4K0KO

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4k0kO00
2UU9O 4JI1O 1YZBA 3M8AA 2LW7A 4LFCO 4DV3O 1R6TA 4K0KO 1N32O 1FYJA 4DR5O 1XMQO 4JI3O 4B3SO 5LMNO 4KHPO 4JI0O 2JRIA 1N33O 3J80N 1XEQA 1IBLO 3JAMN 1DK1A 3J81N 4DR4O 1A32A 1AB3A 2DJVA 5BY1A 4LF6O 4GKKO 3OTOO 4B3RO 1IBMO 2UUBO 4DUYO 4DV7O 1XNRO 2VQEO 4OX9O 4YHHO 4JI7O 1F7YA 3T1YO 2UUAO 3SDLA 3RT3C 5BR8O 2UXBO 5A2QN 2UXDO 4LFBO 2ZM6O 1G1XB 2HHHO 4LF8O 1HNZO 4DV5O 1KUQA 1AILA 2VQFO 1FJGO 2UUCO 4X66O 2N74A 4JI2O 4DV2O 4X65O 4B3MO 4AQYO 1XMOO 4LF5O 2E5LO 4DR6O 2FKXA 4NXMO 4JI8O 4DUZO 1R1BA 3F5TA 5LMUO 4A5UB 4LF9O 4LFAO 4DR7O 1X59A 4LF4O 5IT9N 2ZKOA 1HR0O 2UXCO 4OPHA 4DR1O 1NS1A 4B3TO 5LL6Y 4X62O 1J5EO 5H5NA 3O65A 3R66A 5FLXN 1HNWO 4JV5O 5BXZA 2DOSA 1IBKO 4DR2O 1N34O 4NXNO 4YY3O 4JI6O 1N36O 3J7AU 4DV1O 3T1HO 1FKAO 4DV6O 4GKJO 4JYAO 4X64O 1I94O 1XNQO 1D2DA 2AGAA 4DV4O 4JI4O 2F4VO 1HNXO 4DR3O 4JI5O 4DV0O 5IWAO 4LF7O 2Z0AA 4OPAA
chains in the Genus database with same CATH superfamily
3AG7A 4RO2A 1XI1A 2DYSC 2IH1C 2EINC 4J42A 1S5LZ 3BAAA 4B3SO 1Y67A 3CRRA 4B3TB 3RYIA 1YI2V 2BTQA 3A8TA 4CH5A 2X6BA 2D3OW 1U97A 4RWUA 1MNGA 1ZTEA 1S5JA 4QJFB 2WLJA 3RYHB 1VF5B 5J2UA 2CH7B 2ITCC 2KKWA 2BOCC 4LNUA 2IBZH 4JYAB 2WA3A 2NR5A 1AR4A 1EM1A 1MMMA 4UCTA 5IE9A 3CS5A 1SA0A 4X1YA 4U7OA 1HNXB 4FFKA 1SRYA 1N0JA 3QO7A 3ZCCA 4FLTA 4FFBA 4MTFA 3WG7B 4J41A 2GUZA 1FS0G 1XMOO 3KCXA 1EN5A 4DR2B 1NT2B 1MSWD 3JYCA 4O4IB 1HWYA 1GN2A 5KHKA 1OCOB 3C3SA 2Q7HA 3B09A 1IVSA 4LH7A 2IJIA 4R8CA 4DR1O 5IYBO 3OTOB 5FLXN 2Q7GA 2Q67A 4I9WA 1BZKA 1PKXA 1Q6IA 2ZE5A 3OGCC 5LOVA 1QLEC 1QU7A 1N36O 3VQVA 1K9MW 1N32B 2ZE8A 3HKBB 1UFIA 5IJ0A 4ABMA 1VEWA 3CMEV 5CBHA 4JYYA 4JZ2A 2WLIA 1NI8A 4J7JA 1YVWA 3OEHG 3ZMVA 3DXRB 5EC2C 2Z0AA 4WFEA 4MVSA 4DW0A 3CCMV 3M8AA 3L71H 1CXZB 1K4DC 2EIKC 3K06A 1SKVA 4JI7B 3CP1A 3T1YB 4ZOLA 2FYUH 1PP9H 2Y0PA 4KFMA 3ZN0A 2QM8A 1WA8B 3BY6A 2HHHB 1DTOA 1VQMV 3K9SA 2OCCC 4X9QA 3ZMZA 3G6BA 5B3SB 3P3PA 4EB6A 1CP9A 2OIEA 5CA0B 2N04A 3CEIA 2ITDC 1JFFB 2IJHA 3G6EV 1GO3F 3JARB 3GWOA 4LBEC 5B1NA 2E75B 4DV5O 1ZLZA 4Z1MG 3ZMTA 1RM1C 4MVMA 2H94A 2CTWA 4PA9A 1KYOF 4LF5O 4GUNA 1Y6XA 3RW0A 4CC6A 4K35A 1NR1A 5LMUO 1MOFA 2Q73A 1K5SA 1WP7A 4GKJB 4FLWA 3QTCA 3DC6A 1K7DA 1Q5OA 2CTPA 1VQ4V 2ZCEA 3AG1B 4BIOA 1J5EO 5KHHA 1HNWO 2Q8VA 1H2KA 3BEHA 3K03A 4HNAB 2B1IA 4UCVA 2Y0IA 4JTCB 1L0NH 2CE4A 1Q8IA 4XDKA 2A3QA 1AJQA 1JPXA 3LDDA 1QCEA 2JJ2G 1S3JA 3P30A 2F4VO 3OUFA 1VP7A 3OM3B 2UUCB 3QO8A 4O2BA 5HFLA 4I0XB 5IWAO 4I4TA 1JQ0A 2XUMA 2F93B 4X1KB 4ZI7A 4DV7B 1Y66A 3ZHTA 1XMQO 4KHPO 3OFNG 3UQ8A 2JRIA 3L74H 5CB4B 3CCJV 2F66C 2P4KA 2QDOA 1RP3B 2GTAA 3ABMC 5CA3A 4TQDA 1THZA 4X1IB 1KU9A 4TV8B 1IBMO 4B3MB 4LC1A 1YIJV 2Z5UA 2EZPA 3U10A 1M5IA 4JI8B 4OX9O 1Q7YW 3P3NA 4I7ZB 4JZGA 2UUAO 2Q9LA 1JJOA 4F6RB 3SPGA 5LXTB 4BIZA 3T4DA 2CGNA 2HVJC 5ITZA 2RN9A 1I5YA 1FJGO 3JATA 1FFTB 2N74A 3K08A 2ZNIA 4DV2O 2P6JA 3CD6V 3ASNB 3Q4HB 4YJ2B 2VWJA 5LA6B 3L73H 1UJWB 3RVYA 1KD1W 3CB2A 2M6YA 2YIAA 2HFEC 4CH6A 1P7BA 4P9PA 5JJJB 4B3TO 4PELA 2CTRA 2ZNJA 4PDVA 1M1KW 3OR7C 1QVFU 3ABLB 2QWNB 4TUYB 1XQ8A 2HKOA 4YHHB 2D2CB 5IYZB 1GN3A 5KMGB 5KHIA 2DQ3A 3T1HO 5JH7A 3THOA 1PNMA 5BR8B 4JYAO 4QGPA 2AGAA 1M56C 1XILA 4CS3A 5JCOC 4P30A 3FB5C 5JCOA 1HNXO 5B66Z 3HPLC 3ZRWB 4MVQA 1EZVH 4N21A 3B40A 4JF3A 4AQYB 1RSOB 1SQPH 2X7RB 4NVPA 1BMFG 2X6AA 3CC4V 1OCZC 4O4HA 2E76B 2XAGA 1WLEA 5LGUA 5BMVB 4LR3A 4UUJC 3J81N 4IIJA 1KB9F 4PDMA 3L70H 2OYQA 3OTOO 4FLZA 4J11A 5B1BC 5LHGA 4MW3A 1XNRO 3E8FA 2PI4A 3U11A 3ZMSA 1U96A 4WBNB 2LP7A 2ZXWB 3SYQA 1GRJA 1XHZA 3G4SV 4WFBV 4DR1B 1NTKH 3RYHA 1WN7A 2W6JG 2ODMA 5H6QA 2CH7A 1QBZA 3CMAV 1HW7A 4H37A 2R70A 5LHIA 1XREA 4K3AA 1N36B 2QJ1A 1Y74B 4KUMA 1VMGA 3D36A 3EFFK 2QM7A 3RYFA 3W7UA 3F5TA 4LP8A 1FFXB 1WJZA 5CN0A 4TT3G 2YSUB 3UT5A 4JPRA 4OPHA 2DYRB 3AG4C 1NS1A 1EBOA 2OIGA 3JCUZ 4O4IA 1F23A 3R66A 3LNNA 2Y69C 4BWAA 2HR3A 1ZSPA 1XUQA 2HVKC 3SJQC 2HJFC 4UB6Z 4H13B 3QG5A 1YCIA 1EFRG 4PDLA 4JTDB 3NXSA 1I7FA 3JCZA 2ZE6A 2ATKC 1JA8A 1W0KG 3CJHB 1S72V 2NLJC 3HKBA 3ML0A 3CCQV 3ABTA 1SQGA 2QWRB 4PA6A 3JD1A 2ZR2A 1GN4A 3MHHC 1F4MA 4FLXA 4IHJA 1XEQA 3OGIB 3JAMN 1A32A 2ADPA 5BY1A 3A2FA 1Z5WA 3T4ZA 4P9OA 4DK1A 1JOYA 4LF5B 1WA8A 3L72H 3CPWU 3AK1A 4X20B 1F7YA 5LMUB 4MVRA 1MZFA 