4K0KO

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4k0kO00
2Z0AA 1HNXO 1AILA 4JI4O 4DV5O 1R6TA 5LMUO 4B3MO 2UXBO 1XNRO 4DR7O 5BXZA 2DJVA 5IWAO 4JI2O 4LF7O 2LW7A 2HHHO 2ZM6O 4DUZO 1D2DA 2N74A 2UXDO 4X65O 2UU9O 4DR4O 3OTOO 1FYJA 4JI1O 4DR5O 4NXNO 4KHPO 1AB3A 2UXCO 5IT9N 4OPAA 4JV5O 5FLXN 1IBLO 4JI5O 1FJGO 1F7YA 4DR2O 4DV4O 4JI0O 1J5EO 4B3TO 1R1BA 1N34O 1YZBA 4YY3O 3SDLA 4B3RO 1XMOO 4OPHA 4LF5O 3O65A 4LFBO 1I94O 3J7AU 4JI7O 2VQFO 2UUCO 4AQYO 5LL6Y 4JI8O 1G1XB 1A32A 4YHHO 4GKKO 4GKJO 3J80N 5BY1A 1HR0O 5LMNO 2FKXA 4LFAO 2UUBO 1XMQO 3R66A 2VQEO 4X66O 2F4VO 1IBKO 4LF6O 1N36O 3JAMN 1XNQO 3RT3C 4DV6O 4DUYO 4DV7O 2AGAA 1DK1A 2DOSA 1N33O 5H5NA 1FKAO 4LF4O 1X59A 3M8AA 1KUQA 1XEQA 4OX9O 4DV0O 4JYAO 2ZKOA 5A2QN 3F5TA 5BR8O 4DV1O 1HNZO 4LF9O 2JRIA 4JI6O 4DR1O 4DV3O 1HNWO 3T1YO 3J81N 4DV2O 4DR6O 1NS1A 4JI3O 2UUAO 1N32O 2E5LO 4X64O 4K0KO 4NXMO 4X62O 4LF8O 4DR3O 1IBMO 4LFCO 4A5UB 4B3SO 3T1HO
chains in the Genus database with same CATH superfamily
1NR7A 1JR9A 3SYQA 2Z3YA 2ILMA 3JAKA 1Y76B 4AI8A 3HKEB 3TK1A 5CBGA 2BSKB 2Y4TA 1JX9A 5KUMA 4B3TB 2LJ2A 2ETNA 4JI2O 1XL4A 4I5SA 3L74H 4J80A 3AG1B 2QJ1A 2UUCB 1JJOA 4IYIA 1AB3A 3CE2A 3HKBB 3S3XA 2Q8VA 1F7YA 1KBHA 1RM1C 2A06H 2CH7A 5KHGA 4LF6B 4OPHA 5EIBD 4LF5O 4PA3A 3J7AU 3M7MX 3OEHG 1YVWA 3K5OA 2VQFO 4H44B 4JYYA 3WB1A 2QKCA 3X2QB 1HR0O 5LMNO 3VQWA 3R66A 4X1YB 4X66O 2UXBB 1NH2D 2AZ2A 4F6RA 1TAEA 3ZCCA 2R9AA 4MVZA 5LP6A 1H8EG 3RGBA 2AGAA 3TCUA 1UFIA 1QR8A 1N33O 5H5NA 4MTXA 1AI4A 3ZIAG 1DF4A 3ICXA 1OCZB 4OGQB 3P32A 3T1HB 4MS2A 1AI6A 1LR1A 4N23A 1NKDA 1OCCC 3H1LH 1H2KA 1UJWB 4UFZA 4H33A 1YJWV 1N34B 2DQ0A 1VMGA 2EINB 5IE9A 2ITCC 3OAAG 1QVGU 1VQ8V 1Z2GA 3NXSA 3K04A 1NT2B 1H2NA 4C7UA 1BGYH 5EBLC 1H2MA 4O4HA 5IJ0B 3EXAA 3RWRD 1NH2B 1ZLZA 3G71V 1AILA 3HKDA 3EVKA 2Q68A 4GZRB 1IBKB 1MZEA 3IC7A 2Y69B 1VF6C 4JZ2A 4LF7O 1O9HA 2Q4PA 2OT5A 2R70A 2DYRB 2ZCEA 4RO2A 4PHZA 1US6A 4IHJA 3QO8A 1KKDA 4Z2WA 4EB6A 5FLXN 2R72A 2HR3A 4O2BB 3UT5A 1K4DC 2ZT9B 4GYCB 5GTIZ 2XT9A 1E1QG 4UB6Z 5BR8B 1HNZB 2ZE8A 4DR2O 4DV4O 2DN9A 2Z5UA 4HNAB 4U3JA 3LSSA 2R9IA 4FLZA 1TUEB 1Q7YW 4YJ2B 1BS3A 5ITZA 2IJHA 1BZKA 1R3JC 2H8PC 3AG1C 3DTUB 3W7TA 5B1BB 1JMKC 1PKXA 3M99B 3G4SV 2WSSG 2XAQA 4JTAB 1VEWA 4WFHA 3WG7B 1AJPA 4DR7B 2P4VA 1M9NA 2HKOA 2KG7B 5EBWC 2ZM6B 5KLVH 3F7VC 3KZIZ 3A8TA 2X6AA 3CRQA 4QNHB 3K06A 3X2QC 3M8AA 3VQYA 2KSDA 4R8CA 1WN7A 4F4LA 1RSOA 2WLNA 1JFFB 3FD9A 5A2QN 4UCSA 3E35A 4P9PA 1FS0G 4UXNA 4NTYA 3BAAA 1N0JA 2OIGA 3AEIA 2H3OA 5KHHA 3F7YC 1FFXA 2X6CA 1EFRG 4ZI7A 1HWYA 4TV9B 4OXSA 4UVBA 3I55V 3CD6V 3LUTB 1Y76A 1VQNV 4DV5O 3HKEA 2UXBO 3ABKC 2MW2B 2LFSA 4GX5A 5EK0A 2BSKA 4TQFA 4WFGA 2KB1A 2LFRA 1R3KC 1P4RA 2BTQB 2Q9LA 2N74A 1P84F 4TUYB 5LHIA 3RFRA 4YHHB 1Q86W 3HKBA 4B08A 1IBLO 4WCEV 1TGOA 5KMGA 2Y69C 4BR6A 3VQXA 3ZHUA 1N34O 2BOBC 3MD0A 1F23A 1WA8A 1SQGA 3OR6C 2ZDIC 4O2AA 2FTKA 4PA4A 4NXMB 1NVPD 3D36A 1OCOB 2CTQA 5LL6Y 1G1XB 2LGWA 1IBMB 5TISZ 1PPJH 2ZNIA 1N8RW 2Y4UA 1IBKO 5KAIZ 4I9WA 3CRMA 1HP8A 1MMMA 3ZS8C 3B2EE 2XHBA 3AG3C 2PI4A 2UU9B 2EX3A 4X9QA 4JI1B 5KHIA 2UXCB 1RPOA 5DN6G 2HVJC 4X88A 3IFXA 3ZN0A 2JS5A 5BR8O 1HNZO 2JDIG 1FFTB 2BE3A 2DMXA 3MDSA 1J5EB 4LR3A 4B3MB 1LNQA 4U7NA 4PI2A 2YIAA 1KECA 4KUMA 3E89A 5IJ0A 3QTCA 5CA1A 4MVSA 2QKAA 2ZE5A 1EN6A 4DR7O 2GDSA 4BIOA 3SJCC 2LQTA 3JATB 4J9YB 1UPGA 2HHHO 2ZM6O 1D2DA 1NTZH 5EC1C 4NB5A 5JH7B 4DR4O 5JWPA 3ZRVA 4O2BA 1DGSA 3B8NA 1NQTA 3JAKB 4N21A 1RPRA 4RQFA 3KKYA 2EIKC 1K9MW 3CCLV 4HNAA 5JCOA 3H1HH 4MSWC 3T1YB 3SDLA 2ATKC 2F1MA 4YJ2A 4XBFA 1KD1W 4JPRA 1S72V 2RQ6A 3N2KA 2YXHA 5KUKA 3OD4A 4PDRA 2FKXA 4UCVA 4TOIA 3HB3B 3WU2Z 4AHCA 2CH7B 2QKSA 5LBQA 2HJDA 3RT3C 1T5EA 4H37A 4EFBA 2KG7A 1ZWIC 1GMGA 3PN1A 2JGDB 3CWBH 1VQ6V 3F5TA 1K5SA 4O4IA 2BOCC 1GKFA 4F6RB 4JAAA 3IC9A 1K4CC 4X8AA 2OTLV 1K34A 4JI2B 5C93A 3A0HZ 4NXMO 2Q0OC 1IBMO 3CC7V 1SQPH 2B9ZA 1SERA 1V54C 3CCEV 1FAFA 5B1AB 3E8BA 5LGNA 3K9AA 1QLNA 3TGUH 2Q69A 1YSCA 5LA6B 4FFKA 4EKWA 1ZX3A 3SYCA 4LC1A 3K59A 1IURA 2BTQA 4LF5B 3AK1A 2LO1A 2UU9O 4TUYA 4DW0A 4JI1O 2UXCO 4PJ0Z 1G8MA 1HR0B 3CC4V 4KXRA 5KA6A 1B06A 4CH6A 3HKDB 2YUAA 5LXTB 1J5EO 4DR1B 4X66B 3OW2U 2JGUA 3D3IA 2RJZA 1BE3H 4UVCA 4CC6A 4LP8A 3DC5A 4GLXA 3OUSA 1SF9A 3OGCC 1MSWD 1QQCA 3PJSK 1KB9F 4LCUC 