A 3VR1A 4M5JA 2HS3A 2I8EA 1P27B 4XAKA 1TL3A 3UVJB 1WWHA 1BXNA 1U2RA 2GMLA 2BKOA 4J9OA 4RW6A 3BR8A 2LP4A 3HVTA 1HBUB 4ZK7M 3QGGA 2W9CA 1KONA 2AQ4A 2YKNA 3R1HA 4K0KF 1C2PA 4C98A 4ED4A 1HBMA 1X4AA 3MD3A 4J9RA 2DPIA 4OV1A 5HMYA 4JI7J 3HD2A 4WE1A 2VG6B 4C8OA 1VRTB 2R2UA 4Q2MA 1WI6A 4LVOP 2XTJP 2ERRA 3FC9A 3WC2A 2YNHA 4FF2A 2EEYA 4DX7A 5B0DA 3UDEA 3J7YI 3W61A 4BLGA 2HQDA 2ZHAA 3PM9A 4NXNF 4UW2A 2RKIA 1VHIA 2K3KA 1UJ4A 4LBPA 1RB0A 4ZVGA 3L3CA 1FNOA 3V81A 2W2OP 1JLFA 1S76D 1NBEB 4A8QA 4EEYA 5LSOA 2VFVA 1FKPB 2AYEA 1DBDA 4HI2A 4ICLB 5KFBA 3GIJA 1XNRJ 4PWWA 1B4SA 3ZO7A 3DLGA 1Q8LA 3BM7A 4F4YA 1GTEA 3RAXA 1WNEA 3MR2A 2JC1A 3HCXA 2IC3A 2FPHX 1TK0A 2FTRA 2W4DA 2W01A 5EN1A 4ZP6A 2V67A 4DU8A 1R0AB 2BANA 4IG0B 3PJWA 2IAJA 1ZAXA 5CZVA 4ANDA 4M5IA 2CNNB 3D54A 4DCPB 1DJ0A 4Q0BB 1KTVA 4Z7YA 1RT3B 4DR6F 4KGZB 4PG5A 1T02A 4PG6A 5LJ5Y 2WBMA 2UUWA 2HWTA 4KJIA 2WBRA 1A0OB 3OL8A 4FS2A 1JLQB 1WDTA 1PC5A 2BKPA 1JLCA 3CJ8A 1Q5YA 3M8QA 2HHQA 5ETLA 2VG7A 2DO4A 2DR9A 2HAIA 4LFBJ 1CQNA 4ZPAA 3R5DA 1IKVB 4B9UA 3LH2S 2HLUA 3OTOF 1IBLF 3TAQA 3O8WA 2NPIA 4P2SA 3MM8A 2J9DA 1RA7A 3THVA 2EFVA 2FGCA 2KM8B 5E3QA 2R9LA 2GIFA 2HRUA 2R4FA 1V5IB 4DFPA 2XY7A 3DRXA 1WJ9A 1R27B 1O0PA 2ZWOA 2JHEA 3OPKA 1JX4A 4K7QA 3NGRA 4ATNA 4C8LA 4MKVA 5DZ7A 2E5HA 3MD1A 4GVBB 4USJC 4CT9A 4JOUA 2YNIB 4ANEA 2DY9A 2NUUG 2NYIA 3G2XA 3CD0A 2HFZA 4C4WA 2JSXA 3W5XA 3JTOA 2KDOA 4DR2F 2YWFA 5L39A 5H9FJ 2CJBA 5LSRA 1J5OB 1VQLS 2ZITA 4BC7A 5KFCA 3GYGA 2PA3A 3ZTRA 1RJJA 5KFSA 4QPTA 2UUAJ 1YSJA 4M5HA 2Z58B 4K59A 4IR9A 2P5VA 3FBBA 3I0RA 2O1PA 4WFZA 1V3RA 2E5LJ 3BR9A 5IM0A 2DNLA 4YHHJ 3RR7A 3OFHA 4R8UA 1VYAA 2L08A 3EGWB 5DM7Q 3D1OA 5K5MA 4J5OA 3BZQA 4DL5A 1FTRA 4P2FA 2IM0A 2V8PA 1HA1A 3PFOA 4HYKA 1TU0B 3L4BC 3M7VA 4HACA 4DPUA 3PEHA 1VK3A 5J2NA 1REVA 4GKJF 4UOCA 2CA9A 1T05B 1NZAA 3RRGA 1TK8A 1L3VA 1I1GA 