1TUBB 1KP2A 4LFBO 2DQ0A 3UO3A 2EIMB 4JI5B 5EYPB 3H1HH 2UUCO 5CA0A 1H8HG 1J5EB 1JFFA 1ENVA 2R9IA 2IU0A 2ILMA 1OCCB 4GLXA 2ZIOA 4K8ZA 4I50A 5DECA 5B1AB 1KBHA 1M57C 2DWEC 1R6NA 1ZAUA 2AHYA 1OCRB 1Y76A 4D6TH 1LNQA 1Q3EA 3STLC 5LL6Y 2WLKA 3MDSA 2AW9A 4FJCC 1SF9A 4MVZA 2R72A 2WLNA 1Z5VA 5BXZA 2IW5A 2DMXA 3ZX6A 4ZHQB 4DK0A 4U3FH 2AZ0A 2QE7G 3H1LH 4J7KA 1PD3A 3OUSA 1I08A 1FKAO 4KHPB 1BSMA 1XNQO 5LBQA 4DXWA 1VF6A 4HNAA 4GCZA 3CSXA 4PI2A 4EKWA 4DV0O 2KB1A 1JVMA 1SERA 1V55C 1IBMB 4IL6Z 4BIUA 3CCRV 1ZX3A 1YTFB 2B1GA 2EX3A 2ZDIC 2R9AA 2Q0OC 5L3GA 1L0LH 4DW1A 2UUAB 3FB8C 2JDIG 3ZJZA 3OE7G 4OGQB 1YEWA 1FJGB 1IXBA 1VQKV 2JS3A 1GK9A 1QQCA 4AILC 5KX5B 4DV2B 1Q81W 3X2QC 5CB4A 1I0HA 3CRMA 5C8YB 3K3WA 3KZIZ 4J9ZB 4YHHO 5IJ9B 2JEXA 1AI4A 4X1IA 1V54B 3OT7A 4TV8A 1GH6A 5BR8O 2F95B 5L3BA 2LO1A 1HNZO 5CBFA 2GBOA 3IAYA 3O9OA 4FMTA 1TVKB 4AQYO 3LSSA 2YDEA 2A7WA 2MW2B 4L8JA 3T1HB 3EHBB 5GTHZ 4LFAO 3EXAA 2YI8A 2R9RB 2QTSA 5KHGA 4UVAA 5KLVH 3BCCH 3Q4HA 3DSQA 2Y4UA 2W0FC 4WFGA 2EILC 4DYLA 4QNHB 2RJZA 1YDXA 1QR8A 3J7AU 1WP8A 1BL8A 2IU3A 1BGYH 5LYJB 4U3JB 2WAMA 3JAKB 4TUYA 1CEZA 1GM7A 1YXBA 5KMGA 3SPIA 4LF7O 4NR1A 4QE7A 1MA1A 3K58A 3CC2V 3WB2A 2HP8A 1XNRB 5FNVA 5KAFZ 5EBLC 1KKDA 3ZRWA 1R6TA 3ASOB 4JTAB 4LF9B 1W59A 2M7WA 2YIBA 4TV9B 1MZEA 3ETGA 2ADQB 2P5OA 1RSOA 3H1KH 3K59A 3K5NA 1PM9A 4X88A 2YXLA 1I5XA 2XOKG 3BHPA 5J9PC 3CRCA 1NH2B 2PYJA 4NXNB 3JD2A 3WB0A 3TETA 1Q6HA 1URFA 2ZINA 3BPZA 5K1XA 4JYBA 3K04A 3CE2A 1KMIZ 1XDCA 4MTOA 2WWWA 3D3IA 3CC7V 2P7TC 1K33A 2AXTZ 2XHBA 4WBNA 4PI0A 4FM0A 1Q86W 1N0NA 3N27A 4IGGA 1WNSA 3SPJA 1B3QA 1K8AW 1NZ6A 1E1QG 2X6CA 4GZRB 1GKFA 1P4RA 1B06A 2W0XA 2FTKA 3D3QA 4W4KA 5IT9N 5IYDO 4W4LA 3JAWB 3O65A 1FFXA 2LW1A 5B5EZ 2RNBA 5IDJA 1COWG 2DYRC 5JJEB 1FXVA 1FAFA 4H0LB 4JGSA 2CUGA 2JIZG 4UCRA 1VQPV 2DN9A 3CXHF 3U0ZA 2NNUA 2JGDB 4JI5O 2E3CA 1KQSU 4OPAA 4NTXA 3MD0A 4O2AB 5D5PA 3JD3A 3AG3B 4XDLA 4H33A 4LFCO 3SYCA 4K0KO 1VQ8V 4ZIBA 1GMGA 4LFBB 4LWSB 4FLUA 3JALB 3FAVB 2QGNA 4RUFA 2NN4A 4LF6O 2Q4PA 3E8GA 1IBKB 1OV9A 2UXNA 4PJ0Z 1HP8A 2XASA 5CMUA 5JQGB 1NTMH 4DV1B 1JX9A 3HKCB 2IM9A 3RT3C 3H1JH 1QR9A 5L3CA 1FXKB 4DV4B 2YXHA 1LR1A 4X20A 4ASUG 5F2VO 1NU1H 4DR6O 2EIMC 2FKXA 2A9HA 4DR5B 4A5UB 2ETNA 1R3IC 2ZE7A 1X59A 1XNQB 1NBMG 1P49A 2CAZC 2DYSB 3FKSG 5EZYA 2EINB 2GDSA 2WLHA 4DV0B 3AG2C 2ZD9A 1OCRC 3G67A 2DOSA 4Q6GA 4YY3O 1SS3A 2BTQB 2YC0A 3CWBH 3ABKC 4J80A 4UCOA 1KC8W 4ZHQA 1K97A 5KHJA 2EIJC 1Q90D 4BW9A 4ZKIA 4IYIA 4CBCA 1NVPB 1IDSA 2ZIMA 4QPKA 1WPBA 2DWDC 4X1YB 3BA9A 2Q68A 4FVMA 2OTJV 3G71V 4WF9V 3ZMUA 3EVKA 4UFZA 3OMNB 2IJKA 4JAUA 1N33O 3H01A 1HNZB 1AB3A 2DJVA 4WCEV 4I55B 4R7CA 4BAYA 4DUYO 1QVGU 2QKCA 4JI6B 1MABG 1B6QA 1G6UA 1AR1B 5JVDA 3CX5F 3SJBC 4LFAB 3SDLA 5KX5A 5H9CA 1SZTA 1ZWIC 2MK3A 5BZBA 1QLEB 3ETDA 5C8YA 4X66O 1K34A 2Q0AA 3E83A 2Y48A 5L3FA 1H38A 1PNKA 4BR6A 2YEVB 3I5DA 1AI5A 2X0LA 2WLIB 1YF2A 1BS3A 4DV3B 3QF7A 2E74B 4R50A 4O4JB 4LF9O 1F4NA 2H8PC 1TVKA 2B9ZA 2PYLA 2EIKB 3S3WA 1AI6A 4DR4B 4ICGA 2A79B 1K3EA 2DW4A 4J7ZA 2HLDG 4LF7B 1K4CC 1SETA 4NXNO 2YUAA 2OCCB 3D36C 4RQFA 3KCYA 1NQTA 1QNMA 5DM6V 4J10A 3WG7C 4B08A 1SC5B 4PHZA 3CCLV 4FZ1A 2EJRA 1B04A 5LP6B 4E4EA 4HYOA 2JGUA 2Q6AA 3BFRA 3F5WC 5LHHA 3RYCB 1OCOC 5LYJA 2JS5A 5AG2A 4QE9A 3JAKA 5JJNB 3K5OA 4CZZA 4Z1VA 1RM1B 1W2BU 5LMNO 5H6RA 3IC9A 2VS0A 1F51A 3E86A 2P06A 3E89A 1AROP 1NVPD 3JASB 3H1IH 1M90W 4TV9A 4QPJA 3APOA 3LSQA 1VQNV 4CH3A 4X89A 3FYEB 4F4LA 3VOUA 4UCUA 2RCVA 1SZXA 3DXRA 1M9NA 1Q43A 2HG5C 2UXBO 2UXDO 3B77A 5CA1B 1NTZH 2QWOB 3T2MA 1KKCA 1NKDA 3K0DA 2YIBD 4TOIA 1YJWV 1N8RW 4O2BB 5B3SC 1IX9A 3TXSA 1IBLB 2WLMA 4KXRA 1GN6A 1J95A 4JAVA 3D8CA 4KL1A 3FYIB 4TSFG 4X62O 1VQ9V 3AK3A 5D5QA 4JV5O 5KUMA 3SGIA 4Q20A 4OXSA 3ZS8C 1IBKO 3TCUA 3JARA 3E35A 3ABMB 4LFCB 4MVUA 3JAWA 3IC7A 4NYKA 4K0KB 1KP3A 3NR7A 5GONB 4DV1O 4UXNA 1VQ7V 4DV4O 5FPOA 2GHYA 3B8NA 2VQFB 4CS4A 5E79Z 4LF6B 2CDYA 1PL0A 4GX5A 5ITZB 2EULA 2F1MA 3AG1C 2A0LA 1YITV 4DR5O 4JASA 1JR9A 5L3EA 3ZHUA 4O2AA 3J80N 2FB5A 3F7YC 1VF6C 4O4LB 5C93A 5EBWC 2LGQA 1BT8A 2FL4A 2WPDG 1XL4A 4UVCA 2EZOA 1EN6A 3ETQA 3DC5A 1BE3H 2QSAA 4PA4A 4P2ZA 1D5AA 4LWSA 4DR6B 1VQLV 3FAVA 4YJ3B 1MG1A 1RPOA 4I0XA 3TK1A 3RN4A 4H44B 4XBFA 2LGWA 1TGOA 2YS8A 2OTLV 1US6A 4PDRA 2CTQA 4X1KA 