4K0KF

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k0kF00
2UXCF 1N32F 5AJ3F 3OTOF 3R3TA 1J5EF 4JI1F 1LOUA 4LF6F 1G7CB 2KJVA 4DV4F 2F4VF 4DV6F 2ZM6F 4X64F 4X66F 4NXNF 1CQNA 1F60B 1IBMF 4DV7F 2B7BB 3T1YF 4DR3F 4DUZF 4AQYF 1XMOF 4DUYF 5BR8F 1B64A 4YHHF 1IBLF 4YY3F 1N33F 4JI4F 4K0KF 2UXDF 4B3SF 4LF4F 4DR1F 3T1HF 4DV0F 4NXMF 1HNXF 4DV2F 4B3TF 2VQFF 4LF9F 4X62F 4DR7F 1IJEB 4JI6F 4DR2F 1HR0F 1I94F 5LMUF 4DR5F 5IWAF 1IBKF 2UU9F 2KJWA 4JI7F 1GH8A 4LF8F 4GKKF 1RISA 2BXJA 4B3MF 4JI3F 2J5AA 4JV5F 2RJZA 4GKJF 1IJFB 3ZZPA 4JI2F 4DR6F 2UUAF 4DV3F 4JYAF 4LFCF 2YY3A 4KHPF 2UUCF 1HNWF 4X65F 2UXBF 1XNQF 1HNZF 2UUBF 4LF5F 4LFBF 4OX9F 1XMQF 1N34F 1CQMA 4JI8F 2VQEF 1FJGF 4DV1F 1QJHA 2HHHF 1XNRF 1VMBA 1N36F 2BVZA 5LMNF 4LFAF 4B3RF 4DR4F 2E5LF 2B7CB 4JI0F 1FKAF 4DV5F 4JI5F 4LF7F 1G1XA
chains in the Genus database with same CATH superfamily
1CJUA 2VF3A 3KUGA 3J7YI 4DUZJ 5M2PA 3CPWR 2Y3YA 1RXOB 2ZHOA 2ERRA 4ATNA 3POTA 3WDOA 4A8WA 3BO4A 1TL4A 3GR0A 4X4SA 1NJZA 1RHQB 1PGZA 4LF6F 3JXOA 3MOJB 2BE7D 3IMQJ 1RHKB 1UCNA 2FHJA 1V5IB 3HO1A 3G8QA 1H98A 2ZM6F 2VHGA 3PX0A 4X64F 1LXNA 4D3HA 4RNMA 1VQ7S 4NXMJ 2G0IA 5DDQC 3BZQA 3BDEA 2QZ8A 5EWFA 2BUNA 5SZTA 4I0WA 3HK2A 3SSQA 5RUBA 1KSPA 5JUMA 3DOLB 2DH8A 3NGKA 3H4BA 3PW2A 2MPUA 2C2ZB 2JEFA 4HLBA 4KRWA 2LQ8A 3VF0B 1N33F 2AYMA 3PIOQ 1M5SA 2W2NP 3C66A 1FEEA 1H72C 3I82A 2LYVA 3NGRA 1NK7A 1RT5A 5J2MA 2M3DA 5LXYA 3L7PA 3T1HF 1X0PA 4ILLA 2HWIA 1RQ0A 2IA0A 3M2VB 2YKMB 5D6GA 2XLJA 2WONA 3X3UA 1QD1A 4RX6A 2IBKA 2ZKTA 3EZOA 2DGSA 3DLGA 5KFLA 4NLUA 2MQPA 1WG1A 2WB4A 4NYPA 2YVSA 5HVHA 1WC5A 4KYZA 1RLDA 4JI0J 1H6KX 5D4OA 3TYTA 1RAGB 3BB5A 2MEWA 3KJQB 5DG9A 1IJEB 4IRKA 3MMCB 2KXNB 3RJMB 3LQVA 4FN5A 1SCJB 2CZVC 2W2QP 3I0SB 3MCSA 3ZZ0A 5GAEU 2OEKA 1V3RA 2J0QD 2IY5B 2B4PA 1ZBTA 2D41A 1Y5LB 4JV0A 4ELVA 4PUOB 2KM8C 1NKBA 5KFJA 4DUYJ 3ZNUA 4YB1P 1LWFA 2IBOA 1UVNA 2RDIA 4RPFA 4LBHA 3MR7A 2A10A 1R6YA 1AZSB 4C8YA 4WE1B 2AGQA 4HTJA 3R7NB 3AJ2A 3PEJA 5DQGA 2V50A 3IR5B 2OD6A 3MPUB 3PW7A 1WI6A 2I0XA 3TOQA 1HW9A 3SV3A 1WKLA 4V1Ak 4U9RA 2XSFA 1CVJA 4EBCA 1GXTA 2ZBIA 3BSOA 3D6MB 2FZCB 5K8OA 4WFXA 2ZJRQ 1DTQB 4JUZA 3T9ZA 4Z7CA 4IO1A 5A0YB 4MK9A 4DR6F 4DX7A 3MEGA 4ED0A 2EPIA 2RHQB 2DCLA 3I5BA 4C9DA 1F2GA 1JNRB 3DCAA 4QPTA 3QYYA 3KOAA 1U0HA 1EJ7L 4F3QA 1FO1A 2MLZA 2G13A 4UY85 2Z57B 3SEOA 3OLAA 4EEYA 1RT3A 3LW5C 1RTDB 1CG2A 1B99A 1WF2A 2ZITA 3O2IA 3BBFA 5D77A 1WC0A 4R8UA 3TEHB 4YUDA 1VQPS 1Q7YT 4ETZA 2KVQE 1OWXA 5AXMA 1VS3A 4EI2A 2CQPA 2R7RA 1NH7A 3FC9A 4GRSA 1XMQF 4ZVRB 2KYXA 4JI8F 4C11B 3NGDA 2CA9A 3IGVA 2H51B 2J6SA 2DISA 5D0EA 2BQUA 3BYRA 4KAIA 4IQXA 2JFDA 1WHVA 1QVFR 2Z4PA 2QLFB 2PDAA 1XN9A 2NUHA 3M8ZA 3MI7X 3Q83A 2CG8A 4NLSA 5HJXA 3UVJB 1FT8A 1H2TZ 2MYFA 3ADAC 1NDLA 1TL7A 2J9EA 2IHR1 2Y0SD 4U8VA 1L3UA 1S76D 4DCPB 5DG7A 4JI5F 1D8ZA 3BF4A 3IBFB 2XY7A 2FJEB 1CSJA 3DLBA 1VYAA 2K7KA 1PYOB 1SUQB 3D1QA 4O3NA 1R0AA 3BJYA 3LP2B 4KR0B 5KFWA 4DQIA 4Z37A 1UZDA 1FRIA 1NK8A 5B0GA 1LWCA 1O51A 3FCHA 3GYXB 3TNVA 2LA4A 3ET6A 1Q16B 2QG9B 4K7QA 3OTDA 4WKYA 2ZNZA 2QA4G 1VLYA 4DFJA 1VRTA 1B70B 1G7CB 4ZPWR 2R7OA 4FVCA 1C1BB 1MWQA 2ZUGA 3JSMB 4NLOA 5K8MA 2HURA 2VFSA 1FVSA 4I2PB 4I64A 4ZPDA 1EX8A 3AHPA 2I38A 4USWA 1ZTWA 3DLLQ 2R7VA 2KRBA 3CC7S 3MM9A 3QO9A 3UVJA 3VR1A 1N36J 2ZBPA 3IS9A 2UU9J 2E5GA 4C0OC 2HNZA 3HD1A 1UFWA 2VFVA 4FPIA 1FF2A 3L4BC 3VAGA 2LP4A 3N01A 4F04B 5L39A 2V8PA 1VC5A 5HMYA 4DL4A 5IC6B 3JYTA 1ZOTA 3BBBA 3AA9A 3O5TB 1IBKJ 4LF4F 3CJ3A 3I32A 2C22A 5B0FA 3V81B 3D4JA 4JV5J 2EK6A 3EDQB 2IC3A 1NBEB 2B6AA 4HTIA 4CYUA 1P8GA 3TA0A 2Z2ZA 1JLCB 2VQFF 3RAXA 4QQBA 2ROPA 2X1GA 2W1BA 5MLCV 1NJIT 4Q0BB 3HXMA 4DV3J 4N8NA 2XQCA 2HNDA 3O44A 5HO4A 3BR9A 2DB1A 3KLFB 1FRJA 4YEAA 1YDLA 2MGZA 2YWWA 1RT1A 2JVRA 4I68A 1I94F 2C2OB 3JAMY 2LCWA 4DFMA 5HLFA 4K4TA 1YG0A 2HLTA 3G82A 4WPAA 3LWMA 2DR5A 2MQNA 3KJVA 3I5CA 4E98A 1U02A 2SXLA 3G6VA 5T41A 1HMVB 1YKWA 1S1XA 2O01C 1FJCA 4MIBA 4CLYA 3I96A 5HMXA 3OL6A 2AEJA 4OZ3A 1LK7A 4B9UA 4PUOA 3K17A 4HI2A 3SFUA 3SFGA 3BN4A 3HD2A 4QIEA 4ZP9A 5EGYA 2FJBB 2DR7A 1WDDA 5HJYA 3MD3A 1P1LA 4NMXA 5DDOC 5D4NA 4PPZA 1A7GE 1HBOB 1T05A 1H74A 4UOGA 4CLWA 2KFZA 1C4CA 4KB7A 2L9DA 3G82B 2VV5A 3QWPA 4B9LA 1BUXA 1DTTA 1JLFB 2RRNA 2YKNA 4NE9C 2H5IB 2ACYA 4A8OA 1B7FA 2Y1RI 4QPXA 4I2QA 4NCBA 1NAQA 4RNNA 1VQ8S 4BWMA 4IOAQ 2YNIA 2M8HA 4KGZB 4CH0S 2IDEA 3N6LA 3KK3A 1L3SA 2FLPA 3HHNB 3W64A 2GO8A 3DXSX 3CXCR 4FXDA 1VDHA 4BC7A 1S9EA 2RF2A 3FFIB 2BJ8A 4XK8C 5DGAA 1T03A 1UVLA 3F0NA 3PYDA 1KC8T 4WIQA 2YNHB 5A2QY 4DZ6A 3V81A 1DQAA 3GR1A 2ZWPA 3OTEA 1QAJA 4DN9A 2R4FA 3TUZC 4LF7F 5EX0A 4RUHA 1C0UA 2AYEA 2IJNA 2DR8A 2FQQB 5B0AA 4UUWA 4ZVTB 5KFFA 1GTEA 4B3MJ 3KMSA 1N0VC 2X1AA 4F4YA 1TK0A 1N54B 1R8PA 4LF5J 4X4UA 1KDNA 1RWOB 5IV4A 2GVZA 1OQ6A 4A48A 3CJKB 1YZ6A 1UJ6A 3AT1B 4Y2AA 5A8RB 4F02A 3DXBA 4DFPA 3VQTA 1NRKA 3BREA 4M5NA 2DT9A 4Y00A 2CUYA 3BSAA 5KFMA 3BQ2A 2ZWOA 1K73T 1VRQC 1UPMB 5DDPC 3AD9C 1F9FA 5HAOA 5KFEA 2FY1A 3AB4B 5ETMA 3I5AA 1YGYA 1ZAVA 4DPYA 5E41A 4DV7F 4JI3F 2HBRB 4DUZF 5LSOA 1M1GA 3I87A 4H54A 3AQPA 4PXBA 5L46A 