1JVMA 1W2BU 4G28B 1JPXA 2QWRB 1V9PA 4AILC 3JYCA 4L8JA 2F66C 4FVMA 3VOUA 4I0XB 4NXNB 1KUQA 5IY5B 1R6KA 2P90A 3I56V 4JAUA 3A0RA 3P30A 3ASOB 5KHJA 1HNWO 4Z1MG 3T1YO 2RCVA 1AJQA 4YIPA 3FB6C 4LF7B 3E22B 4LH7A 3ABTA 1K7DA 1I5YA 1KP3A 1H8HG 4I55B 2VWJA 4LF8O 5FPOA 3K9SA 3SJAC 5E79Z 2WLJA 4PDLA 4UCUA 1FXKB 1RSOB 2EIMB 4DR2B 4DV4B 5DEDA 3BY6A 1D5NA 1XHXA 5LP6C 2L35A 3SYPA 2CTRA 5JH7A 1U96A 4WBNB 2EJRA 1GN2A 4OX9B 3JALB 1H2LA 2JEUA 4LF9B 5B1AC 2OWOA 1NTMH 2ZXWB 4JI6B 1QLEB 3JCUZ 2Y48A 1XREA 4RWUA 1XI1A 1JCHA 1VQ9V 1YXBA 4Q6GA 1S0VA 3LDDA 5LHGA 2IU0A 3IGAC 1XQ8A 3SPJA 5GW7A 3DGEA 5KMGB 1XBLA 2CGOA 1JOYA 1NI8A 2A3QA 4GT1A 1WAZA 2RDCA 4D7SA 5FPRA 1WA8B 2QWNB 4FK5C 4O2AB 1TA8A 1W59A 2EJ7A 4PELA 1L1FA 4ASUG 2WA4A 5KX5A 4JYAO 2JGDA 1SQFA 2E3CA 2Q73A 2XAJA 3JSLA 1OCRC 4DV5B 4DR1O 1DLBA 3KCXA 5IYCO 3D8CA 1YTFD 4JI3O 3OR7C 2VWKA 3DXRB 2PUSA 1DF5A 4I4TA 4QPKA 3OEEG 4HYOA 2Q5ZA 2GSMB 4TV8A 4LFAB 5KA5A 1IBLB 1Y4MA 2P06A 2A79B 3ASOC 1GN4A 5IDJA 5LA6A 2AHYA 1V55B 4DRXB 4DV7B 2FMLA 1E79G 3RBZA 4NXNO 5B66Z 1PNKA 1WP7A 2QTOA 2IM9A 4ZIBA 4LH6A 3E8FA 2C2AA 1WJZA 5CA1B 4DV1B 1LUVA 3GWOA 2NLJC 1YTFB 1IDSA 5LXTA 1EZVH 2WLIB 1MA1A 2ZR2A 1Z5VA 3BVOA 1W0KG 3B40A 4ZBMA 1SESA 3W7UA 1YIJV 1P7GA 4JASA 3APOA 2JEXA 4FMTA 3FB7C 1BHAA 4KP4A 3ML0A 1SKVA 4JI4B 3SJBC 5LHHA 2WLHA 2ZNJA 2F4VO 2OCCB 3H01A 1B6QA 1SQVH 3SPIA 4J7ZA 2OIEA 3SGIA 3A0BZ 1QNMA 3CXHF 1EN4A 1KU9A 2IH1C 2HP8A 5L3GA 2ZQMA 2XUMA 1L8DA 3N2KB 4I0XA 5CBFA 1VQ7V 4OX9O 5BZBA 2Q67A 4LF9O 4U3FH 4JI6O 5FNVB 4I7ZB 4WFBV 3RVZA 3L9DA 4BWAA 2UXNA 4DV3O 1AP6A 2QM4A 1YDXA 3BCCH 4QE9A 1GM7A 5C8YB 3VQVA 3E22A 3G6EV 1GRJA 4TQDA 2HHHB 3A2FA 3D36C 4I55A 2PTMA 4R6ZA 4JI8B 4DR4B 1K73W 1P49A 2HJFC 4NTWA 3ETEA 1G6UA 3UQ8A 3MHHC 1CXZB 1FXKA 3G6BA 4RUEA 2FL4A 4O4IB 2G38A 4UUJC 3K5MA 5HFMA 1XL6A 3BRCA 4KFMA 2GBOA 2DQ3A 2EBOA 3BA9A 1KQSU 4DUZO 1GAXA 2NNUA 2GV9A 1VARA 1VQ4V 4CH5A 3CCRV 2IBZH 1OCZC 4I50A 1I5XA 1Q5OA 2ADQB 3UKMA 3ZX6A 4WBNA 1SQQH 2PY5A 4FZ1A 3JALA 1MZFA 1F51A 2W0FC 5J9PC 5EIBC 4JGSA 1KYOF 3UCSC 3JD3A 1M90W 1Y67A 2EINC 3AG2B 3ZEDA 1V55C 4MTOA 1CEZA 2RMKB 1BHBA 1D5AA 3EHBB 2Q7GA 1Q6UA 2YC0A 4O4JA 5F2VO 4LFAO 3JD0A 3ABUA 1XHZA 1QBZA 3QG5A 1GH6A 3ZBHA 1SZXA 2E75B 3N2GB 3CCJV 4BAYA 4GCZA 1KP2A 4QGPA 1NR1A 2DW4A 1XNQO 4RUFA 2YIBD 3SYOA 2O57A 3GWKC 4K35A 3UO3A 4DV7O 2DYRC 1B3QA 5K1XA 3OE7G 3JASB 1OZ0A 1GN6A 4MVOA 5H6QA 2GUZA 2JK5C 4KHPB 1XEQA 2ZE7A 5CN0A 3R65A 1YJ9V 5JVDB 4JYBA 4DV1O 4GUNA 2OCCC 2RN9A 4PDVA 2DYSB 5CMUA 5JCOC 3O9OA 1MABG 5L3BA 1FXVA 5J2TA 1WPXA 2F43G 3DXRA 2E5LO 2X0LA 3K0DA 3L70H 4DYLA 4K0KO 5B1BC 2PYJA 4IGGA 4GKKB 3ABLB 1ZUQA 2Y0IA 2P67A 1F4NA 2XAFA 1BL8A 4JI4O 2VQEB 1G4YB 4J7JA 2YIDA 3WG7C 4UVAA 1Y66A 2QA4V 1Q82W 4X1KB 2DJVA 1NVPB 3ETDA 3U11A 3W7WA 1S77D 3BA8A 3GB7C 3BEHA 4DRXA 3LDEA 2N05A 2JJ1G 1AI5A 1R73A 1Y6XA 3JD1A 4DXWA 1ZTEA 1SC5B 1CP9A 2WLLA 2EIJB 3CCQV 1VQOV 3CS5A 4TWKA 5IYZB 1MNGA 1Q6IA 4JAVA 4MVMA 2WLIA 4B3RO 4LFBO 2UXXA 4L87A 3CRRA 4JI8O 2Q7HA 4LNUA 2B1IA 4PA6A 1WB7A 4B3SB 4JTCB 5BY1A 3ABMB 1FPOA 5K1PA 1WLEA 4Z1VA 3L73H 2UUBO 2WPDG 4J9ZB 2QM8A 1AP5A 2V1DA 1HNWB 1Q90D 4FFBB 2FYUH 3SPGA 1K97A 2QDOA 3AK3A 1FKAO 5D5QA 1X59A 4LF8B 4P9OA 2D3OW 5GONA 3JARA 4R50A 5H6RA 3HKCA 3CXCU 4MW3A 4XDJA 2LW1A 5FNVA 2XAGA 1E1RG 4WFAV 1R6NA 4YY3B 4DR6O 1AI7A 4GX2A 4J7KA 1YEWA 5C8YA 1VQKV 1XDCA 1H2GA 4H0LB 3TXQA 1OCOC 4X62O 3QO5A 2WWWA 5KX5B 1HNXO 5KAFZ 4GX0A 1AJNA 1YITV 4MW8A 1QCEA 2MK3A 1KKCA 4WF9V 2AW9A 3JAWB 1ZAUA 2LW7A 4X89A 3CX5F 1M57B 1PL0A 5JQGB 4I4TB 4BW5A 5E1AC 1YI2V 4KHPO 3ABLC 3BABA 2ZD9A 1F4MA 4TV8B 2QR4A 5L3CA 2QTSA 4JI0O 2LGQA 2BTOA 2P6JA 3U0ZA 5FL7G 2N04A 4TSFG 3GVMA 2K1EA 3K08A 2BCCH 3K0GA 3WFVA 3RYFB 4FLTA 4CZZA 3K79A 4GKKO 3J80N 4X20B 5CA0B 4RAIA 3ZJZA 4HBNA 3ZMVA 3LNNA 4JYAB 4R7CA 2VQEO 2WLMA 3N2GA 3ZHVA 1GTOA 1AR1B 1VQ5V 4JI3B 1RP3B 1Y74B 1GN3A 3JASA 4W4LA 2F23A 3WB0A 3FX7A 3G80A 3JCZA 5JVDA 1AROP 4CS3A 1EZJA 1QHTA 1RM1B 1P7BA 1H2SB 2R9RB 4MTGA 3CMAV 1I94B 4JI7B 2YI8A 3RYCA 5B1OA 4B3SO 2IJKA 2VRZA 2ZIOA 5J2UB 1SS3A 3IJ4A 5EYPA 1X4TA 1YF2A 2YIBA 1TUBA 1S3JA 1O9GA 1K5QA 4ZOLB 3H1IH 4X1KA 2CGNA 4XDKA 4YXWG 4G2KA 1IZ3A 4NKGB 2X7RB 2E74B 3L71H 1LUWA 2HEPA 1RFYA 3L75H 2CTPA 4JI5O 1WB8A 5IYZA 4CBCA 4P2ZA 4IT5A 2F4VB 