4K12A

Structural basis for host specificity of factor h binding by streptococcus pneumoniae
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
GSHMSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement factor H
publication title Structural determinants of host specificity of complement Factor H recruitment by Streptococcus pneumoniae.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/choline binding protein
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4k12A00
2EHFA 1HCCA 1H04P 1TPMA 4MUCA 3GXEA 1GKGA 1VVDA 3T5OA 1GHQB 1QGBA 2MCYA 1Z92B 4FXGG 1G4FA 1HFIA 2CG7A 5JPMG 3ERBA 2O39C 1H2QP 1OK9A 2RLQA 2W81A 2CKUA 1E8BA 1SRZA 3GOVA 1Q3XA 3OXUD 1MD7A 4LOSA 1FBRA 1PPQA 3RJ3D 2IZ4A 3KXVA 3KZJA 2BZMA 4AYIA 5HYUB 4ZH1D 2XRDA 4WJG2 2JGWA 3IX0A 1U5MA 4KKDA 4J38B 2EC3A 5FO8C 2QY0A 2KRIA 4CSYA 1G4GA 3NFPI 3ZRZA 1TPGA 2B5ID 2RKYA 3OEDC 1OJYA 3TVJA 2JRAA 3SW0X 1E88A 5I0QB 2A55A 2JGXA 4F4OC 1ELVA 4B2SA 3EJHA 4PZ5A 2RL0A 1CKLA 2G7IA 1OJVA 1OK2A 1GKNA 3ZD1A 2XWBF 4YNXA 1C1ZA 3L89M 1UOTP 5HYPA 3OP8A 2XRBA 4ONTD 2CG6A 1OK3A 3O8EB 4LOTA 1TPNA 2XWJI 1QUBA 1SS2A 1GPZA 1H03P 5HYTB 3R62A 1ZJKA 2KMSA 3CALA 4IGDA 4AYEA 4C16A 1LY2A 1O9AA 1MD8A 2YRAA 2MCZA 3ZD2A 4B2RA 2LOJA 1OK1A 1VVCA 2XQWC 4K12A 5HZPB 4A5WB 3MQLA 4AYMA 4AYDA 2YBYA 2ERJA 3INBC 2UWNA 1HFHA 2RKZA 3IU3I 1OJWA 2WIIC 2RLPA 1H2PP 1NWVA 1E5GA 2IZ3A 1QO6A 3M7PA 2W80A 2V8EA 4DJZA 4JHSA
chains in the Genus database with same CATH superfamily
2EHFA 1HCCA 1H04P 4PO7A 1TPMA 4MUCA 3GXEA 4N7EA 1GKGA 1VVDA 3T5OA 1GHQB 1QGBA 2MCYA 1Z92B 4FXGG 1G4FA 4BWCA 1HFIA 2CG7A 5JPMG 3ERBA 2O39C 1H2QP 1OK9A 2RLQA 2W81A 2CKUA 1E8BA 5DN5A 1SRZA 3GOVA 1Q3XA 2I2LA 3OXUD 1MD7A 2X2ZA 4LOSA 1FBRA 1PPQA 3RJ3D 5DN4A 3F6KA 2IZ4A 3KXVA 3KZJA 2BZMA 4AYIA 5HYUB 3NJAA 4ZH1D 2XRDA 4WJG2 2JGWA 3IX0A 1U5MA 4KKDA 4J38B 2EC3A 5FO8C 2QY0A 2KRIA 4CSYA 1G4GA 3NFPI 3ZRZA 1TPGA 2B5ID 2RKYA 3OEDC 1OJYA 3TVJA 2JRAA 3SW0X 1E88A 3ZLDA 5I0QB 2A55A 3FGRA 2JGXA 4F4OC 1ELVA 4B2SA 3EJHA 4PZ5A 2RL0A 