2EFVA 2PI5A 1NDPA 2GMHA 2Y8WA 2XNQA 1MROA 2XMVA 3OT9A 1HBUB 1YJWS 2DXDA 5ETKA 3TO8A 2MQMA 3SV4A 2VQFJ 3D6FB 5GAEI 2QA1A 4P71A 4KSEB 4DR5J 3E51A 2CPDA 1ZPWX 4JOUA 4FF2A 2QMXA 1KFSA 4NXMF 1TL3B 1FJGJ 3IWNC 1UW4A 1GK8A 1WEZA 3CJ5A 1FFWB 4RLEA 2YWEA 2RD5C 3BQ1A 4N76A 3B54A 3PNIA 2LXFA 4LVNP 4C3MA 1KLMA 4F0KA 1Z4UA 1RLCL 4FVMA 3W9IA 3T5JA 4FZVA 3C14B 1HYSA 1X4EA 1P9QC 2OAUA 1GX5A 4OLOA 1RAEB 1S6PA 3ENWA 4XAKA 1WWHA 2EFNA 4ZN3A 4J9LA 4GKJJ 4WP3A 2R7UA 1UW9A 5DLFA 2FTRA 4AT1B 4YB7A 5MAOA 2OH2A 4B9VA 2UXCJ 3P5TL 5E2QA 1JLFA 2JOQA 2MLXA 3WBZA 2W9BA 3P8BB 3IP0A 4OZLA 1SC3B 2GQCA 1WEXA 3QGHA 1N34J 3HHEA 4IFYB 3PR5B 2CAJA 4WJBA 1RBOB 1HA1A 2R2SA 2BKPA 5J2PA 2Q43A 4GKKF 4FYDA 1OIAA 3EGZA 3HHDA 4FYVB 3VALA 3J7AN 4W90B 1RYRA 1WC1A 2KB2A 2HBZB 4BBYA 3SXLA 2FJXA 2GS8A 2E1RA 3VAMA 3DYAB 4ED6A 2VBWA 1JLGA 5KT3A 1S1XB 3UN5A 2R2UA 2PFFB 3NY0A 5ADZA 3ENQA 5B7WA 1LW0A 5A2QU 2HHPA 1TVRA 2UP1A 2D7SA 2FD2A 1KQKA 2B9EA 3I9ZA 2VJVA 1IKVB 3CJ0A 2O67A 3DMJB 1CJTB 2XO7A 1EIYB 1JJ2R 2E7VA 2DNGA 4LSZB 3MWBA 2HGMA 4N7TA 4QYRA 4BLGA 2RQKA 3HHLA 3BGFA 1F5CA 4PPDA 1CEZA 2IIHA 1Q5VA 4EYIB 2BKNA 2OEMA 1TP7A 1R0CB 4OI3A 2IFXA 4TXSA 5F0WA 5GAHU 2C2NA 4F4ZA 4ZA1A 4DR6J 2OI2A 4XDDA 2K2PA 1RBAA 2CJQA 2LDYA 2V4JB 3CDUA 4R0JA 4X4QA 3B4MA 4KO0A 4DI6A 4YOEA 1RT6B 4I7FA 1FRXA 2H9ZA 3UNYA 3H42A 1XERA 4EK2A 2IJRA 3E3XA 4LR7A 4M5JA 5ETQA 4LF7J 4X4VA 4RUAA 2EG1A 2L48A 4QWAA 3HZGA 4MYTA 3K58A 1VQSA 3VGVA 2ZBQA 2RQCA 4RW9B 2W9CA 2G4BA 1QAYA 3HI9A 3WZ0A 1I1GA 1R6VA 4DR4F 3PHEA 2E5LF 3JYTB 3HHLB 1G1XA 4HHHA 5L1JA 1YRTA 2IVYA 2ZE2A 4JI8J 2M52A 4IO9Q 3B8HA 3MECB 3R5DA 4KFBA 1X5OA 3A3OB 3KFWX 4OYBA 1Q5YA 1X5SA 3J80Y 2MKKA 2BJDA 2RIJA 4P2MA 4JI1F 1TAQA 3D2WA 1KONA 1KQFB 5GADI 1SIZA 2LQBA 2POKA 3DHWC 3EE3A 1X4HA 1UTAA 4A8XA 4C0HA 1JX4A 2VG5A 1FDBA 1XEZA 2EWHA 3TZXA 2V8HA 4WFAQ 1HMVA 2E1MC 2GJ2A 3VGUA 2WW4A 3KUEA 4M63A 4KGXB 3OLBA 1FK9A 1V9OA 4U67Q 2DNHA 2ZBRA 1WHXA 2I9SA 2KU7A 3EGNA 4E8UA 4YR3A 3FNNA 2GAHC 2H65B 3IO1A 5D0HA 4ZVFA 3QT5A 1IQTA 1VBXA 1J2VA 2OEJA 5H9EK 2MZRA 3M9MB 4EWTA 3HFVA 3BM7A 3ZTPA 1RGVA 4DQRA 1LWEA 3K5OA 4C3LA 4C8ZA 4Y34A 2PEHA 4H4KA 3QJJA 1TL7B 4ERDA 1OY8A 5ETVA 2HNDB 4O3OA 1HNIA 3HHLC 4ANCA 4RZRA 3PW4A 3D5MA 1WJ9A 3CNQP 3QT7A 3OHBA 3EWGA 2Y8YA 4FS2A 2DK2A 3MEDB 4B17A 4LMZA 5K8NA 2NYHA 3TVYA 2UVRA 3ZO7A 2ZKUA 5GMDA 3IS9B 4WCEQ 3T1YJ 4K50A 3CMQA 2CQ3A 2C28A 2HZAA 1S0NA 1YX2A 2W9AA 3E8OA 3HP6A 2LMIA 1D8YA 4CLZA 3MMJA 3CJ2A 2N7CA 1M5VC 5I42A 3CDEA 1PC4A 2FJAB 4ITSA 4O44A 3RUBL 2HKEA 1DQ8A 1PIEA 2OPPA 3FBBA 3IG1A 4LF1A 1K9MT 1VQ5S 5DS7A 3GLJA 1NDCA 4ECXA 1R8BA 1HR0F 2HMIB 1S1TA 3LP1B 3FMBA 3V2UC 4ZS6A 4H4OB 5LMUF 4HDHA 4OLPA 4ECZA 2XMUA 5A8WA 1I6JA 3BGUA 3W9HA 2AHOB 1XK8A 2KDOA 3VCDA 4MTPA 3KK2A 2EI5A 4XO0A 2JVOA 2GIQA 2RKIA 4NASA 3Q22A 1BE4A 3GJTB 4IFVA 2GMJA 4XIUA 2AF6A 2QLWA 2BACA 3FEYB 3TX0A 1S49A 5K9FA 4ZLNA 4X65J 1S79A 2W9BB 3JSMA 1VIOA 4DQSA 4HVZA 4O3SA 2H4WB 3EYZA 1UWAA 1RT1B 3HVRA 2UUTA 3KMQA 3THVA 3GE9A 4DG1B 5D15A 1CJKA 1TV6A 4NX9A 4K4XA 1S1UB 3VTIA 1LWCB 1YIJS 1HQ2A 1VI7A 2EFQA 1J5OB 3CMES 3M8RA 2FGOA 3F56A 4OHZA 4OHVA 3RG6A 1V6HA 1QDUB 5K14A 3G96A 4PRFA 2DRAA 4LFCF 2BKOA 2HMIA 2BV3A 1LFPA 4QU7A 1GXUA 2V67A 1FEHA 3J7ZT 4GC7A 1HHQA 3LP0B 3LP0A 3PYEA 1Q82T 1X0FA 3BGRA 2FLNA 4W4MA 4A8YA 4O3RA 1KVKA 3KLIA 1IWGA 2DIUA 4RWXA 4ZPAA 1OMSA 3QJPA 4YB6A 4QYZJ 1HQUA 2HNZB 1LW2B 5I3UB 1FXRA 2P8IA 4P2SA 1HNIB 4ZKAA 2VA3A 3D3CJ 1HARA 4HT5A 1JIHA 1JLAB 3IBWA 3O8WA 4N47A 1HBMB 2ADBA 2YNIB 3QSYB 3W65A 2B7CB 4OYPA 4PG6A 4ZK7M 1FKAF 3MAQA 2HHXA 3RW7A 3KLEA 2DGWA 5B0EA 2BZ2A 1RBLA 5FD1A 1G4CA 1XTZA 2WSEC 4TVAB 2WBRA 3P45B 1B3TA 4UQTA 2G0JA 2A6MA 4PABA 1U2CA 3L3CA 2UUBJ 4TNOA 4K4WA 3S1TA 2MZTA 3CJKA 4DF4A 4FF3A 3J81Y 2RILA 4PWWA 4RO0A 1EQ0A 1FKOB 2HIQA 1VQLS 5KT7A 4PWDA 4DV1J 2KFNA 1WORA 2DBBA 5DZ7A 3RU0A 2FPHX 2OUGA 4RW8A 1F0XA 1JK9B 2IRYA 4NRTA 1HPZA 3UNGC 4TU9A 5E3CA 1PILA 2BRLA 4X4PA 4K2XA 1KBRA 1KNZA 1VK3A 1PO6A 2ZBCA 1NKCA 2MB0B 3QFWA 1HI0P 3HJFA 4LUBA 1HW8A 2QV6A 2BM0A 4MMOA 3KNAA 2DHAA 3Q2TC 3NAIA 2HGNA 2APOA 1RT7A 2HGLA 3KG4A 3H4DA 2A6OA 1NJXA 1TL1B 1ZS6A 4ETXA 4JI7J 1Y5NB 3H8YA 1JKHB 2CVEA 2LFVA 4ER8A 3H5XA 4MKBA 1LEOA 1JLBB 2DGOA 5HMWA 1N56A 1DBDA 4YY3F 3KLEB 3BO3A 2FIUA 2GQQA 4UF4A 5GADU 3KK3B 2KI2A 1LNQA 1OPZA 1RZMA 1N5YA 2HBQB 1UWBA 1UWBB 2RB7A 2YX7A 3M2UB 1RT3B 4I4BA 5BXIA 1P6TA 2C42A 3PZPA 1RTDA 3AJDA 4DL0C 3QRPA 1DZ5A 3W2WA 3KDOA 1E6YB 1Q78A 2XGQA 1LW2A 2J7WA 2UZAA 3H2LA 4AXIA 5I3UA 3V6KA 1TK5A 3DOLA 1FD8A 3VZIA 4DCOB 2MKSA 1WACA 2YKMA 4CNYA 1IKYB 4OHXA 3IM9A 1RT7B 3VHQA 3WIVA 1FXDA 2XMJA 5LJ3Y 4Q8EA 5HQ8A 4LFBJ 4IYQA 2CJYB 2GGPA 1DJ0A 2XYPB 3A1YG 1CJVA 1NSAA 1TUGB 3EDRB 3PM9A 3S01A 2EEYA 2JEIA 2KZZA 4LJMA 2F63A 3HVWA 4EZ9A 1MSWD 5EDWA 4QIVA 1KQGB 1OPIA 3MM6A 3N4WA 1EP4A 2AZ1A 2EFOA 3IA0A 2AEFA 3ZZOA 5DM7Q 4KH1B 4DR5F 1NHVA 4DR7J 5KOWA 4XTTA 3OR1A 2C3OA 2RRAA 3R8YA 5AJ3J 2YNGB 5G0RB 2ZH7A 1S0OA 5L1KA 2CPXA 3JB9k 2D3OR 1NDKA 3A3PB 2QIFA 3BN7A 1A0OB 3MPVA 2XMKA 4WBFA 2AJ4A 3CDAA 1CJUB 4QWCA 2VBZA 3D66A 4A46A 2D74B 1OS5A 