1H2SB 4L87A 1Z2GA 2YI9A 4FZ0A 5JQGA 3HKCA 3ZRVA 3LUTB 1G4YB 1M56B 2EJ7A 1M4UA 1GM9A 4YY3B 2H3OA 2IH3C 3SYAA 4JI3B 3FD9A 4PA7A 1DF4A 5EIBD 4DR7O 3FB6C 4LH6A 3N2KB 3ZRXA 3A0HZ 4HZ3A 4GKKB 4O4HB 1YJNV 2AHZA 1OCZB 4CC5A 5J2TB 3STZC 3FB7C 2XAHA 5FL7G 4F6RA 4NKGB 5LXTA 4JAAA 1Q6UA 3HKEB 4IIJB 4JI6O 1QLNA 3CRQA 3UCSC 3E22B 2GV9A 4PV1B 1TA8A 5B1BB 1N33B 3ASNC 4LF8B 3MAQA 4DR3O 1ZL8B 4YJ2A 1XOUA 5LA6A 3H9VA 4X65B 3TJTA 5A9GA 4DUYB 4HBNA 2A06H 2L6LA 1AP6A 2XAFA 4NXMB 1GTOA 2LW7A 4MW8A 3G80A 2Z3YA 2OT5A 3K5MA 4DV3O 1HDJA 5E1AC 1WB7A 4IT5A 3JSNA 3ABLC 5L3DA 1AJPA 4FM2A 4DR4O 4B7EA 3RYFB 3N2GB 5IYZA 4X66B 1XHXA 4X8AA 2XAQA 4MTXA 2BE3A 4CS2A 1LUVA 5KAIZ 4AI8A 3UT5B 2AZ2A 2UUBO 3LDCA 2QKSA 4K8XA 3OMAB 3I56V 3AG4B 4C7UA 3ZHSA 4I55A 1I94B 4YIOA 3UM7A 2Y69B 1BQZA 2RMKB 4TQFA 1FD9A 2KG7B 3ZHVA 5A2QN 4JI4B 2ZM6O 1G1XB 2JEUA 5IY5B 2XAJA 2G38A 4EEQA 1IXMA 2UU9B 3LSUA 3VQYA 1VQOV 5BMVA 3AEIA 2OCHA 3JSLA 4ZBMA 1YTFD 3HKDB 3ZHRA 2YEVA 3ICXA 4LF4O 4UVBA 2ZKOA 5FPRA 1R6KA 3OR6C 1FXHA 1AR5A 4G28B 2Q7EA 3CYOA 5B1OA 4O4JA 4JYCA 1R73A 2ZXWC 4IHJB 3KKYA 4DRXB 1W0JG 3TGUH 2VQEB 2PGGA 4PD4F 1NJIW 3C90A 4DO2A 5KA6A 2Q69A 1BHAA 5LMNB 2FMLA 5KA5A 1S5HC 3AK2A 2Q5ZA 3ZRSA 1Y74A 1D5NA 1XBLA 2DE0X 1P84F 1S0VA 1H8EG 4NTWA 2KQXA 2F43G 1K73W 1NR7A 5LP6C 4YIPA 5EK0A 5LP6A 4DUZB 3B4SA 4J9YB 2LJ2A 3RYCA 3QVNA 1RPRA 2JK5C 2UXBB 2UXDB 3OD4A 1IBLO 3CCEV 4GT1A 3ZHQA 4I50B 2BSKB 1BCCH 1M57B 3W7WA 4MS2A 2B5UA 1K5QA 1PNLA 2P4VA 1R3LC 1Y76B 3FX7A 1R3KC 2LFRA 2XNDG 4QIWF 2XT9A 2VWKA 2QA4V 3JASA 3WB1A 3CCUV 4X64B 4NB5A 1DLBA 4MTGA 3ZN1A 4UV8A 3CJHA 3DGEA 1DF5A 1UPGA 5GW7A 3GVMA 1AILA 2VQFO 4X62B 3K5LA 5EIBC 1H2NA 3WU2Z 4JV5B 1OJHA 4FPPA 5CA1A 1FPOA 1P7GA 1DGSA 2E5LO 1PPJH 2QTOA 1S76D 3K9AA 1R1BA 3SPHA 4D7SA 3OTFA 4JI0B 1V55B 3W7TA 3GB7C 1VQ6V 1SQQH 3APQA 1XL6A 3BVOA 4YXWG 3HB3B 4B3RB 2WLLB 1NH2D 3ZEDA 1ZUQA 3K0GA 1H2GA 1TUBA 1JJ2U 1TUEB 1N34O 3E8BA 2QM4A 3QO5A 4R6ZA 5EYPA 2P90A 1MSDA 3BRCA 5CBGA 1D2DA 3X2QB 1N4CA 3JD0A 1GM8A 1OCCC 1PL4A 3CCVV 2YIDA 5B1AC 2V1DA 4FLVA 4JI2B 5HFMA 5GONA 4FM1A 1V9PA 1VQ5V 4JI1O 1YZBA 1PV0A 3SYOA 3SYPA 3RYIB 3QNEA 5JWPA 2BOBC 2K9PA 4JI3O 2PUSA 1ROPA 1OZ0A 1HR0B 3E8HA 2UXCB 1VF7A 5J2UB 1R3JC 4LNUB 4GKKO 4G27B 1Y4MA 3ETEA 2CGOA 4B7KA 1SA0B 5IYCO 4O4LA 2HEPA 4FFBB 3RBZA 2P67A 3UO2A 4DV6B 4DR7B 2ZQMA 2GUZB 4WFHA 4IYHA 2EILB 4GX0A 4LF8O 4YJ3A 1BHBA 5K1PA 1QHTA 4X65O 2GSMB 3SJAC 4NXMO 4UV9A 3SR2C 2RDCA 3K57A 4B3SB 5LGNA 4MVOA 4MSWC 4CH4A 5FNVB 2UXXA 5LOVB 4FLYA 4DR3B 3T1CA 5DEDA 3IGAC 5IJ9A 5EC1C 1V54C 4F6EA 1WAZA 4FK5C 3CHXA 3VQXA 3N2KA 5IJ0B 4DR2O 3IFXA 2KSDA 1CPYA 2EBOA 2QWQB 5J2TA 3CXCU 1JMKC 3PN1A 1I94O 2VRZA 3FFQA 4JI4O 3HKEA 4AHCA 4Z2WA 1AP5A 3E22A 4N23A 4ZOLB 1SESA 2Y4TA 1XMOB 2UUBB 2UU9O 4U7NA 3BABA 3KG2A 2BCCH 2RQ6A 3RVZA 1ZL8A 1N32O 1EN4A 4KP4A 1AVMA 3CCSV 4EB6B 5H2FZ 1JCHA 4UB8Z 2ZM6B 1DK1A 2LQTA 3CRAA 2YICA 4FIPC 4EFBA 1GAXA 3R65A 4XDJA 2V7QG 4U3JA 2K1EA 2IJJA 3BA8A 3MHSC 2JJ1G 2VQEO 2PI5A 1YHQV 4JI7O 3S3XA 3N2GA 3T1YO 5TISZ 1VIBA 4LF4B 3ZBHA 2ARHA 2HHHO 3ASOC 3L75H 2PY5A 4NTYA 2KG7A 2P22C 3RWRD 1SQBH 2C2AA 3ABUA 3LDEA 3L9DA 3LNMB 3SJCC 5IY5C 4DUZO 3OEEG 1L1FA 3P32A 1AI7A 1S77D 3K79A 3I55V 3HKDA 3UKMA 4RAIA 2F23A 2WA4A 3VBBA 1YJ9V 1LUWA 3OMIB 3B8MA 4GX1A 1TAEA 2HJDA 3JD4A 4I4TB 3C3TA 2PTMA 3TXQA 3WFVA 4GKJO 4X64O 4DRXA 2N05A 4ZI7B 4TWKA 2L35A 4DV5B 3F7VC 1SQFA 4UCSA 3OW2U 1IZ3A 1KECA 4RQEA 4G2KA 2LFSA 2XTAA 4LCUC 4MT8A 2CK3G 3RFRA 1FYJA 5LGTA 3SPCA 5KUKA 1YSCA 1E1RG 1OHHG 1AJNA 4JI0O 1HNWB 1K92A 2PF4E 4B3RO 5EZYB 1X4TA 4I9QA 4WFFA 4DV7O 2PZSA 3M7MX 1L8DA 2E5LB 1H2MA 3W7XA 1VARA 2ZT9B 2BSKA 3JATB 2JGDA 3DTUB 3B2EE 3AG2B 2QWPB 4GYCB 1WPXA 1M93A 2F4VB 2ZR3A 3AG3C 1KUQA 4I5SA 1ORQC 5IWAB 4E2LA 3ABKB 4JI2O 1O9GA 3VQWA 3IJ4A 1E79G 4B3MO 2EIJB 3HR0A 3A0BZ 2OWOA 3M99B 1N34B 3PJSK 3JALA 4JI8O 2BTOA 1EZJA 4RUEA 4GX2A 2YXYA 1XMQB 1SQXH 1O9HA 1RFYA 2W6IG 3E2EA 1G8MA 5GTIZ 1HR0O 2UXCO 4PA3A 4D7TA 1Q82W 2QEXV 5H5NA 4HAMA 5JH7B 2QKAA 2V4DA 1WB8A 4WFAV 1IURA 1T5EA 4JI1B 1FXKC 1FXKA 5DN6G 4OX9B 2QR4A 3W7SA 2ZDIA 4BW5A 2JVDA 2GTSA 4DV6O 1H2LA 3RGBA 2WLLA 3GWKC 5JVDB 2WSSG 3ZIAG 3A0RA 3OAAG 1SQVH 1BQ0A 5EBMC 4EFEA 2O57A
chains in the Genus database with same CATH topology
