4K0KF

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k0kF00
2RJZA 1XNQF 4JYAF 4X64F 4JI3F 1N32F 1N34F 4YY3F 4JI4F 1CQNA 1J5EF 4LF7F 4JI5F 4DUZF 4LF6F 5AJ3F 4LF5F 4DV2F 3T1HF 4GKJF 1FJGF 2UUCF 5LMUF 3OTOF 5IWAF 4X65F 1QJHA 4X62F 4GKKF 2HHHF 1FKAF 1HNXF 4DV6F 4B3SF 4DV7F 2B7CB 4LFAF 4DR1F 4LF4F 1HNWF 2ZM6F 4JV5F 4KHPF 4LFBF 4B3RF 5BR8F 4LF9F 4X66F 4AQYF 1IBMF 3T1YF 1XNRF 1IJEB 4DV1F 1GH8A 5LMNF 4DV3F 1IJFB 1HR0F 1N33F 1XMQF 2UXDF 2UUAF 1F60B 4DV0F 2UXBF 1G7CB 4OX9F 4DR2F 4YHHF 1B64A 2F4VF 4DUYF 2VQFF 1LOUA 4LF8F 4K0KF 4DR4F 1RISA 1HNZF 4DR7F 1IBKF 3ZZPA 3R3TA 1VMBA 2UU9F 4DR6F 4JI7F 2BXJA 1I94F 4B3TF 4B3MF 4JI2F 2KJWA 4DR5F 1N36F 4NXNF 4LFCF 1CQMA 4JI0F 4JI8F 2BVZA 4DR3F 4DV5F 2VQEF 2E5LF 4JI6F 2YY3A 2UXCF 2J5AA 1XMOF 1IBLF 4NXMF 1G1XA 2UUBF 2KJVA 4DV4F 2B7BB 4JI1F
chains in the Genus database with same CATH superfamily
2KT5A 3DRRA 4MH8A 1H73A 2DNRA 1TK0A 1LWCA 4CO3A 2G4BA 2BKPA 2OEKA 3G2XA 4QCLA 2A2CA 1KVIA 2OD4A 1HNXF 2IPOB 1T9YA 1L5UA 2I5JB 3CCMS 4IG3A 3X3UA 3ELHA 4B3RF 2DRAA 4J9LA 1F2HA 4WFZA 1VOMA 4P2SA 2MZQA 1SKSA 1M5HA 1T8EA 2CQ0A 4L73A 3BGRA 5BJRA 2VUGA 1HNZF 2F7VA 3ENWA 4LFBJ 2HNDA 3GZ7A 3R7NB 1HI8A 1VQMS 4DZ6A 4KB7A 1QM9A 1NEEA 1IKVA 2OPPB 4FYWB 2KN4A 5KFWA 3S7RA 3QJPA 4QIVA 4K59A 1U7LA 3R8YA 2AJFE 1MWZA 3O3LA 4PG7A 1V3ZA 5DM6Q 3V6KA 4B3MJ 4W98A 1L3KA 1UA0A 2ALYB 1LWEA 5L1IA 2KXFA 4ITSA 1B0PA 1FTRA 2WRMA 1KN6A 1FWLA 2CPEA 4ZPAA 1FJGJ 3MWBA 2C2KB 4N8NA 3I5CA 1VJWA 3CCWA 4J37A 3DMJB 4DXLA 2Z2MA 1YIJS 4UUXA 3JSMA 5CHCB 1RHKB 2V5HG 3LANA 1X4CA 3PJWA 2IJFA 5ITHA 3MECB 1AA1B 4TXSA 2DR5A 1N0UA 3C16B 2GV1A 3B78A 2ZDOA 2JC1A 3R5GA 3TAPA 4ZOSA 1RT4B 3N5BA 4NXNF 4O3OA 1RT5B 2HPUA 2W8LA 4CLYA 5DLFA 3OW2R 3W8GA 4KO0B 3G87A 3BSCA 3ZTSA 4CLZA 1B70B 1XC9A 1LFPA 3HVTA 4GRSA 1K8AT 4JI7J 3HHLC 2V50A 3AOCA 4DUZF 1Q53A 3R1HA 1J2VA 2AJ4A 1BXNA 4CLFA 2K3KA 3D2WA 3VVTA 2Q1LA 1FI4A 5FIIA 5KFOA 3MM9B 2ZVIA 2C42A 3VAFA 4J9MA 3M1VB 1SCJB 1TZ0A 2WSEC 4P7TA 3Q8VA 3T9ZA 2M88A 1U1RA 3RAMA 5H9FK 1S0VA 3UFCX 4HHUA 3QAEA 1U6FA 2VJUA 2BEFA 2IFXA 1CULA 1G3OA 1ZA2B 4K0KF 3RRGA 3KHLA 1NDKA 2MKCA 2HQDA 1N5VA 1JLFA 2QL9B 4OI1A 4ZPVR 4ANDA 4DQSA 3D5MA 1Q82T 2C2ZB 2FLLA 4CP5A 4V19J 4HACA 2KH9A 3CWJA 3K17A 2G2ZA 1XN9A 2C2RA 2AGOA 3LF0A 1SVDA 1Y9OA 3TWZA 3NCQA 2WTFA 4NLTA 4URGA 1QY7A 3TAQA 1LW0B 4Y2IA 3KMQA 4X2BA 1UZHA 1UP1A 3QZ7A 1Q7LB 5AE1A 1YX2A 2KM8C 1RKIA 3TNVA 1LW2A 2AEMA 2I5JA 1RAEB 2W2MP 3CD7A 3OR2B 3IM9A 2YKOA 4WXOA 3NLCA 3FSIA 4ANEA 2RRNA 2WHOA 4O0NA 4AQYF 8ATCB 1X5OA 3DGPB 1X5PA 4N77A 4WFNQ 2JFDA 3VAMA 2YQ3A 3LW5C 1APSA 5F8MA 5E3AA 5IQQA 2YNHA 4FYVB 2BMBA 4QR1A 2ATCB 2CA9A 5D4LA 2AU0A 2Z58B 5M2RA 2YH1A 3RRKA 4WP9A 3T1AA 4BCAA 1VC6A 2VG5B 3NOGA 3VZIA 2V2VA 1N5TA 2HRUA 2MZSA 2FLNA 1UA1A 2C2NA 1GXLA 2ZE2A 3L7OA 8RUCA 1PO6A 2MQPA 2DGSA 2GCFA 2NXNA 1OJ4A 3KK1B 3MEGB 2QFIA 4CTAA 3D68A 1HIYA 1WOSA 3F56A 3SDEB 2A6OA 2X3GA 3JQJA 2EFPA 2HWIA 3MMAA 3BDPA 2VPXB 4OX9F 4UF4A 5IV4A 2HVHA 2VBWA 4KAIA 4JV5J 2E1PA 4O44B 2GAGC 4DFMA 1G4CA 1BMQB 2N82B 2H4WB 1SH2A 1YRXA 2OUGA 4JI0F 4CLTA 3NP5A 3NGKA 4H4MA 1IN0A 3WC2A 1I3OB 4USKA 3NL0A 1RTDB 2CQDA 4KO0A 1S4FA 2UUAJ 2IM3A 4M5LA 2B9EA 3C15A 1RWWB 3HP6A 2VQFJ 1TMMA 3W8PA 3OFFA 3QATA 4DR7J 3GFHA 1HARA 4QJVA 3HK2A 4UQTA 3PKMA 4RW4B 2KT2A 2FZGB 1JLGA 3BH6B 2BJ3A 2ZOGA 1S79A 1LWXA 1S76D 5GVQA 3RR8A 3IR6B 4LQ9A 1FXDA 2JL9A 3M2RA 4EMDA 3WBZA 5HJXA 4NX9A 1TL5A 4ZP6A 2W9CB 2RT3A 9RUBA 2AJQA 2LQ9A 1RT2A 1CEZA 4TU8A 1FDDA 1HHQA 4DV6J 3UNYA 2C3MA 3DLLQ 3M9MB 5MLCV 3HSJA 1HWJA 2RVJA 3HHLD 2H4YB 1T02A 4FDFA 1ZPVA 1Z4UA 4O3NA 1RWNB 1G6BA 5KFMA 2BANA 5J2NB 1JJ4A 5C25A 4NASA 1RB0A 2CWKA 3PYEA 4B9LA 4QIWD 4JI4F 3CCJS 1TKTB 1HLWA 1YWXA 4I67A 1Y11A 3WHIA 1WJ9A 3MM8A 4CO0A 5KFRA 2IDEA 3U27A 2IVMA 3CDWA 4KGKA 1L3VA 1S59A 1NDPA 3BYPA 1T03B 2QMUB 1DQ8A 1N32J 2CUYA 4U8VA 2NXCA 3B4DA 5THWA 2PE8A 1YKWA 2DH9A 5LL6d 3TVZA 1R6YA 2D74B 2E1CA 1R31A 2V2ZA 3V2UC 1KR4A 3K89A 2MPUA 3ILOA 5A8RB 3OTBA 3AA8A 1CJTB 2BUNA 4RO0A 4Z37A 1X7VA 2HHVA 2HLUA 1R27B 4PRFA 3CUNA 4G65A 5HQLA 2WBMA 1WHWA 2VG5A 3TO8A 5L39A 4ZJOA 3BZQA 2COLA 1K44A 4A48A 1U09A 2ILYA 1KHWA 4WE1A 3PYFA 4K8RA 1CVJA 1I94J 4B3TJ 5EHHA 3UE2A 2HW3A 2NZCA 4ILMA 2DGOA 2RRBA 2ZJPQ 4KQZA 4ECUA 5CZXA 3RG6A 1RAIB 3KK1A 4DR1F 1SV5A 1CG2A 1M5VC 1Q95G 5B09A 2V4JB 3G4SS 2OP5A 3R6LB 2DH8A 1I1GA 3DGVA 3AJDA 3A1YG 2QE5A 4CLUA 1HNXJ 5KG6A 5DZ6A 1EAYC 2CPIA 4C8KA 1IQZA 1WG1A 4NZ6A 2Q3PA 2DBBA 3NS6A 4UZBA 4CO1A 4PWUA 2IA6A 4M94A 4A8SA 1J27A 3KDNA 5J2MB 5B0AA 2CQ3A 1YJ9S 1T05B 1HWUA 1DFDA 2H48B 3SBMA 4HEA9 5JUMA 3MAAA 2VBXA 2I1RA 1HNZJ 2X1GA 4ZLPA 3ICLA 2CPYA 1RCXB 3DKDA 4PEOA 5E0OA 4C9DA 1URNA 3CJKB 4XK8C 5E3RA 4RNMA 3QWPA 1CBKA 1XR7A 4LVNP 3DLKB 2GX8A 4RPFA 1S6QB 2A3JA 2A18A 3KK2B 4LRBA 2RU3A 1FXLA 3W7BA 4FP9A 1VLOA 4ECZA 3VQTA 4QOTA 2EFGA 4DMZA 4DCJB 4N41A 4RUCA 4DUYF 2WVFA 3K5LA 3CJ3A 3MFHA 5CYMA 2J9CA 3H5SA 3SQGA 3CSKA 3QWUA 3NNHA 3ZTQA 3ZO7A 2H1YA 2CQPA 4UTGA 4TYAA 4C8LA 1V5IB 3UDVA 2GIQA 3WZ0A 1R43A 1WC4A 2EKYA 4KBIA 1M5PC 2LQBA 2AIRB 3NCPA 3N79A 1GTHA 4FF3A 