3K8WA 3OFFA 3QBCA 2M8DB 1R43A 2AWZA 3SCJE 5ITHA 3W61A 3VAKA 3CVKA 3W5XA 4ED8A 3DU5A 4RL1A 3V6JA 4F2SA 2B8QA 2ROGA 1IJFB 4MFBB 4B3OB 1OY6A 2ZH9A 4X66J 3POTB 1XJWB 3MM7A 2DPIA 2DIVA 2I8EA 3LPEA 3MM5A 1N5SA 3SSSA 4E0DA 5CYJA 4KGMA 4KTQA 3OL7A 4F7VA 2KTQA 1RSCA 5C24A 5LJ5Y 4AL5A 2PMZD 3A3NB 3I4HX 1AYEA 4FYXB 4BHQA 4Y65A 3RW6A 2YKPA 2YY3A 2C3UA 2FVSA 2ZH2A 4ZPCA 4DBQA 5KG5A 1SJ4P 3GQCA 3RRKA 1Q53A 2EW9A 1IR1A 2EFGA 2K1RB 1JLAA 4LF5F 1S7HA 2KT2A 4ZITA 3LO3A 3OSPA 1BQMB 3M05A 3TQEA 5FDLB 2YKOA 3PY8A 2Q1LA 2J9CA 3D0IE 3Q0AA 3OL9A 4JYAJ 2XG8A 2A2DA 2VG6B 2VG6A 3RZAA 5LXRA 2Z2YB 2HQGA 3DLEA 3DRPA 2KG1A 2HHHF 1XNRF 2V8GA 4CH1A 4OMFG 1T02A 4KV8A 5KFBA 2CPZA 3G86A 4RW6A 1SPBP 2W25A 3GIKA 1HWJA 1JXVA 3P96A 1GAOA 4HH0A 4KHRA 3SSRA 1U2RA 4NWBA 1KHVA 1NK4A 1RT2A 4O0IA 1QM9A 1V3SA 4KQZA 1NKEA 3DYAA 3OXGA 1WC3A 2R2RA 2E5IA 3BGOP 4C8OA 2W4DA 3FCWA 3MOZA 2U2FA 3L9ZA 3BS9A 4EUVA 3TAQA 2QL5B 2HHUA 1AFJA 2W4PA 2B3TB 1UVMA 2KN4A 3MD1A 3VWSA 3MPWA 1S1UA 4HACA 2K06A 2X1BA 3EVWA 2Z2LA 1KVJA 2H4YB 2CIMA 4X4NA 3K89A 3BGLA 2VG5B 3UDCA 1YBTA 3IRXA 5IC4B 4OYAA 3HHKA 1X9SA 4OL8A 3SBMA 3GFHA 2VZ9A 2VKRA 1HNVB 3NS6A 1RT2B 2WOMA 2BE2A 1SH2A 3M6VA 3HKZD 1RWPB 1BMQB 5M2UA 3J81U 3G4SS 2WVFA 2W8LA 5GAHI 2OHDA 2J7KA 2V2KA 4B9SA 2JLGA 4C2MA 1PJ7A 1NK0A 2JLFA 2O5DA 4UT4A 3FSIA 3EX7B 3PHTA 2G0CA 3CCRS 4L6V3 1L3TA 1RAAB 5JJBA 1QAIA 3KYLA 4OYZA 3TZYA 2O3DA 3CO9A 3AODA 1FTRA 2FHMA 3NCRA 5M2RA 3P5BP 2P5VA 1TUVA 1SJRA 2DRDA 2FHJD 2W8KA 4ID5B 3A8EA 3EVMA 4MYUA 2AGPA 1IKWB 2PMWA 1PJ5A 4QR0A 3T6JA 2DRBA 2KXFA 1U7LA 4WWSA 1VQ9S 3QZ7A 3M8SA 1U0HB 4U7UK 1SH3A 1F3VA 3NKYA 1KD1T 4R5PB 2MY8A 4FP9A 4U95A 4ZHRA 4ZP7A 4J9SA 2L08A 2QRRA 4UZCA 4DR7F 1S72S 4OX6A 4NZ7A 2DJWA 4NLXA 3P49B 4RU9A 3LAMA 4FXVA 2A2CA 2FZKB 2WBMA 5KFHA 3M8YA 4U7CA 5CQGA 3QQCD 1RAIB 4ECRA 3UCZP 1D0EA 4JI3J 3DN9A 2RKIB 2V2VA 2DHGA 2W2PP 2CKWA 3HZEA 2QLBB 4L3KA 4ZVUB 1TKXA 1UJ4A 4WXWA 4ZVQB 2XS2A 2LXIA 1G6BA 3ISNC 4ZVPB 2BX6A 4AL7A 2Y1JA 2XS7A 1K44A 5HVFA 3WIUA 1SQEA 2QL7B 3QMQA 3OJSA 2GHWA 4WP8A 1TU0B 5D0RA 3UQSA 5HQMA 4A8MP 3V4MA 4DSFA 1S1TB 3LP1A 3KK1A 2FDNA 5HATA 3WC2A 3U02A 4ZCMA 1VC6A 1GMWD 4QIWD 3OBIA 1CLFA 1OQ3A 4OI4A 4ZPTR 5AXNA 2W9CB 4X64J 1BXNA 2V9KA 3KDNA 2M9KA 2OO4A 4DSJA 3IBCB 4NCGA 3G9CA 3FFIA 2YKQA 1XMOJ 1FX2A 2Q66A 1JXLA 2E5JA 2ZH3A 2WONB 4IR1A 2COLA 3CCZA 4J9OA 4EO6A 3Q8VA 2XY5A 4EO8A 2M70A 2V4JA 1SKUB 4OHWA 4DQPA 2HAFA 5IZHA 2EXUA 5GAGI 3NOCA 4OX8A 3R6GB 4X65F 2UXBF 2HYIB 1XNQF 1XBWA 1QVGR 3RRHA 3IFEA 2QMUB 3N5FA 2GQ2A 5B0DA 1UEVA 2JL9A 4C8MA 4J5OA 4Q45A 3CT9A 1KP6A 1NPRA 3AA8A 1FJ7A 2O66A 3DRSB 4A8SA 3T1HJ 2HRUA 2WW8A 1AFIA 4LR8A 2KVIA 2CQHA 1VMBA 4K2JA 1U47A 4X4TA 5EHHA 1IKWA 4DHVA 1LW0B 2GIFA 4CRJA 2KG0A 2MKYA 4IQMA 4JI6J 2ILZA 1T9YA 4PXCA 4J7CA 5HMZA 1IM4A 2BRKA 3T5KA 4PG7A 1S4EA 1Y0HA 2E1AA 2MHNA 3HX9A 4P9SA 1Q8LA 5DO2A 4JI0F 3QRRA 2CZ4A 1TQLA 1HPZB 3EPGA 4WK3A 4KGKA 3BPSP 2V8DA 3TARA 4M94A 3M8QB 2RH3A 2R8GA 2AJFE 3Q2SC 4O3QA 1X60A 4EU0A 3JQMA 5LMNJ 1R8HA 4HH1A 2A1BA 1HIYA 1LFWA 1Q4RA 1U09A 5ETSA 3BQ0A 2XWXA 3B6BA 2FHOB 3AOAA 4G1IA 2VG7A 2KHDA 1DAXA 2G1DA 3TVZA 5HN0A 2XO6A 3MR6A 2CRLA 2J6UA 3DKDA 4IG0A 3L7UA 3U1LA 1RWKB 1B4SA 3KJFB 3QT8A 4LBIA 1NEEA 2KJVA 2VDIA 3K8VA 1NNDA 5HI7A 1SJ3P 1CS4B 4L74A 2XLKA 5KG6A 5EWEA 1VCTA 5F8NA 1FVQA 2N4DA 4ELTA 1HLWA 1D9FA 1FE0A 5BYQA 3SCLE 4ZHRB 3MM8B 3H25A 2DR9A 1ELOA 4DR3F 2OTJS 3R5AA 2DR6A 2AT1B 1HBNA 1QE1A 1FDNA 3LF0A 2QYGA 1MMNA 3OFHA 4H4OA 2B6AB 2IC3B 4CYUB 4YHHF 1IBLF 4U6PA 4TU8A 2E66A 4NI2B 3KLIB 4JV1A 4DUTA 3MEEB 1T9XA 2W01A 1FWLA 4K0KF 2VFTA 1FKPB 2CADA 1P1TA 3HVTB 2OIHA 2VDHA 1NO8A 2AKWB 2HNYA 3ENVA 4GVBB 4RW6B 5KTQA 3VV2B 2A0FB 3CCJS 3D1HA 2AX1A 4JB8B 4DEZA 3NWGA 3G87A 1L3KA 1ZAXA 3ZZUA 2D69A 3RB6A 2DGQA 3KHLA 2AX0A 1SB6A 1RWWB 5I3PA 3CCUS 1TL3A 2ZEJA 4CH7A 1WHYA 5DJBA 3SQGB 5IM0A 3BKTA 4KHMA 2HWTA 3NXZA 4GMKA 4LIWA 3LPYA 3R5JB 2XI3A 4ED3A 2C2EA 4LF9F 1SI9A 4CT9A 2AD9A 2EBGA 3HVAA 2RRBA 4M5HA 1Y3KA 5HK4A 2GJIA 3BKUA 4NI2A 4F0MA 4DX6A 4DV2J 5DZ6A 4K4ZA 1GTHA 2FZGB 3E01B 1U8WA 3U27A 2XMAA 1N88A 5HROA 5CAAA 1ZZNA 1VQ4S 1NH8A 4YB5A 2BJ7A 3Q24A 1HBNB 1H3DA 1APSA 1N5TA 2QN6B 5KFQA 1VBKA 1URNA 5AE3A 3GWCA 3OTOJ 3MM5B 5F8JA 2MHEA 3D3BJ 1VFJA 3QNWB 2HVZA 4IFYA 4LF8J 1NSKL 4GKKJ 3DLKA 2HK2A 2FJDB 3FCVA 3MGJA 1REGX 2CQ4A 3MPDA 3PR4A 2XY6A 1HNWJ 4CM0A 2J5AA 3ISND 1KTQA 1OSCA 3DOKA 2JRSA 3L7OA 3PTWA 3QIDA 4ED1A 4DR4J 1ACMB 5KG2A 4USHA 3DFEA 5J2PB 1TKXB 3A13A 3IG1B 3G71S 1RHMB 2GVZB 1C1CB 1TTHB 5IOLA 1JLQA 5ETTA 3ULHA 5KT6A 1T8EA 2CDQA 4PYAA 1RADB 2AP6A 2IM1A 2NYIA 2YNHA 5KFPA 2EKNA 4EBDA 1QSYA 1XNQJ 1B7YB 1TFYA 2QSFA 1UEUA 1RKJA 2AEMA 1XR5A 2FVCA 5C2GA 4LF2A 3S8SA 2JFKA 4NPOA 4UZBA 1S97A 1VC0A 1REVA 3N79A 1RTJB 4XDCA 2XCAA 4PQUB 2HNYB 4GVBA 2VUGA 4P2FA 2UUBF 3HFZB 3LALA 3R5CA 3J7Z5 4LFBF 2VPZB 1Q8BA 1O5JA 3M8WA 5F0UA 1M0SA 2QYCA 2L9WA 2MKCA 1IKYA 3PRVA 1DLOB 4O3PA 1U1MA 4F3OA 4FNHA 3PYFA 3B4DA 4DV1F 1RCXB 3HPOA 1SKWA 3M9NB 3FK4A 1M5KC 1QUVA 1EKRA 4ZVHA 2DH9A 1S57A 4AL6A 2HQ3A 4F0HA 4TY8B 4AQYJ 7FD1A 1KFDA 3A8JA 1N5YB 