2VBWA 2N7CA 4X4QA 1NAQA 3GV7B 3ZXWA 1U7LA 1X7VA 4DN0A 1RBOB 4I2PA 5F8JA 2VFSA 2VF3A 4F2RA 4NMXA 5I42B 2J9EA 3SIPB 3KK3A 4U67Q 4M5NA 3UCZP 5T7LB 5I4MA 3ZTSA 2MKYA 1EAYC 1EHWA 3L9ZA 3M1VB 4HI1A 4EK2A 3KJVB 1N54B 1X4BA 2Q6CA 4KV8A 5DZ6A 3HJVA 3OFGA 4K4ZA 2HVEA 1M5KC 4KPCA 1F3VA 3FBFA 3GMGA 3K5MA 2N4CA 2DNGA 3K59A 5E7OB 1WC1A 1UFLA 3EGNA 4JI4F 2XWYA 1QY7A 3BS9A 3S7RA 2DHSA 2EI5A 2E5GA 3CSKA 2KT3A 1IBMF 4F67A 1WUUA 2Y1LB 4B9NA 4O4GB 3NCPA 2ALZA 1U1MA 2RHQB 4CO1A 5DLFA 1GXUA 2HVDA 1W2IA 4PYDA 3ZTQA 4DL4A 1M0SA 5AXKA 2W2MP 1F2GA 4RUBA 2ZKTA 5KFPA 4AD6A 2NR0A 4O4RA 3M2VA 4USKA 2AWZA 4B3SF 4DV4J 2E1CA 1ROFA 3NGTA 3DHWC 4NLVA 4NA2A 3LA0A 3N5FA 4CLPA 2LA6A 4HH1A 5LT5A 5CYMB 3VF0B 3MR6A 3E51A 4RU2A 3H98A 2KFNA 4LRAA 2E1RA 1QAJA 3Q8VA 2KJVA 5C42B 1WORA 3DU6A 1RDRA 3OLAA 5IZHA 4JI1F 1PILA 2DEJA 1KD1T 5A8KA 2LCWA 2IJNA 2DNKA 4K5RA 4LF2A 1CG2A 3ISZA 4I64A 1H98A 4AT1B 2AJFE 1XNQJ 2R8IA 4YEAA 4QQBA 4O3OA 3ENAA 2XSJA 2VKZG 2E1MC 4DL7A 1NJIT 5H9FK 5HP1B 7FDRA 1WF1A 2VFRA 3IG1A 2QV6A 2XGPA 1WHXA 3K5NA 1XJWB 3LGMA 3CJRA 1YJRA 3ZZ0A 4NASA 2AW0A 1JKHA 5D8HB 3FCWA 4ES2A 2OLWA 2H1YA 4PXCA 2VQFF 4OJ3A 5LMUF 2EBGA 1J5EJ 2MYFA 3OSPA 1D9FA 3DDIA 1ZYQA 3TVZA 2YH0A 5LOQA 3H90A 1B0TA 2VHGA
chains in the Genus database with same CATH topology
5LXYA 4RW4A 2C3PA 2IBOA 5A8RB 2MGZB 3LP0B 2ZHBA 4K50A 3TW0A 1RTIA 1U09A 4H4KA 5EDWA 1FO1A 2CJ9A 1NK7A 1SL0A 1LW2B 3W3SA 7FD1A 4PXDA 1IKXA 2ZDOA 4KO0A 5KFZA 1RTDB 4PWDA 3O3LA 3DLEB 1X4HA 5KFGA 4KHPF 2LXFA 2IVYA 2IA6A 2JH3A 2VBXA 4OI1A 1WACA 4N76A 4QW9A 4GC6A 4E98A 4I4BA 3K5LA 4IRCA 4C3LA 3Q8QB 1FKOB 4IH7A 2WSEC 3G86A 1RYSA 1ZPVA 2Z8QA 2WOMB 2V9WA 2FUG9 3FFIB 4G3IA 5KFJA 2PE8A 3M6XA 4R0JA 4A8MP 4N56A 1N56A 3C2PA 4LSNB 4O44B 3T5HA 4ZLPA 1VC6A 3M05A 4WKRA 1YRUA 2RVJA 4PR6A 4GKKF 3KLFA 2J7UA 4A8SA 3T5LA 1VQ4S 4DQPA 4X2BA 2W7OA 