4YY3O 1XMOO 2GTAA 2UUAB 5LYJA 4WFFA 4D6TH 1EM1A 3RVYA 1N32B 2PI5A 3LSUA 4CH4A 4FM1A 2PYLA 4I50B 2YS8A 3B8MA 3CCSV 1KMIZ 3OTFA 3ZRWB 2IW5A 2D2CB 4DV3B 4PA7A 3JAMN 5JJEB 4FFBA 4DV6O 4BIZA 2PGGA 3MAQA 2DOSA 1MG1A 3OT7A 3H1KH 1M5IA 4TT3G 4UV9A 3QF7A 1YCIA 4O4JB 4LWSA 2X6BA 3APQA 1ZSPA 2DWDC 1S5JA 1NS1A 5CB4B 1JJ2U 4JYCA 4J11A 5IJ9A 2IU3A 2EZOA 3CMEV 4DUZB 5EZYA 4IL6Z 3FKSG 5CBHA 2GUZB 1NJIW 4GKJB 2YEVA 3Q4HA 1MOFA 3OGIB 1XILA 3MHSC 2V4DA 1I0HA 3CYOA 5BXZA 3OM3B 1N36B 5IWAO 5JJJB 4GX1A 3ETQA 3G67A 3JAWA 5J2TB 5JQGA 3NR7A 3S3WA 1HDJA 4LF4B 2QGNA 5EC2C 5IY5C 4ZKIA 4JZGA 3FYEB 1FD9A 4KL1A 2WAMA 4PD4F 3CB2A 1OV9A 2M6YA 1XNQB 4HAMA 2QEXV 5IYBO 3WB2A 1I94O 4JI7O 3RYFA 1IX9A 3D3QA 2JJ2G 1S5HC 4LFCB 1A32A 4DR3B 4O4LB 1L0LH 2YXLA 2WLLB 4K3AA 4X20A 5CA0A 3ZN1A 2HG5C 3U10A 3UO2A 5B3SB 1FXKC 2EIMC 4QIWF 4XDLA 2YDEA 2JS3A 3ABKB 1XNRB 4RQEA 2XAHA 1ROPA 4MVRA 5LOVB 3ETGA 3FYIB 5B1NA 4BW9A 4DUYO 1Q8IA 3DSQA 5L3FA 2E5LB 2UXDB 4K0KB 1Y74A 4FPPA 1OHHG 4LNUB 2CK3G 2ZKOA 1AR5A 1FJGB 4DO2A 2JRIA 3H9VA 2ZXWC 1Z5WA 3SPCA 1QLEC 5HFLA 4DV2O 5B5EZ 2UUAO 4UCRA 4ABMA 1N32O 3LSQA 3SPHA 3E86A 4LBEC 3RYIB 2ITDC 1S76D 3CEIA 5GONB 1PL4A 3JARB 4E2LA 2V7QG 5J2UA 5LMUO 2JIZG 3HKCB 2ADPA 3IAYA 3LNMB 1SZTA 4UV8A 3K03A 1VQPV 4ZOLA 2PZSA 2A7WA 3JSNA 3THOA 4B3RB 2XNDG 3HPLC 3RW0A 4LFBB 3AG3B 1I7FA 1EN5A 2Y0PA 2ZE6A 3CRAA 4IIJB 1QR9A 4I9QA 4OPAA 2WA3A 1PP9H 2AXTZ 3B4SA 2W6IG 3B09A 2UUBB 3SJQC 3CRCA 1GK9A 3QO7A 1QU7A 2P22C 3C3TA 3P3NA 4PV1B 3ZRXA 3FAVA 4B3TO 1R1BA 5A9GA 4EFEA 3TETA 1GM8A 4YJ3B 3B77A 3RYHB 4W4KA 1PV0A 4X64B 2UUCO 1SA0B 4CS4A 5L3EA 4GKJO 2P4KA 3AK2A 5DM6V 4K8XA 1FXHA 3OMNB 3QNEA 3ASNB 2CE4A 3CCUV 4QJFB 3CCVV 1K92A 3ZRWA 3JD2A 1AVMA 1J95A 3OUFA 4QE7A 3BFRA 2EILB 1COWG 4LF6O 1N36O 1VF6A 3STLC 3AG4B 4DR6B 5L3DA 2Q6AA 3ZHQA 4UB8Z 4NYKA 3FB8C 4LF4O 4X62B 1SQXH 4YIOA 1NZ6A 3ZHTA 2CAZC 5B3SC 1ZL8B 1N4CA 1HNXB 2W6JG 2EIKB 4FLVA 2EULA 2IJJA 5CB4A 1N0NA 2YXYA 4Q20A 4FLUA 4AQYB 4DR3O 4LFCO 2FB5A 3T1HO 2HLDG 3ZMUA 1GM9A 1K3EA 1PD3A 1Q43A 3ZMTA 4K8ZA 1SQBH 1XMQB 3ZHRA 4JI0B 4E4EA 1XNRO 1Q6HA 2PF4E 4ZHQB 3L72H 1NU1H 2DWEC 2UXDO 4FZ0A 2ARHA 3RYCB 3T1CA 2CUGA 1NBMG 5H2FZ 1FJGO 1R3IC 1TVKB 4X1YA 4CS2A 2AZ0A 5EYPB 1TUBB 3E8HA 1M56B 1YZBA 1URFA 3O65A 2LP7A 4DK1A 4FJCC 1BQZA 3CJHB 4BIUA 2P7TC 2JVDA 3CSXA 4O4LA 5KHKA 1ENVA 4X1IB 1V54B 3SR2C 2CTWA 3W7SA 2WLKA 4UCOA 5LOVA 5LGUA 5LYJB 4H13B 2W0XA 1VF7A 4X65B 1VIBA 3OTOB 3P3PA 4DR5B 4NR1A 3ASNC 4JV5B 3H1JH 1MSDA 1ORQC 3DC6A 2CDYA 1BQ0A 2EILC 1SRYA 4FLYA 3J81N 3FB5C 3AG2C 3AG4C 4HZ3A 3VBBA 4CH3A 3OFNG 4X64O 4PA9A 5BMVB 2ZDIA 5LGTA 3RYIA 4A5UB 3LDCA 2Z0AA 3K58A 3CCMV 4LWSB 1Q3EA 2EZPA 4JI5B 5CA3A 1R6TA 2F93B 2H94A 1B04A 2OYQA 1CPYA 1I08A 5D5PA 2OTJV 1XMOB 3T4ZA 5IJ9B 5DECA 1THZA 2YI9A 5EZYB 1FYJA 4JTDB 4FM0A 2Q0AA 4IIJA 2YEVB 4DV0B 3Q4HB 1WNSA 4JF3A 1S5LZ 3KG2A 3K57A 2DYSC 1KC8W 1L0NH 3E8GA 2P5OA 1YHQV 3F5WC 2KKWA 4DV6B 2QM7A 3ZMSA 2ZINA 4G27B 3OMAB 4YJ3A 3N27A 3RYHA 2K9PA 4AQYO 3ZHSA 1SA0A 3BHPA 4YHHO 2KQXA 1WP8A 1JFFA 4FLWA 1R3LC 1XMQO 1M4UA 3SYAA 4DW1A 3TXSA 4FIPC 1M56C 3CP1A 3TJTA 1SETA 5LP6B 1QVFU 1NTKH 1BT8A 4P30A 4QPJA 3QVNA 2XTAA 1VF5B 1DK1A 2QWQB 2YSUB 3C3SA 1IXBA 3E83A 2EIJC 4TV9A 2XOKG 1ZL8A 4J42A 2IH3C 4FLXA 1WPBA 3JD4A 4MVUA 1HW7A 5IYDO 3CHXA 2GHYA 1K33A 2QE7G 5IWAB 1H38A 4FM2A 3T4DA 2VQFB 1PM9A 2B1GA 2ZR3A 3T2MA 4O4HB 3ABMC 2L6LA 5LMNB 1VQLV 2ODMA 1DTOA 2A0LA 1EBOA 1XUQA 1JQ0A 4U7OA 4B3MO 5H9CA 3FFQA 4DK0A 1GO3F 4J41A 4ZHQA 3KCYA 4IHJB 2GTSA 4X65O 3CC2V 2QSAA 1N33B 3OTOO 4J10A 4DR5O 4F6EA 4EB6B 1YJNV 5IT9N 3UT5B 4JV5O 4UCTA 5AG2A 3EFFK 3ZMZA 4EEQA 3AG7A 3RN4A 2XASA 2ZIMA 1TVKA 1OCRB 4NVPA 4U3JB 1U97A 5JJNB 4D7TA 2HVKC 2B5UA 2IJIA 2NR5A 2Q7EA 1BSMA 5ITZB 4CC5A 3CPWU 1M1KW 4DUYB 3I5DA 1M93A 1PNMA 2E76B 4MVQA 2RNBA 2HFEC 4B7KA 3CJHA 4MTFA 5GTHZ 4IYHA 4X1IA 3K5LA 1OJHA 1XOUA 1OCCB 2VS0A 3FAVB 1W0JG 1IXMA 4DV2B 2A9HA 3OMIB 1VP7A 4MT8A 1M57C 3K3WA 2M7WA 3W7XA 3UM7A 1BMFG 3ZRSA 4PDMA 2QWOB 4DV0O 3C90A 3E2EA 2YICA 1JA8A 3STZC 2AHZA 3BPZA 1AR4A 2QWPB 2DE0X 1IVSA 5LMUB 1Q81W 4B7EA 4WFEA 3HR0A 2OCHA 2F95B 3JATA 4ICGA 1FFXB 5EBMC 2NN4A 1PNLA 1K8AW 4NTXA 5BMVA 1BCCH 4ZI7B 4PI0A 1VQMV 3K5NA
chains in the Genus database with same CATH topology