4URSA 1RWNB 2Z0GA 3DNCA 3I6PA 3NCQA 4PXDA 4TKTA 4I2QB 2ZHAA 2FC9A 3LGHA 3PYGA 4EGLA 3IR6B 3DI6B 3US5A 2N82B 2KM8B 2V69A 1UZHA 4LFAJ 4DL6A 1U1RA 3N0VA 3BEGB 3ICLA 1AZSA 2FJVA 2JNJA 2X3DA 6FD1A 4J9MA 1TAUA 4DPUA 3I56S 2N4CA 3WX4A 5J2NA 4F67A 3K5PA 5F8MA 1S0VA 4OZ0A 1O0PA 3M4XA 3I9V9 4GC6A 2FVRA 4YQWA 4DV4F 3AD8C 2V4RA 2F4VF 1UFLA 2Q6CA 4X62J 2ZDOA 2NXNA 3IM8A 4X66F 2IM2A 5FJ4A 4GKJF 5L1IA 1F60B 3M6WA 2DNLA 1X4GA 2MTLA 2R42A 3VAFA 3R7SB 5HLFB 1QSLA 1X8DA 4OZJA 1FESA 3CTRA 1X4DA 3ZTSA 2ATCB 5BR8F 4DV0J 2MKHA 3VAJA 4AE5A 5BJRA 4H4MB 3G6ES 1RT5B 2OMLA 4FPRA 4PAAA 1C4AA 2XULA 9RUBA 2B4OA 3NBPA 2BOAA 1X5TA 1VR6A 1T95A 3CDWA 3RAMA 3MPYA 3TZZA 4PQAA 4QWEA 2XLIA 5A8KB 2IPOB 4DV2F 5IFMA 4MK7A 3CJ4A 5KT2A 4NCGB 2MQOA 2B4VA 1K47A 4ECSA 2IVMA 2F8HA 4M1KA 2NREA 2M4MA 3C6UB 1FNOA 4DV6J 3CJ8A 4BWJA 1FI4A 4KC5A 3L95X 1AUDA 3TQ1A 1PKUA 4ILRA 5F9LA 4R0EA 2BE9B 5KT5A 2H54B 1Z2ZA 5ETLA 3TA2A 3OW2R 3MAHA 1P27B 3MAAB 1Y9OA 4DMZA 1RYSA 4NLPA 1U6ZA 2XI2A 3LAKA 3ET6B 3W62A 4IR9A 1U49A 1HWIA 2EFPA 4DJBA 3ONQA 4NA1A 1N6QB 3GYNA 4I67A 1WKKA 3UWTA 1HNVA 1NZAA 1PBUA 2V2QA 4NMLA 4P73A 1U26A 1A9NB 3ZXWA 2CQDA 5ETRA 1DARA 1R7IA 2ZZMA 2RS2A 4K4YA 2B9WA 3OD2A 4UOCA 2MGZB 4UOHA 3D68A 4WF9Q 2DO0A 4F25A 3D0GE 2ZFHA 3NNAA 2M7SA 5KG0A 1ZTTA 4LSLA 1W7WA 2NUUG 4JI2J 2YWKA 1UVIA 4Q0BA 1VRUA 3ELHA 3OTCA 4PG5A 3QJLA 1RA7A 4OX9J 1VK8A 2O1PA 2V94A 1F2HA 4TN2A 1FA0A 2MDAA 4DFKA 3UN2A 4AD6A 1E6VB 1TZ0A 2AMCB 1RE1B 5T14A 2ZH4A 2JH3A 5A6PA 3UR3C 2C2KB 4IUFA 3TR5A 2UVWA 2DYAA 3FBFA 3WQPA 5D3GA 5K14B 1GX6A 1QJHA 4C6AA 2PA3A 5E3AA 1TMMA 4FDFA 4KY3A 3W2WB 3KHHA 2IDLA 4LT6A 3T5HA 4PG4A 1VQYA 4ZDNA 3C46A 4WKRA 2PT0A 2V8VA 1BD6A 2ASDA 4LFAF 4I2PA 5JVHQ 4C0BA 4EZ6A 2DGTA 2Z30B 3IN5A 1VISA 3M8PB 3DDNA 1WC6A 2YNFB 5FLXY 2HSEB 3M9OB 3KTQA 4L72B 5FLXU 2EVZA 2HQCA 2UXCF 3FEZA 1RAOA 1WF0A 1RUSA 4FYWB 1FHTA 3BR8A 3M6XA 4KGVB 3D7SB 5A0YA 1FFGB 3MMBA 4NLRA 4USUA 4EFAC 2XGPA 4QWDA 1M5PC 1SVDA 4GO7X 1RK8A 2DY9A 1OYEA 1LWFB 2UXBJ 2CXEA 1LOUA 3LP2A 2JWNA 2HZCA 1TMJA 3KK1B 5C25B 4S0MA 1N32J 1MNEA 1WEYA 2FY8A 4NA3A 2E7XA 2Y0BB 3FSXA 2YPZA 4USVA 2MQQA 3G6YA 1NSQA 2XZTB 1L3VA 4U7UD 1YRXA 2C3PA 4DU8A 1F6TA 1CBKA 3TRGA 4UUXA 1KTVA 3H2UB 3PO5A 2BQRA 4BS2A 3PJWA 2FVPA 2J0SD 2QGFB 4ECVA 4KFBB 4NLDA 3OXFA 1XMOF 2WVCA 1W26A 1EP4B 3MUMP 4NLTA 2FYXA 4CLKA 2YNFA 4CLUA 1MU2A 3C6TA 3NRBA 4O0NA 4ZOSA 1PAEX 1FCAA 2BJ9A 2YPYA 2IAJA 3CULA 4HHUA 2GMLA 4GO5X 2K1RA 1YVFA 2OGUA 2U1AA 3U1NA 1CPZA 3J80U 4H4MA 2W2OP 1BC6A 5IT4A 1PC5A 3JSRA 2K3KA 3SDEB 5I3QA 2CQ1A 3EJMA 1H7WA 2HVEA 1WTFA 2I5JB 2IRUA 1IKXA 2HK3A 3CIMA 3H5SA 1LKZA 1Q8KA 1U6FA 3M32B 1NJYA 1HNXJ 3RR8A 2XHWA 1CULA 4K5SA 5HL7Q 4F4AA 4JBCA 4Q2LA 3IGNA 3QAUA 4QW9A 1HL6A 1REVB 2CQ2A 3AXMA 1EKSA 3KNGA 3V6DB 3H0PA 4K0KJ 3UPFA 1FNMA 3EM1A 4M5DA 1Q86T 2FVQA 4V19J 2OTLS 2B0GA 2OFHX 2ZVSA 1ZH5A 2NXCA 4JP8A 1RACB 2QA2A 1J5EJ 1T3OA 1JLQB 1T94A 2HS3A 2J76E 4RBVA 3RBXA 3TJAA 4D3GA 3GJSB 2W7OA 1CJKB 1TV6B 2DGXA 4BDPA 2VICA 2E29A 3HFKA 2DHSA 1TKDA 3CC2S 1BY9A 3MR5A 3EVOA 3MR2A 3H5UA 2F8MA 4KKOA 2GX8A 3H20A 1JB0C 2LA6A 1IN0A 5HP1B 2QTWA 2BDPA 2ZJQQ 4ED5A 1VBZA 1BWVA 3TJ8A 1KOOA 3IWLA 2R9LA 1EAYC 4K5RA 5F3ZA 1BLUA 2B56A 3R27A 3BO2A 2HS4A 2HG4A 2BW2A 4A8FA 4CQ1A 2DHHA 5ETOA 4DCJB 1OY9A 1N48A 4G65A 1TR0A 3R5GA 5AE1A 5C42B 2AZ3A 3E01A 3T1AA 1BWEA 4HHJA 1JQGA 3H2VE 3T3FA 2XWYA 4C8LA 5CCMA 3TAMB 1H73A 5J2MB 4OJHA 5D4PA 1RU2A 4XPEA 3W3SA 4YDXA 4I6AA 3R1LA 2IYIA 2FLLA 2XNRA 4B3SJ 5CYMA 4QOTA 1C0TA 1R3NA 1WELA 4OZNA 4WU3A 1SC4B 2JC1A 4YN3B 5L1LA 2P9GA 5CHCB 1I94J 1Y7PA 1NCLA 2C3MA 2G2ZA 1N36F 1FTCA 3MMAA 3NGTA 4PYDA 5L9XA 3TAPA 1SJFA 2IA6A 1FKPA 3FBEA 4N41A 1K1SA 3V6HA 2W4CA 3KLGA 1RTZA 1MMLA 3Q8SB 3TAMA 3K5NA 1LWEB 2J6TA 4CO1A 3OSNA 4FYYB 3CJQA 4ED2A 2PMHA 2HS0A 3HJVA 4HYKA 2ZZNA 3DOMA 1N32F 3DLKB 1U1LA 2E9TA 3OTOF 1FNXH 2WVEA 5C7PA 1W2IA 1K1QA 4EMDA 2ZHBA 4P75A 3KLHA 1IM6A 4QU6A 5D0GA 3D0HE 3A12A 4ELUA 2E44A 3MAAA 1MLAA 2UXDJ 4DPWA 1S6UA 1YLXA 2RU3A 1TKZA 2GNKA 3D9BA 1FX4A 5KG3A 4LQ3A 3Q86A 3PDNA 3BYPA 3UD5A 3KG1A 3PEHA 3TUPA 2R8JA 2AU0A 1YJVA 3K57A 1NPKA 3ILOA 3NGSA 4ICLB 4RNHA 1PBAA 2YNGA 5G0RA 3V4IB 1H0HB 3ETMA 2F65A 3FRZA 3J7A1 4U8YA 2VB6A 1YTYA 4CT8A 4QCLA 4DDFA 3G6XA 3K0JA 1IWAA 5F3TA 1SJ1A 2CJXB 1N33J 2PFDA 3G2XA 4TLRA 4NLGA 1GXLA 1Q0NA 1WD6A 4RNOA 1TKTA 4IKAA 2KYZA 2YWHA 3A4TA 4L3NA 5FDLA 1YWXA 2LEBA 3PCOB 5HANA 4IOBA 2VONA 5EWGA 2F7VA 3MTJA 4DR1F 3ZTRA 1EETA 3QLHB 2GA7A 2V0NA 1H38A 2CPHA 2FC8A 1WDTA 1TFWA 1KRPA 1YK9A 1XR7A 2DD8S 4C97A 4P6QA 2KHCA 3OHAA 3GILA 1S9GA 2R8KA 5D8HB 1RABB 3D67A 1QUPA 2F4FA 1BGXT 3H7HB 5BYSA 2HVIA 1H7XA 1H2UX 4PKDB 2R2TA 2ZOMA 3EGVA 1RTHB 3ZZYA 1T7PA 2N3LA 2HAIA 4C48A 2ABYA 2B5JA 3QWUA 3FJ2A 2R7SA 3JTPA 2GIRA 1RJJA 3GU0A 4NRUA 4DV5J 4N77A 1HBOA 3H59A 2DNQA 4UOFA 3W8GA 2UUWA 3MUVP 3MFHA 4KPYA 4TU7A 1MN9A 2QMWA 3PV8A 1FXLA 3LOUA 3DI6A 5DG8A 2D9PA 4DLEA 1C0UB 1PCAA 2MLYA 3PKYA 3OXLA 4CLTA 4ANDA 1YZ7A 1IBMJ 1NK6A 1ZA1B 2ZC3A 5KG7A 1T3NA 4A47A 2VL1A 3C15A 3DM2B 1F5BA 2UUAF 5F9NA 4Y6IA 2LLZA 4DV3F 1F9HA 3W5ZA 4RJVA 