2XMJA 1FXRA 2RRNA 1KLMA 3CJ2A 2JEJA 4MAKA 4C2MA 1CLFA 1YBAA 2BJEA 2KYXA 3M6WA 2PMZD 3MPYA 4HDHA 2QE5A 4IFVB 1EETB 1Z2ZA 3UDLA 5GAEU 3MECA 5K8NA 4A8YA 1JNZB 3SCLE 1XMOF 4M5DB 4O3SA 1Y0HA 4DFJA 4QIGA 4FNHA 2HNYB 2X1FA 1NK9A 1JLBA 1Y4ZB 4RW8A 2R8JA 4I6WA 4C0BA 5L38A 4PQUA 1JIHA 3H2UB 4DG1A 1JJ4A 1S79A 4URQU 4KKOB 1WG5A 2X3GA 3NS6A 3W2VA 1HNIA 1AW0A 1U6ZA 1FJ7A 4P6QA 3M9NB 3MPWA 1U24A 1TL3B 1TUVA 3C66A 2KT5A 1Q81T 1X8DA 3IAM9 2FVQA 4L6V3 2B7BB 1HWUA 3NRBA 3TVYA 3BSNA 4KPYA 1XTZA 5A8KB 4EUVA 1TVRA 2KRRA 2DNMA 1LXJA 2QMXA 3MAHA 3L7PA 2J0QD 2WB4A 4KHRA 1RTJB 3BSCA 4A47A 3JAMY 2OD6A 4NL5A 4ID5B 2VC1A 3R1LA 2UUTA 4YY3F 2C42A 3HVRA 2HHUA 5DETA 3HVTB 3KHLA 2MB0B 3OTEA 5IT9Y 1H0HB 5I3UA 2UXBF 1HR0F 3NCRA 2DGOA 4IDKA 4DFMA 3PV8A 3TO8A 5KG2A 1OIAA 2GJ2A 2F8HA 3W2WB 2W9CB 4NX9A 3M4XA 3VALA 2ASLA 3F73A 2XSJB 1Y3KA 3HI9A 1P6TA 2OPQA 3I0SB 4DV5F 4QU6A 2YKNB 1JLEB 5B0BA 4Y6IA 2ZH5A 1N36F 2JRSA 4YR3A 2B4OA 2J9CA 5AJ3F 2RF2A 2O01C 3AB2B 3K2YA 2LDYA 3O1LA 4PG7A 3IWNC 1S1UB 1JJ2R 4P7VA 1HNVA 2CRLA 4ZCKA 4FVMA 1YIJS 3GFYA 3B8HA 1TL4A 2KFYA 1NKEA 1NH8A 2DGXA 2HNZA 4FN5A 1HI1A 1VBXA 4WE1B 1T8EA 4KHMA 1X5OA 3H5YA 3R3TA 4C8OA 2GGPA 1MU2A 3PW0A 1RT4B 3AA8A 3OQ2A 1SV5B 1LKZA 2DRBA 2Z0GA 1XBWA 3ULHA 4RW7B 1RYRA 3PEJA 3DLKB 5B0EA 1ZBTA 2HMIB 2C3UA 2XMKA 4L3NA 5KG5A 4P7TA 3EZUA 1M1KT 4CZCA 3IS9A 1U45A 1GXLA 3RRKA 3R5CA 3TA2A 2W8LA 3GFXA 3OSNA 3O2IA 4N41A 1DTQA 3QMQA 5HLFA 4AL5A 3JYTA 2VV5A 2PC6A 3KLIA 4UQGA 5LMNF 4ECZA 3S6EA 2NS1B 1FRXA 2RKIB 1Q7LB 1M5PC 4NLTA 2RQKA 4H4OA 3KNAA 2JLGA 2DTJA 2V2KA 1NNDA 3DM2A 5CD4H 3D5MA 3OL6A 4NZ0A 5J1EB 3GQCA 4DR5F 1SJFA 2FVSA 1HW8A 3UW1A 4C3KA 1UA1A 2UVRA 2LQ9A 3V81B 4F25A 4PUOA 1ZM2A 4LF4F 3D1HA 3LP1B 5KT2A 4U7CA 4DL2A 2EVZA 1D8YA 5KFWA 1FRHA 1X9MA 4I7FA 1U1NA 4H4MB 5C24B 1RT2B 3OVAA 2L41A 4IKAA 2VPYB 2V94A 4RNHA 4ECTA 4ECVA 