1XBWA 5D4PA 1NJXA 1U0HB 2MY7A 4I2PA 1CC8A 2J0XA 4HTIA 2D3O1 2DRDA 2VONA 1GMWD 4NXNJ 3G8TA 1FVQA 2DEIA 5F3TA 1Y5IB 1AZSA 3W66A 1HBUB 3DFEA 3IR5B 1FKAF 5DRKA 4LFAF 4NA3A 5HLFB 4EYIB 4HLBA 1NK0A 2MLZA 1BGXT 3FCHA 1S0NA 4Y2MA 4DUZJ 2XULA 1AW0A 3UDCA 1RJJA 3N5FA 5KFGA 4V19X 4NOHA 3FUYA 2WONB 1WC6A 3NAIA 1UVJA 4DN9A 2QMXA 2HVEA 3I9ZA 1Q8LA 1YJUA 1VBZA 3PFOA 2ZBQA 4Q44A 1KD1T 4C97A 2VV5A 3DRXA 2YQ0A 2ZZTA 1RLDA 5DDOC 3ZZRA 3MEEA 1JB0C 2DITA 2ZHAA 4DS4A 4FKYA 1HHTP 2IMWP 2MKKA 4K0KJ 2RUSA 2NLWA 1UEVA 3MDFA 5KFNA 2KYZA 4ED1A 1WOPA 2HZAA 3QT8A 2E44A 2K3IA 3BS9A 3DYAB 3QGPA 4TY8B 1LQ9A 2RSQA 3ZZTA 4OI2A 3HFKA 2FZKB 1RDRA 2UUWA 1TK5A 3K0JA 1KOOA 1R89A 3IAM9 5HP1A 5K8NA 2B4PA 1WG5A 3WIVA 4USHA 3RW6A 4AXJA 1TELA 4ZVFA 2L3MA 3MGJA 2QLWA 1JLBA 1LOUA 2LXIA 3V6HA 2EI5A 3N6LA 2PGCA 3OFHA 1DARA 2VKRA 4DR6F 2IC3B 1HQUB 1MU2B 4AQYJ 1LEOA 2W8KA 3P6YC 2LXUA 4F3QA 2CQ4A 3T5HA 4OFZA 2B9YA 4LRCA 3PR4A 3C6TB 1NPPA 4LIRA 3D66A 2C22A 3HHEA 3J81j 1URRA 2IAJB 4WF9Q 4J91A 4ECYA 1GK8A 1EJ7L 2CFXA 3SFUA 1F3FA 5HO4A 4J9VA 2LA6A 5KFYA 4MKVA 3H5YA 2CDQA 3CE8A 2MQQA 2VG6A 1ZPWX 1TL3B 3K8VA 4DV7J 4PQUA 3IRXB 3RTVA 4I6AA 3JQMA 3CCVS 2Q6BA 4PYAA 2QL7B 3DRYA 1NZ8A 2V2KA 4G1QB 1Q5YA 2E7XA 3GB0A 3CDUA 2Q66A 4HI2A 2AW0A 4DR2J 1HD1A 5HVGA 2MKHA 1NAQA 2YNGB 1VYAA 2G2YA 4ZN1A 5I42A 2XMKA 3KNGA 1KQGB 2CJQA 4MFBA 1X4HA 1HNVB 5ETPA 4C11A 1WHVA 2E5IA 4OX9J 3P5TL 2XY5A 2Y9HA 1FEEA 3CMQA 3NCRA 2UP1A 2NYHA 5DGAA 4CIOA 1NK4A 2YKNA 4ELVA 5KFCA 4RUHA 3HVRA 2OKQA 4JI0J 2PMWA 3AXMA 3CCUS 4K50A 2RDDA 3DOMB 2AD9A 1EIYB 1SL2A 4B3OA 4OI6A 4RNNA 2VH7A 1IKYA 1RZMA 2RDJA 3DU5A 5ETVA 1QUPA 2XEXA 2K7KA 3QFWA 3A8KA 1PC5A 4HT5A 3HHNB 5B7WA 1WUUA 3K2YA 2CDRB 2YKMB 2HRTA 2HS0A 3KHHA 1MWYA 1K0TA 2V8PA 1RAFB 2BE2A 3Q23A 2CPXA 3OXFA 1OSCA 1IM4A 4OHZA 4F2SA 3D4JA 1VQLS 2JSXA 1PJ6A 1U49A 1N56A 3DRPA 1PCAA 3W62A 2FY1A 2QYCA 2CVIA 3HI9A 4ZVOB 2HFNA 1SQFA 3QPIA 3SEOA 2VF3A 4Q8EA 2DGVA 3FEYB 1K9MT 4QPXA 4ECRA 4KH0B 2LECA 3V6DB 1MG7A 4TY8A 3DXBA 1NSPA 4DJBA 3SV3A 4I7FB 3CCTA 1RT3B 3G6YA 4IG0B 2D3OR 5EX0A 2B8PA 5GAEI 2V8HA 2H5JB 2QA1A 4OL8A 1RTHB 2K06A 2YNFB 1NKCA 2XSJB 3J7ZT 1DHMA 1REVB 4ILRA 2P6SA 4ID5A 1FFGB 4EBEA 2I38A 1WDTA 3RB3A 4W4MA 3QIPA 4RJVA 2GVDB 3GJTB 4RL1A 5HK4A 4MAKA 2OPQA 4TLRA 4OZNA 3M6XA 3C14B 3JS9A 3PW0A 3D6FB 2RUGA 2F65A 3ENQA 4FS1A 2ZFHA 2A10A 4CO5A 4GC6A 4QWBA 2E1RA 5CYJA 1NH8A 4ZHRB 5DG8A 4NLGA 2W4DA 3QMQA 3LP1A 4E0DA 3MM6A 3A8IA 2VZ9A 4JI1F 2E5JA 3UD4P 5FD1A 3G8SA 1ZH5A 1KBRA 2M7SA 3BSNA 3D0GE 1TL7B 5HQ8A 4QR0A 3T1HF 1VQNS 4OYOA 1NU4A 3D6HB 4DUTA 2R8GA 4Q8FA 2XI3A 5F0UA 1UPPA 1TL3A 2QRRA 1U24A 5IC4B 2WW4A 2ZM6J 4YQWA 4LR8A 3H5XA 3Q8QB 2RB7A 1BQNA 1W25A 1P1LA 3OUYA 3T5KA 1KLNA 4OZLA 4K7QA 5JXSA 2BKOA 2HFOA 4G1QA 1N6QB 5GADI 4DR1J 3IBWA 4U7CA 4QYZK 4DG1A 5F8JA 1B7YB 2CKWA 1QAJA 2XMWA 2DNPA 4OMFG 3IS9A 4I1TA 5DDPC 4B9UA 1UFKA 3QLHA 3PX4A 3UCGA 4K2XA 4LF2A 3UCUP 2B7BB 2Y1LB 4I69A 3W65A 3FFIA 2BV3A 1TKXA 4GO5X 4Q0BA 4NLSA 3MR6A 1EQ0A 3TUJC 5IC6B 3QJJA 2QTWA 2ZH8A 2HIQA 3NRBA 3BYRA 1UVIA 3WC0A 3ZC4A 2IDLA 3TZXA 5IZHA 3CCLS 5H9EK 4GKKF 2QZ8A 1VRTA 1NLKL 4RW8B 2OPRB 4P2MA 4FN5A 3KXDA 2MLYA 4CO2A 2I0XA 2W7OA 5B0BA 5D3GB 3Q83A 2OFHX 3RRHA 3BPSP 3LP0B 3CO0P 1X9MA 3CPWR 5I3UA 1X4EA 1Z2ZA 1CPZA 2QO3A 1T95A 2ZWOA 2XWYA 1U2RA 5BYQA 2BJ8A 3E01A 1M1KT 3ITHB 4PKDB 2WVCA 4ZVPB 3G6XA 4F4ZA 5GMKa 4TU9A 1H74A 2P9GA 1JLAB 1HBOB 4DUYJ 1YBAA 3BBBA 2Y1JA 5KT7A 5K8MA 3GV5B 3OVAA 4UY8T 3HMJG 4R8UB 3CJ0A 4U7UD 3QGIA 2CRLA 5G0RA 2NPFA 1S4EA 3G9CA 3V6DA 3EGZA 2B9WA 1X4FA 4X65F 2AEFA 5J1EA 2LKZA 5U47A 4ZLLA 3Q22A 1V6HA 3MAQA 2OO4A 3MXHP 2QLFB 4NPOA 1VQPS 2J0WA 3V81B 2QJ3A 2NS1B 1Q8IA 2BQUA 2L9NA 4WFBQ 2AHOB 2D3UA 4JUZA 3KHRA 3IN5A 2V94A 3E2EA 3L7UA 1PKUA 4LFAJ 3LUYA 2VL1A 4IRDA 1EARA 1DJ0A 1KSPA 1VQYA 3THVA 3C14A 3F44A 1M90T 2BXJA 4HT7A 1HBNA 5KFKA 3BQ0A 2Z2ZA 2GC8A 2GJ2A 2MB0B 4ZVTB 3FZBA 3M6WA 2MZTA 1G1XA 2J0SD 2HVZA 4M1KA 1IXKA 4NE9C 2D1CA 1RYSA 3CO9A 2LFVA 2EVZA 2U1AA 4TU7A 3N6MA 4DV2F 2LCWA 3IBFB 3A8EA 3NAHA 3I0SA 2EFOA 4DPWA 3K58A 3C3LA 4GMKA 2R8HA 3R5DA 1DURA 3CJSA 3UR0A 4KHPF 4QW9A 2DGXA 3KG4A 3W9JA 3I9V9 5KG4A 1QTMA 2DR7A 1GQEA 4NWBA 2GHPA 2OSRA 3M4XA 3KK3B 2EC2A 3O1LA 1LK5A 1SC6A 2B6AA 3IBCB 2VPWB 3R3TA 1EKSA 3D3CJ 1U48A 3DLBA 1GMUA 3D0HE 3PDNA 3OJUA 2C3OA 3CXCR 5F8HA 5L1KA 4ZCKA 3QO9A 1UWBB 3GSDA 1PSDA 2KFYA 2AX0A 1GT8A 1UEUA 1L3TA 3ETOA 2QGFB 3PO5A 3SQOP 2ZWPA 1CQNA 2JFKA 1CC7A 2NQPA 2HMIB 1SKUB 5L1LA 4EBDA 1S77D 1IR1A 3KLGA 1DQ9A 3OPKA 3JB9k 4RW9B 4LR9A 3ENAA 4RW8A 4IFVB 1HKAA 4Q5VA 1VI7A 5EGYA 4O4RA 2XS7A 4EYHB 1MSWD 1YQHA 2AV5A 5C24B 2DH7A 2C2OB 2N3LA 4NYZA 1HR0F 5IFMA 1XMQF 3OL7A 5KG1A 1CS4B 2XHCA 1YJWS 4PABA 1T3OA 4IDKB 2Q79A 5T41A 2VOPA 1RKJA 1LWFA 1DAXA 5EX3A 1ZTTA 1FK9B 1T9WA 4A8OA 3AA9A 1M5OC 2QEXS 1T9TA 4QQBA 1RE1B 3D3BJ 4C8ZA 3S01A 2KRBA 1ZM9A 2BYCA 4RW6A 4DBQA 2YNIB 3I31A 4OZ0A 1S6UA 4OHVA 4QYRA 1RA6A 4X4PA 1UFLA 2GVZA 4RX6A 2VICA 3BV8A 5DZ7A 4LF7F 3M8QB 4NLOA 5IT9U 2MSSA 4NYOA 4YR2A 3OTOF 1TAUA 4ZVRB 2CQHA 1E6VB 2V69A 4QIGA 2HHHF 4KFBB 4ZIVA 2DNKA 