1IUJA 1XMQJ 4M5IA 2OJ3A 1I5OB 3CCMS 1Y10A 4B9TA 2VBXA 5EX3A 5LOQA 3MFIA 2DNRA 2V6AA 4NLYA 1R0BG 4WYLA 4KHPF 5H9FK 4JV5F 2KRRA 1NHKL 1TL5A 2C2RA 1GFWB 3BPDA 1RP5A 2NPIA 3FGVA 4EYHB 4PQUA 2QL9B 4CO5A 2MXYA 3C6TB 1YI2S 1JLCA 4F3MA 3I4PA 1EB0A 1R8CA 3GG1A 1WNEA 3AJ1A 2HFVA 2DO4A 2ZOGA 2NZCA 1DLOA 1KR4A 3MXHP 2VFUA 3IR7B 3DC2A 5KFZA 1I3OB 4AUKA 3D6TB 3CGIA 3LGMA 4USTA 2JEJA 4PXEA 2RVJA 3EGWB 1E6VA 1AB8A 2ZD1B 1RCOB 4UW2A 4YHHJ 4DSIA 1MN7A 4O23A 1T9TA 1YSJA 2H3EB 2OPQA 3QAEA 4NXNJ 2XM3A 2PA8D 1W25A 1CJTA 2CPEA 2NS1B 2KO1A 1F5AA 2DKOB 3EZUA 2UV8G 3PG9A 3IAM9 5IQQA 1JJHA 2PGCA 5J2NB 1SV5B 4O4GB 3Q8PB 4LSLB 5KFYA 5CA5A 3OQ2A 2WZ1A 2ZH5A 2HW3A 1NB2A 1WUUA 2H5EA 1BQNB 2CQ0A 2LVWA 2VODA 4C4WA 1BHNA 4NOHA 1UFKA 4MT1A 4FKYA 3OUYB 3GIIA 3OR2B 4IG0B 1M1HA 2C1EB 4B02A 1NB7A 1ROFA 4X4OA 4PG8A 4BC9A 3KLHB 2ZJPQ 1VQOS 2Q3PA 1HD1A 4RW9A 4X84A 2CPIA 4ZVSB 3SQOP 2XSJA 4CLPA 3T1YF 2HZVA 4PEOA 4NXNF 2CWKA 3AB2B 4Z7YA 4K4UA 1MG7A 3THTA 3QGGA 1R0AB 3OJUA 3BH7B 1TK8A 4AYBD 4YP3A 4DL7A 1Q81T 2OPRA 3FZBA 2ZH6A 2OPQB 4KBIA 2R7TA 2HHSA 1Y00A 4JI4F 4WTOB 4P10A 5CYMB 4G1PA 3BGRB 3GIRA 4HEA9 3CWJA 4LBPA 4OI2A 5E7OB 3U7JA 3MMAB 5I42B 2RS8A 4K4VA 2MKIA 3GJQB 3FUYA 1F3FA 1RTJA 1U0SA 4N8OA 4HL9A 3TJ9A 1GQEA 1QAXA 3T19A 2LECA 1T03B 3PRBA 1XR6A 4URGA 1U2FA 3W7BA 4ZIWA 4C11A 2ZH1A 3UD4P 1ZM2A 3HLUA 5KFTA 2HVDA 1Q79A 4OV6A 4OYMA 2NSBA 4MIWA 2I1RA 1HQEA 1VLOA 2DITA 1NXIA 2F9JA 4I6YA 4P72A 3OTBA 3FKBA 3HVTA 4PWUA 3RB0A 4WFYA 4IRDA 5K5MA 2GV1A 2F9DA 2QLXA 3MZIA 3GIMA 2G1HA 2ZDPA 3H40A 4DR2F 3CCWA 1S1VB 1ICEB 4MJKA 3R6LB 4WZQA 1TKZB 1FE4A 2PEBA 1VRTB 3PACA 1SBRA 4M5KA 4ZPVR 2HRYA 1OJ4A 1MWYA 4ES3A 4Y28C 4ES2A 5IWAF 4IFVB 5AE2A 4DL3A 1NK9A 3EXCX 1FK9B 4DU7A 2E1CA 4LF8F 1VHIA 3IAS9 5E3RA 4ED7A 3TUJC 3TI0A 1Y3JA 2BXJA 2L9NA 1LK5A 3DOMB 3W5YA 3A8KA 3BDPA 1FRKA 2M88A 3GJRB 1MMDA 3OR2A 4KKOB 1NHUA 5ETNA 3WHIA 2BYCA 4Y2IA 3AXKA 5KFSA 2NXJA 2CNOB 2FB0A 3LGNA 2OFGX 3N6NA 1M5OC 4WYWA 3C6UA 2X7IA 1U48A 2CPYA 4O44B 3OVBA 2VPWB 3MCMA 1SH0A 3QFHA 2DVIA 4ZLJA 4F50A 5FIIA 4LF9J 3SQGA 5IM0B 1VQNS 3TWZA 4CM2A 4USJC 3HM9A 4Q2MA 1ZM3A 2J8SA 2ACMA 1ZPVA 1UEKA 3UD3P 3JSYA 2LU1A 3VGTA 3W2VB 3PKMA 3CJRA 4RUCA 1HNZF 3NAHA 4W92B 1PAUB 2BJ1A 1EQMA 1RI7A 1ZETA 1S10A 1GMUA 3R7BB 2G9OA 4E2FB 2YX1A 4DV4J 3GP9A 2VC1A 2ATLA 2F4VJ 4HKQA 2JSXA 4GVLA 1N34F 8AT1B 3K2YA 3GPAA 1QLNA 2M0GB 5C24B 3PVXA 3TUIC 4WIIA 2P6SA 4TQRA 3R97A 1ZZFA 2YX4A 1GT8A 1JMTA 2BVZA 3EMTA 1SQGA 1RB0A 2L41A 3ETOA 4K4SA 3KJNB 1FRLA 3CF5Q 1D1UA 1FRMA 4ZMMA 4DXLA 1UPPA 5B0CA 1VGYA 1YJ7A 4Y2MA 2GHPA 2GO9A 2VFRA 2B9YA 4K59A 3GFZA 2BJEA 5KFVA 3V4IA 2XTJP 2C2MB 5KFDA 3KJVB 1S1WA 1WOOA 2B4UA 2PD1A 4KE5A 1Y4ZB 4TYBA 3G8SA 2IVFB 5L8RC 4HR2A 4URQU 4DL2A 1ITPA 2CJAA 3FQKA 1KLNA 4LIRA 4PWDB 2KT5A 3K5MA 3BH6B 4Q43A 3S7RA 1JLEB 3HSGA 1D9DA 2XBPA 5J1PA 2Q6BA 2B7BB 4NEZA 1N4LA 1WOPA 2DNPA 4NEYA 4DOZA 4AQYF 2VASA 2M5YA 1RTIA 2CZ9A 2P2CB 2RQMA 3QPIA 3ZC4A 4CDIA 2XC9A 3DGVA 3DRSA 1JNZB 2OMOA 4IH7A 2DTJA 2KKHA 5LM7E 4ZN1A 3RAQA 2BABA 1X31C 2E5LJ 4IH5A 3AFGA 3I0RB 4CCHA 1LWXA 2UXDF 2B9XA 4YFUA 4B3SF 4CNZA 1WSRA 5JXSA 4PZVA 3GMGA 4DX8H 5H9FJ 3DLEB 3DRPB 2ASYA 4QW8A 4QBUA 2XS5A 3QIPA 3DMJA 2GW8A 4DR2J 3P6YC 3GB0A 4QIGA 2QE5A 2AJQA 3LTOA 1R89A 4TQSA 5LSRA 2MKJA 3L09A 1YBUA 3LA0A 2H1YA 4X62F 4ICLA 2RHSB 5IWAJ 1S6QB 2RQ4A 4JI6F 1S77D 3GG0A 5DQHA 2HHWA 3CE8A 4IG3A 1MROB 3NP5A 4ZVOB 4ZJLA 3FVYA 5THWA 5KG1A 2CJKA 3VGSA 4Z2XA 5KOXA 1KHWA 4IH6A 2W7PA 3NWRA 1RDRA 4HACB 2MSSA 4OZ2A 4IRCA 3MM7B 2JDJA 4RNFA 2BANA 2VOPA 1ZA2B 2W2MP 5E3PA 2K7JA 5IQ6A 5HP1A 4ZCLA 1DURA 2CJ9A 2MQ8A 3NMRA 4ZCIA 3OFGA 4I56A 4KIAA 5HQLA 1AA1B 3JS9A 3M30B 3M30A 3NOGA 3N9UC 3H5YA 1UETA 1U1PA 5E0OA 2ASJA 1S4FA 2LQJA 5J1NA 5CABA 3TA1A 3TX8A 3C14A 1YITS 4UY8T 1WC4A 1T9VA 3F41A 2KL8A 1RWVB 3ENAA 4JI1J 4JI2F 2DHXA 4LRCA 2HHHJ 3GCWP 4J9PA 2OD4A 3CJSA 1D3WA 3PIPQ 2LDIA 3DHXA 1HQUB 1Q95G 2Z8QA 4OI6A 3D54A 1MWZA 1N52B 2MJUA 3RBDA 1UJ5A 1DQ9A 3CCLS 4YDDB 2BQ3A 1C0TB 3LUYA 3TW0A 1BQXA 4MAKA 4ZJQA 4DSEA 2OPPB 2PN6A 4NLQA 4NCAA 3NL0A 2DGVA 3RB3A 2IM0A 2LKZA 2J9DA 2NXUA 3SIPB 5JMNA 3AH6A 2J7UA 2WAQD 2HFNA 3HF5A 2ALYB 3M1VA 3CD6S 3CCVS 1XQIA 1PJ6A 4B08A 4B9MA 4UQGA 3H98A 2NQPA 2KZMA 1U24A 3W1YC 5F8GA 3VAIA 3ZTQA 4MH8A 2P6TA 3SDEA 1VIXA 1VQ6S 4YR2A 4FF1A 1B0TA 1G3OA 1WSVA 2HRTA 2XYHB 4QIFA 5KAKA 3W66A 4XPCA 1U1QA 3CIZA 4KH0B 5DGBA 2NR0A 2EKYA 3N28A 2DNKA 3MUTP 1RAHB 4RKUC 1UL3A 4H4KC 3W9JA 4DV5F 1URRA 1WKJA 3DU6A 4I69A 1RA6A 3C19A 3W8PA 2MZ1A 3QZ8A 3OUYA 3UCUP 3EICA 1S9FA 2P9CA 3SCKE 3P3DA 3R1HA 2OPSB 1M5HA 3UO0A 2ZVIA 3C15B 1SKRA 2BANB 3MDFA 1JLEA 1DTQA 1F1BB 4LRFA 4X4RA 6FDRA 1SC1B 1J27A 2WVBA 4C7QA 5E33A 2CG4A 2D9OA 1NSPA 3WC0A 1FDDA 4ZIVA 5F8IA 1FWKA 2CQGA 3NLCA 1NJWA 4LF6J 4CLSA 3GV7B 2VA2A 1M90T 3T41A 1NLKL 2E1PA 4DSKA 2G2YA 2BM1A 3SCIE 1SXLA 4F36A 5KFNA 1RWMB 3Q23A 4DQQA 1CQNA 3NG8A 1M1KT 2D3UA 2HBYB 2YQ1A 3M2RA 3KLVA 4KHPJ 2Z56B 4DPXA 3JTOA 1CC8A 1IKXB 5GMKa 4QR2A 1X5PA 3GZ7A 2MZQA 4CLLA 4DUYF 4CIOA 2VKZG 2RU9A 2F5GA 5DLGA 4CO4A 5CD4A 3PRDA 3VVUA 1ZAWA 