4KGKA 1U1OA 3LAKA 1QAIA 1C0TA 5LSLA 5M2PA 5CYQB 1IKWA 1U2FA 2ZC3A 1S1WA 3FQKA 1RTIB 2OIHA 1U1LA 1S97A 1TL1A 4WXWA 4RW9A 5DG7A 4K5SA 1LWCA 3H20A 1IKXB 2KU7A 4KO0B 4Q7AA 3U27A 3KLGA 1URNA 4X84A 2L3MA 1X5SA 2W9BA 1N5TA 2ZDPA 2KHCA 3R27A 4NLRA 3N6NA 5B0AA 1U4BA 2CQCA 3DLGB 1RT1A 5GAHU 2AU0A 3PDNA 4U6PA 2FHJD 3OUYB 4NRUA 3M30A 2DNPA 5E3CA 2L9NA 3LGNA 2IC3B 3O5TB 3LAMA 1VRUA 3CCQS 2BVZA 3HK2A 5L1JA 1HWJA 2BE2A 2AV5A 2KYZA 4MMOA 3DLLQ 2E9RX 1O5JA 4ED3A 4JI3F 4HH0A 4ZPBA 3GIIA 4M1KA 4ECSA 1FK9A 3G6YA 1X0PA 3MM5A 1L3UA 1N88A 5J1NA 4CTAB 4XIUA 2RD5C 2DO0A 4DQRA 3MECB 4NLWA 4AYBD 4ECWA 2BYCA 4NLDA 3PACA 4G1QA 1VQMS 4XO0A 2ATLA 4OI2A 4YB1P 2U1AA 4A46A 2R7TA 4Z37A 2YKOA 2ZBCA 2IAJB 1GTHA 1VLYA 3QGIA 1Q7YT 1JLBB 4R25A 4IR1A 2RH3A 3CJ0A 3MMJA 1UVJA 1WTFA 4NLYA 1LW0A 2QLXA 3KLHA 2L48A 4HVZA 3BDPA 2FC8A 2MSTA 2ZVSA 2KZZA 3PX0A 1VBYA 2MQQA 2RDJA 4W90B 2PA8D 1HNIB 3ZZZA 5D3GA 2XMWA 1MWZA 2MKHA 3N6LA 1N5QA 4DL0C 2OTJS 1W25A 2HHXA 4X4RA 2NUHA 5B0CA 2B6AB 1SQEA 4X66F 3SI8A 1HMVB 2Q3PA 4IYQA 1XR7A 2VA3A 2WSFC 2J6UA 4JV1A 3C8YA 1S6PA 3CJ5A 3AH6A 5HQ8A 1IR0A 3SCIE 4A8FA 3SQGA 2ZJPQ 1T95A 4DSEA 4B3OA 2APOA 1TVRB 3JSMA 3U02A 3LALA 1SUQB 1FJGF 1SC6A 3EXYA 3HZEA 2HS4A 4AUKA 3HHEA 2CJAA 2MZRA 4N8OA 3ZZYA 4JI2F 2DT9A 4MK7A 1JLCB 3DMJB 3T1YF 1RI7A 3M8QB 2R8KA 2ZNYA 3QGHA 1ZM9A 1F9FA 3GFHA 3VZIA 2VG7B 3UR0A 2B5JA 1HQEB 4WKYA 4U7UK 3TX8A 3DRPA 4Y65A 1KC8T 1IBKF 1TQLA 2R7VA 3G8QA 1AFJA 2ZH3A 1M90T 4I68A 2RS8A 1KNZA 2HHWA 3HHLB 3MF5A 2XLJA 4EZ9A 2IRXA 2JFKA 3J81Y 1QSSA 3NCQA 2D9PA 5IT4A 3S8SA 4FBTA 2LMIA 4GO7X 3LANA 2B56A 2OPQB 4I2QA 4ZVEA 5A8WA 1QM9A 4ZHRA 1YJWS 4NLUA 2RF2B 4OZ5A 5E0OA 1M5OC 4ZS6A 1AUDA 2DHAA 3MM8B 3H5XA 1VJWA 4MKAA 4RLEA 3GWCA 4EYIB 1QVFR 2JFDA 2KXHA 4LVNP 2O5DA 3BSAA 2F7VA 3VQSA 2K8GA 4RNOA 2OAUA 2Q1LA 3M8PA 1X4DA 3DYAA 4CH1A 1K9MT 1MU2B 3UD3P 