2UU9O 4JI1O 1YZBA 3M8AA 2LW7A 4LFCO 4DV3O 1R6TA 4K0KO 1N32O 1FYJA 4DR5O 1XMQO 4JI3O 4B3SO 5LMNO 4KHPO 4JI0O 2JRIA 1N33O 3J80N 1XEQA 1IBLO 3JAMN 1DK1A 3J81N 4DR4O 1A32A 1AB3A 2DJVA 5BY1A 4LF6O 4GKKO 3OTOO 4B3RO 1IBMO 2UUBO 4DUYO 4DV7O 1XNRO 2VQEO 4OX9O 4YHHO 4JI7O 1F7YA 3T1YO 2UUAO 3SDLA 3RT3C 5BR8O 2UXBO 5A2QN 2UXDO 4LFBO 2ZM6O 1G1XB 2HHHO 4LF8O 1HNZO 4DV5O 1KUQA 1AILA 2VQFO 1FJGO 2UUCO 4X66O 2N74A 4JI2O 4DV2O 4X65O 4B3MO 4AQYO 1XMOO 4LF5O 2E5LO 4DR6O 2FKXA 4NXMO 4JI8O 4DUZO 1R1BA 3F5TA 5LMUO 4A5UB 4LF9O 4LFAO 4DR7O 1X59A 4LF4O 5IT9N 2ZKOA 1HR0O 2UXCO 4OPHA 4DR1O 1NS1A 4B3TO 5LL6Y 4X62O 1J5EO 5H5NA 3O65A 3R66A 5FLXN 1HNWO 4JV5O 5BXZA 2DOSA 1IBKO 4DR2O 1N34O 4NXNO 4YY3O 4JI6O 1N36O 3J7AU 4DV1O 3T1HO 1FKAO 4DV6O 4GKJO 4JYAO 4X64O 1I94O 1XNQO 1D2DA 2AGAA 4DV4O 4JI4O 2F4VO 1HNXO 4DR3O 4JI5O 4DV0O 5IWAO 4LF7O 2Z0AA 4OPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 O;  4JI1 O;  1YZB A;  3M8A A;  2LW7 A;  4LFC O;  4DV3 O;  1R6T A;  4K0K O;  1N32 O;  1FYJ A;  4DR5 O;  1XMQ O;  4JI3 O;  4B3S O;  5LMN O;  4KHP O;  4JI0 O;  2JRI A;  1N33 O;  3J80 N;  1XEQ A;  1IBL O;  3JAM N;  1DK1 A;  3J81 N;  4DR4 O;  1A32 A;  1AB3 A;  2DJV A;  5BY1 A;  4LF6 O;  4GKK O;  3OTO O;  4B3R O;  1IBM O;  2UUB O;  4DUY O;  4DV7 O;  1XNR O;  2VQE O;  4OX9 O;  4YHH O;  4JI7 O;  1F7Y A;  3T1Y O;  2UUA O;  3SDL A;  3RT3 C;  5BR8 O;  2UXB O;  5A2Q N;  2UXD O;  4LFB O;  2ZM6 O;  1G1X B;  2HHH O;  4LF8 O;  1HNZ O;  4DV5 O;  1KUQ A;  1AIL A;  2VQF O;  1FJG O;  2UUC O;  4X66 O;  2N74 A;  4JI2 O;  4DV2 O;  4X65 O;  4B3M O;  4AQY O;  1XMO O;  4LF5 O;  2E5L O;  4DR6 O;  2FKX A;  4NXM O;  4JI8 O;  4DUZ O;  1R1B A;  3F5T A;  5LMU O;  4A5U B;  4LF9 O;  4LFA O;  4DR7 O;  1X59 A;  4LF4 O;  5IT9 N;  2ZKO A;  1HR0 O;  2UXC O;  4OPH A;  4DR1 O;  1NS1 A;  4B3T O;  5LL6 Y;  4X62 O;  1J5E O;  5H5N A;  3O65 A;  3R66 A;  5FLX N;  1HNW O;  4JV5 O;  5BXZ A;  2DOS A;  1IBK O;  4DR2 O;  1N34 O;  4NXN O;  4YY3 O;  4JI6 O;  1N36 O;  3J7A U;  4DV1 O;  3T1H O;  1FKA O;  4DV6 O;  4GKJ O;  4JYA O;  4X64 O;  1I94 O;  1XNQ O;  1D2D A;  2AGA A;  4DV4 O;  4JI4 O;  2F4V O;  1HNX O;  4DR3 O;  4JI5 O;  4DV0 O;  5IWA O;  4LF7 O;  2Z0A A;  4OPA A; 
#chains in the Genus database with same CATH topology
 3AG7 A;  4RO2 A;  1XI1 A;  2DYS C;  2IH1 C;  2EIN C;  4J42 A;  1S5L Z;  3BAA A;  4B3S O;  1Y67 A;  3CRR A;  4B3T B;  3RYI A;  1YI2 V;  2BTQ A;  3A8T A;  4CH5 A;  2X6B A;  2D3O W;  1U97 A;  4RWU A;  1MNG A;  1ZTE A;  1S5J A;  4QJF B;  2WLJ A;  3RYH B;  1VF5 B;  5J2U A;  2CH7 B;  2ITC C;  2KKW A;  2BOC C;  4LNU A;  2IBZ H;  4JYA B;  2WA3 A;  2NR5 A;  1AR4 A;  1EM1 A;  1MMM A;  4UCT A;  5IE9 A;  3CS5 A;  1SA0 A;  4X1Y A;  4U7O A;  1HNX B;  4FFK A;  1SRY A;  1N0J A;  3QO7 A;  3ZCC A;  4FLT A;  4FFB A;  4MTF A;  3WG7 B;  4J41 A;  2GUZ A;  1FS0 G;  1XMO O;  3KCX A;  1EN5 A;  4DR2 B;  1NT2 B;  1MSW D;  3JYC A;  4O4I B;  1HWY A;  1GN2 A;  5KHK A;  1OCO B;  3C3S A;  2Q7H A;  3B09 A;  1IVS A;  4LH7 A;  2IJI A;  4R8C A;  4DR1 O;  5IYB O;  3OTO B;  5FLX N;  2Q7G A;  2Q67 A;  4I9W A;  1BZK A;  1PKX A;  1Q6I A;  2ZE5 A;  3OGC C;  5LOV A;  1QLE C;  1QU7 A;  1N36 O;  3VQV A;  1K9M W;  1N32 B;  2ZE8 A;  3HKB B;  1UFI A;  5IJ0 A;  4ABM A;  1VEW A;  3CME V;  5CBH A;  4JYY A;  4JZ2 A;  2WLI A;  1NI8 A;  4J7J A;  1YVW A;  3OEH G;  3ZMV A;  3DXR B;  5EC2 C;  2Z0A A;  4WFE A;  4MVS A;  4DW0 A;  3CCM V;  3M8A A;  3L71 H;  1CXZ B;  1K4D C;  2EIK C;  3K06 A;  1SKV A;  4JI7 B;  3CP1 A;  3T1Y B;  4ZOL A;  2FYU H;  1PP9 H;  2Y0P A;  4KFM A;  3ZN0 A;  2QM8 A;  1WA8 B;  3BY6 A;  2HHH B;  1DTO A;  1VQM V;  3K9S A;  2OCC C;  4X9Q A;  3ZMZ A;  3G6B A;  5B3S B;  3P3P A;  4EB6 A;  1CP9 A;  2OIE A;  5CA0 B;  2N04 A;  3CEI A;  2ITD C;  1JFF B;  2IJH A;  3G6E V;  1GO3 F;  3JAR B;  3GWO A;  4LBE C;  5B1N A;  2E75 B;  4DV5 O;  1ZLZ A;  4Z1M G;  3ZMT A;  1RM1 C;  4MVM A;  2H94 A;  2CTW A;  4PA9 A;  1KYO F;  4LF5 O;  4GUN A;  1Y6X A;  3RW0 A;  4CC6 A;  4K35 A;  1NR1 A;  5LMU O;  1MOF A;  2Q73 A;  1K5S A;  1WP7 A;  4GKJ B;  4FLW A;  3QTC A;  3DC6 A;  1K7D A;  1Q5O A;  2CTP A;  1VQ4 V;  2ZCE A;  3AG1 B;  4BIO A;  1J5E O;  5KHH A;  1HNW O;  2Q8V A;  1H2K