2Z0AA 1HNXO 1AILA 4JI4O 4DV5O 1R6TA 5LMUO 4B3MO 2UXBO 1XNRO 4DR7O 5BXZA 2DJVA 5IWAO 4JI2O 4LF7O 2LW7A 2HHHO 2ZM6O 4DUZO 1D2DA 2N74A 2UXDO 4X65O 2UU9O 4DR4O 3OTOO 1FYJA 4JI1O 4DR5O 4NXNO 4KHPO 1AB3A 2UXCO 5IT9N 4OPAA 4JV5O 5FLXN 1IBLO 4JI5O 1FJGO 1F7YA 4DR2O 4DV4O 4JI0O 1J5EO 4B3TO 1R1BA 1N34O 1YZBA 4YY3O 3SDLA 4B3RO 1XMOO 4OPHA 4LF5O 3O65A 4LFBO 1I94O 3J7AU 4JI7O 2VQFO 2UUCO 4AQYO 5LL6Y 4JI8O 1G1XB 1A32A 4YHHO 4GKKO 4GKJO 3J80N 5BY1A 1HR0O 5LMNO 2FKXA 4LFAO 2UUBO 1XMQO 3R66A 2VQEO 4X66O 2F4VO 1IBKO 4LF6O 1N36O 3JAMN 1XNQO 3RT3C 4DV6O 4DUYO 4DV7O 2AGAA 1DK1A 2DOSA 1N33O 5H5NA 1FKAO 4LF4O 1X59A 3M8AA 1KUQA 1XEQA 4OX9O 4DV0O 4JYAO 2ZKOA 5A2QN 3F5TA 5BR8O 4DV1O 1HNZO 4LF9O 2JRIA 4JI6O 4DR1O 4DV3O 1HNWO 3T1YO 3J81N 4DV2O 4DR6O 1NS1A 4JI3O 2UUAO 1N32O 2E5LO 4X64O 4K0KO 4NXMO 4X62O 4LF8O 4DR3O 1IBMO 4LFCO 4A5UB 4B3SO 3T1HO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0A A;  1HNX O;  1AIL A;  4JI4 O;  4DV5 O;  1R6T A;  5LMU O;  4B3M O;  2UXB O;  1XNR O;  4DR7 O;  5BXZ A;  2DJV A;  5IWA O;  4JI2 O;  4LF7 O;  2LW7 A;  2HHH O;  2ZM6 O;  4DUZ O;  1D2D A;  2N74 A;  2UXD O;  4X65 O;  2UU9 O;  4DR4 O;  3OTO O;  1FYJ A;  4JI1 O;  4DR5 O;  4NXN O;  4KHP O;  1AB3 A;  2UXC O;  5IT9 N;  4OPA A;  4JV5 O;  5FLX N;  1IBL O;  4JI5 O;  1FJG O;  1F7Y A;  4DR2 O;  4DV4 O;  4JI0 O;  1J5E O;  4B3T O;  1R1B A;  1N34 O;  1YZB A;  4YY3 O;  3SDL A;  4B3R O;  1XMO O;  4OPH A;  4LF5 O;  3O65 A;  4LFB O;  1I94 O;  3J7A U;  4JI7 O;  2VQF O;  2UUC O;  4AQY O;  5LL6 Y;  4JI8 O;  1G1X B;  1A32 A;  4YHH O;  4GKK O;  4GKJ O;  3J80 N;  5BY1 A;  1HR0 O;  5LMN O;  2FKX A;  4LFA O;  2UUB O;  1XMQ O;  3R66 A;  2VQE O;  4X66 O;  2F4V O;  1IBK O;  4LF6 O;  1N36 O;  3JAM N;  1XNQ O;  3RT3 C;  4DV6 O;  4DUY O;  4DV7 O;  2AGA A;  1DK1 A;  2DOS A;  1N33 O;  5H5N A;  1FKA O;  4LF4 O;  1X59 A;  3M8A A;  1KUQ A;  1XEQ A;  4OX9 O;  4DV0 O;  4JYA O;  2ZKO A;  5A2Q N;  3F5T A;  5BR8 O;  4DV1 O;  1HNZ O;  4LF9 O;  2JRI A;  4JI6 O;  4DR1 O;  4DV3 O;  1HNW O;  3T1Y O;  3J81 N;  4DV2 O;  4DR6 O;  1NS1 A;  4JI3 O;  2UUA O;  1N32 O;  2E5L O;  4X64 O;  4K0K O;  4NXM O;  4X62 O;  4LF8 O;  4DR3 O;  1IBM O;  4LFC O;  4A5U B;  4B3S O;  3T1H O; 
#chains in the Genus database with same CATH topology
 1NR7 A;  1JR9 A;  3SYQ A;  2Z3Y A;  2ILM A;  3JAK A;  1Y76 B;  4AI8 A;  3HKE B;  3TK1 A;  5CBG A;  2BSK B;  2Y4T A;  1JX9 A;  5KUM A;  4B3T B;  2LJ2 A;  2ETN A;  4JI2 O;  1XL4 A;  4I5S A;  3L74 H;  4J80 A;  3AG1 B;  2QJ1 A;  2UUC B;  1JJO A;  4IYI A;  1AB3 A;  3CE2 A;  3HKB B;  3S3X A;  2Q8V A;  1F7Y A;  1KBH A;  1RM1 C;  2A06 H;  2CH7 A;  5KHG A;  4LF6 B;  4OPH A;  5EIB D;  4LF5 O;  4PA3 A;  3J7A U;  3M7M X;  3OEH G;  1YVW A;  3K5O A;  2VQF O;  4H44 B;  4JYY A;  3WB1 A;  2QKC A;  3X2Q B;  1HR0 O;  5LMN O;  3VQW A;  3R66 A;  4X1Y B;  4X66 O;  2UXB B;  1NH2 D;  2AZ2 A;  4F6R A;  1TAE A;  3ZCC A;  2R9A A;  4MVZ A;  5LP6 A;  1H8E G;  3RGB A;  2AGA A;  3TCU A;  1UFI A;  1QR8 A;  1N33 O;  5H5N A;  4MTX A;  1AI4 A;  3ZIA G;  1DF4 A;  3ICX A;  1OCZ B;  4OGQ B;  3P32 A;  3T1H B;  4MS2 A;  1AI6 A;  1LR1 A;  4N23 A;  1NKD A;  1OCC C;  3H1L H;  1H2K A;  1UJW B;  4UFZ A;  4H33 A;  1YJW V;  1N34 B;  2DQ0 A;  1VMG A;  2EIN B;  5IE9 A;  2ITC C;  3OAA G;  1QVG U;  1VQ8 V;  1Z2G A;  3NXS A;  3K04 A;  1NT2 B;  1H2N A;  4C7U A;  1BGY H;  5EBL C;  1H2M A;  4O4H A;  5IJ0 B;  3EXA A;  3RWR D;  1NH2 B;  1ZLZ A;  3G71 V;  1AIL A;  3HKD A;  3EVK A;  2Q68 A;  4GZR B;  1IBK B;  1MZE A;  3IC7 A;  2Y69 B;  1VF6 C;  4JZ2 A;  4LF7 O;  1O9H A;  2Q4P A;  2OT5 A;  2R70 A;  2DYR B;  2ZCE A;  4RO2 A;  4PHZ A;  1US6 A;  4IHJ A;  3QO8 A;  1KKD A;  4Z2W A;  4EB6 A;  5FLX N;  2R72 A;  2HR3 A;  4O2B B;  3UT5 A;  1K4D C;  2ZT9 B;  4GYC B;  5GTI Z;  2XT9 A;  1E1Q G;  4UB6 Z;  5BR8 B;  1HNZ B;  2ZE8 A;  4DR2 O;  4DV4 O;  2DN9 A;  2Z5U A;  4HNA B;  4U3J A;  3LSS A;  2R9I A;  4FLZ A;  1TUE B;  1Q7Y W;  4YJ2 B;  1BS3 A;  5ITZ A;  2IJH A;  1BZK A;  1R3J C;  2H8P C;  3AG1 C;  3DTU B;  3W7T A;  5B1B B;  1JMK C;  1PKX A;  3M99 B;  3G4S V;  2WSS G;  2XAQ A;  4JTA B;  1VEW A;  4WFH A;  3WG7 B;  1AJP A;  4DR7 B;  2P4V A;  1M9N A;  2HKO A;  2KG7 B;  5EBW C;  2ZM6 