1CKLA 2G7IA 1OJVA 1OK2A 1GKNA 3ZD1A 2XWBF 4YNXA 3K3TA 1C1ZA 3L89M 1UOTP 5HYPA 3OP8A 2XRBA 4ONTD 2CG6A 4YIZA 1OK3A 3O8EB 4LOTA 1TPNA 2XWJI 1QUBA 1SS2A 1GPZA 1H03P 3VWOA 5HYTB 2ZYCA 3R62A 1ZJKA 2KMSA 3CALA 4IGDA 3WSYA 4AYEA 1LY2A 1O9AA 4C16A 3CI0J 1MD8A 2YRAA 2MCZA 3ZD2A 4B2RA 2LOJA 1OK1A 1VVCA 3FGTA 1RLHA 2XQWC 4K12A 3WSXA 5HZPB 4A5WB 3MQLA 4AYMA 4AYDA 3ZLEA 2YBYA 2ERJA 3INBC 4APLA 2Y8TA 2UWNA 1HFHA 2RKZA 3IU3I 1OJWA 2WIIC 2RLPA 1H2PP 1NWVA 1E5GA 2Y8RA 2IZ3A 4MSLA 1QO6A 3M7PA 2W80A 2V8EA 4DJZA 2Y8SA 4JHSA
chains in the Genus database with same CATH topology
2EHFA 1HCCA 1H04P 1TPMA 4MUCA 3GXEA 1GKGA 1VVDA 3T5OA 1GHQB 1QGBA 2MCYA 1Z92B 4FXGG 1G4FA 1HFIA 2CG7A 5JPMG 3ERBA 2O39C 1H2QP 1OK9A 2RLQA 2W81A 2CKUA 1E8BA 1SRZA 3GOVA 1Q3XA 3OXUD 1MD7A 4LOSA 1FBRA 1PPQA 3RJ3D 2IZ4A 3KXVA 3KZJA 2BZMA 4AYIA 5HYUB 4ZH1D 2XRDA 4WJG2 2JGWA 3IX0A 1U5MA 4KKDA 4J38B 2EC3A 5FO8C 2QY0A 2KRIA 4CSYA 1G4GA 3NFPI 3ZRZA 1TPGA 2B5ID 2RKYA 3OEDC 1OJYA 3TVJA 2JRAA 3SW0X 1E88A 5I0QB 2A55A 2JGXA 4F4OC 1ELVA 4B2SA 3EJHA 4PZ5A 2RL0A 1CKLA 2G7IA 1OJVA 1OK2A 1GKNA 3ZD1A 2XWBF 4YNXA 1C1ZA 3L89M 1UOTP 5HYPA 3OP8A 2XRBA 4ONTD 2CG6A 1OK3A 3O8EB 4LOTA 1TPNA 2XWJI 1QUBA 1SS2A 1GPZA 1H03P 5HYTB 3R62A 1ZJKA 2KMSA 3CALA 4IGDA 4AYEA 4C16A 1LY2A 1O9AA 1MD8A 2YRAA 2MCZA 3ZD2A 4B2RA 2LOJA 1OK1A 1VVCA 2XQWC 4K12A 5HZPB 4A5WB 3MQLA 4AYMA 4AYDA 2YBYA 2ERJA 3INBC 2UWNA 1HFHA 2RKZA 3IU3I 1OJWA 2WIIC 2RLPA 1H2PP 1NWVA 1E5GA 2IZ3A 1QO6A 3M7PA 2W80A 2V8EA 4DJZA 4JHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHF A;  1HCC A;  1H04 P;  1TPM A;  4MUC A;  3GXE A;  1GKG A;  1VVD A;  3T5O A;  1GHQ B;  1QGB A;  2MCY A;  1Z92 B;  4FXG G;  1G4F A;  1HFI A;  2CG7 A;  5JPM G;  3ERB A;  2O39 C;  1H2Q P;  1OK9 A;  2RLQ A;  2W81 A;  2CKU A;  1E8B A;  1SRZ A;  3GOV A;  1Q3X A;  3OXU D;  1MD7 A;  4LOS A;  1FBR A;  1PPQ A;  3RJ3 D;  2IZ4 A;  3KXV A;  3KZJ A;  2BZM A;  4AYI A;  5HYU B;  4ZH1 D;  2XRD A;  4WJG 2;  2JGW A;  3IX0 A;  1U5M A;  4KKD A;  4J38 B;  2EC3 A;  