3CCLS 1JWWA 2DHXA 2G9OA 3B4MA 4PXBA 3US5A 3PRBA 4WFBQ 4JV0A 3V2UC 5KFKA 4K4YA 4DR1F 3NL0A 4IFYB 3GIKA 1N6QA 1OO0B 2IM1A 3PY8A 2ZOGA 2M7SA 3DLJA 3MEKA 1MSWD 1OPZA 2GMJA 3ONQA 4O3QA 2ZZMA 1E6VB 2V5HG 2E7XA 4EBCA 3JYTB 1FF2A 4Y2IA 3B4DA 3KLIB 2JVOA 5E2QA 3ZFVA 2MMYA 3HJFA 5D78A 5KFYA 2B4PA 4H4OB 2W25A 2FLLA 1TKTA 4AL7A 3MM7A 2E29A 4NPOA 5KT3A 1WG4A 3V4IA 2VD3A 3ZZTA 1GT8A 4NZ7A 4B17A 3MUVP 3VAHA 2VB6A 3GV5B 1PSDA 2XCAA 2DNZA 4ZMMA 1KS2A 3QYYA 2BXJA 2GFFA 2K7JA 3KK2A 3LWMA 3CULA 4PRFA 4X4OA 5C25A 2HIQA 1IXKA 3G6ES 4I7FB 1HFEL 2OPSA 4DF8A 3NNHA 4FYDA 3OVSA 2OSQA 3CJ3A 3TARA 4G6VB 2OPRA 1Y5IB 3OFFA 5KT6A 1C0TB 2R7OA 1F60B 2RRBA 2DH7A 1D0EA 3M2RA 1GXTA 1TL1B 1K0TA 4RW9B 1R31A 1LWCB 2GJIA 1R89A 3MTJA 5BJRA 3QZ7A 3CD6S 1N33F 1LQ9A 3GV8B 3TQ1A 1TR0A 2ZHOA 1FESA 2OPPB 4LJMA 5KFQA 4M63A 4CO5A 2Q43A 3UNGC 4LSLA 3TA0A 3OVBA 3OR2B 4WF9Q 3CWJA 5JUMA 3V6KA 3VQTA 2C22A 2DCUB 4LQ3A 1SKWA 3MMBA 5KFNA 1JMTA 3M30B 1NK5A 2EPIA 5F8GA 1E6YA 4F4XA 1S1TB 2VFTA 1VQSA 3CD5A 3N01A 3NP5A 1ZETA 2GX8A 1FKPA 4L72B 5J1PA 1FA0A 4KR0B 4DS4A 4ICLA 2AP6A 3CTRA 1UP1A 3Q2SC 5GAGI 5IFMA 3U7JA 3BGLA 1U26A 4F3MA 4QOTA 3MM5B 4PKDB 1V3ZA 2IRUA 4ELVA 1OS5A 1VIXA 4TYAA 5F9NA 2QZ8A 2OO4A 3UPFA 4F4ZA 3OL9A 4J9KA 4NCGA 5B7WA 2J5AA 4QIVA 4R8UB 3T19A 2BQUA 3QPIA 2CPYA 4ILRA 4MYUA 3PXGa 3QLHB 2RQMA 2I38A 2GHPA 1RTHB 4OX6A 1IJFB 4C97A 5CYJA 1Q8IA 2DK2A 2CYYA 3ZZUA 1MW7A 2Q79A 1SJ1A 4QBUA 5LJ3Y 2LEPA 2W7AA 2F9DA 3QIDA 1RA6A 1KQSR 2VZ9A 2BQ3A 3I5BA 2MZ1A 1UVLA 3NNCA 4F26A 3KLVA 4WTYA 1NO8A 3J7YU 1P8GA 3BSOA 3K0JA 4C8YA 2CG4A 4YB6A 4C0HA 1Y7PA 2Q6BA 4ITSA 3D1QA 5KG0A 2MDAA 3UCGA 1CC8A 2EG2A 4WK1A 1UEVA 5J2NB 3DI6A 4MIWA 2MKCA 1OQ3A 2F9JA 1REVB 5F0UA 3CJKA 2BQRA 1VQ5S 2VA2A 3CB4A 2GHWA 2GQCA 3CO9A 4HLBA 1S1XB 3QJPA 2OP5A 3JSMB 2LDIA 4WK3A 4AL6A 4PPZA 2ADCA 2LYVA 1P1LA 2OMOA 1UJ6A 4WU3A 