A;  3BEH A;  3K03 A;  4HNA B;  2B1I A;  4UCV A;  2Y0I A;  4JTC B;  1L0N H;  2CE4 A;  1Q8I A;  4XDK A;  2A3Q A;  1AJQ A;  1JPX A;  3LDD A;  1QCE A;  2JJ2 G;  1S3J A;  3P30 A;  2F4V O;  3OUF A;  1VP7 A;  3OM3 B;  2UUC B;  3QO8 A;  4O2B A;  5HFL A;  4I0X B;  5IWA O;  4I4T A;  1JQ0 A;  2XUM A;  2F93 B;  4X1K B;  4ZI7 A;  4DV7 B;  1Y66 A;  3ZHT A;  1XMQ O;  4KHP O;  3OFN G;  3UQ8 A;  2JRI A;  3L74 H;  5CB4 B;  3CCJ V;  2F66 C;  2P4K A;  2QDO A;  1RP3 B;  2GTA A;  3ABM C;  5CA3 A;  4TQD A;  1THZ A;  4X1I B;  1KU9 A;  4TV8 B;  1IBM O;  4B3M B;  4LC1 A;  1YIJ V;  2Z5U A;  2EZP A;  3U10 A;  1M5I A;  4JI8 B;  4OX9 O;  1Q7Y W;  3P3N A;  4I7Z B;  4JZG A;  2UUA O;  2Q9L A;  1JJO A;  4F6R B;  3SPG A;  5LXT B;  4BIZ A;  3T4D A;  2CGN A;  2HVJ C;  5ITZ A;  2RN9 A;  1I5Y A;  1FJG O;  3JAT A;  1FFT B;  2N74 A;  3K08 A;  2ZNI A;  4DV2 O;  2P6J A;  3CD6 V;  3ASN B;  3Q4H B;  4YJ2 B;  2VWJ A;  5LA6 B;  3L73 H;  1UJW B;  3RVY A;  1KD1 W;  3CB2 A;  2M6Y A;  2YIA A;  2HFE C;  4CH6 A;  1P7B A;  4P9P A;  5JJJ B;  4B3T O;  4PEL A;  2CTR A;  2ZNJ A;  4PDV A;  1M1K W;  3OR7 C;  1QVF U;  3ABL B;  2QWN B;  4TUY B;  1XQ8 A;  2HKO A;  4YHH B;  2D2C B;  5IYZ B;  1GN3 A;  5KMG B;  5KHI A;  2DQ3 A;  3T1H O;  5JH7 A;  3THO A;  1PNM A;  5BR8 B;  4JYA O;  4QGP A;  2AGA A;  1M56 C;  1XIL A;  4CS3 A;  5JCO C;  4P30 A;  3FB5 C;  5JCO A;  1HNX O;  5B66 Z;  3HPL C;  3ZRW B;  4MVQ A;  1EZV H;  4N21 A;  3B40 A;  4JF3 A;  4AQY B;  1RSO B;  1SQP H;  2X7R B;  4NVP A;  1BMF G;  2X6A A;  3CC4 V;  1OCZ C;  4O4H A;  2E76 B;  2XAG A;  1WLE A;  5LGU A;  5BMV B;  4LR3 A;  4UUJ C;  3J81 N;  4IIJ A;  1KB9 F;  4PDM A;  3L70 H;  2OYQ A;  3OTO O;  4FLZ A;  4J11 A;  5B1B C;  5LHG A;  4MW3 A;  1XNR O;  3E8F A;  2PI4 A;  3U11 A;  3ZMS A;  1U96 A;  4WBN B;  2LP7 A;  2ZXW B;  3SYQ A;  1GRJ A;  1XHZ A;  3G4S V;  4WFB V;  4DR1 B;  1NTK H;  3RYH A;  1WN7 A;  2W6J G;  2ODM A;  5H6Q A;  2CH7 A;  1QBZ A;  3CMA V;  1HW7 A;  4H37 A;  2R70 A;  5LHI A;  1XRE A;  4K3A A;  1N36 B;  2QJ1 A;  1Y74 B;  4KUM A;  1VMG A;  3D36 A;  3EFF K;  2QM7 A;  3RYF A;  3W7U A;  3F5T A;  4LP8 A;  1FFX B;  1WJZ A;  5CN0 A;  4TT3 G;  2YSU B;  3UT5 A;  4JPR A;  4OPH A;  2DYR B;  3AG4 C;  1NS1 A;  1EBO A;  2OIG A;  3JCU Z;  4O4I A;  1F23 A;  3R66 A;  3LNN A;  2Y69 C;  4BWA A;  2HR3 A;  1ZSP A;  1XUQ A;  2HVK C;  3SJQ C;  2HJF C;  4UB6 Z;  4H13 B;  3QG5 A;  1YCI A;  1EFR G;  4PDL A;  4JTD B;  3NXS A;  1I7F A;  3JCZ A;  2ZE6 A;  2ATK C;  1JA8 A;  1W0K G;  3CJH B;  1S72 V;  2NLJ C;  3HKB A;  3ML0 A;  3CCQ V;  3ABT A;  1SQG A;  2QWR B;  4PA6 A;  3JD1 A;  2ZR2 A;  1GN4 A;  3MHH C;  1F4M A;  4FLX A;  4IHJ A;  1XEQ A;  3OGI B;  3JAM N;  1A32 A;  2ADP A;  5BY1 A;  3A2F A;  1Z5W A;  3T4Z A;  4P9O A;  4DK1 A;  1JOY A;  4LF5 B;  1WA8 A;  3L72 H;  3CPW U;  3AK1 A;  4X20 B;  1F7Y A;  5LMU B;  4MVR A;  1MZF A;  1TUB B;  1KP2 A;  4LFB O;  2DQ0 A;  3UO3 A;  2EIM B;  4JI5 B;  5EYP B;  3H1H H;  2UUC O;  5CA0 A;  1H8H G;  1J5E B;  1JFF A;  1ENV A;  2R9I A;  2IU0 A;  2ILM A;  1OCC B;  4GLX A;  2ZIO A;  4K8Z A;  4I50 A;  5DEC A;  5B1A B;  1KBH A;  1M57 C;  2DWE C;  1R6N A;  1ZAU A;  2AHY A;  1OCR B;  1Y76 A;  4D6T H;  1LNQ A;  1Q3E A;  3STL C;  5LL6 Y;  2WLK A;  3MDS A;  2AW9 A;  4FJC C;  1SF9 A;  4MVZ A;  2R72 A;  2WLN A;  1Z5V A;  5BXZ A;  2IW5 A;  2DMX A;  3ZX6 A;  4ZHQ B;  4DK0 A;  4U3F H;  2AZ0 A;  2QE7 G;  3H1L H;  4J7K A;  1PD3 A;  3OUS A;  1I08 A;  1FKA O;  4KHP B;  1BSM A;  1XNQ O;  5LBQ A;  4DXW A;  1VF6 A;  4HNA A;  4GCZ A;  3CSX A;  4PI2 A;  4EKW A;  4DV0 O;  2KB1 A;  1JVM A;  1SER A;  1V55 C;  1IBM B;  4IL6 Z;  4BIU A;  3CCR V;  1ZX3 A;  1YTF B;  2B1G A;  2EX3 A;  2ZDI C;  2R9A A;  2Q0O C;  5L3G A;  1L0L H;  4DW1 A;  2UUA B;  3FB8 C;  2JDI G;  3ZJZ A;  3OE7 G;  4OGQ B;  1YEW A;  1FJG B;  1IXB A;  1VQK V;  2JS3 A;  1GK9 A;  1QQC A;  4AIL C;  5KX5 B;  4DV2 B;  1Q81 W;  3X2Q C;  5CB4 A;  1I0H A;  3CRM A;  5C8Y B;  3K3W A;  3KZI Z;  4J9Z B;  4YHH O;  5IJ9 B;  2JEX A;  1AI4 A;  4X1I A;  1V54 B;  3OT7 A;  4TV8 A;  1GH6 A;  5BR8 O;  2F95 B;  5L3B A;  2LO1 A;  1HNZ O;  5CBF A;  2GBO A;  3IAY A;  3O9O A;  4FMT A;  1TVK B;  4AQY O;  3LSS A;  2YDE A;  2A7W