5FO8 C;  2QY0 A;  2KRI A;  4CSY A;  1G4G A;  3NFP I;  3ZRZ A;  1TPG A;  2B5I D;  2RKY A;  3OED C;  1OJY A;  3TVJ A;  2JRA A;  3SW0 X;  1E88 A;  5I0Q B;  2A55 A;  2JGX A;  4F4O C;  1ELV A;  4B2S A;  3EJH A;  4PZ5 A;  2RL0 A;  1CKL A;  2G7I A;  1OJV A;  1OK2 A;  1GKN A;  3ZD1 A;  2XWB F;  4YNX A;  1C1Z A;  3L89 M;  1UOT P;  5HYP A;  3OP8 A;  2XRB A;  4ONT D;  2CG6 A;  1OK3 A;  3O8E B;  4LOT A;  1TPN A;  2XWJ I;  1QUB A;  1SS2 A;  1GPZ A;  1H03 P;  5HYT B;  3R62 A;  1ZJK A;  2KMS A;  3CAL A;  4IGD A;  4AYE A;  4C16 A;  1LY2 A;  1O9A A;  1MD8 A;  2YRA A;  2MCZ A;  3ZD2 A;  4B2R A;  2LOJ A;  1OK1 A;  1VVC A;  2XQW C;  4K12 A;  5HZP B;  4A5W B;  3MQL A;  4AYM A;  4AYD A;  2YBY A;  2ERJ A;  3INB C;  2UWN A;  1HFH A;  2RKZ A;  3IU3 I;  1OJW A;  2WII C;  2RLP A;  1H2P P;  1NWV A;  1E5G A;  2IZ3 A;  1QO6 A;  3M7P A;  2W80 A;  2V8E A;  4DJZ A;  4JHS A; 
#chains in the Genus database with same CATH topology
 2EHF A;  1HCC A;  1H04 P;  4PO7 A;  1TPM A;  4MUC A;  3GXE A;  4N7E A;  1GKG A;  1VVD A;  3T5O A;  1GHQ B;  1QGB A;  2MCY A;  1Z92 B;  4FXG G;  1G4F A;  4BWC A;  1HFI A;  2CG7 A;  5JPM G;  3ERB A;  2O39 C;  1H2Q P;  1OK9 A;  2RLQ A;  2W81 A;  2CKU A;  1E8B A;  5DN5 A;  1SRZ A;  3GOV A;  1Q3X A;  2I2L A;  3OXU D;  1MD7 A;  2X2Z A;  4LOS A;  1FBR A;  1PPQ A;  3RJ3 D;  5DN4 A;  3F6K A;  2IZ4 A;  3KXV A;  3KZJ A;  2BZM A;  4AYI A;  5HYU B;  3NJA A;  4ZH1 D;  2XRD A;  4WJG 2;  2JGW A;  3IX0 A;  1U5M A;  4KKD A;  4J38 B;  2EC3 A;  5FO8 C;  2QY0 A;  2KRI A;  4CSY A;  1G4G A;  3NFP I;  3ZRZ A;  1TPG A;  2B5I D;  2RKY A;  3OED C;  1OJY A;  3TVJ A;  2JRA A;  3SW0 X;  1E88 A;  3ZLD A;  5I0Q B;  2A55 A;  3FGR A;  2JGX A;  4F4O C;  1ELV A;  4B2S A;  3EJH A;  4PZ5 A;  2RL0 A;  1CKL A;  2G7I A;  1OJV A;  1OK2 A;  1GKN A;  3ZD1 A;  2XWB F;  4YNX A;  3K3T A;  1C1Z A;  3L89 M;  1UOT P;  5HYP A;  3OP8 A;  2XRB A;  4ONT D;  2CG6 A;  4YIZ A;  1OK3 A;  3O8E B;  4LOT A;  1TPN A;  2XWJ I;  1QUB A;  1SS2 A;  1GPZ A;  1H03 P;  3VWO