B;  5KLV H;  3F7V C;  3KZI Z;  3A8T A;  2X6A A;  3CRQ A;  4QNH B;  3K06 A;  3X2Q C;  3M8A A;  3VQY A;  2KSD A;  4R8C A;  1WN7 A;  4F4L A;  1RSO A;  2WLN A;  1JFF B;  3FD9 A;  5A2Q N;  4UCS A;  3E35 A;  4P9P A;  1FS0 G;  4UXN A;  4NTY A;  3BAA A;  1N0J A;  2OIG A;  3AEI A;  2H3O A;  5KHH A;  3F7Y C;  1FFX A;  2X6C A;  1EFR G;  4ZI7 A;  1HWY A;  4TV9 B;  4OXS A;  4UVB A;  3I55 V;  3CD6 V;  3LUT B;  1Y76 A;  1VQN V;  4DV5 O;  3HKE A;  2UXB O;  3ABK C;  2MW2 B;  2LFS A;  4GX5 A;  5EK0 A;  2BSK A;  4TQF A;  4WFG A;  2KB1 A;  2LFR A;  1R3K C;  1P4R A;  2BTQ B;  2Q9L A;  2N74 A;  1P84 F;  4TUY B;  5LHI A;  3RFR A;  4YHH B;  1Q86 W;  3HKB A;  4B08 A;  1IBL O;  4WCE V;  1TGO A;  5KMG A;  2Y69 C;  4BR6 A;  3VQX A;  3ZHU A;  1N34 O;  2BOB C;  3MD0 A;  1F23 A;  1WA8 A;  1SQG A;  3OR6 C;  2ZDI C;  4O2A A;  2FTK A;  4PA4 A;  4NXM B;  1NVP D;  3D36 A;  1OCO B;  2CTQ A;  5LL6 Y;  1G1X B;  2LGW A;  1IBM B;  5TIS Z;  1PPJ H;  2ZNI A;  1N8R W;  2Y4U A;  1IBK O;  5KAI Z;  4I9W A;  3CRM A;  1HP8 A;  1MMM A;  3ZS8 C;  3B2E E;  2XHB A;  3AG3 C;  2PI4 A;  2UU9 B;  2EX3 A;  4X9Q A;  4JI1 B;  5KHI A;  2UXC B;  1RPO A;  5DN6 G;  2HVJ C;  4X88 A;  3IFX A;  3ZN0 A;  2JS5 A;  5BR8 O;  1HNZ O;  2JDI G;  1FFT B;  2BE3 A;  2DMX A;  3MDS A;  1J5E B;  4LR3 A;  4B3M B;  1LNQ A;  4U7N A;  4PI2 A;  2YIA A;  1KEC A;  4KUM A;  3E89 A;  5IJ0 A;  3QTC A;  5CA1 A;  4MVS A;  2QKA A;  2ZE5 A;  1EN6 A;  4DR7 O;  2GDS A;  4BIO A;  3SJC C;  2LQT A;  3JAT B;  4J9Y B;  1UPG A;  2HHH O;  2ZM6 O;  1D2D A;  1NTZ H;  5EC1 C;  4NB5 A;  5JH7 B;  4DR4 O;  5JWP A;  3ZRV A;  4O2B A;  1DGS A;  3B8N A;  1NQT A;  3JAK B;  4N21 A;  1RPR A;  4RQF A;  3KKY A;  2EIK C;  1K9M W;  3CCL V;  4HNA A;  5JCO A;  3H1H H;  4MSW C;  3T1Y B;  3SDL A;  2ATK C;  2F1M A;  4YJ2 A;  4XBF A;  1KD1 W;  4JPR A;  1S72 V;  2RQ6 A;  3N2K A;  2YXH A;  5KUK A;  3OD4 A;  4PDR A;  2FKX A;  4UCV A;  4TOI A;  3HB3 B;  3WU2 Z;  4AHC A;  2CH7 B;  2QKS A;  5LBQ A;  2HJD A;  3RT3 C;  1T5E A;  4H37 A;  4EFB A;  2KG7 A;  1ZWI C;  1GMG A;  3PN1 A;  2JGD B;  3CWB H;  1VQ6 V;  3F5T A;  1K5S A;  4O4I A;  2BOC C;  1GKF A;  4F6R B;  4JAA A;  3IC9 A;  1K4C C;  4X8A A;  2OTL V;  1K34 A;  4JI2 B;  5C93 A;  3A0H Z;  4NXM O;  2Q0O C;  1IBM O;  3CC7 V;  1SQP H;  2B9Z A;  1SER A;  1V54 C;  3CCE V;  1FAF A;  5B1A B;  3E8B A;  5LGN A;  3K9A A;  1QLN A;  3TGU H;  2Q69 A;  1YSC A;  5LA6 B;  4FFK A;  4EKW A;  1ZX3 A;  3SYC A;  4LC1 A;  3K59 A;  1IUR A;  2BTQ A;  4LF5 B;  3AK1 A;  2LO1 A;  2UU9 O;  4TUY A;  4DW0 A;  4JI1 O;  2UXC O;  4PJ0 Z;  1G8M A;  1HR0 B;  3CC4 V;  4KXR A;  5KA6 A;  1B06 A;  4CH6 A;  3HKD B;  2YUA A;  5LXT B;  1J5E O;  4DR1 B;  4X66 B;  3OW2 U;  2JGU A;  3D3I A;  2RJZ A;  1BE3 H;  4UVC A;  4CC6 A;  4LP8 A;  3DC5 A;  4GLX A;  3OUS A;  1SF9 A;  3OGC C;  1MSW D;  1QQC A;  3PJS K;  1KB9 F;  4LCU C;  1JVM A;  1W2B U;  4G28 B;  1JPX A;  2QWR B;  1V9P A;  4AIL C;  3JYC A;  4L8J A;  2F66 C;  4FVM A;  3VOU A;  4I0X B;  4NXN B;  1KUQ A;  5IY5 B;  1R6K A;  2P90 A;  3I56 V;  4JAU A;  3A0R A;  3P30 A;  3ASO B;  5KHJ A;  1HNW O;  4Z1M G;  3T1Y O;  2RCV A;  1AJQ A;  4YIP A;  3FB6 C;  4LF7 B;  3E22 B;  4LH7 A;  3ABT A;  1K7D A;  1I5Y A;  1KP3 A;  1H8H G;  4I55 B;  2VWJ A;  4LF8 O;  5FPO A;  3K9S A;  3SJA C;  5E79 Z;  2WLJ A;  4PDL A;  4UCU A;  1FXK B;  1RSO B;  2EIM B;  4DR2 B;  4DV4 B;  5DED A;  3BY6 A;  1D5N A;  1XHX A;  5LP6 C;  2L35 A;  3SYP A;  2CTR A;  5JH7 A;  1U96 A;  4WBN B;  2EJR A;  1GN2 A;  4OX9 B;  3JAL B;  1H2L A;  2JEU A;  4LF9 B;  5B1A C;  2OWO A;  1NTM H;  2ZXW B;  4JI6 B;  1QLE B;  3JCU Z;  2Y48 A;  1XRE A;  4RWU A;  1XI1 A;  1JCH A;  1VQ9 V;  1YXB A;  4Q6G A;  1S0V A;  3LDD A;  5LHG A;  2IU0 A;  3IGA C;  1XQ8 A;  3SPJ A;  5GW7 A;  3DGE A;  5KMG B;  1XBL A;  2CGO A;  1JOY A;  1NI8 A;  2A3Q A;  4GT1 A;  1WAZ A;  2RDC A;  4D7S A;  5FPR A;  1WA8 B;  2QWN B;  4FK5 C;  4O2A B;  1TA8 A;  1W59 A;  2EJ7 A;  4PEL A;  1L1F A;  4ASU G;  2WA4 A;  5KX5 A;  4JYA O;  2JGD A;  1SQF A;  2E3C A;  2Q73 A;  2XAJ A;  3JSL A;  1OCR C;  4DV5 B;  4DR1 O;  1DLB A;  3KCX A;  5IYC O;  3D8C A;  1YTF D;  4JI3 O;  3OR7 C;  2VWK A;  3DXR B;  2PUS A;  1DF5 A;  4I4T