A;  2MW2 B;  4L8J A;  3T1H B;  3EHB B;  5GTH Z;  4LFA O;  3EXA A;  2YI8 A;  2R9R B;  2QTS A;  5KHG A;  4UVA A;  5KLV H;  3BCC H;  3Q4H A;  3DSQ A;  2Y4U A;  2W0F C;  4WFG A;  2EIL C;  4DYL A;  4QNH B;  2RJZ A;  1YDX A;  1QR8 A;  3J7A U;  1WP8 A;  1BL8 A;  2IU3 A;  1BGY H;  5LYJ B;  4U3J B;  2WAM A;  3JAK B;  4TUY A;  1CEZ A;  1GM7 A;  1YXB A;  5KMG A;  3SPI A;  4LF7 O;  4NR1 A;  4QE7 A;  1MA1 A;  3K58 A;  3CC2 V;  3WB2 A;  2HP8 A;  1XNR B;  5FNV A;  5KAF Z;  5EBL C;  1KKD A;  3ZRW A;  1R6T A;  3ASO B;  4JTA B;  4LF9 B;  1W59 A;  2M7W A;  2YIB A;  4TV9 B;  1MZE A;  3ETG A;  2ADQ B;  2P5O A;  1RSO A;  3H1K H;  3K59 A;  3K5N A;  1PM9 A;  4X88 A;  2YXL A;  1I5X A;  2XOK G;  3BHP A;  5J9P C;  3CRC A;  1NH2 B;  2PYJ A;  4NXN B;  3JD2 A;  3WB0 A;  3TET A;  1Q6H A;  1URF A;  2ZIN A;  3BPZ A;  5K1X A;  4JYB A;  3K04 A;  3CE2 A;  1KMI Z;  1XDC A;  4MTO A;  2WWW A;  3D3I A;  3CC7 V;  2P7T C;  1K33 A;  2AXT Z;  2XHB A;  4WBN A;  4PI0 A;  4FM0 A;  1Q86 W;  1N0N A;  3N27 A;  4IGG A;  1WNS A;  3SPJ A;  1B3Q A;  1K8A W;  1NZ6 A;  1E1Q G;  2X6C A;  4GZR B;  1GKF A;  1P4R A;  1B06 A;  2W0X A;  2FTK A;  3D3Q A;  4W4K A;  5IT9 N;  5IYD O;  4W4L A;  3JAW B;  3O65 A;  1FFX A;  2LW1 A;  5B5E Z;  2RNB A;  5IDJ A;  1COW G;  2DYR C;  5JJE B;  1FXV A;  1FAF A;  4H0L B;  4JGS A;  2CUG A;  2JIZ G;  4UCR A;  1VQP V;  2DN9 A;  3CXH F;  3U0Z A;  2NNU A;  2JGD B;  4JI5 O;  2E3C A;  1KQS U;  4OPA A;  4NTX A;  3MD0 A;  4O2A B;  5D5P A;  3JD3 A;  3AG3 B;  4XDL A;  4H33 A;  4LFC O;  3SYC A;  4K0K O;  1VQ8 V;  4ZIB A;  1GMG A;  4LFB B;  4LWS B;  4FLU A;  3JAL B;  3FAV B;  2QGN A;  4RUF A;  2NN4 A;  4LF6 O;  2Q4P A;  3E8G A;  1IBK B;  1OV9 A;  2UXN A;  4PJ0 Z;  1HP8 A;  2XAS A;  5CMU A;  5JQG B;  1NTM H;  4DV1 B;  1JX9 A;  3HKC B;  2IM9 A;  3RT3 C;  3H1J H;  1QR9 A;  5L3C A;  1FXK B;  4DV4 B;  2YXH A;  1LR1 A;  4X20 A;  4ASU G;  5F2V O;  1NU1 H;  4DR6 O;  2EIM C;  2FKX A;  2A9H A;  4DR5 B;  4A5U B;  2ETN A;  1R3I C;  2ZE7 A;  1X59 A;  1XNQ B;  1NBM G;  1P49 A;  2CAZ C;  2DYS B;  3FKS G;  5EZY A;  2EIN B;  2GDS A;  2WLH A;  4DV0 B;  3AG2 C;  2ZD9 A;  1OCR C;  3G67 A;  2DOS A;  4Q6G A;  4YY3 O;  1SS3 A;  2BTQ B;  2YC0 A;  3CWB H;  3ABK C;  4J80 A;  4UCO A;  1KC8 W;  4ZHQ A;  1K97 A;  5KHJ A;  2EIJ C;  1Q90 D;  4BW9 A;  4ZKI A;  4IYI A;  4CBC A;  1NVP B;  1IDS A;  2ZIM A;  4QPK A;  1WPB A;  2DWD C;  4X1Y B;  3BA9 A;  2Q68 A;  4FVM A;  2OTJ V;  3G71 V;  4WF9 V;  3ZMU A;  3EVK A;  4UFZ A;  3OMN B;  2IJK A;  4JAU A;  1N33 O;  3H01 A;  1HNZ B;  1AB3 A;  2DJV A;  4WCE V;  4I55 B;  4R7C A;  4BAY A;  4DUY O;  1QVG U;  2QKC A;  4JI6 B;  1MAB G;  1B6Q A;  1G6U A;  1AR1 B;  5JVD A;  3CX5 F;  3SJB C;  4LFA B;  3SDL A;  5KX5 A;  5H9C A;  1SZT A;  1ZWI C;  2MK3 A;  5BZB A;  1QLE B;  3ETD A;  5C8Y A;  4X66 O;  1K34 A;  2Q0A A;  3E83 A;  2Y48 A;  5L3F A;  1H38 A;  1PNK A;  4BR6 A;  2YEV B;  3I5D A;  1AI5 A;  2X0L A;  2WLI B;  1YF2 A;  1BS3 A;  4DV3 B;  3QF7 A;  2E74 B;  4R50 A;  4O4J B;  4LF9 O;  1F4N A;  2H8P C;  1TVK A;  2B9Z A;  2PYL A;  2EIK B;  3S3W A;  1AI6 A;  4DR4 B;  4ICG A;  2A79 B;  1K3E A;  2DW4 A;  4J7Z A;  2HLD G;  4LF7 B;  1K4C C;  1SET A;  4NXN O;  2YUA A;  2OCC B;  3D36 C;  4RQF A;  3KCY A;  1NQT A;  1QNM A;  5DM6 V;  4J10 A;  3WG7 C;  4B08 A;  1SC5 B;  4PHZ A;  3CCL V;  4FZ1 A;  2EJR A;  1B04 A;  5LP6 B;  4E4E A;  4HYO A;  2JGU A;  2Q6A A;  3BFR A;  3F5W C;  5LHH A;  3RYC B;  1OCO C;  5LYJ A;  2JS5 A;  5AG2 A;  4QE9 A;  3JAK A;  5JJN B;  3K5O A;  4CZZ A;  4Z1V A;  1RM1 B;  1W2B U;  5LMN O;  5H6R A;  3IC9 A;  2VS0 A;  1F51 A;  3E86 A;  2P06 A;  3E89 A;  1ARO P;  1NVP D;  3JAS B;  3H1I H;  1M90 W;  4TV9 A;  4QPJ A;  3APO A;  3LSQ A;  1VQN V;  4CH3 A;  4X89 A;  3FYE B;  4F4L A;  3VOU A;  4UCU A;  2RCV A;  1SZX A;  3DXR A;  1M9N A;  1Q43 A;  2HG5 C;  2UXB O;  2UXD O;  3B77 A;  5CA1 B;  1NTZ H;  2QWO B;  3T2M A;  1KKC A;  1NKD A;  3K0D A;  2YIB D;  4TOI A;  1YJW V;  1N8R W;  4O2B B;  5B3S C;  1IX9 A;  3TXS A;  1IBL B;  2WLM A;  4KXR A;  1GN6 A;  1J95 A;  4JAV A;  3D8C A;  4KL1 A;  3FYI B;  4TSF G;  4X62 O;  1VQ9 V;  3AK3 A;  5D5Q A;  4JV5 O;  5KUM A;  3SGI A;  4Q20 A;  4OXS A;  