2FLPA 3QWUA 4BDPA 3TUIC 2HGLA 3Q8PB 2IYIA 3H4DA 1IQZA 5KFHA 2XCPA 2ZKUA 2BJDA 4Q8EA 5DG8A 1DHMA 4HDGA 2B7CB 5J2MA 2MKSA 2B5JB 5KT5A 1U1PA 2MZQA 3BQ2A 2XMUA 5KAKA 1SJQA 4I2PB 4C8NA 1HQUB 1R8CA 2YNFA 1C4AA 1S0NA 1KQGB 5EWEA 4ZPTR 2B4VA 3DRRA 1KFSA 2IMWP 4I6YA 3LW5C 3I96A 1KOHA 1JLGA 1RP5A 2CZVC 1ZOTA 4I2QB 4O23A 5DDQC 1QTMA 1JLQA 4I0WA 5HO4A 5EX3A 5L1IA 2DGVA 2L9WA 2XMVA 1XMQF 3CXCR 3DXSX 5CCMA 3HF5A 2CPEA 3PVXA 3TOQA 1Q53A 3K5OA 5F8MA 4XK8C 3T3FA 3D0HE 2L9DA 1TKXA 5EWGA 3MMCB 3TA1A 4I67A 5B08A 3ISND 5H9EJ 4X4SA 4NLGA 3MR5A 3D28A 2VOPA 4KC5A 4QIFA 3PO4A 4CO3A 1S9FA 2J7KA 5EUHA 4X62F 3ENVA 5FDLB 2XB2D 4KV8B 3F41A 1IKVA 4KRWA 3GG1A 2CZ4A 3GR1A 4B9LA 4GMKA 5A0YA 5AE3A 2POKA 3CDBA 2CVEA 4R0EA 1HPZB 1JK9B 2JLFA 4I56A 4TLRA 3CVKA 4ED8A 1RQ0A 4BBYA 4DR4F 1WELA 1S4FA 4OL8A 5J2PB 3MMAB 5E3RA 4MIAA 3MURP 4TYBA 2BW2A 3HM9A 1UA0A 2EBEA 2WONA 1S49A 3FSIA 2GIRA 4RUCA 2NREA 2HFOA 4CO2A 3RAQA 3RW6A 4WJBA 1KVJA 3I5AA 3QO9A 2UUCF 3FSYA 5F9LA 4X65F 3FDSA 2KH9A 4R5PA 1C1CA 1VK8A 2D74B 3WBZA 2XWXA 4MIBA 5D4OA 4DV7F 2XY5A 2LQJA 1NB7A 4B9SA 1RGVA 3I31A 1S99A 1NJXA 4LFBF 4Q44A 1MNEA 4N8NA 2AYBA 4U9RA 3OV7A 3KK2B 3HHNB 4ALZA 5KFUA 2J6SA 2Q66A 4KGMA 3RB4A 5C25B 4C11A 1WF0A 4UY85 2K2PA 2R7RA 2A10A 2OPSB 2FGOA 4FPRA 2DNOA 3SV4A 4NRTA 3FQLA 2UP1A 5ITHA 2AJ0A 3MAQA 1A7GE 2KXFA 3DFEA 2FJVA 4QR0A 5HBMB 5K14A 2R7WA 1SH3A 4OZ0A 5LXRA 5HROA 4AFFA 1OSDA 3PW7A 1QSLA 4NMLA 4IOCQ 4M95A 2Z2MA 5L1KA 1VGYA 2NLWA 3HZGA 5AE1A 1YJ9S 2CIMA 3SSRA 2WCXA 2VUGA 1VMBA 2DH9A 3SDEA 2EKYA 2YNIA 2WTFA 3PKMA 3E01A 3UQSA 3N0VA 1SJ4P 3MM9B 1CPZA 3G96A 2BDPA 1U49A 3DXBA 1MROA 1Y5LB 3KK1A 3MUTP 1DLOB 2PGCA 1MWYA 3DRSB 4KB7A 4HKQA 1E6YB 2QEXS 4IH5A 2PN6A 3M8RA 3KLEA 4HT7A 1VQ8S 1G3OA 1HD1A 3UFCX 3TAMA 2ILYA 4Q5VA 3OW2R 5FLXY 3X1LB 3M2VB 4NWBA 2PO4A 4JV5F 3BEGB 2GNKA 2RJZA 3SCKE 2UU9F 2I9SA