A;  4QPK A;  3OEE G;  4HYO A;  2Q5Z A;  2GSM B;  4TV8 A;  4LFA B;  5KA5 A;  1IBL B;  1Y4M A;  2P06 A;  2A79 B;  3ASO C;  1GN4 A;  5IDJ A;  5LA6 A;  2AHY A;  1V55 B;  4DRX B;  4DV7 B;  2FML A;  1E79 G;  3RBZ A;  4NXN O;  5B66 Z;  1PNK A;  1WP7 A;  2QTO A;  2IM9 A;  4ZIB A;  4LH6 A;  3E8F A;  2C2A A;  1WJZ A;  5CA1 B;  4DV1 B;  1LUV A;  3GWO A;  2NLJ C;  1YTF B;  1IDS A;  5LXT A;  1EZV H;  2WLI B;  1MA1 A;  2ZR2 A;  1Z5V A;  3BVO A;  1W0K G;  3B40 A;  4ZBM A;  1SES A;  3W7U A;  1YIJ V;  1P7G A;  4JAS A;  3APO A;  2JEX A;  4FMT A;  3FB7 C;  1BHA A;  4KP4 A;  3ML0 A;  1SKV A;  4JI4 B;  3SJB C;  5LHH A;  2WLH A;  2ZNJ A;  2F4V O;  2OCC B;  3H01 A;  1B6Q A;  1SQV H;  3SPI A;  4J7Z A;  2OIE A;  3SGI A;  3A0B Z;  1QNM A;  3CXH F;  1EN4 A;  1KU9 A;  2IH1 C;  2HP8 A;  5L3G A;  2ZQM A;  2XUM A;  1L8D A;  3N2K B;  4I0X A;  5CBF A;  1VQ7 V;  4OX9 O;  5BZB A;  2Q67 A;  4LF9 O;  4U3F H;  4JI6 O;  5FNV B;  4I7Z B;  4WFB V;  3RVZ A;  3L9D A;  4BWA A;  2UXN A;  4DV3 O;  1AP6 A;  2QM4 A;  1YDX A;  3BCC H;  4QE9 A;  1GM7 A;  5C8Y B;  3VQV A;  3E22 A;  3G6E V;  1GRJ A;  4TQD A;  2HHH B;  3A2F A;  3D36 C;  4I55 A;  2PTM A;  4R6Z A;  4JI8 B;  4DR4 B;  1K73 W;  1P49 A;  2HJF C;  4NTW A;  3ETE A;  1G6U A;  3UQ8 A;  3MHH C;  1CXZ B;  1FXK A;  3G6B A;  4RUE A;  2FL4 A;  4O4I B;  2G38 A;  4UUJ C;  3K5M A;  5HFM A;  1XL6 A;  3BRC A;  4KFM A;  2GBO A;  2DQ3 A;  2EBO A;  3BA9 A;  1KQS U;  4DUZ O;  1GAX A;  2NNU A;  2GV9 A;  1VAR A;  1VQ4 V;  4CH5 A;  3CCR V;  2IBZ H;  1OCZ C;  4I50 A;  1I5X A;  1Q5O A;  2ADQ B;  3UKM A;  3ZX6 A;  4WBN A;  1SQQ H;  2PY5 A;  4FZ1 A;  3JAL A;  1MZF A;  1F51 A;  2W0F C;  5J9P C;  5EIB C;  4JGS A;  1KYO F;  3UCS C;  3JD3 A;  1M90 W;  1Y67 A;  2EIN C;  3AG2 B;  3ZED A;  1V55 C;  4MTO A;  1CEZ A;  2RMK B;  1BHB A;  1D5A A;  3EHB B;  2Q7G A;  1Q6U A;  2YC0 A;  4O4J A;  5F2V O;  4LFA O;  3JD0 A;  3ABU A;  1XHZ A;  1QBZ A;  3QG5 A;  1GH6 A;  3ZBH A;  1SZX A;  2E75 B;  3N2G B;  3CCJ V;  4BAY A;  4GCZ A;  1KP2 A;  4QGP A;  1NR1 A;  2DW4 A;  1XNQ O;  4RUF A;  2YIB D;  3SYO A;  2O57 A;  3GWK C;  4K35 A;  3UO3 A;  4DV7 O;  2DYR C;  1B3Q A;  5K1X A;  3OE7 G;  3JAS B;  1OZ0 A;  1GN6 A;  4MVO A;  5H6Q A;  2GUZ A;  2JK5 C;  4KHP B;  1XEQ A;  2ZE7 A;  5CN0 A;  3R65 A;  1YJ9 V;  5JVD B;  4JYB A;  4DV1 O;  4GUN A;  2OCC C;  2RN9 A;  4PDV A;  2DYS B;  5CMU A;  5JCO C;  3O9O A;  1MAB G;  5L3B A;  1FXV A;  5J2T A;  1WPX A;  2F43 G;  3DXR A;  2E5L O;  2X0L A;  3K0D A;  3L70 H;  4DYL A;  4K0K O;  5B1B C;  2PYJ A;  4IGG A;  4GKK B;  3ABL B;  1ZUQ A;  2Y0I A;  2P67 A;  1F4N A;  2XAF A;  1BL8 A;  4JI4 O;  2VQE B;  1G4Y B;  4J7J A;  2YID A;  3WG7 C;  4UVA A;  1Y66 A;  2QA4 V;  1Q82 W;  4X1K B;  2DJV A;  1NVP B;  3ETD A;  3U11 A;  3W7W A;  1S77 D;  3BA8 A;  3GB7 C;  3BEH A;  4DRX A;  3LDE A;  2N05 A;  2JJ1 G;  1AI5 A;  1R73 A;  1Y6X A;  3JD1 A;  4DXW A;  1ZTE A;  1SC5 B;  1CP9 A;  2WLL A;  2EIJ B;  3CCQ V;  1VQO V;  3CS5 A;  4TWK A;  5IYZ B;  1MNG A;  1Q6I A;  4JAV A;  4MVM A;  2WLI A;  4B3R O;  4LFB O;  2UXX A;  4L87 A;  3CRR A;  4JI8 O;  2Q7H A;  4LNU A;  2B1I A;  4PA6 A;  1WB7 A;  4B3S B;  4JTC B;  5BY1 A;  3ABM B;  1FPO A;  5K1P A;  1WLE A;  4Z1V A;  3L73 H;  2UUB O;  2WPD G;  4J9Z B;  2QM8 A;  1AP5 A;  2V1D A;  1HNW B;  1Q90 D;  4FFB B;  2FYU H;  3SPG A;  1K97 A;  2QDO A;  3AK3 A;  1FKA O;  5D5Q A;  1X59 A;  4LF8 B;  4P9O A;  2D3O W;  5GON A;  3JAR A;  4R50 A;  5H6R A;  3HKC A;  3CXC U;  4MW3 A;  4XDJ A;  2LW1 A;  5FNV A;  2XAG A;  1E1R G;  4WFA V;  1R6N A;  4YY3 B;  4DR6 O;  1AI7 A;  4GX2 A;  4J7K A;  1YEW A;  5C8Y A;  1VQK V;  1XDC A;  1H2G A;  4H0L B;  3TXQ A;  1OCO C;  4X62 O;  3QO5 A;  2WWW A;  5KX5 B;  1HNX O;  5KAF Z;  4GX0 A;  1AJN A;  1YIT V;  4MW8 A;  1QCE A;  2MK3 A;  1KKC A;  4WF9 V;  2AW9 A;  3JAW B;  1ZAU A;  2LW7 A;  4X89 A;  3CX5 F;  1M57 B;  1PL0 A;  5JQG B;  4I4T B;  4BW5 A;  5E1A C;  1YI2 V;  4KHP O;  3ABL C;  3BAB A;  2ZD9 A;  1F4M A;  4TV8 B;  2QR4 A;  5L3C A;  2QTS A;  4JI0 O;  2LGQ A;  2BTO A;  2P6J A;  3U0Z A;  5FL7 G;  2N04 A;  4TSF G;  3GVM A;  2K1E A;  3K08 A;  2BCC H;  3K0G A;  3WFV A;  3RYF B;  4FLT A;  4CZZ A;  3K79 A;  4GKK O;  3J80 