3ZS8 C;  1IBK O;  3TCU A;  3JAR A;  3E35 A;  3ABM B;  4LFC B;  4MVU A;  3JAW A;  3IC7 A;  4NYK A;  4K0K B;  1KP3 A;  3NR7 A;  5GON B;  4DV1 O;  4UXN A;  1VQ7 V;  4DV4 O;  5FPO A;  2GHY A;  3B8N A;  2VQF B;  4CS4 A;  5E79 Z;  4LF6 B;  2CDY A;  1PL0 A;  4GX5 A;  5ITZ B;  2EUL A;  2F1M A;  3AG1 C;  2A0L A;  1YIT V;  4DR5 O;  4JAS A;  1JR9 A;  5L3E A;  3ZHU A;  4O2A A;  3J80 N;  2FB5 A;  3F7Y C;  1VF6 C;  4O4L B;  5C93 A;  5EBW C;  2LGQ A;  1BT8 A;  2FL4 A;  2WPD G;  1XL4 A;  4UVC A;  2EZO A;  1EN6 A;  3ETQ A;  3DC5 A;  1BE3 H;  2QSA A;  4PA4 A;  4P2Z A;  1D5A A;  4LWS A;  4DR6 B;  1VQL V;  3FAV A;  4YJ3 B;  1MG1 A;  1RPO A;  4I0X A;  3TK1 A;  3RN4 A;  4H44 B;  4XBF A;  2LGW A;  1TGO A;  2YS8 A;  2OTL V;  1US6 A;  4PDR A;  2CTQ A;  4X1K A;  1H2S B;  4L87 A;  1Z2G A;  2YI9 A;  4FZ0 A;  5JQG A;  3HKC A;  3ZRV A;  3LUT B;  1G4Y B;  1M56 B;  2EJ7 A;  1M4U A;  1GM9 A;  4YY3 B;  2H3O A;  2IH3 C;  3SYA A;  4JI3 B;  3FD9 A;  4PA7 A;  1DF4 A;  5EIB D;  4DR7 O;  3FB6 C;  4LH6 A;  3N2K B;  3ZRX A;  3A0H Z;  4HZ3 A;  4GKK B;  4O4H B;  1YJN V;  2AHZ A;  1OCZ B;  4CC5 A;  5J2T B;  3STZ C;  3FB7 C;  2XAH A;  5FL7 G;  4F6R A;  4NKG B;  5LXT A;  4JAA A;  1Q6U A;  3HKE B;  4IIJ B;  4JI6 O;  1QLN A;  3CRQ A;  3UCS C;  3E22 B;  2GV9 A;  4PV1 B;  1TA8 A;  5B1B B;  1N33 B;  3ASN C;  4LF8 B;  3MAQ A;  4DR3 O;  1ZL8 B;  4YJ2 A;  1XOU A;  5LA6 A;  3H9V A;  4X65 B;  3TJT A;  5A9G A;  4DUY B;  4HBN A;  2A06 H;  2L6L A;  1AP6 A;  2XAF A;  4NXM B;  1GTO A;  2LW7 A;  4MW8 A;  3G80 A;  2Z3Y A;  2OT5 A;  3K5M A;  4DV3 O;  1HDJ A;  5E1A C;  1WB7 A;  4IT5 A;  3JSN A;  3ABL C;  5L3D A;  1AJP A;  4FM2 A;  4DR4 O;  4B7E A;  3RYF B;  3N2G B;  5IYZ A;  4X66 B;  1XHX A;  4X8A A;  2XAQ A;  4MTX A;  2BE3 A;  4CS2 A;  1LUV A;  5KAI Z;  4AI8 A;  3UT5 B;  2AZ2 A;  2UUB O;  3LDC A;  2QKS A;  4K8X A;  3OMA B;  3I56 V;  3AG4 B;  4C7U A;  3ZHS A;  4I55 A;  1I94 B;  4YIO A;  3UM7 A;  2Y69 B;  1BQZ A;  2RMK B;  4TQF A;  1FD9 A;  2KG7 B;  3ZHV A;  5A2Q N;  4JI4 B;  2ZM6 O;  1G1X B;  2JEU A;  5IY5 B;  2XAJ A;  2G38 A;  4EEQ A;  1IXM A;  2UU9 B;  3LSU A;  3VQY A;  1VQO V;  5BMV A;  3AEI A;  2OCH A;  3JSL A;  4ZBM A;  1YTF D;  3HKD B;  3ZHR A;  2YEV A;  3ICX A;  4LF4 O;  4UVB A;  2ZKO A;  5FPR A;  1R6K A;  3OR6 C;  1FXH A;  1AR5 A;  4G28 B;  2Q7E A;  3CYO A;  5B1O A;  4O4J A;  4JYC A;  1R73 A;  2ZXW C;  4IHJ B;  3KKY A;  4DRX B;  1W0J G;  3TGU H;  2VQE B;  2PGG A;  4PD4 F;  1NJI W;  3C90 A;  4DO2 A;  5KA6 A;  2Q69 A;  1BHA A;  5LMN B;  2FML A;  5KA5 A;  1S5H C;  3AK2 A;  2Q5Z A;  3ZRS A;  1Y74 A;  1D5N A;  1XBL A;  2DE0 X;  1P84 F;  1S0V A;  1H8E G;  4NTW A;  2KQX A;  2F43 G;  1K73 W;  1NR7 A;  5LP6 C;  4YIP A;  5EK0 A;  5LP6 A;  4DUZ B;  3B4S A;  4J9Y B;  2LJ2 A;  3RYC A;  3QVN A;  1RPR A;  2JK5 C;  2UXB B;  2UXD B;  3OD4 A;  1IBL O;  3CCE V;  4GT1 A;  3ZHQ A;  4I50 B;  2BSK B;  1BCC H;  1M57 B;  3W7W A;  4MS2 A;  2B5U A;  1K5Q A;  1PNL A;  2P4V A;  1R3L C;  1Y76 B;  3FX7 A;  1R3K C;  2LFR A;  2XND G;  4QIW F;  2XT9 A;  2VWK A;  2QA4 V;  3JAS A;  3WB1 A;  3CCU V;  4X64 B;  4NB5 A;  1DLB A;  4MTG A;  3ZN1 A;  4UV8 A;  3CJH A;  3DGE A;  1DF5 A;  1UPG A;  5GW7 A;  3GVM A;  1AIL A;  2VQF O;  4X62 B;  3K5L A;  5EIB C;  1H2N A;  3WU2 Z;  4JV5 B;  1OJH A;  4FPP A;  5CA1 A;  1FPO A;  1P7G A;  1DGS A;  2E5L O;  1PPJ H;  2QTO A;  1S76 D;  3K9A A;  1R1B A;  3SPH A;  4D7S A;  3OTF A;  4JI0 B;  1V55 B;  3W7T A;  3GB7 C;  1VQ6 V;  1SQQ H;  3APQ A;  1XL6 A;  3BVO A;  4YXW G;  3HB3 B;  4B3R B;  2WLL B;  1NH2 D;  3ZED A;  1ZUQ A;  3K0G A;  1H2G A;  1TUB A;  1JJ2 U;  1TUE B;  1N34 O;  3E8B A;  2QM4 A;  3QO5 A;  4R6Z A;  5EYP A;  2P90 A;  1MSD A;  3BRC A;  5CBG A;  1D2D A;  3X2Q B;  1N4C A;  3JD0 A;  1GM8 A;  1OCC C;  1PL4 A;  3CCV V;  2YID A;  5B1A C;  2V1D A;  4FLV A;  4JI2 B;  5HFM A;  5GON A;  4FM1 A;  1V9P A;  1VQ5 V;  4JI1 O;  1YZB A;  1PV0 A;  3SYO A;  3SYP A;  3RYI B;  3QNE A;  5JWP A;  2BOB C;  2K9P A;  4JI3 O;  2PUS A;  1ROP A;  1OZ0 A;  1HR0 B;  3E8H A;  2UXC B;  1VF7 A;  5J2U B;  1R3J C;  4LNU B;  4GKK O;  4G27 B;  1Y4M A;  3ETE A;  2CGO A;  4B7K A;  1SA0 B;  5IYC O;  4O4L A;  2HEP A;  4FFB B;  3RBZ A;  