3TVYA 4CLSA 1RHMB 4Z2XA 4N5SA 4RNOA 4AL6A 1VRQC 3SSRA 5KT4A 2R9LA 5CXTA 2FHJD 4DPXA 2B4VA 4QIFA 3MPYA 3OR1A 1NB7A 3UW1A 4DV1J 1C4AA 2HKEA 1WACA 4MKYA 2NXEA 1EKRA 4JV2A 2DHAA 3EGWB 2YBVA 2ALZA 4P75A 1SXLA 1QSSA 4AL7A 1SBRA 4DR5F 2WVBA 3RUBL 4NEYA 3OTDA 1VISA 4Y65A 4K5SA 2R7VA 4OLOA 1R0AA 2W7AA 3PX6A 1VCTA 4LBHA 3MEDA 4ICLB 3MMJA 2IM2A 3P3DA 2HQGA 3GIKA 1OWXA 3GONA 5ETTA 4XPEA 3TI0A 3R2CJ 2M9KA 3NS5A 2PA3A 2UUCF 4RBVA 4BWMA 4M5DB 2DVIA 2GS8A 1IKWA 3POTB 2ROEA 3OBIA 2C2DA 4NLYA 2DNQA 3X1LB 5IV3A 2J6SA 1HPZA 1S7IA 3FBCA 5HBMB 4RUAA 3EDQB 1ZETA 1M1HA 5C2CA 4YS2A 2P2CB 1QE1A 3KYLA 2UXBF 1G7CB 1SIZA 4QWCA 2L41A 3MMCB 4TY9A 1ZM4A 1FRLA 1ZA1B 4UOCA 3PNIA 3CW2C 2CNOB 2GGPB 2V67A 4QWEA 4L6V3 4IYQA 3R7SB 1JNRB 4ZK7M 4IRKA 4CLPA 1ZZNA 3MR7A 1S1VA 2HGLA 2M8DB 2HHQA 3IWNC 4P9SA 3LAMA 4IUFA 3H8YA 4DOZA 4EZ9A 2CPZA 1MROB 1X8DA 4NCGB 3KHGA 3VHQA 1RSCA 3D1HA 2PIIA 1H98A 1O6XA 1DBDA 4QWAA 5HI7A 1QVGR 2E1AA 1VK8A 3HLUA 1JXVA 4MIBA 4LSNA 4JI1J 1R0CB 2B3TB 4GVBA 2PMZD 2ZD1A 3C6UA 2LP4A 1HYSB 3ZXWA 1XWLA 1JLEB 2LLZA 4WFAQ 2M2BA 4ZIWA 2FVSA 4F8RA 1KRPA 1S1TA 1N33F 1TL1A 2AYEA 4NLRA 2OEMA 4C3KA 3Q8YA 2OPSB 4R5PB 4RNFA 2MKJA 1NZAA 3RZAA 1SUQB 4ES2A 4XDDA 2HYIB 4XIUA 3I56S 3LALA 4FXDA 1AYEA 1PYTA 4WIIA 1FK9A 2DXEA 2BDPA 3I4PA 4NL5A 5D0RA 3KLFA 1HMVB 2GO8A 4WP8A 3QSIA 2CAJA 2OJ3A 2DNMA 1Y3JA 2HWTA 1U1QA 4U6PA 2YKQA 4Y0FA 1KC8T 4IKAA 1T3NA 3SCIE 1RWUA 4F0MA 2G1HA 3QRQA 3HJFA 4OYBA 1RGVA 2DGTA 4CYUB 5L9NA 4YDXA 1BWEA 3EMTA 4AT1B 2OELA 5ETMA 4ZP8A 4CT9A 1LXNA 1KFDA 3HVAA 4RKUC 5H1SV 3GCWP 4URSA 4HHJA 3GIJA 3HHKA 5D4NA 5J2PB 2DO0A 1YZ6A 1M5SA 1Q7YT 4FYYB 1UETA 1FKOA 3BBCA 3QGHA 3VAGA 3CCES 1H3DA 3H59A 4P71A 4GKKJ 2KTQA 3OFEA 2HNYB 2DK2A 2L9DA 3VAJA 1HWLA 1F5CA 5ETNA 5GAGI 1SC1B 1M0SA 1KTVA 3KLIB 4ZS6A 4L75A 4WK1A 2RKIB 3GG0A 3GMGA 3OLAA 3LOUA 4JI8F 2BVZA 2J9EA 3NWGA 3DM2B 2R2RA 3R5BA 4NZ0A 5SZTA 1D8ZA 2X3DA 2P9EA 5CYQA 3FCWA 1X5SA 2DR8A 4JYAF 4N56A 3DU6A 4TVAB 2CJYB 1FKPB 2N4CA 2NUHA 1WC1A 1QJHA 4DX7A 4ECQA 4LRAA 2BE7D 2FB0A 4LF4F 2L9WA 2PT0A 2CVEA 3ONQA 1KQFB 1DTQB 3W9HA 4BLGA 2DIUA 2DNYA 1NXIA 1IBMF 2GQQA 1CJKB 1IUJA 1WI6A 2XMAA 4X65J 3M2VB 4OZ1A 2ROGA 1D3WA 5A0YB 1SL0A 3CC2S 2V9KA 2XNQA 3EICA 2W7PA 4Y34A 4FVCA 4TN2A 3K57A 2UV8G 3EM1A 3HVWA 1VBYA 1RT1A 4M8LA 1H2UX 4B9MA 3ET6A 5HVFA 4A8WA 3FEXB 1WHXA 2MZRA 5D6GA 5KAKA 1CJVB 1XJWB 4RR5A 4OYXA 2R8KA 4DHVA 3HSZA 2NR0A 1REGX 2HNZB 3IG1B 2XZWA 2JDJA 1J5EF 2HS3A 2K1RA 4GKJF 2LVWA 2VOOA 2GQCA 4HH1A 1U1OA 1VDHA 1S1UA 1HNIA 3PJXA 1Q4RA 5A2QY 2UUTA 4N8OA 3DOKB 3FQLA 3CC4S 1FFSB 2RQCA 4DV2J 1OO0B 3V6JA 2Y0SD 3W2VB 3P5BP 4CI0B 3MUMP 1I51B 1YK9A 1RAAB 5DDQC 5JVGQ 1YDLA 3JXOA 2VFTA 4EI2A 4WZQA 4KHPJ 3R1LA 4EZ6A 2GHVC 4KKOB 1FJEB 5F3ZA 1YJNS 3M32B 5KT5A 1NSKL 1YJRA 4NLDA 1IWGA 4OHYA 2XTJP 5I4MA 4NLUA 2ZH3A 2BACA 4HDGA 3UO0A 4J9OA 5HROA 4ATNA 2ADCA 5J2QA 4MJKA 2CQGA 4L74A 2ACYA 5B0FA 5KTQA 2A0FB 4A8MP 2QA4S 3TARA 3IM8A 2VASA 2HAIA 3UN2A 3BR9A 4C6AA 1QSYA 1R8CA 1RTIA 1RAJA 1U26A 5ETOA 3O44A 1NDCA 2EFQA 1EQMA 1BLUA 1V9OA 5FDLB 1IWAA 3QYYA 3W5XA 4L3NA 1TKZB 3W61A 3S6EA 1JLCB 2IRYA 1RBOB 3GU0A 3VALA 2CG8A 3OSNA 5HVHA 2Z2LA 2NSCA 2KG0A 4C0HA 1PYOB 3LP2B 2AGPA 5C42A 7AT1B 4KIAA 4WBFA 4A47A 4G3IA 5K8PA 1EX8A 1HR0J 2OTLS 4P2FA 3KOAA 1XMQJ 2UXCF 2GHWA 3VWSA 1K1SA 3QSYB 1HW8A 2EG1A 3MURP 2GIRA 1D9FA 1S0OA 4I2QA 1KWMA 4X64F 2CADA 4YR3A 1YSJA 3TA0A 1UZDA 1WNEA 5HJYA 4KGVB 4F50A 4PXCA 1C1CA 5K14B 1J5OB 3KLEB 3CMAS 3HT0A 4PUOA 2ZZMA 1FEHA 4NRTA 2BW7A 4YN3B 1FF2A 3UD3P 3OVBA 1VQ7S 4AUKA 5B0CA 4LF7J 4IRCA 2RIJA 3EE3A 3PW7A 3OTOJ 3DOLA 3ADAC 1TU0B 2HHHJ 4DU8A 1C2PA 1C0TB 4ED5A 2GW8A 3ZZPA 1ZYQA 2DY1A 5KFHA 3H2UB 2O3DA 1H72C 1IKXB 1S9GA 1F6TA 1Y10A 2BJEA 4D3HA 3R27A 2Z56B 4X84A 4DL2A 4O3RA 3OHAA 4M5GA 3T5JA 5IQ6A 4CO4A 1SIWB 5D0HA 2FJXA 2W9BA 1RT6A 5B0GA 3BSOA 4LF5F 2KB2A 3GYGA 3MR3A 1UVLA 3NGSA 4LSLA 5A8WA 1IVZA 3AB4B 2YQ1A 3PO4A 3F41A 3MM7A 2XO7A 2HBYB 3KJVA 4ZVHA 4C8OA 1CSJA 1DTTB 2UUCJ 5E7OB 9ATCB 4EGLA 2BZ2A 2I8EA 1VQKS 1B64A 2DPIA 2J6UA 5EWGA 2Y8YA 4W90B 2OFGX 4F2RA 2KM8B 4O4GB 3P45B 1JLQB 2R42A 1GMVA 1YJVA 1WSVA 4DR3F 4R0JA 1ZAWA 1VRUB 3PEJA 1N4LA 3W2WA 2UXBJ 3HSGA 2LU2A 4PWDB 4FPRA 2VODA 5AXLA 2KI2A 2AJ1A 3KLHB 1RTJA 1MWQA 2RHSB 3H42A 3HSDA 2QMWA 3EVMA 3I0RA 4UUWA 3L7PA 2B43A 1UVMA 4NLWA 2XY6A 4M5IA 4QWDA 1D9AA 4Q7AA 2B7CB 1EETA 1SQEA 4BHQA 4USUA 4M63A 4Q45A 3N4WA 2JC0A 4NI2B 1K47A 4DSIA 3SSQA 1TUGB 4MK9A 1B0VA 3DI6A 4CT8A 1S9EB 4DV3F 3PV8A 4C8MA 1FWPA 3FBFA 1H2VZ 2VFRA 3DC2A 4NZ7A 4QR2A 3M8PB 3AD9C 1E6YA 4K4TA 4K4WA 4RBTA 2V8GA 2ZVSA 1N36F 5IM0B 3UWTA 1S99A 3LWMA 2DISA 1N33J 3NBPB 2EEYA 5IT9Y 4F25A 3H2LA 1HQEB 2B56A 3WIUA 2JRSA 4NLQA 2RJZA 2ROPA 1N52B 4YFUA 4OLPA 3NGDA 3UPFA 3CCZA 4JI5F 1LK7A 2CQ1A 3V4IB 2JEGA 2Z0GA 3D1OA 3DLGB 2KXNB 1OMSA 1PBAA 3CD6S 2W9AA 3VAHA 3M05A 5ETKA 2VG7A 3BR8A 4KTQA 3NMRA 2NSBA 1FRKA 6FDRA 4LF9F 2R8IA 1TVRB 2P5VA 1N88A 2DR6A 2KKHA 1S7HA 2MHNA 1TKDA 1A7GE 1BQMA 4ED0A 4OHWA 1F60B 5T14A 1PAEX 4USTA 3TAMA 1S1WA 2RF2A 1RQ0A 2XCPA 4ED7A 2WOMB 1U1MA 1YZ7A 3UVJB 3R97A 