1B0PA 2QFIA 4LRDA 2R8HA 3N5BA 2WRMA 4TY8A 5D78A 4DPTA 2IAJB 3F44A 1WOSA 1U1OA 4DS4A 1VOMA 5AXKA 2UVVA 3HT0A 4QYZK 1RT4A 1RT4B 1HR0J 1HNXF 2HPUA 1X7VA 1UP1A 3U1MA 1TELA 1TL1A 2Z58B 3OPKA 1ZM9A 2YH1A 4G6VB 3Q8QB 3I55S 5CZVA 4WFBQ 2X1FA 2OKQA 3TEGA 4C98A 1HWKA 3OL8A 1OO0B 4Q44A 4KPCA 4PR6A 2ZM6J 3TANA 3BSNA 4F4WA 3W2VA 3CUNA 5LMUJ 2HFSA 4OYXA 3C3LA 2BOPA 1FWPA 1H2VZ 3V5RA 1N8RT 1QTNB 2FLOA 3JQKA 4KJIA 4Y2CA 1Y5IB 1YJUA 1GEHA 4MKAA 3RTVA 2KJWA 4JI7F 3NNCA 4WE1A 1HHTP 2ZOFA 2E5HA 2DH7A 4LR9A 4NZ6A 2V2ZA 2YWGA 4MKVA 1LXJA 2D1CA 4YY3J 1RHRB 1AXQA 3MF5A 1RISA 2ZH8A 5J2QA 3HT3A 1S99A 1YQHA 2FGCA 4R25A 4L75A 3I31A 4USMA 5J1EA 1L5UA 2G2OA 1KKHA 2ROEA 1U4BA 3I0SA 1N5QA 2J9DE 3QSIA 4HT7A 4MK8A 2RJZA 3ZFVA 3OVSA 4ECWA 1NU4A 1N6QA 3CD7A 3GSDA 2Y1LB 4DSLA 2OSRA 3VQSA 4NL5A 1DFDA 1HYSB 4O4RA 2Q79A 3M32A 5E3QA 3UDLA 2XEXA 2AYGA 5F41A 1UAWA 1S5ZA 5LSLA 4HDGA 5KFGA 3M8PA 1HKAA 2EG2A 1EZZB 1S6PB 1YJTA 2PE8A 2N3OA 1S6OA 2UUCF 1HNWF 1YJ9S 2B8PA 2CVIA 2JZ5A 2Y1IA 4G1QB 1DRZA 4B3RJ 4DWIA 4CP5A 1JJCB 1ULRA 4QZVB 2X3GA 4ENOA 1KVIA 5EUHA 3VVTA 2VQEF 3DDKA 4CTAA 1JKHA 3SI8A 2GAGC 3T5LA 3HDSA 3M1VB 5CYQB 5CD4H 2CQCA 2MMYA 3OFEA 4IDKB 4UTGA 3RB4A 3Q8UA 1K0VA 4OHYA 4C3KA 3I0RA 1NM2A 3CMAS 4RBTA 1JLGB 2VD3A 4K8RA 2I6WA 2WTFA 2VJUA 5H9EJ 3HSZA 3PX6A 5C25A 1D9AA 4TYAA 2V4QA 2XMMA 3TVKA 3K5LA 4LSNA 3HCXA 3AD7C 2RSQA 3KK2B 1PYSB 1OYDA 4DG1A 3M6UA 2WK4A 2YH0A 3CO0P 3FEXB 4M5MA 2BMBA 2NXEA 3PFEA 1T0TV 2OPSA 2IM3A 2M2BA 5KFKA 3ITHA 2D3O1 3UFCX 2EBEA 4ECTA 3MCOA 2AQ4A 2GJFA 2LXUA 2E7WA 1FRHA 2ZC4A 1NZ8A 3BBCA 4HI1A 4RW4A 2V9WA 1S7IA 3F73A 1FFSB 1U25A 3D1OA 1F9EB 5AT1B 1HBMA 3Q8YA 5DDRC 3GYGA 5J2QB 4L73A 4NYOA 5KFIA 3H90A 3OR1B 4OV1A 2HWHA 3KG0A 5CYQA 4DF8A 4FNIA 1HWUA 1R31A 9ATCB 2HIYA 3FRYA 2IYGA 3LANA 3BSCA 3QIPB 1FJEB 2R7QA 1B64A 1X4FA 2VC0A 4I1TA 5D4LA 5KFXA 3HMJG 1S48A 2RE1A 2RMLA 4N56A 1WG5A 5DQIA 3V6DA 2C3YA 4NLVA 2QFJA 3PW5A 4G1QA 5CH7B 4ZLPA 1WG4A 1WHWA 4DR3J 1Z2LA 3DRRA 1CC7A 3DLJA 3MR3A 1ZM4A 2E9RX 2XMTA 4ZCKA 1HBUA 4WFNQ 2YTCA 4BCAA 5C42A 3RR7A 6AT1B 3BV8A 3KUHA 1P9YA 2GVDB 3C16B 5BYRA 1RTIB 1AUSL 4AFFA 1SKSA 1VRUB 1HD0A 3GSIA 1J5OA 3GCXP 5B0BA 4YR0A 4CO3A 3E2EA 1C2PA 2CNNB 4F2RA 2FHKA 1QSSA 1QY7A 1MU2B 2DNZA 4WZMA 4OI1A 1JLBA 5CCLA 1HWLA 1XNRJ 5J1EB 2BBEA 2HEKA 2RDJA 2WVDA 4ZP8A 3PW0A 3GFYA 2ZUAA 3KWMA 4NA2A 2RAQA 1S1WB 3Q8RB 2UU9F 3C2PA 3DM2A 2DNMA 3HHLD 1GH8A 2R3VA 1FERA 2XYGB 3ZZZA 1T05B 2AYBA 2NZ4A 2DEIA 1UMJA 1GNKA 2BA9A 4RW7B 4FS1A 1UA1A 2MZJA 4O4GA 1HNZJ 2ALZA 2LQ5A 5AXLA 3JSBA 2OP5A 3M7VA 2R8IA 4C8KA 5IT0A 1KN6A 2VPXB 3R5BA 3WX8A 4RW8B 2E9ZA 2LQ9A 4IG3B 3THPA 3HULA 5IT9U 2HQDA 4P7TA 1CJVB 3KHRA 1OSDA 1RHUB 1WTBA 2UUAJ 4ZVEA 4ILMA 1EHWA 2RT3A 2JLEA 2RNEA 2LEPA 1X4AA 2HFUA 4ED4A 2RDDA 1KEKA 4DLGA 4X2BA 3SMZA 3K59A 1S9EB 2RF2B 4JYAF 1XWLA 3MEKA 4CI0B 4KO0B 1E6YA 2MZSA 5HBMB 1R27B 2KXHA 2MY7A 5H1SV 4IOCQ 3FZ2A 3DGPB 3EPIA 3NBPB 3RBZA 2AIRB 1KLMB 4A4JA 3AAWB 2HVHA 2EC0A 3HSJA 4WFZA 3SZ2A 1Z1ZA 3N6MA 2HQFA 2GVDA 3C16A 3UN3A 4NLWA 1RU1A 1UVJA 1X9MA 1B0VA 2I2YA 1TVRB 4J9UE 1U1NA 4OX7A 3EXYA 1DHMA 2KFYA 2XB2D 4ZLLA 1C1CA 4KT0C 3UCGA 1UA0A 3PJ9A 2HLUA 3GIJA 2QX0A 1IBLJ 3CC4S 2DCUB 4FBUA 3MURP 1U8SA 3DOKB 2YQ0A 4ZP6A 1NPPA 5A6WA 1Y11A 3ILIA 4DX5A 1O6XA 2VBYA 3IWXA 3MCNA 5KFRA 4CLFA 2XSJB 3VZHA 2J8AA 3MMBB 1J5EF 4RUBA 2VU5A 2MSTA 2XZWA 3ISZA 5E5NA 3ILLA 7FDRA 2BE2B 2WOMB 4ECUA 1Q8IA 3AOBA 2BR0A 1C1BA 2V34A 3MECA 1IR0A 3O1LA 2B5JB 2PO4A 2F1FA 2K8GA 3CCTA 4Y2KA 1PYTA 2NLWA 2QT7A 3S6EA 4YS2A 4DV6F 2VOOA 3O3LA 2L3MA 4FF4A 5SUHA 3RBEA 1VJQA 1SL2A 4ID8A 2A3JA 8ATCB 1LQ9A 2CDRB 3DLHA 2OELA 3UDEA 3AQOA 2V68A 7AT1B 1VQMS 2JEGA 1FDAA 2UV8A 3KHGA 2CWXA 3FBCA 4LREA 1JXEA 2ADCA 1RT6A 4I7FB 1RWUA 1EETB 1IBCB 3IC1A 3QLHA 5L38A 2AJ1A 3EUNA 1AROP 1SL1A 1X4CA 4LQ9A 1A6LA 2H5JB 4IDKA 3UE2A 2DPJA 4KV8B 2R7XA 4OJGA 4TLQA 4FBTA 3QGPA 2JC0A 2YQ3A 3IXQA 3ZZTA 3ZZRA 5BR8J 4DN0A 1TKTB 2PIIA 4DV0F 4F4XA 4A8QA 2AJ2A 2LEAA 2QO3A 2V5HG 2W7AA 2EK1A 2PC6A 3DRYA 3GONA 3MHYA 4CO0A 4OQJA 1QE1B 3EZ5A 2QEXS 4B3TF 1VBYA 2X51A 2XZDB 3G8TA 3ZTOA 2F40A 1JWWA 1I51B 4G3IA 4P52A 2HHVA 2QLJB 4OJ3A 3W63A 2C2DA 3CD5A 3MEEA 1Q7LB 3NEKA 2GC8A 3PO4A 4OI0A 4F4KA 5HVGA 4CWBA 2XHCA 4DZDA 3K7RA 1T11A 1IR2A 1DY3A 1S12A 3DRXA 3ITHB 2PI4A 2WSFC 2DY1A 1DTTB 2YKNB 4JV2A 3PXGa 5GMEA 4WP9A 1HI8A 1IBKF 5IS2A 3UW1A 2VG7B 1IQZA 3MEGB 4DL5A 3MM8A 4JI5J 2NSCA 3DDIA 3HKWA 4U96A 4ZVGA 4JI4J 2OSQA 1RAJA 1V3ZA 4J9QA 2JJ4D 2WSCC 4OYWA 5K20B 1G2EA 4RR5A 2FUG9 5A8WB 4OYOA 2FJWA 1T9UA 3C8YA 2CQBA 1K8AT 3J7YU 2UVUA 2HFOA 3KLGB 4RW7A 2VPYB 2GZOA 2BEFA 2WB1D 3ZZPA 4RU2A 1PSDA 1AT1B 3PJXA 2A18A 5I4MA 2ZNYA 3BKFA 4ES1A 3NCPA 4CO2A 4J9NA 1X9WA 2CPJA 2NPFA 2H48B 5KFAA 4WXOA 5A8KA 5HSPA 4CTAB 3CJTA 1QTMA 1NK5A 3MEDA 1KQSR 3IRWP 4FXWA 3RYLA 3MMCA 4OFZA 3O6QA 3UDVA 1RKIA 4OIXA 3R9LA 3PX4A 1HI1A 1AW0A 1PG5B 3AY0A 2XCPA 4M95A 1XC9A 2DNOA 3RRGA 4LF4J 2F3JA 1IVZA 3DLGB 3LH2S 4Q7AA 2CYYA 2DEJA 1XIQA 1V5VA 3CDBA 4OX9F 3TP2A 5K8PA 2I5JA 2OPRB 3GV5B 3CCSS 4M8LA 1K0TA 1UVKA 4OZ1A 2PSZA 4DR1J 1WF1A 2DXFA 