2P67 A;  3UO2 A;  4DV6 B;  4DR7 B;  2ZQM A;  2GUZ B;  4WFH A;  4IYH A;  2EIL B;  4GX0 A;  4LF8 O;  4YJ3 A;  1BHB A;  5K1P A;  1QHT A;  4X65 O;  2GSM B;  3SJA C;  4NXM O;  4UV9 A;  3SR2 C;  2RDC A;  3K57 A;  4B3S B;  5LGN A;  4MVO A;  4MSW C;  4CH4 A;  5FNV B;  2UXX A;  5LOV B;  4FLY A;  4DR3 B;  3T1C A;  5DED A;  3IGA C;  5IJ9 A;  5EC1 C;  1V54 C;  4F6E A;  1WAZ A;  4FK5 C;  3CHX A;  3VQX A;  3N2K A;  5IJ0 B;  4DR2 O;  3IFX A;  2KSD A;  1CPY A;  2EBO A;  2QWQ B;  5J2T A;  3CXC U;  1JMK C;  3PN1 A;  1I94 O;  2VRZ A;  3FFQ A;  4JI4 O;  3HKE A;  4AHC A;  4Z2W A;  1AP5 A;  3E22 A;  4N23 A;  4ZOL B;  1SES A;  2Y4T A;  1XMO B;  2UUB B;  2UU9 O;  4U7N A;  3BAB A;  3KG2 A;  2BCC H;  2RQ6 A;  3RVZ A;  1ZL8 A;  1N32 O;  1EN4 A;  4KP4 A;  1AVM A;  3CCS V;  4EB6 B;  5H2F Z;  1JCH A;  4UB8 Z;  2ZM6 B;  1DK1 A;  2LQT A;  3CRA A;  2YIC A;  4FIP C;  4EFB A;  1GAX A;  3R65 A;  4XDJ A;  2V7Q G;  4U3J A;  2K1E A;  2IJJ A;  3BA8 A;  3MHS C;  2JJ1 G;  2VQE O;  2PI5 A;  1YHQ V;  4JI7 O;  3S3X A;  3N2G A;  3T1Y O;  5TIS Z;  1VIB A;  4LF4 B;  3ZBH A;  2ARH A;  2HHH O;  3ASO C;  3L75 H;  2PY5 A;  4NTY A;  2KG7 A;  2P22 C;  3RWR D;  1SQB H;  2C2A A;  3ABU A;  3LDE A;  3L9D A;  3LNM B;  3SJC C;  5IY5 C;  4DUZ O;  3OEE G;  1L1F A;  3P32 A;  1AI7 A;  1S77 D;  3K79 A;  3I55 V;  3HKD A;  3UKM A;  4RAI A;  2F23 A;  2WA4 A;  3VBB A;  1YJ9 V;  1LUW A;  3OMI B;  3B8M A;  4GX1 A;  1TAE A;  2HJD A;  3JD4 A;  4I4T B;  3C3T A;  2PTM A;  3TXQ A;  3WFV A;  4GKJ O;  4X64 O;  4DRX A;  2N05 A;  4ZI7 B;  4TWK A;  2L35 A;  4DV5 B;  3F7V C;  1SQF A;  4UCS A;  3OW2 U;  1IZ3 A;  1KEC A;  4RQE A;  4G2K A;  2LFS A;  2XTA A;  4LCU C;  4MT8 A;  2CK3 G;  3RFR A;  1FYJ A;  5LGT A;  3SPC A;  5KUK A;  1YSC A;  1E1R G;  1OHH G;  1AJN A;  4JI0 O;  1HNW B;  1K92 A;  2PF4 E;  4B3R O;  5EZY B;  1X4T A;  4I9Q A;  4WFF A;  4DV7 O;  2PZS A;  3M7M X;  1L8D A;  2E5L B;  1H2M A;  3W7X A;  1VAR A;  2ZT9 B;  2BSK A;  3JAT B;  2JGD A;  3DTU B;  3B2E E;  3AG2 B;  2QWP B;  4GYC B;  1WPX A;  1M93 A;  2F4V B;  2ZR3 A;  3AG3 C;  1KUQ A;  4I5S A;  1ORQ C;  5IWA B;  4E2L A;  3ABK B;  4JI2 O;  1O9G A;  3VQW A;  3IJ4 A;  1E79 G;  4B3M O;  2EIJ B;  3HR0 A;  3A0B Z;  2OWO A;  3M99 B;  1N34 B;  3PJS K;  3JAL A;  4JI8 O;  2BTO A;  1EZJ A;  4RUE A;  4GX2 A;  2YXY A;  1XMQ B;  1SQX H;  1O9H A;  1RFY A;  2W6I G;  3E2E A;  1G8M A;  5GTI Z;  1HR0 O;  2UXC O;  4PA3 A;  4D7T A;  1Q82 W;  2QEX V;  5H5N A;  4HAM A;  5JH7 B;  2QKA A;  2V4D A;  1WB8 A;  4WFA V;  1IUR A;  1T5E A;  4JI1 B;  1FXK C;  1FXK A;  5DN6 G;  4OX9 B;  2QR4 A;  3W7S A;  2ZDI A;  4BW5 A;  2JVD A;  2GTS A;  4DV6 O;  1H2L A;  3RGB A;  2WLL A;  3GWK C;  5JVD B;  2WSS G;  3ZIA G;  3A0R A;  3OAA G;  1SQV H;  1BQ0 A;  5EBM C;  4EFE A;  2O57 A; 
#chains in the Genus database with same CATH homology
 2UU9 O;  4JI1 O;  1YZB A;  3M8A A;  2LW7 A;  4LFC O;  4DV3 O;  1R6T A;  4K0K O;  1N32 O;  1FYJ A;  4DR5 O;  1XMQ O;  4JI3 O;  4B3S O;  5LMN O;  4KHP O;  4JI0 O;  2JRI A;  1N33 O;  3J80 N;  1XEQ A;  1IBL O;  3JAM N;  1DK1 A;  3J81 N;  4DR4 O;  1A32 A;  1AB3 A;  2DJV A;  5BY1 A;  4LF6 O;  4GKK O;  3OTO O;  4B3R O;  1IBM O;  2UUB O;  4DUY O;  4DV7 O;  1XNR O;  2VQE O;  4OX9 O;  4YHH O;  4JI7 O;  1F7Y A;  3T1Y O;  2UUA O;  3SDL A;  3RT3 C;  5BR8 O;  2UXB O;  5A2Q N;  2UXD O;  4LFB O;  2ZM6 O;  1G1X B;  2HHH O;  4LF8 O;  1HNZ O;  4DV5 O;  1KUQ A;  1AIL A;  2VQF O;  1FJG O;  2UUC O;  4X66 O;  2N74 A;  4JI2 O;  4DV2 O;  4X65 O;  4B3M O;  4AQY O;  1XMO O;  4LF5 O;  2E5L O;  4DR6 O;  2FKX A;  4NXM O;  4JI8 O;  4DUZ O;  1R1B A;  3F5T A;  5LMU O;  4A5U B;  4LF9 O;  4LFA O;  4DR7 O;  1X59 A;  4LF4 O;  5IT9 N;  2ZKO A;  1HR0 O;  2UXC O;  4OPH A;  4DR1 O;  1NS1 A;  4B3T O;  5LL6 Y;  4X62 O;  1J5E O;  5H5N A;  3O65 A;  3R66 A;  5FLX N;  1HNW O;  4JV5 O;  5BXZ A;  2DOS A;  1IBK O;  4DR2 O;  1N34 O;  4NXN O;  4YY3 O;  4JI6 O;  1N36 O;  3J7A U;  4DV1 O;  3T1H O;  1FKA O;  4DV6 O;  4GKJ O;  4JYA O;  4X64 O;  1I94 O;  1XNQ O;  1D2D A;  2AGA A;  4DV4 O;  4JI4 O;  2F4V O;  1HNX O;  4DR3 O;  4JI5 O;  4DV0 O;  5IWA O;  4LF7 O;  2Z0A A;  4OPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...