3J81U 2ABYA 3M2UB 1D1UA 1QUVA 1NK5A 2GJIA 4QW8A 2POKA 1U8WA 3VV2B 4I6YA 2QLXA 2RU9A 1A9NB 4OJ1A 1U6BA 4CQ1A 2M70A 3OL8A 2QIFA 1F9HA 4UY85 1PBUA 3ZFVA 1OS5A 3G8QA 2PI4A 4TLQA 5GAHU 2XYHB 1VGYA 2RQMA 4PWWA 5KFTA 4JI8J 2E66A 4ES1A 1VC0A 4F04B 3M8WA 1F3VA 3B82A 5B0EA 4USMA 4FF2A 3JYTB 5EDWA 4JYAJ 3FC9A 2EFNA 2JWNA 3CT9A 4LRDA 4WKYA 2OHDA 1U1PA 4OQJA 3D9BA 4WPAA 2B5JB 4KE5A 5DO2A 2VFVA 4OYIA 2OPPA 4M5NA 3R5CA 2F4VF 4NA2A 4WIQA 4LF4J 4EWTA 4F4KA 2WZ1A 2GNKA 3ZZZA 1MMNA 5E5NA 5FLXU 3H40A 5FJ4A 1IBMJ 3D0IE 3QJLA 1EP4B 2HWHA 2VKZG 3H4DA 5EUHA 1AUSL 2F5GA 2ZH1A 5EWEA 2H3EB 3DRSB 2P9CA 2ADBA 2R7TA 3BPDA 4WFXA 4C3LA 1YRUA 2QC3A 4DL5A 1Y4ZB 2UUBJ 3DMJA 1I5OB 1FRMA 1KDNA 2M0GB 2I9SA 2JEJA 2PFDA 2R7SA 1FJGF 1RHUB 3D28A 1S1XB 1UTAA 1FJCA 4GC7A 1Z2LA 2KFZA 3MECA 2ZHBA 1TV6B 4MMOA 1HI1A 4IFYB 2V9WA 3C16A 1FHTA 1EZZB 4OJ3A 1UAWA 1Q16B 1RA7A 3CDBA 3KLVA 1J5EJ 1RT4A 3IRWP 1BC6A 1S9EA 4GKJJ 5L1JA 1RT5A 4K4YA 2FJBB 1SJRA 4BWJA 3IXQA 3M8YA 1D8YA 2OSQA 4HR2A 5M2PA 3B54A 1D9DA 2Q43A 4FF1A 4KPCA 2N4DA 3HM9A 1MNEA 2ZZNA 3HF5A 1K73T 4CCHA 4DQIA 4UOHA 2GMHA 2UVWA 4RUBA 3VGSA 1YITS 1L3UA 2IJNA 4MIWA 2EXUA 3G82B 2J7WA 2RDIA 3GJSB 5E33A 4S0MA 3HZEA 3MM9A 4PXBA 1RYRA 3M1VA 3O8WA 4OJHA 3GR0A 2AYBA 2R2SA 2JH3A 2DNLA 1DLOB 4J7CA 3R9LA 5C7PA 3VF0B 3MR2A 4QU7A 4F4WA 5KOWA 2ACMA 1ULRA 3RBEA 2XGPA 2QFJA 2WVEA 2ZJQQ 3OFGA 1XNRF 2XLKA 1IJEB 5JMNA 2OGUA 3GYXB 2Y1IA 3DLEB 4DEZA 5CZVA 1RWPB 5D78A 1C4CA 3GSIA 4XO0A 5KOXA 2BOPA 1KKHA 2NYIA 1JKHB 4L76A 1ITPA 4ED3A 2MZJA 3ZTOA 2FPHX 4MKAA 4EO6A 4AFFA 2FHJA 2FGOA 4Z7CA 1LW0A 3ILLA 5KFUA 3SCLE 2XI2A 3QQCD 1MN9A 4RW7B 3M30B 4ZP7A 1IR2A 3KG1A 1HBMB 2WB4A 3NG8A 1JNZB 3OTEA 4TQRA 3OR2A 4TKTA 3N28A 2YKAA 2AGQA 2MGZB 3P96A 2EFVA 2EW9A 5ADZA 2JEIA 3H7HB 1TFWA 3DGPA 3T6BA 2IRUA 1FDNA 2UXCJ 3Q86A 2ASDA 1HNWF 2BJDA 4DDFA 3UN3A 4X64J 1RT7B 5D77A 4DSFA 4NLXA 3I55S 4KYZA 1U2CA 3E8OA 3TEGA 2FHOB 1VC5A 3M7VA 4X66J 3MMBB 2F8EX 3O6QA 1RHRB 5J1NA 1P1TA 1S72S 1N5YB 4DLGA 4DN0A 3KUEA 4YEAA 3OL6A 2P6TA 5KFPA 2XMMA 5HQMA 2IHR1 4BDPA 3FBEA 3QAUA 2BQ3A 3BQ1A 4X4UA 2MSTA 5HMXA 2DGUA 1Q8BA 2PD1A 3OT9A 5T7LB 4C2MA 2DRBA 4WK3A 3A12A 3THPA 3MEGA 3LPYA 1NK9A 2RQKA 2YX1A 4X4OA 3VAKA 4OI4A 3MM5B 3SDEA 2JEFA 1F5BA 2HFZA 3A3NB 4RZRA 1SH0A 2J7KA 2FC8A 4B3SF 1DZ5A 3EGNA 3EGVA 3DRRB 5KFIA 4O44A 4HKQA 1LWCB 3FRYA 3VQSA 4KJIA 5F8LA 4AXIA 4B3RJ 2FQQB 2C3PA 3AQOA 4MK8A 1VBXA 2GIFA 4R25A 4LF5J 2XMVA 1Q0NA 4RLEA 5LSLA 4OZJA 2F63A 4A8KA 4IG3B 1RTDA 3GJRB 4YDDB 4PYDA 3MEKA 4X4NA 4DWIA 2HQFA 3PACA 1R6VA 4CNYA 5D0GA 4B17A 4AL5A 3GFYA 3GTYX 2J76E 4RW4A 4J9SA 3QIDA 4ES3A 1Y7PA 3GIMA 1B3TA 3BGRB 1XR6A 2F9JA 2KJVA 2HNDB 3GCXP 2CQCA 3IGVA 3HD1A 4RU9A 3KJQB 1SQGA 4NLVA 2XMJA 2W9CA 1IKVB 5C2GA 2DNGA 2FDNA 4DR3J 3GG1A 3C66A 4DSKA 5EN1A 4DFPA 2IY5B 5A6WA 4DFJA 5KFFA 5KFBA 2H65B 2UVVA 3HT3A 1VHFA 3BGLA 3IMQJ 3VVUA 1LWEB 5AXNA 1AT1B 1VQ8S 3R7BB 3OLBA 3AD7C 5J2NA 1PILA 1JKHA 2ATLA 3TQ1A 3JSMB 4HDHA 2UU9F 2XMUA 4I4BA 4IO9Q 1JMTA 2RRAA 1RBAA 1PIEA 1YRTA 1TKTA 3EUNA 4DV3J 4X4QA 4M5MA 1NSQA 4CM2A 3FDSA 2OIHA 4F4AA 4EO8A 2FYXA 1T03A 1NKBA 4ECVA 1WEYA 1N36J 5KG7A 4ZVUB 3J80U 4ZP9A 1RLCL 1UKUA 1A6LA 1Y5LB 1GTEA 3BO4A 3HVTB 3TEHB 3CC7S 2HFVA 3BGUA 3FKBA 3PHTA 3HD2A 3K5OA 5A8RA 1O5JA 3OXLA 1W2IA 2CJAA 4EEYA 4BBYA 1CJTA 2YWFA 2JZ5A 4JI5J 1U1NA 1KQSR 1MW7A 4FPIA 4A8YA 1Z1ZA 3VAIA 2KXHA 4ED8A 2HG4A 4U67Q 5L46A 2JLGA 3QT6A 4JOUA 2W24A 3G6ES 2V6AA 4LF9J 1X4DA 1GXTA 4JI6F 2HK3A 1S12A 1CULB 3TUZC 4X4VA 5F8IA 1NJZA 1ZZFA 4CWBA 4ECTA 3IFEA 2HQ3A 1YBUA 1JLFB 2KVIA 2MMYA 1RWVB 1JJ2R 3BKUA 4QIEA 1OSDA 3PW4A 4HACB 2V4JA 4ZPBA 4X62F 1KQKA 2Z4PA 1O51A 1KEKA 4ETZA 1V3SA 2AF6A 3Q2TC 1ZAXA 1SJFA 4B9SA 2CJBA 3IO1A 2VDIA 5C5JA 2CJ9A 2BQRA 4JP8A 5H9FJ 5J2MA 1LW2B 1T05A 4F02A 5ETRA 2AYMA 2VFSA 3PFEA 4DSLA 4WU3A 3AOBA 1FNMA 4CLLA 1RWOB 1H2TZ 1PC4A 1FFWB 2J9DA 4YMEA 1CQMA 3UNGC 2YNHB 3CJKA 3Q0AA 5K8OA 3AAWB 5F0WA 4LVOP 2DHXA 3M8ZA 2F4VJ 1O8BA 4USIA 3FQKA 3V5RA 3OSPA 3DLKA 2DHSA 2Y8WA 1S6QA 1N34F 1D09B 5LM7E 2HHXA 3K5MA 5L8RC 3KK2A 3FCVA 2G0JA 3K5PA 2HGNA 2H51B 1NDLA 3TJAA 3OQ2A 1KLMB 4P2XA 2BABA 2KO1A 4DCOB 2DYAA 2ZE2B 2LQ5A 3MPUB 2ZH7A 3H0PA 1OY6A 3GLJA 2GZOA 1XEZA 2OEJA 3WDOA 4WZMA 1GH8A 1BE4A 3EX7B 1SKRA 5D8HB 2O01C 4AYBD 2VB6A 3T3FA 4LT6A 2ZKUA 4AD6A 1FT8A 2ZITA 2AKWB 4WTYA 1VQSA 2KVQE 3LGMA 4A8XA 3M9OB 4CTAB 1WSRA 3H2VE 3M6VA 1T7PA 1WEZA 1U0HA 4DCPB 4DX8H 5DM7Q 3NGRA 2D9OA 1S6PB 3MMAB 2JJ4D 2AZ3A 5AXMA 2R3VA 2ERRA 3DN9A 1HBUA 2WBRA 2HVIA 2J9DE 2F40A 4KHRA 4NLPA 5HLFA 2PFFB 4Y00A 4H4MB 4LF1A 2B9XA 2K8GA 3MZIA 3C15B 1MN7A 2PC6A 2YPYA 4DX6A 3T6JA 2WONA 1RXOB 2R7UA 1WC3A 3ZZOA 3L3CA 4WXWA 4PG8A 4FBUA 1JLGB 1JIHA 2HQIA 3PX0A 2W2NP 3J81Y 3M2RB 4JV1A 3AT1B 3NS7B 4DQRA 5KT2A 1IBKF 1S0MA 1FO1A 1U02A 4Y3CA 4IQXA 1RHJB 1OQ3A 2ZH5A 1XNRJ 4UT4A 4DF4A 1RT2B 2V0NA 4H4KA 1F9FA 1WKJA 3DYAA 1LV5A 2VC1A 1XMOF 1WG4A 2KZZA 3EYZA 3A4TA 5L9XA 1T94A 3ZZUA 2YPZA 1RWMB 2CQIA 3SIPB 1QAIA 4JI4J 4KT0C 4ER8A 3EDRB 2MKSA 2R7WA 2BANB 2CNLB 1NHUA 5G4DA 3R5AA 2DXDA 5GMEA 3KJFB 5C25B 2BOAA 3HULA 2IM1A 