1YJRA 1EARA 3FMWA 1NUEA 1Q1KA 1S59A 2QSWA 2V63A 2LU2A 4WTYA 4J9RA 3FQLA 1YHQS 2HFZA 3GV8B 3M2UA 5KFUA 5IV3A 5LMNF 4ZPBA 3OV7A 3W60A 4B3RF 3PFOA 2Z2MA 3QT6A 3P4UB 2HHTA 5GAGU 4EBEA 3NS5A 5IT9Y 3R2DJ 2UUCJ 2VQEJ 2J0WA 2YXLA 4N5SA 4YMEA 1XMBA 2ASLA 2Y9HA 1IKVA 4W98A 4B3TJ 1BQNA 3R2CJ 5AJ3F 2BJ3A 3ZNJ1 1IXKA 3MM9B 3QO9B 3QGIA 5A8RA 3TZWA 3VAHA 2MQLA 3R3TA 5DRKA 5KG4A 2D3ZA 4USKA 3D6HB 4MIAA 1YRUA 1VQKS 3D28A 5C2CA 2EC2A 3RGIA 4RWWA 5IXUA 3MM6B 3IRXB 2QC3A 3CW2C 3CSKA 3NS7B 2QJ3A 2ZE2B 3MTKA 4MKYA 1RTHA 2N7YA 2ZD1A 1FKOA 2GHVC 5B08A 2DNNA 5C5JA 3KLFA 3GTYX 2DNYA 1IBMF 1KS2A 1CULB 4LSNB 4Q5VA 2RUGA 2AGOA 1RAFB 2YWFA 2ILYA 2DGUA 4CZCA 5B09A 3M2VA 4P7VA 4P74A 1S1VA 4J37A 4DPOA 2DXEA 1W2BR 5CXTA 3OVAA 2IMWP 3UI3A 1N0UA 1SQFA 4RBUA 1KOHA 3CEDA 3Q89A 4ID5A 2XMWA 3AOCA 5U47A 1HQEB 2WCXA 2WHOA 5GVQA 5T7LA 5A76A 5F8LA 5HBMA 1SL0A 4ECYA 1JJ4A 2VH7A 2YBVA 3CD0A 1GMWA 2JX2A 2YKAA 5KT4A 1S0MA 3CB4A 4ECQA 2HHQA 4J9KA 4LVOP 2RUSA 4L76A 3JTNA 4USIA 4Y3CA 3M2RB 4J91A 1O8BA 1X4BA 4R8UB 1U45A 2KT3A 2OLWA 4TY9A 4ALZA 2P9EA 1VHFA 2GFFA 2B51A 1D09B 5LL6d 5KFCA 5L9NA 2GCFA 4ANEA 2ZZTA 3T9NA 4PCQA 1UKUA 5G4DA 1SC6A 4F26A 1R8AA 4OYIA 2IRXA 4MFBA 3LWLA 1LV5A 2J0XA 3FDSA 2B43A 3NMAA 1HHSA 4B3MF 4B3OA 3T6BA 4RW4B 2CNKB 2K3IA 4NYZA 1SUQA 4ZJOA 5HROB 4A8KA 3B78A 2AJ0A 4C8NA 2CJBA 4QR1A 4M5GA 2QA4S 3B82A 3ILJA 4J9VA 3CCES 1SJQA 1YJNS 4P2XA 3A8IA 4OJ1A 8RUCA 1S9GB 4AXJA 1SV5A 3NGUA 1GMVA 5DETA 3JAMU 4R5PA 1MW7A 3M8QA 1HFEL 5D3GB 1SIWB 4M5DB 4QJVA 5F8HA 4OZ5A 1RWXB 4LFCJ 3JQJA 1KWMA 4DV7J 2MJNA 1S6QA 1TUWA 3DRRB 2JHEA 2IJFA 3QATA 1YBAA 5KFOA 4WK1A 5DM6Q 3CCQS 3GFXA 2GGPB 2CNLB 2CQIA 4LRAA 3J81j 1U1KA 3HSDA 4I6WA 4NZ0A 4FKXA 4F8RA 4V19X 2CFXA 2IMOA 2F8EX 1FD2A 2AW0A 1CQMA 1NMEB 4DS5A 2NCKL 1FJGF 1ZYQA 2AV5A 3X1LB 1N5VA 4LRBA 4WU2A 2R7WA 1T9WA 1U6BA 3UR0A 5JVGQ 2KH9A 2VIHA 2BW7A 4Q8FA 5T7LB 1BQMA 2CPFA 4J90A 1VJWA 4B9NA 3KKFA 3QRQA 3DGPA 2HQIA 3SYZA 4M5LA 5ETPA 1WI8A 2W24A 1CS4A 3FSYA 1RHJB 4QWBA 3KXDA 5LT5A 5EN1A 4Y0FA 5CZXA 3NNHA
chains in the Genus database with same CATH topology
3J7YI 5M2PA 3CPWR 2ZHOA 4ATNA 3POTA 3WDOA 4A8WA 3BO4A 1TL4A 3GR0A 4X4SA 1NJZA 1PGZA 4LF6F 2FHJA 3HO1A 3G8QA 1H98A 2ZM6F 3PX0A 4X64F 1LXNA 4D3HA 4RNMA 1VQ7S 5DDQC 3BZQA 3BDEA 2QZ8A 5EWFA 2BUNA 5SZTA 4I0WA 3HK2A 3SSQA 1KSPA 5JUMA 3DOLB 2DH8A 3NGKA 3H4BA 3PW2A 2MPUA 2JEFA 4HLBA 4KRWA 3VF0B 1N33F 2AYMA 3PIOQ 1M5SA 3C66A 1FEEA 3I82A 2LYVA 1NK7A 1RT5A 5J2MA 2M3DA 5LXYA 3L7PA 3T1HF 1X0PA 4ILLA 2HWIA 1RQ0A 2IA0A 3M2VB 2YKMB 5D6GA 2XLJA 2WONA 3X3UA 4RX6A 2IBKA 2ZKTA 2DGSA 3DLGA 5KFLA 4NLUA 2MQPA 1WG1A 2WB4A 4NYPA 2YVSA 4DQIA 1H6KX 5D4OA 3TYTA 3BB5A 5DG9A 4IRKA 1IJEB 3MMCB 2KXNB 3LQVA 4FN5A 5GAEU 2CZVC 3I0SB 3ZZ0A 3MCSA 2J0QD 1V3RA 2B4PA 1ZBTA 2D41A 1Y5LB 4JV0A 4ELVA 4PUOB 2KM8C 1NKBA 5KFJA 4YB1P 1LWFA 2IBOA 1UVNA 2RDIA 4C8YA 2A10A 1R6YA 4WE1B 2AGQA 4HTJA 3AJ2A 3PEJA 5DQGA 3IR5B 2OD6A 3PW7A 1WI6A 2I0XA 3TOQA 1HW9A 3SV3A 4U9RA 2XSFA 1CVJA 4EBCA 1GXTA 2ZBIA 3BSOA 5K8OA 4WFXA 2ZJRQ 1DTQB 4JUZA 3T9ZA 4IO1A 5A0YB 4MK9A 4DR6F 3MEGA 4ED0A 2EPIA 2DCLA 3I5BA 4C9DA 1F2GA 1JNRB 3DCAA 4QPTA 3QYYA 3KOAA 4F3QA 1FO1A 2G13A 4UY85 3SEOA 3OLAA 4EEYA 1RT3A 3LW5C 1RTDB 1CG2A 2ZITA 1WF2A 4R8UA 3O2IA 4YUDA 5D77A 1VQPS 1Q7YT 4DSKA 4ETZA 1OWXA 5AXMA 1VS3A 2R7RA 2CQPA 1XMQF 1NH7A 3NGDA 2KYXA 4JI8F 4C11B 2J6SA 3IGVA 4IQXA 2DISA 2BQUA 4KAIA 2JFDA 1WHVA 1QVFR 2Z4PA 2PDAA 3MI7X 1XN9A 2NUHA 4NLSA 1FT8A 1H2TZ 2MYFA 2IHR1 2Y0SD 2J9EA 1L3UA 1S76D 5DG7A 4JI5F 1D8ZA 3BF4A 2XY7A 2FJEB 1CSJA 3DLBA 2K7KA 1SUQB 3D1QA 4O3NA 1R0AA 3BJYA 3LP2B 4KR0B 5KFWA 4Z37A 1FRIA 1NK8A 5B0GA 1LWCA 1O51A 3FCHA 3GYXB 3TNVA 2LA4A 1Q16B 3OTDA 4WKYA 2ZNZA 2QA4G 1VLYA 4DFJA 1VRTA 1G7CB 4ZPWR 2R7OA 4FVCA 1C1BB 2ZUGA 3JSMB 4NLOA 5K8MA 2VFSA 1FVSA 4I2PB 4I64A 4ZPDA 3DLLQ 3AHPA 2I38A 1ZTWA 2R7VA 2KRBA 3CC7S 3MM9A 3QO9A 3VR1A 3IS9A 2E5GA 4C0OC 2HNZA 1UFWA 2VFVA 1FF2A 3VAGA 3N01A 5L39A 1VC5A 5HMYA 4DL4A 3JYTA 1ZOTA 3AA9A 3O5TB 4LF4F 3CJ3A 3I32A 2C22A 5B0FA 3V81B 2EK6A 2IC3A 2B6AA 4HTIA 1P8GA 3TA0A 1JLCB 2VQFF 3RAXA 1NJIT 2ROPA 2X1GA 5MLCV 4Q0BB 3HXMA 4N8NA 2HNDA 3O44A 5HO4A 3BR9A 2DB1A 3KLFB 1FRJA 4YEAA 2MGZA 1RT1A 2JVRA 4I68A 1I94F 3JAMY 2LCWA 4DFMA 5HLFA 4K4TA 1YG0A 2HLTA 3LWMA 2DR5A 2MQNA 3KJVA 3I5CA 4E98A 2SXLA 3G6VA 5T41A 1HMVB 2O01C 1S1XA 1FJCA 4MIBA 3I96A 5HMXA 3OL6A 4B9UA 4PUOA 1LK7A 4HI2A 3SFUA 3SFGA 3BN4A 4QIEA 4ZP9A 5EGYA 2FJBB 2DR7A 3MD3A 1P1LA 5DDOC 5D4NA 4PPZA 1A7GE 1HBOB 1T05A 2KFZA 1C4CA 4KB7A 2L9DA 3QWPA 2VV5A 4B9LA 1DTTA 1JLFB 2RRNA 2YKNA 2ACYA 4A8OA 1B7FA 2Y1RI 4QPXA 4I2QA 4NCBA 1NAQA 4RNNA 1VQ8S 4BWMA 4IOAQ 2YNIA 2M8HA 4CH0S 1L3SA 3N6LA 3KK3A 2FLPA 3HHNB 2GO8A 3DXSX 3CXCR 4FXDA 4BC7A 1S9EA 2RF2A 3FFIB 4XK8C 5DGAA 1T03A 1UVLA 1KC8T 2YNHB 5A2QY 3V81A 1DQAA 3GR1A 3OTEA 1QAJA 4DN9A 2R4FA 3TUZC 4LF7F 5EX0A 4RUHA 1C0UA 2AYEA 2IJNA 2DR8A 5B0AA 4UUWA 5KFFA 1GTEA 3KMSA 1N0VC 2X1AA 4F4YA 1TK0A 1N54B 1R8PA 4X4UA 1OQ6A 4A48A 3CJKB 1UJ6A 5A8RB 4Y2AA 4F02A 3DXBA 4DFPA 3VQTA 1NRKA 3BREA 2DT9A 4Y00A 5KFMA 3BSAA 