N;  4X20 B;  5CA0 B;  4RAI A;  3ZJZ A;  4HBN A;  3ZMV A;  3LNN A;  4JYA B;  4R7C A;  2VQE O;  2WLM A;  3N2G A;  3ZHV A;  1GTO A;  1AR1 B;  1VQ5 V;  4JI3 B;  1RP3 B;  1Y74 B;  1GN3 A;  3JAS A;  4W4L A;  2F23 A;  3WB0 A;  3FX7 A;  3G80 A;  3JCZ A;  5JVD A;  1ARO P;  4CS3 A;  1EZJ A;  1QHT A;  1RM1 B;  1P7B A;  1H2S B;  2R9R B;  4MTG A;  3CMA V;  1I94 B;  4JI7 B;  2YI8 A;  3RYC A;  5B1O A;  4B3S O;  2IJK A;  2VRZ A;  2ZIO A;  5J2U B;  1SS3 A;  3IJ4 A;  5EYP A;  1X4T A;  1YF2 A;  2YIB A;  1TUB A;  1S3J A;  1O9G A;  1K5Q A;  4ZOL B;  3H1I H;  4X1K A;  2CGN A;  4XDK A;  4YXW G;  4G2K A;  1IZ3 A;  4NKG B;  2X7R B;  2E74 B;  3L71 H;  1LUW A;  2HEP A;  1RFY A;  3L75 H;  2CTP A;  4JI5 O;  1WB8 A;  5IYZ A;  4CBC A;  4P2Z A;  4IT5 A;  2F4V B;  4YY3 O;  1XMO O;  2GTA A;  2UUA B;  5LYJ A;  4WFF A;  4D6T H;  1EM1 A;  3RVY A;  1N32 B;  2PI5 A;  3LSU A;  4CH4 A;  4FM1 A;  2PYL A;  4I50 B;  2YS8 A;  3B8M A;  3CCS V;  1KMI Z;  3OTF A;  3ZRW B;  2IW5 A;  2D2C B;  4DV3 B;  4PA7 A;  3JAM N;  5JJE B;  4FFB A;  4DV6 O;  4BIZ A;  2PGG A;  3MAQ A;  2DOS A;  1MG1 A;  3OT7 A;  3H1K H;  1M5I A;  4TT3 G;  4UV9 A;  3QF7 A;  1YCI A;  4O4J B;  4LWS A;  2X6B A;  3APQ A;  1ZSP A;  2DWD C;  1S5J A;  1NS1 A;  5CB4 B;  1JJ2 U;  4JYC A;  4J11 A;  5IJ9 A;  2IU3 A;  2EZO A;  3CME V;  4DUZ B;  5EZY A;  4IL6 Z;  3FKS G;  5CBH A;  2GUZ B;  1NJI W;  4GKJ B;  2YEV A;  3Q4H A;  1MOF A;  3OGI B;  1XIL A;  3MHS C;  2V4D A;  1I0H A;  3CYO A;  5BXZ A;  3OM3 B;  1N36 B;  5IWA O;  5JJJ B;  4GX1 A;  3ETQ A;  3G67 A;  3JAW A;  5J2T B;  5JQG A;  3NR7 A;  3S3W A;  1HDJ A;  4LF4 B;  2QGN A;  5EC2 C;  5IY5 C;  4ZKI A;  4JZG A;  3FYE B;  1FD9 A;  4KL1 A;  2WAM A;  4PD4 F;  3CB2 A;  1OV9 A;  2M6Y A;  1XNQ B;  4HAM A;  2QEX V;  5IYB O;  3WB2 A;  1I94 O;  4JI7 O;  3RYF A;  1IX9 A;  3D3Q A;  2JJ2 G;  1S5H C;  4LFC B;  1A32 A;  4DR3 B;  4O4L B;  1L0L H;  2YXL A;  2WLL B;  4K3A A;  4X20 A;  5CA0 A;  3ZN1 A;  2HG5 C;  3U10 A;  3UO2 A;  5B3S B;  1FXK C;  2EIM C;  4QIW F;  4XDL A;  2YDE A;  2JS3 A;  3ABK B;  1XNR B;  4RQE A;  2XAH A;  1ROP A;  4MVR A;  5LOV B;  3ETG A;  3FYI B;  5B1N A;  4BW9 A;  4DUY O;  1Q8I A;  3DSQ A;  5L3F A;  2E5L B;  2UXD B;  4K0K B;  1Y74 A;  4FPP A;  1OHH G;  4LNU B;  2CK3 G;  2ZKO A;  1AR5 A;  1FJG B;  4DO2 A;  2JRI A;  3H9V A;  2ZXW C;  1Z5W A;  3SPC A;  1QLE C;  5HFL A;  4DV2 O;  5B5E Z;  2UUA O;  4UCR A;  4ABM A;  1N32 O;  3LSQ A;  3SPH A;  3E86 A;  4LBE C;  3RYI B;  2ITD C;  1S76 D;  3CEI A;  5GON B;  1PL4 A;  3JAR B;  4E2L A;  2V7Q G;  5J2U A;  5LMU O;  2JIZ G;  3HKC B;  2ADP A;  3IAY A;  3LNM B;  1SZT A;  4UV8 A;  3K03 A;  1VQP V;  4ZOL A;  2PZS A;  2A7W A;  3JSN A;  3THO A;  4B3R B;  2XND G;  3HPL C;  3RW0 A;  4LFB B;  3AG3 B;  1I7F A;  1EN5 A;  2Y0P A;  2ZE6 A;  3CRA A;  4IIJ B;  1QR9 A;  4I9Q A;  4OPA A;  2WA3 A;  1PP9 H;  2AXT Z;  3B4S A;  2W6I G;  3B09 A;  2UUB B;  3SJQ C;  3CRC A;  1GK9 A;  3QO7 A;  1QU7 A;  2P22 C;  3C3T A;  3P3N A;  4PV1 B;  3ZRX A;  3FAV A;  4B3T O;  1R1B A;  5A9G A;  4EFE A;  3TET A;  1GM8 A;  4YJ3 B;  3B77 A;  3RYH B;  4W4K A;  1PV0 A;  4X64 B;  2UUC O;  1SA0 B;  4CS4 A;  5L3E A;  4GKJ O;  2P4K A;  3AK2 A;  5DM6 V;  4K8X A;  1FXH A;  3OMN B;  3QNE A;  3ASN B;  2CE4 A;  3CCU V;  4QJF B;  3CCV V;  1K92 A;  3ZRW A;  3JD2 A;  1AVM A;  1J95 A;  3OUF A;  4QE7 A;  3BFR A;  2EIL B;  1COW G;  4LF6 O;  1N36 O;  1VF6 A;  3STL C;  3AG4 B;  4DR6 B;  5L3D A;  2Q6A A;  3ZHQ A;  4UB8 Z;  4NYK A;  3FB8 C;  4LF4 O;  4X62 B;  1SQX H;  4YIO A;  1NZ6 A;  3ZHT A;  2CAZ C;  5B3S C;  1ZL8 B;  1N4C A;  1HNX B;  2W6J G;  2EIK B;  4FLV A;  2EUL A;  2IJJ A;  5CB4 A;  1N0N A;  2YXY A;  4Q20 A;  4FLU A;  4AQY B;  4DR3 O;  4LFC O;  2FB5 A;  3T1H O;  2HLD G;  3ZMU A;  1GM9 A;  1K3E A;  1PD3 A;  1Q43 A;  3ZMT A;  4K8Z A;  1SQB H;  1XMQ B;  3ZHR A;  4JI0 B;  4E4E A;  1XNR O;  1Q6H A;  2PF4 E;  4ZHQ B;  3L72 H;  1NU1 H;  2DWE C;  2UXD O;  4FZ0 A;  2ARH A;  3RYC B;  3T1C A;  2CUG A;  1NBM G;  5H2F Z;  1FJG O;  1R3I C;  1TVK B;  4X1Y A;  4CS2 A;  2AZ0 A;  5EYP B;  1TUB B;  3E8H A;  1M56 B;  1YZB A;  1URF A;  3O65 A;  2LP7 A;  4DK1 A;  4FJC C;  1BQZ A;  3CJH B;  4BIU A;  2P7T C;  