1V5VA 2VJVA 1UW9A 3LWLA 1FVSA 3PCOB 2BRLA 2IC3A 3CJ2A 3MM8B 1HQUA 1MU2A 2O5DA 3NNAA 2X7IA 3LPEA 5FLXY 1XIQA 1W2BR 3FRZA 3BKTA 2BRKA 2CWXA 4Y28C 4YHHF 3C6TA 5F8GA 1HNWJ 2V4RA 3J7AN 2IAJA 2JVOA 4DL0C 3PJ9A 3AQPA 1SJ1A 3T9NA 2ASLA 3V4MA 2JVRA 1U2FA 2WB1D 2H9ZA 2VIHA 2KT3A 3M8RA 4UZCA 7FDRA 1L3SA 4KHMA 1KONA 2L08A 2M52A 4OJGA 5L38A 3TUPA 3Q89A 5HSPA 4ZPWR 4LQ3A 3Q24A 3TZWA 4HHHA 2A1BA 3HJVA 3VGVA 3IWLA 3R6GB 3IRXA 2E9RX 3TANA 1AUDA 4O3PA 4F3OA 1C1BB 1OY8A 1KLMA 4DV7F 2W1BA 2BJ9A 3GQCA 5KG3A 4WE1B 2UZAA 3ZNUA 1RCOB 2IA0A 4J9RA 3BB5A 1NKEA 2D7SA 4NCAA 2YNGA 1H38A 4U95A 4OI3A 1S6OA 2IMOA 1Q5VA 2XWXA 4J9NA 4ZPCA 1HNVA 3DLJA 4ZPDA 3R2DJ 2AMCB 4DR2F 4P73A 2AYGA 1SV5B 4B3SJ 3KNAA 4EK2A 2F1FA 2XY7A 1JK9B 2MY8A 2EG2A 2R4FA 5CA5A 3ENVA 4NMXA 4JI2F 2MQNA 1A0OB 1S6PA 2ZBCA 1QAXA 4U9RA 2I2YA 1BD6A 3PIOQ 3US5A 2GMLA 2YY3A 4LUBA 2EWHA 3EZ5A 3DOMA 2XLIA 5LSRA 1M1GA 4RNHA 4JI3F 1SH3A 3KUHA 3W5YA 4NA1A 1S48A 2XYPB 4PXDA 1D0EA 3NKYA 2FJDB 3T41A 1FE0A 2NZ4A 3HDSA 2F8HA 2XCAA 1JX4A 1X0PA 3MAAB 1WWHA 1WD6A 1XQIA 2OI2A 5D15A 3CJ4A 1VK3A 2FUG9 1N5QA 1RAOA 2YKMA 2YWKA 1UPMB 4DPYA 2CZ4A 3AJ2A 2B4UA 1JXEA 1Y0HA 3EZUA 2MJUA 3GE9A 2YWWA 4K4ZA 3Q8UA 1MMLA 3G71S 4XPCA 3QGGA 2BR0A 1FD8A 2F9DA 5E3CA 3VCDA 3KWMA 2G13A 2M3DA 2WVDA 2R7OA 3FSXA 3A3OB 3BGFA 1KP6A 2WSCC 2DT9A 1WI8A 1U1KA 2BW2A 2ZEJA 2ZKTA 5CYMB 4U7UK 4I7FA 3CJQA 3HFVA 3MD3A 3SQGB 1RT3A 1XNQF 2VBYA 4IG0A 4USJC 2UU9J 2BE9B 2KU7A 1WF1A 1RTHA 2YNFA 2X1AA 1HI0P 2XSJA 5AJ3F 1REVA 1TMJA 2DR9A 1XMBA 3TVKA 1F5AA 1XR5A 2HIYA 2GVDA 3JTNA 2VDHA 3PTWA 4I2PB 1RADB 2N3OA 4G6VB 2QN6B 1YG0A 1RWKB 4ED4A 2EBEA 2JNJA 3H4BA 3T1YF 2DNHA 1AZSB 1Q78A 1SJ4P 4CM0A 3BREA 3N0VA 3LTOA 2XB2D 2VA2A 2XGQA 3PW5A 3SV4A 4ZHRA 3ILIA 4DR4F 2BBEA 2HZCA 5CAAA 1NH7A 5KFDA 2C2EA 4YB5A 5B0DA 1VIXA 1FJ7A 2E5LF 1TL7A 1IBLF 2KG1A 2HQCA 4NXMF 3SFGA 4C8YA 3EXCX 5E41A 1PJ7A 5IT4A 5DJBA 4DV4F 2XO6A 4KGXB 1T9UA 3H25A 3FVYA 1WF2A 2E7VA 4WYWA 2J0QD 2RS8A 3MPVA 4MTPA 2RQ4A 3MEEB 5LMUF 4PG5A 1C1BA 4K2JA 4JI6J 4FNHA 2VPYB 1TUWA 2YX7A 1OYDA 1PGZA 3GJQB 2ZM6F 1N6QA 4MKBA 3HO1A 2ZUGA 2ZNYA 5BR8F 4ECWA 3C8YA 1VLYA 2OD6A 5K5MA 3S1TA 1TR0A 3HZGA 5LMNF 1IJFB 2RHQB 2PO4A 3NOCA 1QSLA 2V68A 4X62J 3RB4A 4ZPTR 3TZZA 3CNQP 4DL4A 1NJWA 3LAKA 4I56A 5BXIA 2KZMA 3HX9A 4ERDA 2JOQA 2J8SA 5HP1B 4CH0S 2HHUA 1UW4A 4DR6J 2IM0A 4X4TA 2WW8A 4V1Ak 1AFIA 3G96A 3TJ9A 4UQGA 4C3MA 5KFQA 3U7JA 1JLBB 4Q43A 1WF0A 3RAXA 3W3SA 4OX8A 3NXZA 1RUSA 2B0GA 4RWWA 2HBZB 1W7WA 4Y2CA 2MZ1A 1RACB 2OPRA 2FTRA 1H0HB 5DS7A 1OPIA 1PAUB 3FSYA 1FERA 5D3GA 1HFEL 3TW0A 3UN5A 2RILA 3LP0A 1MLAA 2O66A 3D67A 4ZCIA 3UCZP 4P74A 1N34J 3ZZ0A 4F4XA 3FBBA 4WTOB 5KFJA 2MDAA 2KRRA 2HEKA 1F9EB 3ITHA 2VG6B 4WWSA 1R8PA 4DPOA 1FESA 4PQUB 3RB0A 1NPRA 1JLAA 1HBOA 3CDEA 3FK4A 2XZDB 3KKFA 3U1NA 4U8YA 4PZVA 2XMTA 4R8UA 4DV5F 2VQEF 1FRXA 3J80Y 2G2OA 1NBEB 2C28A 2PDAA 3FMBA 3UDEA 1Q86T 4WKRA 1DRZA 5J1PA 2QSFA 5I42B 3MTKA 2G1DA 4MFBB 3JSYA 2CZVC 3V81A 2VBZA 4MYUA 3T19A 4C11B 5A8KB 4F0KA 2XYGB 4LIWA 1R8AA 3UDLA 1GFWB 2ZH2A 2R8JA 2YKNB 4WJBA 4DL6A 2MQ8A 3IGNA 2WSFC 4C0BA 5HMYA 3AB2B 3BF4A 2KL8A 4O3QA 4Y6IA 2WAQD 4F67A 2ASJA 2IBOA 4L72B 2DB1A 3F73A 4B3OB 2UXDF 4LJMA 1N8RT 2DXFA 5KFZA 2H5EA 3SCKE 2X1BA 1IKYB 3DDIA 1F2GA 2DTJA 4C4WA 2E7WA 4IR1A 4G1PA 3AFGA 4PPZA 1B4SA 4ANCA 3UQSA 1NSAA 2DCUB 2QX0A 1JXLA 1RAHB 1U25A 1H7WA 2Y0BB 2FD2A 4USVA 2KFNA 2MQMA 1IBKJ 2BE2B 1NK7A 3PIPQ 1NB2A 1MMDA 2V8DA 2LDIA 5LOQA 5CH7B 3CF5Q 3DRPB 3CEDA 1XMOJ 1T0TV 3KK3A 3O5TB 3GP9A 2EBGA 3LH2S 5CCMA 2Y3YA 3TX0A 1JWWA 1B7FA 2B51A 5A6PA 3L9ZA 1BHNA 2MQOA 1QDUB 3NEKA 1LFWA 4OIXA 3CCSS 4A4JA 1VBKA 2CPHA 4J9UE 5DG9A 1UWBA 4DQPA 3I5AA 2IVYA 2A6MA 4XTTA 1XK8A 3J7YI 4ID5B 2I6WA 3SCJE 3E3XA 3QIPB 2LQ8A 3N6NA 1ZM2A 3FMWA 5KT3A 2AX1A 2CYYA 2HMIA 1AXQA 2NCKL 1JJHA 1OIAA 2OPQB 4YHHJ 3IC1A 3D54A 1YGYA 4KC5A 4K4VA 4RW9A 4IFVA 2F8MA 4DL7A 1U47A 2QA2A 1U0SA 1X4GA 1GAOA 3CD5A 1FTCA 4CZCA 2MKYA 5C24A 3LP1B 3CIZA 3T1HJ 4IH7A 3VZHA 1UMJA 3MM6B 1CS4A 4GO7X 1NM2A 3TRGA 4P72A 4QU6A 4J9KA 4IDKA 1AFJA 5LT5A 4IH6A 1Q81T 4HL9A 1FWKA 2YWGA 3G6VA 4PXEA 4ZLNA 2XC9A 5E2QA 1BY9A 2PMHA 3GIRA 4MT1A 5KFSA 1SJ3P 2O67A 1KFSA 2LMIA 4DV0F 2PI5A 2HHPA 4J9PA 3TA2A 3EXYA 1N48A 1UJ5A 2G0CA 1TUVA 2YNIA 3WX4A 2GO9A 7FD1A 2VD3A 3FGVA 1X60A 2ZBIA 3M8SA 1BQNB 3UD5A 3OUYB 2KJWA 3MCNA 4DS5A 5SUHA 4ILLA 3M8QA 5DQIA 3J7YU 2ZJRQ 5K20B 1SKWA 4OX6A 1E6VA 4OHXA 4DG1B 4KFBA 1S97A 3MCMA 5IT0A 4NEZA 4YY3F 4F3MA 2ZUAA 4JI2J 3WX8A 1RK8A 3TQEA 2XHWA 3AH6A 3THTA 3IS9B 2IIHA 5A8KA 4FXWA 2IBKA 3QLHB 5IWAF 1WDDA 2FHKA 4JB8B 1KNZA 1P9YA 1U6ZA 3FFIB 4YP3A 1TKXB 4Q0BB 2FZCB 4IH5A 1GX5A 4JI3J 4OYAA 4GVLA 2EPIA 2L48A 2DNNA 3H5UA 1NNDA 4M5JA 4DV1F 2QLBB 3JAMU 3NY0A 1VRTB 3OHBA 1FRJA 1QD1A 4H4KC 4QBUA 3RU0A 3QRRA 3NMAA 1YVFA 3MHYA 4WCEQ 3TZYA 4QYZJ 3AY0A 4ICLA 3LGHA 3TP2A 3PYDA 2FLPA 4OI0A 3LGNA 3J7A1 5LXRA 3BM7A 4E8UA 1Y3KA 4W92B 2Z2YB 3I5BA 4KRWA 5I3UB 4CRJA 1HD0A 2XLJA 4M5DA 1WEXA 2FGCA 4KY3A 3SSSA 1SB6A 2HGMA 3POTA 3S8SA 4B02A 3H98A 3E01B 1R8BA 4I68A 4JBCA 4O3SA 4OYZA 4LF6F 5HBMA 