A;  5HYT B;  2ZYC A;  3R62 A;  1ZJK A;  2KMS A;  3CAL A;  4IGD A;  3WSY A;  4AYE A;  1LY2 A;  1O9A A;  4C16 A;  3CI0 J;  1MD8 A;  2YRA A;  2MCZ A;  3ZD2 A;  4B2R A;  2LOJ A;  1OK1 A;  1VVC A;  3FGT A;  1RLH A;  2XQW C;  4K12 A;  3WSX A;  5HZP B;  4A5W B;  3MQL A;  4AYM A;  4AYD A;  3ZLE A;  2YBY A;  2ERJ A;  3INB C;  4APL A;  2Y8T A;  2UWN A;  1HFH A;  2RKZ A;  3IU3 I;  1OJW A;  2WII C;  2RLP A;  1H2P P;  1NWV A;  1E5G A;  2Y8R A;  2IZ3 A;  4MSL A;  1QO6 A;  3M7P A;  2W80 A;  2V8E A;  4DJZ A;  2Y8S A;  4JHS A; 
#chains in the Genus database with same CATH homology
 2EHF A;  1HCC A;  1H04 P;  1TPM A;  4MUC A;  3GXE A;  1GKG A;  1VVD A;  3T5O A;  1GHQ B;  1QGB A;  2MCY A;  1Z92 B;  4FXG G;  1G4F A;  1HFI A;  2CG7 A;  5JPM G;  3ERB A;  2O39 C;  1H2Q P;  1OK9 A;  2RLQ A;  2W81 A;  2CKU A;  1E8B A;  1SRZ A;  3GOV A;  1Q3X A;  3OXU D;  1MD7 A;  4LOS A;  1FBR A;  1PPQ A;  3RJ3 D;  2IZ4 A;  3KXV A;  3KZJ A;  2BZM A;  4AYI A;  5HYU B;  4ZH1 D;  2XRD A;  4WJG 2;  2JGW A;  3IX0 A;  1U5M A;  4KKD A;  4J38 B;  2EC3 A;  5FO8 C;  2QY0 A;  2KRI A;  4CSY A;  1G4G A;  3NFP I;  3ZRZ A;  1TPG A;  2B5I D;  2RKY A;  3OED C;  1OJY A;  3TVJ A;  2JRA A;  3SW0 X;  1E88 A;  5I0Q B;  2A55 A;  2JGX A;  4F4O C;  1ELV A;  4B2S A;  3EJH A;  4PZ5 A;  2RL0 A;  1CKL A;  2G7I A;  1OJV A;  1OK2 A;  1GKN A;  3ZD1 A;  2XWB F;  4YNX A;  1C1Z A;  3L89 M;  1UOT P;  5HYP A;  3OP8 A;  2XRB A;  4ONT D;  2CG6 A;  1OK3 A;  3O8E B;  4LOT A;  1TPN A;  2XWJ I;  1QUB A;  1SS2 A;  1GPZ A;  1H03 P;  5HYT B;  3R62 A;  1ZJK A;  2KMS A;  3CAL A;  4IGD A;  4AYE A;  4C16 A;  1LY2 A;  1O9A A;  1MD8 A;  2YRA A;  2MCZ A;  3ZD2 A;  4B2R A;  2LOJ A;  1OK1 A;  1VVC A;  2XQW C;  4K12 A;  5HZP B;  4A5W B;  3MQL A;  4AYM A;  4AYD A;  2YBY A;  2ERJ A;  3INB C;  2UWN A;  1HFH A;  2RKZ A;  3IU3 I;  1OJW A;  2WII C;  2RLP A;  1H2P P;  1NWV A;  1E5G A;  2IZ3 A;  1QO6 A;  3M7P A;  2W80 A;  2V8E A;  4DJZ A;  4JHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...