2JVD A;  3CSX A;  4O4L A;  5KHK A;  1ENV A;  4X1I B;  1V54 B;  3SR2 C;  2CTW A;  3W7S A;  2WLK A;  4UCO A;  5LOV A;  5LGU A;  5LYJ B;  4H13 B;  2W0X A;  1VF7 A;  4X65 B;  1VIB A;  3OTO B;  3P3P A;  4DR5 B;  4NR1 A;  3ASN C;  4JV5 B;  3H1J H;  1MSD A;  1ORQ C;  3DC6 A;  2CDY A;  1BQ0 A;  2EIL C;  1SRY A;  4FLY A;  3J81 N;  3FB5 C;  3AG2 C;  3AG4 C;  4HZ3 A;  3VBB A;  4CH3 A;  3OFN G;  4X64 O;  4PA9 A;  5BMV B;  2ZDI A;  5LGT A;  3RYI A;  4A5U B;  3LDC A;  2Z0A A;  3K58 A;  3CCM V;  4LWS B;  1Q3E A;  2EZP A;  4JI5 B;  5CA3 A;  1R6T A;  2F93 B;  2H94 A;  1B04 A;  2OYQ A;  1CPY A;  1I08 A;  5D5P A;  2OTJ V;  1XMO B;  3T4Z A;  5IJ9 B;  5DEC A;  1THZ A;  2YI9 A;  5EZY B;  1FYJ A;  4JTD B;  4FM0 A;  2Q0A A;  4IIJ A;  2YEV B;  4DV0 B;  3Q4H B;  1WNS A;  4JF3 A;  1S5L Z;  3KG2 A;  3K57 A;  2DYS C;  1KC8 W;  1L0N H;  3E8G A;  2P5O A;  1YHQ V;  3F5W C;  2KKW A;  4DV6 B;  2QM7 A;  3ZMS A;  2ZIN A;  4G27 B;  3OMA B;  4YJ3 A;  3N27 A;  3RYH A;  2K9P A;  4AQY O;  3ZHS A;  1SA0 A;  3BHP A;  4YHH O;  2KQX A;  1WP8 A;  1JFF A;  4FLW A;  1R3L C;  1XMQ O;  1M4U A;  3SYA A;  4DW1 A;  3TXS A;  4FIP C;  1M56 C;  3CP1 A;  3TJT A;  1SET A;  5LP6 B;  1QVF U;  1NTK H;  1BT8 A;  4P30 A;  4QPJ A;  3QVN A;  2XTA A;  1VF5 B;  1DK1 A;  2QWQ B;  2YSU B;  3C3S A;  1IXB A;  3E83 A;  2EIJ C;  4TV9 A;  2XOK G;  1ZL8 A;  4J42 A;  2IH3 C;  4FLX A;  1WPB A;  3JD4 A;  4MVU A;  1HW7 A;  5IYD O;  3CHX A;  2GHY A;  1K33 A;  2QE7 G;  5IWA B;  1H38 A;  4FM2 A;  3T4D A;  2VQF B;  1PM9 A;  2B1G A;  2ZR3 A;  3T2M A;  4O4H B;  3ABM C;  2L6L A;  5LMN B;  1VQL V;  2ODM A;  1DTO A;  2A0L A;  1EBO A;  1XUQ A;  1JQ0 A;  4U7O A;  4B3M O;  5H9C A;  3FFQ A;  4DK0 A;  1GO3 F;  4J41 A;  4ZHQ A;  3KCY A;  4IHJ B;  2GTS A;  4X65 O;  3CC2 V;  2QSA A;  1N33 B;  3OTO O;  4J10 A;  4DR5 O;  4F6E A;  4EB6 B;  1YJN V;  5IT9 N;  3UT5 B;  4JV5 O;  4UCT A;  5AG2 A;  3EFF K;  3ZMZ A;  4EEQ A;  3AG7 A;  3RN4 A;  2XAS A;  2ZIM A;  1TVK A;  1OCR B;  4NVP A;  4U3J B;  1U97 A;  5JJN B;  4D7T A;  2HVK C;  2B5U A;  2IJI A;  2NR5 A;  2Q7E A;  1BSM A;  5ITZ B;  4CC5 A;  3CPW U;  1M1K W;  4DUY B;  3I5D A;  1M93 A;  1PNM A;  2E76 B;  4MVQ A;  2RNB A;  2HFE C;  4B7K A;  3CJH A;  4MTF A;  5GTH Z;  4IYH A;  4X1I A;  3K5L A;  1OJH A;  1XOU A;  1OCC B;  2VS0 A;  3FAV B;  1W0J G;  1IXM A;  4DV2 B;  2A9H A;  3OMI B;  1VP7 A;  4MT8 A;  1M57 C;  3K3W A;  2M7W A;  3W7X A;  3UM7 A;  1BMF G;  3ZRS A;  4PDM A;  2QWO B;  4DV0 O;  3C90 A;  3E2E A;  2YIC A;  1JA8 A;  3STZ C;  2AHZ A;  3BPZ A;  1AR4 A;  2QWP B;  2DE0 X;  1IVS A;  5LMU B;  1Q81 W;  4B7E A;  4WFE A;  3HR0 A;  2OCH A;  2F95 B;  3JAT A;  4ICG A;  1FFX B;  5EBM C;  2NN4 A;  1PNL A;  1K8A W;  4NTX A;  5BMV A;  1BCC H;  4ZI7 B;  4PI0 A;  1VQM V;  3K5N A; 
#chains in the Genus database with same CATH homology
 2Z0A A;  1HNX O;  1AIL A;  4JI4 O;  4DV5 O;  1R6T A;  5LMU O;  4B3M O;  2UXB O;  1XNR O;  4DR7 O;  5BXZ A;  2DJV A;  5IWA O;  4JI2 O;  4LF7 O;  2LW7 A;  2HHH O;  2ZM6 O;  4DUZ O;  1D2D A;  2N74 A;  2UXD O;  4X65 O;  2UU9 O;  4DR4 O;  3OTO O;  1FYJ A;  4JI1 O;  4DR5 O;  4NXN O;  4KHP O;  1AB3 A;  2UXC O;  5IT9 N;  4OPA A;  4JV5 O;  5FLX N;  1IBL O;  4JI5 O;  1FJG O;  1F7Y A;  4DR2 O;  4DV4 O;  4JI0 O;  1J5E O;  4B3T O;  1R1B A;  1N34 O;  1YZB A;  4YY3 O;  3SDL A;  4B3R O;  1XMO O;  4OPH A;  4LF5 O;  3O65 A;  4LFB O;  1I94 O;  3J7A U;  4JI7 O;  2VQF O;  2UUC O;  4AQY O;  5LL6 Y;  4JI8 O;  1G1X B;  1A32 A;  4YHH O;  4GKK O;  4GKJ O;  3J80 N;  5BY1 A;  1HR0 O;  5LMN O;  2FKX A;  4LFA O;  2UUB O;  1XMQ O;  3R66 A;  2VQE O;  4X66 O;  2F4V O;  1IBK O;  4LF6 O;  1N36 O;  3JAM N;  1XNQ O;  3RT3 C;  4DV6 O;  4DUY O;  4DV7 O;  2AGA A;  1DK1 A;  2DOS A;  1N33 O;  5H5N A;  1FKA O;  4LF4 O;  1X59 A;  3M8A A;  1KUQ A;  1XEQ A;  4OX9 O;  4DV0 O;  4JYA O;  2ZKO A;  5A2Q N;  3F5T A;  5BR8 O;  4DV1 O;  1HNZ O;  4LF9 O;  2JRI A;  4JI6 O;  4DR1 O;  4DV3 O;  1HNW O;  3T1Y O;  3J81 N;  4DV2 O;  4DR6 O;  1NS1 A;  4JI3 O;  2UUA O;  1N32 O;  2E5L O;  4X64 O;  4K0K O;  4NXM O;  4X62 O;  4LF8 O;  4DR3 O;  1IBM O;  4LFC O;  4A5U B;  4B3S O;  3T1H O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...