4B9VA 2W4PA 3K59A 4OV6A 5KFEA 5H9EJ 1DY3A 4M5HA 3ISNC 4TQSA 2CNKB 4G1IA 1VIOA 3MMCA 1XNQJ 2XS5A 3QRPA 4C0OC 1P9QC 2ZH9A 5G0RB 4BC7A 3MUVP 4RBUA 2GGPA 1GX6A 5AJ3J 1FA0A 5HATA 4KR0B 4Y2AA 5J1EB 3OVSA 3EVOA 5KG0A 2H54B 1YI2S 2RE1A 1U8SA 2GMJA 3KDOA 4H54A 3RBZA 4DZDA 2M8HA 1VJQA 1NJIT 1UVNA 1VHIA 1T11A 2FVRA 4FYDA 4DPTA 3T1YJ 1Y00A 5CD4A 5HANA 1MROA 3U1MA 4NCGA 1CJUB 1VQOS 1SJQA 1X9WA 3PM9A 3WQPA 4MYTA 3BSAA 4DR4J 4IOBA 2MEWA 2HHWA 3F0NA 1HBNB 1Q79A 3FZ2A 4ZITA 1FD2A 4IO1A 4C7QA 4IR9A 4HTJA 1X5TA 4ZA1A 2JHEA 1HYSA 3M9NB 4H4OB 2G0IA 5HMZA 1HW9A 1JLEA 2E5LJ 1IM6A 3CJTA 1IBLJ 4KGZB 4NXMJ 1QLNA 4DV4J 2OPSA 2E5GA 4R5PA 1ACMB 3OV7A 1SUQA 3CMES 1Q8KA 2CZ9A 3VGUA 1VQ9S 1VQ5S 1VQ6S 2Z8QA 5LXYA 2AQ4A 3JQKA 3I0SB 4OZ5A 5CD4H 2DGWA 1HMVA 4LSZB 5LMUJ 5F9LA 1N0VC 3A3PB 4M5KA 1X0FA 4A46A 4I0WA 2OTJS 4HVZA 1WTFA 1VMBA 5BR8J 4ENOA 3W5ZA 2FHMA 5GAEU 1RP5A 3P49B 2QG9B 3SZ2A 5A2QU 5LMNJ 4CYUA 1HWIA 1RU2A 2YX4A 4YR0A 2B6AB 2EC0A 3I87A 2W2OP 4WYLA 4LMZA 3P8BB 3SI8A 2R2UA 2HVDA 5AT1B 4HYKA 4QZVB 1NO8A 4OX7A 4NMLA 5J2PA 4A8FA 3QO9B 2FVPA 5JVHQ 3JTOA 2AZ1A 3TR5A 3GV7B 5ETLA 2Z30B 4IOAQ 4DPUA 2FIUA 2RS2A 4DL3A 3OD2A 1WKKA 2DD8S 2FLOA 2U2FA 1TQLA 2HNYA 3U02A 2ZHOA 5KT6A 1U45A 2OLWA 3U1LA 1S10A 2BM0A 3EZOA 3RW7A 1EB0A 2DIVA 2XBPA 3AODA 3B8HA 3KLIA 3SYZA 3KLGB 3B6BA 4PG4A 3IR7B 2RKIA 2GQ2A 2E1MC 3DM2A 4E98A 4K4UA 1NPKA 2AT1B 2QV6A 4K4XA 3ZTPA 4L3KA 3GV8B 2CPDA 4RU2A 2W01A 4FF4A 4ALZA 4HI1A 3I82A 5HL7Q 1FKPA 2J5AA 2QLJB 2F4FA 1LWFB 2R7RA 3KFWX 1K0VA 2XS2A 3RR7A 2VFUA 4FZVA 5GADU 5KG2A 1DTQA 2NREA 5DQGA 5A76A 4RW6B 4FKXA 4DV5J 1CJKA 2VQEJ 1EHWA 1UL3A 3C2PA 2XM3A 3VTIA 2CQ2A 2R2TA 3M2VA 5A0YA 2GVZB 1RI7A 5I3PA 1YLXA 4CLWA 3HHLB 2DGQA 2PA8D 2C3YA 3KTQA 1M5KC 2YVSA 4CNZA 3R5JB 1AROP 3HCXA 1QAYA 1AB8A 2YH0A 1FCAA 2CXEA 3PYGA 3I96A 4LF8F 3GYNA 1CJVA 4N47A 3BEGB 1U1LA 3VGTA 2HHTA 2OH2A 1WTBA 4USWA 4P10A 5D4OA 2QYGA 3OR1B 2HNZA 3IG1A 2BJ7A 3BH7B 4DR5J 4ZN3A 3PKYA 3O2IA 4DSEA 2B4OA 3PVXA 4WP3A 2UXDJ 1NMEB 1CJUA 1RTZA 2M5YA 2DO4A 3ISND 4ZVEA 2KHDA 5IS2A 3A8JA 3AD8C 3MPDA 1XERA 1TL4A 1NHVA 3I32A 3MFIA 3DOKA 4H4OA 2RAQA 1C0UB 1R0AB 3J7Z5 3MEDB 2W25A 3BDEA 3IWXA 3W2VA 2D69A 2EKNA 1IR0A 3QFHA 1YJ7A 1PG5B 3ETMA 2V34A 4KKOA 4N7TA 1KVJA 2CJXB 4PQAA 1SI9A 3M32A 2CNNB 3C46A 1QTNB 1R7IA 1TP7A 3FJ2A 2UVRA 1IKWB 4URQU 4MK7A 2ZDPA 1RHQB 3PRVA 1IBCB 1FRHA 5M2UA 2DJWA 3H90A 1HPZB 4ZVQB 3DNCA 3MI7X 1X4AA 3D6TB 1LKZA 1OQ6A 3OXGA 4J9QA 3KUGA 4F26A 4ZMMA 1QE1B 3AXKA 1UCNA 3RBXA 2ZH6A 2AJ0A 3TYTA 3L95X 2DNOA 3CTRA 3CULA 4U96A 1OPZA 4DX5A 2QT7A 1WELA 3EWGA 3PR5B 2AJ2A 2XZTB 2UV8A 4NRUA 1ZTWA 5B08A 3I4HX 2AEJA 4ZJQA 1NRKA 1FNOA 5FDLA 2K7JA 3BO3A 3N9UC 1S1VB 2AWZA 4R0EA 4FBTA 4FXVA 2GA7A 3NGTA 2DHHA 3HPOA 1TKZA 3RJMB 1JLCA 2YWHA 5AE2A 2B8QA 4FVMA 1BUXA 3LP2A 2GJFA 1KVKA 3GFZA 3K7RA 2E29A 3L4BC 1ZBTA 2PEBA 4DU7A 2MLXA 2CPFA 3AJ1A 2HBQB 2HBRB 1FRIA 4LSNB 2HHSA 5F8NA 1ICEB 2KDOA 4GVBB 1KOHA 5GAHI 2ZD1B 3MOZA 3C6UB 3CCRS 1YHQS 2YTCA 4AE5A 1O0PA 5EWFA 4UOGA 3CB4A 3QT5A 5KFVA 1BWVA 4LFCF 1S1TB 5AE3A 1WC0A 1TL1B 1SC3B 2N7YA 3MCSA 5F41A 2MTLA 3MOJB 4LREA 5K14A 4DV0J 2HK2A 1J5OA 3KLEA 1KTQA 4IQMA 2K2PA 3KLFB 3Q8PB 2HLTA 4ID8A 3Q2SC 4ZKAA 4YB7A 1WORA 2BKNA 2XNRA 2LDYA 4KGMA 4LBIA 4J90A 3W60A 2FY8A 1S49A 4IOCQ 4QPTA 4M95A 1W26A 4YB1P 2M4MA 2GFFA 1WC5A 2QSWA 4BS2A 2NXJA 1C0TA 3HHLA 3HKWA 4YY3J 3PZPA 4ZDNA 4I64A 5KFXA 3DLHA 2HRYA 4I6WA 1IKXA 5IWAJ 4O23A 2FJEB 2MJNA 1TTHB 2C2MB 4E2FB 2MQLA 2GAHC 2ZBPA 3DHWC 4F0HA 3JSRA 1TFYA 1FX4A 1FKOB 2MXYA 3UR3C 4LRFA 3Q8SB 4P6QA 4MIAA 1RABB 3P4UB 2YWEA 4ZCLA 2ZC3A 2CG4A 3D6MB 2ZNZA 2W4CA 4CDIA 1UWAA 1S5ZA 3FEZA 2J8AA 2FVCA 3K5NA 1UFWA 3TJ8A 1C0UA 3HHDA 4X4SA 3TUIC 3PRBA 3M6UA 1DTTA 1NUEA 5CYQB 4B08A 2XG8A 3L09A 1P8GA 4Z7YA 2W2PP 4LFBF 1Y5NB 5MAOA 2LEBA 2HZVA 4YOEA 3TA1A 1FNXH 3CJ8A 4KPYA 1R3NA 4LF6J 3LQVA 2BX6A 4O4GA 1JLQA 3NWRA 2Y1RI 4ZJLA 3AHPA 1FXRA 1UJ6A 5ETSA 4B9NA 1VRUA 1WHYA 2V63A 1DQAA 2VC0A 4WU2A 3FNNA 1NCLA 3ZZYA 1RISA 3RBDA 4PWDA 4DI6A 2VU5A 3EVWA 2MYFA 4LR7A 2BA9A 2DPJA 2HAFA 5HAOA 4B3MF 2FC9A 4C98A 1H6KX 3KLHA 1PJ5A 3RAQA 2LA4A 1RU1A 2IVFB 2LU1A 2JLFA 4TYBA 2VA3A 3CJ5A 4WFYA 2UVUA 3EPGA 2SXLA 3IP0A 4LBPA 3QNWB 2CJKA 3CVKA 3PW2A 3Q8RB 3PEHA 2OMOA 1IQTA 2IYIA 2QL5B 1VS3A 1RT1B 4NYPA 4NI2A 1VQ4S 3A13A 4B9TA 2MKIA 3ET6B 3W1YC 3HFZB 2N7CA 4C8NA 1H7XA 1UVKA 5E3QA 2NPIA 5KFAA 3GWCA 3M8PA 2BM1A 5F9NA 4ZVSB 2K1RB 2DNZA 5CABA 1NK6A 3EPIA 4J5OA 5IM0A 3CCQS 2DCLA 1S1UB 1HNIB 3GR1A 2JX2A 3PXGa 3VR1A 2G9OA 3RYLA 1WOOA 3NBPA 5E3PA 3KJNB 2LEPA 3MD1A 1Q1KA 3IA0A 1HQEA 4DLEA 2NXUA 2V2QA 1KHVA 3I6PA 1SC4B 4JI7F 3PRDA 3BJYA 1FDAA 1JJCB 2FJAB 2X51A 2FJWA 8AT1B 4ECSA 3DCAA 1X4BA 5HN0A 3V4IA 3B4MA 1SL1A 3DLGA 3JSBA 1N54B 4PCQA 4OV1A 3HKZD 4CLKA 4OZ3A 2E9ZA 2HFUA 2IRXA 2QA4G 4OYWA 3DXSX 3MCOA 5BYRA 1QVFR 2W2QP 2MHEA 1TVRA 2V4QA 2Q6CA 2HSEB 3PHEA 2DHGA 5HROB 2J6TA 4DFKA 3OL9A 3JAMY 2DEJA 1K1QA 3E51A 5J2QB 1FDBA 3MAHA 4YUDA 5LSOA 4OZ2A 1S57A 4YB6A 4FS2A 2C3UA 1NHKL 1TAQA 2CIMA 2WOMA 3ZNJ1 1UEKA 2ILZA 3UVJA 3PY8A 3M2UA 2LYVA 3T5LA 4ELUA 