3BQ2A 1K73T 5DDPC 1F9FA 5KFEA 3AB4B 3I5AA 1YGYA 1ZAVA 5E41A 4DV7F 4DUZF 5LSOA 3I87A 4H54A 3AQPA 4PXBA 2EFVA 2PI5A 2GMHA 2XNQA 1MROA 2XMVA 1YJWS 1HBUB 3SV4A 3TO8A 2MQMA 5GAEI 2QA1A 4KSEB 3E51A 2CPDA 1ZPWX 4JOUA 2QMXA 1KFSA 4NXMF 1TL3B 3IWNC 1UW4A 3CJ5A 1WEZA 4RLEA 4N76A 2YWEA 2RD5C 3BQ1A 3PNIA 2LXFA 4LVNP 4C3MA 1KLMA 1Z4UA 4FVMA 3T5JA 4FZVA 1HYSA 1X4EA 1P9QC 2OAUA 1GX5A 4OLOA 1S6PA 3ENWA 5CYMA 4XAKA 1WWHA 2EFNA 4J9LA 4FF2A 2R7UA 2OH2A 5DLFA 2FTRA 4YB7A 5MAOA 4B9VA 3P5TL 5E2QA 1JLFA 2JOQA 3WBZA 2W9BA 4OZLA 3QGHA 2GQCA 1WEXA 3HHEA 4IFYB 3PR5B 4WJBA 1HA1A 2R2SA 2Q43A 4GKKF 4FYDA 1OIAA 3EGZA 3HHDA 3VALA 4W90B 1RYRA 2KB2A 4BBYA 3SXLA 2FJXA 3VAMA 2E1RA 3DYAB 4ED6A 2VBWA 1JLGA 5KT3A 1S1XB 2R2UA 2PFFB 5B7WA 5ADZA 3ENQA 1LW0A 2HHPA 1TVRA 2UP1A 2D7SA 2FD2A 1KQKA 3I9ZA 1IKVB 3CJ0A 2O67A 3DMJB 2XO7A 1JJ2R 2DNGA 3MWBA 2HGMA 4QYRA 2RQKA 3HHLA 3BGFA 1F5CA 4PPDA 1CEZA 4EYIB 1TP7A 4OI3A 4TXSA 2IFXA 5F0WA 5GAHU 4F4ZA 4ZA1A 4XDDA 2K2PA 2CJQA 2LDYA 2V4JB 3CDUA 4R0JA 4DQPA 4X4QA 3B4MA 4KO0A 4YOEA 1RT6B 4I7FA 1FRXA 2H9ZA 1XERA 3E3XA 4X4VA 4RUAA 2EG1A 2L48A 4QWAA 3HZGA 4MYTA 3K58A 1VQSA 2RQCA 4RW9B 2W9CA 2G4BA 1QAYA 3HI9A 3WZ0A 1I1GA 4DR4F 3PHEA 2E5LF 3JYTB 3HHLB 1G1XA 5L1JA 1YRTA 2IVYA 2ZE2A 2M52A 4IO9Q 3B8HA 3MECB 3R5DA 4KFBA 1X5OA 3KFWX 1X5SA 3J80Y 2MKKA 2BJDA 2RIJA 4JI1F 1TAQA 3D2WA 1KONA 1KQFB 5GADI 1SIZA 2LQBA 2POKA 3DHWC 4A8XA 1X4HA 4C0HA 1JX4A 2VG5A 1FDBA 1XEZA 2EWHA 2V8HA 4WFAQ 1HMVA 2E1MC 2GJ2A 4M63A 3OLBA 1FK9A 1V9OA 4U67Q 2DNHA 4YR3A 1WHXA 2I9SA 2KU7A 3EGNA 4E8UA 3FNNA 4ZVFA 3IO1A 1IQTA 1VBXA 1J2VA 2MZRA 3M9MB 4EWTA 3BM7A 1RGVA 4DQRA 1LWEA 3K5OA 4C3LA 4C8ZA 4Y34A 2PEHA 4H4KA 3QJJA 4ERDA 2HNDB 4O3OA 1HNIA 3HHLC 4RZRA 3PW4A 3D5MA 3OHBA 2DK2A 3MEDB 4B17A 4LMZA 5K8NA 2UVRA 3TVYA 2ZKUA 4WCEQ 3IS9B 4K50A 2C28A 2CQ3A 1S0NA 1D8YA 2W9AA 3E8OA 3HP6A 2LMIA 2N7CA 3MMJA 3CJ2A 1M5VC 2Q66A 5I42A 3CDEA 1PC4A 2FJAB 4ITSA 4O44A 3S8SA 4J9OA 1DQ8A 2OPPA 3IG1A 1K9MT 1VQ5S 5DS7A 4ECXA 1R8BA 1HR0F 2HMIB 1S1TA 3LP1B 3FMBA 3V2UC 4ZS6A 4H4OB 5LMUF 4HDHA 4OLPA 4ECZA 2XMUA 5A8WA 1I6JA 3BGUA 1XK8A 2KDOA 3VCDA 4MTPA 3KK2A 2EI5A 4XO0A 2GIQA 2RKIA 2JVOA 3Q22A 4IFVA 2GMJA 4XIUA 2QLWA 2AF6A 2BACA 3FEYB 3JSMA 1S49A 5K9FA 2ERRA 4DQSA 1S79A 2W9BB 1VIOA 4O3SA 4HVZA 3EYZA 1RT1B 3HVRA 2UUTA 3KMQA 3THVA 3GE9A 4DG1B 1TV6A 4NX9A 4K4XA 1S1UB 3VTIA 1LWCB 1YIJS 2EFQA 1VI7A 1J5OB 3CMES 3M8RA 2FGOA 3F56A 4OHZA 4OHVA 4PRFA 1V6HA 5K14A 3G96A 2DRAA 4LFCF 2HMIA 2BV3A 1LFPA 4QU7A 1GXUA 1FEHA 3J7ZT 4GC7A 3LP0B 3LP0A 1Q82T 1X0FA 3BGRA 2FLNA 4O3RA 4A8YA 3KLIA 2DIUA 4RWXA 4ZPAA 3QJPA 4YB6A 4QYZJ 1HQUA 2HNZB 1LW2B 5I3UB 1FXRA 4P2SA 4ZKAA 1HNIB 2VA3A 1HARA 4HT5A 1JIHA 1JLAB 3IBWA 3O8WA 4N47A 1HBMB 2ADBA 2YNIB 2B7CB 4PG6A 4ZK7M 1FKAF 3MAQA 2HHXA 3RW7A 3KLEA 2DGWA 5B0EA 2BZ2A 5FD1A 2WSEC 1XTZA 2WBRA 4UQTA 3L3CA 4TNOA 4K4WA 3S1TA 2MZTA 3CJKA 4DF4A 4FF3A 3J81Y 2RILA 1FKOB 2HIQA 1VQLS 5KT7A 4PWDA 2KFNA 2DBBA 3RU0A 2FPHX 4RW8A 1F0XA 1JK9B 2IRYA 4NRTA 1HPZA 3UNGC 4TU9A 5E3CA 1PILA 2BRLA 4X4PA 4K2XA 1KNZA 1VK3A 1PO6A 2ZBCA 1NKCA 2MB0B 3HJFA 1HI0P 4LUBA 1HW8A 2QV6A 2BM0A 4MMOA 3KNAA 2DHAA 3Q2TC 3NAIA 2HGNA 2APOA 1RT7A 2HGLA 3KG4A 3H4DA 1NJXA 1TL1B 4ETXA 1Y5NB 3H8YA 1JKHB 2CVEA 3H5XA 4MKBA 2DGOA 1JLBB 1N56A 5HMWA 1DBDA 4YY3F 3KLEB 3BO3A 2FIUA 2GQQA 5GADU 3KK3B 2KI2A 1OPZA 1N5YA 1UWBA 1UWBB 2RB7A 2YX7A 3M2UB 1RT3B 4I4BA 3PZPA 1P6TA 2C42A 1RTDA 3DLHA 4DL0C 1DZ5A 3W2WA 1E6YB 1Q78A 2XGQA 1LW2A 2J7WA 2UZAA 3H2LA 4AXIA 5I3UA 3V6KA 1TK5A 3DOLA 1FD8A 3VZIA 1AUDA 2MKSA 1WACA 2YKMA 4CNYA 1IKYB 4OHXA 1RT7B 1FXDA 2XMJA 5LJ3Y 4Q8EA 5HQ8A 4IYQA 2GGPA 1DJ0A 3A1YG 3PM9A 2JEIA 3S01A 2KZZA 4LJMA 3HVWA 4EZ9A 1MSWD 5EDWA 4QIVA 1KQGB 1OPIA 3MM6A 3N4WA 1EP4A 2EFOA 3IA0A 3ZZOA 5DM7Q 4DR5F 1NHVA 5KOWA 3OR1A 2C3OA 2RRAA 2YNGB 5G0RB 2ZH7A 1S0OA 5L1KA 2CPXA 3JB9k 2D3OR 3BN7A 2QIFA 4K4YA 4QWCA 3MPVA 2XMKA 2AJ4A 3CDAA 4JI3F 2VBZA 4A46A 2D74B 1OS5A 3K8WA 3OFFA 2M8DB 1R43A 2AWZA 3SCJE 5ITHA 3VAKA 3CVKA 4ED8A 4F2SA 3DU5A 3V6JA 2ROGA 1IJFB 4MFBB 4B3OB 2ZH9A 3POTB 3MM7A 2DPIA 4E0DA 2DIVA 2I8EA 3MM5A 3SSSA 1N5SA 5CYJA 4KGMA 4KTQA 3OL7A 2KTQA 5C24A 5LJ5Y 4AL5A 2PMZD 3I4HX 4BHQA 4Y65A 3RW6A 2YKPA 2YY3A 2C3UA 2FVSA 2ZH2A 4ZPCA 4DBQA 5KG5A 1SJ4P 3RRKA 1Q53A 2EW9A 2EFGA 2K1RB 1JLAA 4LF5F 1S7HA 2KT2A 3OSPA 3LO3A 1BQMB 3M05A 5FDLB 2YKOA 3PY8A 2Q1LA 2J9CA 3D0IE 3Q0AA 3OL9A 2XG8A 2A2DA 2VG6B 2VG6A 3RZAA 5LXRA 3DLEA 3DRPA 2KG1A 2HHHF 1XNRF 2V8GA 4CH1A 4OMFG 1T02A 4KV8A 5KFBA 2CPZA 3G86A 4RW6A 2W25A 3GIKA 1HWJA 3P96A 1GAOA 4HH0A 4KHRA 3SSRA 1U2RA 4NWBA 1KHVA 1NK4A 1RT2A 4O0IA 1QM9A 1V3SA 4KQZA 1NKEA 3DYAA 3OXGA 2R2RA 2E5IA 4C8OA 2W4DA 3MOZA 2U2FA 3BS9A 4EUVA 3TAQA 2HHUA 1AFJA 2W4PA 2B3TB 1UVMA 2KN4A 3MD1A 3VWSA 3MPWA 1S1UA 1KVJA 2X1BA 2Z2LA 2CIMA 4X4NA 3BGLA 2VG5B 3UDCA 3IRXA 4OL8A 1X9SA 3HHKA 3GFHA 2VZ9A 2VKRA 1HNVB 3NS6A 1RT2B 2WOMA 2BE2A 1SH2A 3M6VA 3HKZD 5M2UA 3G4SS 2W8LA 5GAHI 4B9SA 2J7KA 2V2KA 2JLGA 4C2MA 1NK0A 2JLFA 2O5DA 3FSIA 3EX7B 2G0CA 3CCRS 4L6V3 1L3TA 5JJBA 1QAIA 3KYLA 2O3DA 3CO9A 1FTRA 2FHMA