3TX8A 1B0TA 1RTIB 3OJSA 5GMDA 2OMLA 4FYXB 2WK4A 4OYPA 1GMWA 3PG9A 3MTJA 1ZS6A 4KV8B 3NGUA 2ASYA 1I6JA 4EUVA 2E5HA 4KSEB 5LJ3Y 4Q2MA 4UW2A 3QZ8A 1CLFA 4N76A 1OY9A 1ZM3A 5C42B 4KH1B 2ZOFA 4Y2KA 1ELOA 1U4BA 4D3GA 2Z57B 3JYTA 3BN4A 3W63A 5DQHA 3MPWA 3LA0A 3CD0A 3HXMA 3ISZA 2APOA 1YJTA 3BO2A 2B5JA 3GPAA 4I2QB 2PSZA 3AOAA 2LXFA 1HWKA 5CQGA 1C1CB 2D3ZA 3D7SB 3GIIA 3IAS9 1SPBP 4PUOB 5DDRC 2AP6A 2YXLA 1EP4A 3BGOP 1T9VA 4PPDA 4TNOA 1VFJA 3DRSA 5DG7A 5HMWA 5KFLA 2A2DA 3UI3A 2VHGA 4ZLJA 4ED2A 2V8VA 2RMLA 2R7QA 4F36A 3DOLB 2DKOB 4UOFA 3N01A 3QBCA 1S1XA 6FD1A 2UUBF 2JLEA 3MR5A 3CIMA 1NJYA 2D9PA 1KS2A 4LF8J 5IXUA 4EFAC 2D41A 2HFSA 1TV6A 5K9FA 3ZTRA 4IFYA 5DGBA 1S9GB 5GAGU 1WKLA 1TK8A 4ZCMA 3ILJA 4K4SA 1T9XA 2DY9A 2P8IA 4JV5F 3GFXA 5DETA 2R7XA 2CPJA 2LEAA 3BKFA 2W9BB 1RT6B 3K8WA 3NNCA 1P27B 1JQGA 1HL6A 2UUAF 4DF8A 4LSLB 5A8WB 2VQFF 1F0XA 4P7VA 5KG5A 5I3QA 3MM7B 4DR7F 3G82A 4O0IA 3KJVB 2X1FA 4JV0A 3JTPA 3H20A 1HQ2A 4DQQA 1GEHA 1GXUA 1YTYA 4ETXA 4X4RA 2H5IB 3CJRA 5CCLA 5IOLA 2IJRA 1S9FA 4CH7A 1R0BG 2IYGA 4EBCA 1DLOA 2RD5C 1ROFA 4P52A 5BYSA 2WCXA 2EK6A 1G2EA 3TOQA 2YKPA 2HS4A 3W2WB 2PEHA 4FNIA 4XDCA 1B99A 2ZBRA 2ZH4A 3DLEA 4DV6F 1LNQA 1PYSB 1RTJB 4BC9A 2C1EB 3W64A 1BQXA 3MF5A 3OTCA 3I0RB 2O1PA 3DDNA 2LQJA 1RWXB 2ZOMA 1YBTA 5JJBA 2OAUA 4OYMA 2XSFA 1EETB 3DDKA 3KG0A 4PAAA 2FJVA 5ETQA 1XTZA 3M30A 4RW7A 5RUBA 2E9TA 3SMZA 1HBMA 3BQ2A 3SXLA 2PN6A 3G86A 4KV8A 1NK8A 4F7VA 2MGZA 1X9SA 5LJ5Y 3DI6B 1RAGB 2HURA 3W9IA 4DSJA 5AXKA 3DHXA 1V3RA 2J7UA 2CQBA 1OYEA 1E6YB 3QT7A 1N32F 4XAKA 1ZOTA 3LO3A 4ED6A 3BN7A 1RT7A 2NUUG 2RNEA 4PR6A 5DLGA 6AT1B 4LFCJ 4NCBA 3D1QA 4Q2LA 1F1BB 3ULHA 3MMBA 4PG6A 2BJ1A 1UJ4A 3RGIA 3CGIA 4ELTA 1N5YA 2FVQA 2F3JA 1P6TA 4CH1A 4X66F 2XQCA 3MUTP 2RH3A 2EK1A 1N5SA 2KHCA 1HA1A 4ECXA 3GILA 4ZVGA 3KMSA 1X31C 2VG7B 1VR6A 4RWXA 3BBFA 3C19A 1LXJA 5T7LA 5D0EA 3CDAA 4K5RA 4F4YA 4A8QA 4C48A 1I94F 4B3TF 1GNKA 1FE4A 1HHSA 3EJMA 1RBLA 1BQMB 2KYXA 1FX2A 1R8HA 4HH0A 3TAMB 3MM5A 1ZAVA 1S1WB 4EU0A 3RB6A 2RF2B 2ZC4A 2VPZB
chains in the Genus database with same CATH topology
2KT5A 2RDIA 4RW9A 3OVAA 4UY8T 3DRRA 5E33A 4IFVA 3HMJG 2F8MA 4MH8A 2DNRA 4DL7A 1U47A 4R8UB 3CJ0A 2QA2A 3HZEA 3MM9A 3QGIA 1TK0A 2CRLA 1LWCA 5G0RA 2NPFA 4PXBA 1RYRA 3M1VA 4CO3A 3O8WA 1X4GA 2G4BA 1GAOA 3CD5A 3G9CA 1FTCA 3V6DA 4OJHA 4CZCA 3GR0A 2AYBA 3EGZA 5C24A 2R2SA 2B9WA 1X4FA 2DNLA 2JH3A 3LP1B 4X65F 3CIZA 4QCLA 2A2CA 1KVIA 4IH7A 3VZHA 5J1EA 1UMJA 1DLOB 2LKZA 2OD4A 3MM6B 1HNXF 5U47A 1L5UA 4GO7X 2I5JB 3TRGA 3VF0B 3MR2A 3Q22A 3CCMS 1V6HA 4IG3A 3X3UA 4QU7A 4QU6A 3MAQA 2OO4A 3MXHP 4J9KA 4F4WA 4IDKA 4NPOA 5KOWA 1AFJA 1ULRA 3RBEA 5LT5A 4B3RF 4IH6A 1Q81T 4HL9A 2YWGA 1VQPS 2J0WA 2DRAA 2XGPA 4J9LA 3V81B 2QFJA 3G6VA 4PXEA 2ZJQQ 3OFGA 2XC9A 4WFZA 2NS1B 1Q8IA 1XNRF 2BQUA 2XLKA 1IJEB 1VOMA 5E2QA 1BY9A 2L9NA 4WFBQ 3GYXB 2PMHA 2MZQA 4P2SA 2Y1IA 5KFSA 1SJ3P 3DLEB 4DEZA 1SKSA 1M5HA 5CZVA 1T8EA 2CQ0A 2D3UA 2O67A 1KFSA 4JUZA 2LMIA 4DV0F 2PI5A 3KHRA 3IN5A 2V94A 2HHPA 5D78A 1C4CA 3TA2A 4J9PA 3BGRA 3E2EA 3EXYA 4XO0A 1N48A 1UJ5A 3LUYA 2VL1A 2G0CA 5KOXA 4IRDA 5BJRA 2BOPA 1TUVA 1DJ0A 2YNIA 3WX4A 1KSPA 2VUGA 1VQYA 2GO9A 2NYIA 3F44A 7FD1A 2VD3A 3THVA 1HNZF 1JKHB 3FGVA 2F7VA 3ENWA 2ZBIA 4ED3A 2HNDA 2MZJA 3GZ7A 3M8SA 1M90T 1BQNB 2BXJA 1HI8A 3OUYB 2KJWA 1VQMS 4HT7A 2FPHX 4MKAA 1HBNA 4KB7A 4EO6A 5KFKA 4AFFA 4DS5A 2FHJA 3BQ0A 2FGOA 1QM9A 1NEEA 2GC8A 5SUHA 4ILLA 1LW0A 3M8QA 2GJ2A 5KFUA 1IKVA 3SCLE 5DQIA 2OPPB 2MB0B 2XI2A 2KN4A 5KFWA 3FZBA 3M6WA 3S7RA 3J7YU 3QJPA 2ZJRQ 4QIVA 4K59A 4RW7B 3M30B 2MZTA 4ZP7A 1SKWA 1G1XA 4OX6A 1U7LA 3KG1A 2J0SD 2HVZA 1E6VA 4M1KA 1HBMB 2WB4A 4OHXA 4DG1B 4KFBA 3NG8A 1JNZB 1S97A 3OTEA 1IXKA 2AJFE 4TQRA 5IT0A 3OR2A 1MWZA 4TKTA 3O3LA 4PG7A 3N28A 2YKAA 2AGQA 2D1CA 1RYSA 3CO9A 4YY3F 2MGZB 3P96A 2EFVA 1V3ZA 2EW9A 4F3MA 5DM6Q 3V6KA 5ADZA 1L3KA 2JEIA 1RK8A 1UA0A 2XHWA 2EVZA 3AH6A 2U1AA 3THTA 4TU7A 3N6MA 3IS9B 1LWEA 5A8KA 5L1IA 2KXFA 4ITSA 4DV2F 1TFWA 2LCWA 3DGPA 4FXWA 2IBKA 3A8EA 3QLHB 1B0PA 1FTRA 5IWAF 3T6BA 2IRUA 3NAHA 2WRMA 3I0SA 1FDNA 2EFOA 1KN6A 2FHKA 2CPEA 3K58A 1KNZA 4ZPAA 3MWBA 2ASDA 3C3LA 4N8NA 3I5CA 1VJWA 4GMKA 3CCWA 1U6ZA 4J37A 2R8HA 1HNWF 2BJDA 3FFIB 4YP3A 3DMJB 3R5DA 1DURA 4DDFA 3UR0A 4KHPF 1TKXB 2Z2MA 4QW9A 4Q0BB 2DGXA 1YIJS 4IH5A 3KG4A 1GX5A 1RT7B 5D77A 4DSFA 4UUXA 4NLXA 3I55S 3I9V9 3JSMA 2EPIA 5CHCB 3E8OA 2V5HG 5KG4A 2L48A 1QTMA 2FHOB 3LANA 1VC5A 2DNNA 3H5UA 2DR7A 1NNDA 3MMBB 1GQEA 4DV1F 4NWBA 1X4CA 2GHPA 2F8EX 2OSRA 3M4XA 3O6QA 3PJWA 1VRTB 3KK3B 3OHBA 1FRJA 5J1NA 4H4KC 1P1TA 4QBUA 1S72S 2IJFA 5ITHA 3MECB 3RU0A 3O1LA 1N5YB 3NMAA 4TXSA 1YVFA 2DR5A 4DLGA 3MHYA 1LK5A 1N0UA 4DN0A 1SC6A 4YEAA 2B6AA 2GV1A 3B78A 2ZDOA 4WCEQ 3OL6A 2JC1A 4QYZJ 2P6TA 5KFPA 3AY0A 2XMMA 2VPWB 4ICLA 3R3TA 2IHR1 4BDPA 3TAPA 1U48A 3DLBA 3D0HE 3TP2A 3PDNA 4ZOSA 1RT4B 3QAUA 3OJUA 2C3OA 3N5BA 3CXCR 2BQ3A 4NXNF 2FLPA 3BQ1A 4O3OA 4X4UA 5F8HA 1RT5B 4OI0A 2MSTA 5L1KA 3LGNA 2HPUA 3J7A1 4ZCKA 5HMXA 3BM7A 5LXRA 4E8UA 3QO9A 2W8LA 1Y3KA 4W92B 5DLFA 1UWBB 1Q8BA 2DGUA 3GSDA 3OW2R 2PD1A 1PSDA 3I5BA 2KFYA 4KRWA 4KO0B 5I3UB 2AX0A 1GT8A 5T7LB 1UEUA 3BSCA 1L3TA 4C2MA 1HD0A 3ETOA 2DRBA 2XLJA 4M5DA 1XC9A 1WEXA 1LFPA 2FGCA 4WK3A 3HVTA 3THPA 3PO5A 3SSSA 1SB6A 2HGMA 3POTA 3S8SA 1K8AT 3MEGA 4B02A 3LPYA 3H98A 3E01B 3HHLC 1R8BA 1CQNA 1NK9A 2RQKA 4I68A 2JFKA 2YX1A 1CC7A 4JBCA 2NQPA 2HMIB 4O3SA 4X4OA 4DUZF 5HBMA 4LF6F 4B9VA 1Q53A 3VAKA 2W4PA 4OI4A 3R1HA 3K59A 1J2VA 5L1LA 4EBDA 1S77D 5KFEA 3MM5B 2AJ4A 3SDEA 3KLGA 2JEFA 1F5BA 2HFZA 1DQ9A 5H9EJ 4RZRA 1SH0A 2J7KA 2FC8A 4B3SF 3OPKA 2K3KA 3D2WA 1DZ5A 3JB9k 3EGNA 4RW9B 3ISNC 2Q1LA 3DRRB 4RW8A 4IFVB 4TQSA 5FIIA 4G1IA 1VIOA 5KFIA 5KFOA 3MMCA 4Q5VA 2XS5A 3MM9B 1VI7A 1P9QC 2C42A 4C0OC 4O44A 2ZH9A 3VAFA 4HKQA 1LWCB 3FRYA 5G0RB 4J9MA 3M1VB 5EGYA 4PUOB 4O4RA 3VQSA 2XS7A 4BC7A 1TZ0A 2WSEC 5F8LA 3MUVP 4EYHB 4KJIA 1MSWD 4AXIA 2C3PA 3AQOA 4MK8A 1YQHA 2AV5A 2GGPA 4RBUA 4P7TA 5C24B 1VBXA 2DH7A 4R25A 1GX6A 2N3LA 2XMVA 3T9ZA 4NYZA 1FA0A 2M88A 4KR0B 1U1RA 4Y2AA 1HR0F 5IFMA 5J1EB 3RAMA 3OVSA 1XMQF 4RLEA 1S0VA 5KG0A 3OL7A 5KG1A 3UFCX 1YJWS 3QAEA 5LSLA 4OZJA 4A8KA 1YI2S 2RE1A 4IG3B 1RTDA 1U6FA 1U8SA 2GMJA 4YDDB 4H54A 1T3OA 2IFXA 2Q79A 4IDKB 5T41A 1G3OA 1RKJA 2VOPA 1LWFA 4K0KF 2M8HA 3MEKA 1NJIT 3RRGA 4X4NA 1UVNA 1DAXA 5EX3A 4DWIA 3PACA 3KHLA 2MKCA 4CNYA 1ZTTA 1FK9B 2FVRA 1N5VA 1JLFA 4B17A 4FYDA 4A8OA 4OI1A 3AA9A 4ZPVR 4AL5A 1M5OC 1Y00A 3GFYA 4DQSA 2QEXS 4QQBA 3D5MA 2J76E 4RW4A 1Q82T 4J9SA 3QIDA 2FLLA 4ES3A 1Y7PA 3GIMA 3BGRB 1MROA 3S01A 3U1MA 2KRBA 4C8ZA 1ZM9A 4NCGA 2BYCA 4V19J 2KH9A 3CWJA 4RW6A 1XR6A 4DBQA 2YNIB 2F9JA 1SJQA 1VQOS 1X9WA 3PM9A 3I31A 4MYTA 2KJVA 4OZ0A 1XN9A 1S6UA 2HNDB 2C2RA 3BSAA 2AGOA 2CQCA 3LF0A 4IOBA 3IGVA 4OHVA 1Y9OA 4RU9A 4QYRA 1RA6A 3NCQA 4NLVA 4X4PA 2WTFA 2HHWA 1UFLA 1HBNB 1Q79A 4NLTA 4RX6A 4URGA 1QY7A 3FZ2A 2XMJA 1FD2A 4IO1A 3TAQA 4C7QA 4LF7F 1LW0B 3M8QB 2W9CA 4IR9A 1IKVB 4HTJA 4NLOA 1X5TA 4Y2IA 4ZA1A 3KMQA 4X2BA 2DNGA 2FDNA 2JHEA 1HYSA 1UP1A 2MSSA 4NYOA 4YR2A 4H4OB 5HMZA 3GG1A 3C66A 3QZ7A 3M9NB 1Q7LB 1HW9A 3OTOF 1JLEA 5AE1A 2KM8C 1TAUA 1RKIA 4DSKA 2CQHA 5EN1A 4DFPA 1E6VB 4QIGA 2HHHF 4KFBB 5A6WA 3TNVA 4DFJA 5KFFA 2DNKA 1LW2A 3TVYA 2I5JA 1QLNA 3OR2B 3CD7A 5KFBA 2OPSA 2E5GA 2YKOA 4WXOA 4Z2XA 4R5PA 2UVVA 3HT3A 4N5SA 4RNOA 3OV7A 1SUQA 3NLCA 1VHFA 3FSIA 2RRNA 3BGLA 4AL6A 3CMES 2WHOA 3SSRA 5KT4A 2R9LA 4AQYF 5CXTA 1VQ9S 1VQ5S 1LWEB 2FHJD 5AXNA 1X5OA 1VQ6S 2Z8QA 5LXYA 2AQ4A 1X5PA 4N77A 3I0SB 4WFNQ 1VQ8S 4OZ5A 5CD4H 2DGWA 2B4VA 3OLBA 4QIFA 3MPYA 1HMVA 3OR1A 1NB7A 2JFDA 3VAMA 3UW1A 5F9LA 2YQ3A 3LW5C 1APSA 5F8MA 5E3AA 5IQQA 2YNHA 1C4AA 1N0VC 1X0FA 1WACA 4A46A 4QR1A 4I0WA 4MKYA 2OTJS 5J2NA 1PILA 1JKHA 4JV2A 4HVZA 2ATLA 1WTFA 2DHAA 3TQ1A 3EGWB 3JSMB 5D4LA 1VMBA 4HDHA 2UU9F 2AU0A 2ALZA 2XMUA 4I4BA 4IO9Q 1SXLA 1QSSA 4AL7A 1SBRA 2FHMA 1JMTA 5M2RA 4DR5F 2YH1A 2RRAA 5GAEU 3RRKA 1YRTA 1TKTA 1RP5A 3P49B 3EUNA 3SZ2A 3T1AA 3OTDA 4Y65A 4K5SA 1HWIA 4BCAA 1VC6A 2VG5B 2R7VA 4OLOA 1R0AA 2YX4A 3VZIA 2W7AA 3PX6A 4YR0A 2B6AB 2EC0A 3I87A 1N5TA 3MEDA 2HRUA 4WYLA 2MZSA 4LMZA 4ICLB 4X4QA 3MMJA 3SI8A 2IM2A 3P3DA 3FDSA 2R2UA 1UA1A 2FLNA 2OIHA 4HYKA 4QZVB 1NO8A 4OX7A 3GIKA 4NMLA 4EO8A 1GXLA 1T03A 5J2PA 1OWXA 4ECVA 1NKBA 2ZE2A 3L7OA 1WEYA 4A8FA 1PO6A 5KG7A 3QO9B 4XPEA 4ZP9A 3TI0A 1UKUA 2M9KA 3NS5A 2MQPA 2FVPA 2PA3A 2UUCF 2DGSA 5JVHQ 1A6LA 3JTOA 1Y5LB 3TR5A 4RBVA 1GTEA 3GV7B 2GCFA 4IOAQ 2FIUA 4BWMA 4M5DB 2RS2A 4DL3A 2DVIA 3BO4A 2DD8S 3HVTB 3KK1B 1IKWA 2FLOA 3POTB 2U2FA 3MEGB 1TQLA 3CC7S 2HNYA 3U02A 2ZHOA 2ROEA 3OBIA 2C2DA 4NLYA 2DNQA 3BGUA 3X1LB 4CTAA 5KT6A 1U45A 2OLWA 3K5OA 5A8RA 1O5JA 3OXLA 2J6SA 3U1LA 1HPZA 2BM0A 1S10A 5HBMB 1W2IA 2CJAA 4RUAA 4EEYA 1ZETA 4BBYA 3RW7A 2DIVA 2XBPA 2YWFA 3B8HA 3KLIA 3F56A 3SYZA 3SDEB 3KLGB 2JZ5A 2X3GA 1U1NA 4PG4A 1KQSR 2EFPA 3IR7B 2HWIA 1MW7A 2RKIA 2GQ2A 2E1MC 3MMAA 4A8YA 3BDPA 1QE1A 1Z1ZA 3KYLA 3VAIA 2VPXB 2KXHA 3DM2A 2UXBF 1G7CB 4OX9F 1SIZA 4QWCA 4E98A 4ED8A 2HG4A 4U67Q 2L41A 2HVHA 2VBWA 4KAIA 3MMCB 4K4UA 2JLGA 4TY9A 1ZM4A 4O44B 1FRLA 2QV6A 4K4XA 4DFMA 4JOUA 4UOCA 3GV8B 3PNIA 2W24A 3G6ES 2N82B 2GGPB 1SH2A 1X4DA 1YRXA 2CPDA 4RU2A 4QWEA 4L6V3 1GXTA 4IYQA 1JNRB 4ZK7M 4FF4A 4ALZA 4JI0F 4HI1A 3NP5A 4IRKA 3NGKA 4H4MA 3I82A 1IN0A 5HL7Q 3WC2A 1FKPA 3NL0A 1ZZNA 4JI6F 1RTDB 2CQDA 2J5AA 4KO0A 1S4FA 2IM3A 3TUZC 1S1VA 1LWFB 4X4VA 5F8IA 2HGLA 3HP6A 2R7RA 1NJZA 1ZZFA 3KFWX 1K0VA 2M8DB 4ECTA 3IFEA 3RR7A 2XS2A 2HQ3A 2VFUA 3OFFA 2HHQA 1QVGR 3IWNC 3GFHA 1JLFB 2KVIA 3LAMA 4FZVA 1HARA 4IUFA 2MMYA 5GADU 4QJVA 3H8YA 3HK2A 4UQTA 3PKMA 5KG2A 4RW4B 2KT2A 4DOZA 1DTQA 1JJ2R 4EZ9A 1JLGA 2CPZA 2NREA 4QIEA 2ZOGA 1MROB 1OSDA 1X8DA 5DQGA 4NCGB 3PW4A 3KHGA 1S79A 4RW6B 2V4JA 3D1HA 2PIIA 1S76D 5GVQA 1H98A 4ZPBA 4X62F 3RR8A 3IR6B 1KQKA 1UL3A 1DBDA 3C2PA 3VTIA 4QWAA 2CQ2A 2Z4PA 5HI7A 2R2TA 2E1AA 1FXDA 1O51A 2JL9A 3M2RA 3M2VA 4LQ9A 1VK8A 3HLUA 4ETZA 3WBZA 1KEKA 1V3SA 4MIBA 4NX9A 1TL5A 2AF6A 5A0YA 3Q2TC 1RI7A 1ZAXA 4LSNA 5I3PA 4ZP6A 1SJFA 2B3TB 3HHLB 2W9CB 2DGQA 2PMZD 2PA8D 2ZD1A 2RT3A 3C6UA 4B9SA 1HYSB 2CJBA 2C3YA 3IO1A 3KTQA 1M5KC 1XWLA 2YVSA 1JLEB 2LLZA 4WFAQ 4CNZA 2M2BA