4K14A

Crystal structure of staphylococcal nuclease mutant v66i/v99l
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Crystal Structure of Staphylococcal nuclease mutant V66I/V99L
rcsb
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k14A00
5HGTA 1TR5A 3LX0A 3MVVA 4QF4A 5CV5A 4DFAA 2M00A 1STNA 2F0QA 4KJNA 2PZWA 3EJIA 3T16A 2F0OA 4ID6A 1STAA 3SXHA 3H6MA 2PW5A 4NKLA 2F0SA 1A3VA 1SYBA 1KAAA 4F8MA 5J22A 1STGA 5KYIA 1KDAA 1NUCA 1SYGA 3NUCA 3OWFA 1KABA 3OMCA 1A2UA 3MEHA 2EYFA 2EYHA 3C1EA 2O4XA 1STBA 4KHVA 4PMCA 1SYCA 2EY6A 4ZUJA 4KD3A 4ZQ3A 5NUCA 5IGBA 1EY7A 5IOCA 1U9RA 2PZTA 5M9OA 1JOKA 2F0TA 2PW7A 4K5XA 4PNYA 2PZUA 2OF1A 4KTAA 3NP8A 1ENCA 1JOOA 1F2YA 4KY6A 3TMEA 4K8JA 3S9WA 1TQOA 3PMFA 1F2ZA 5EKKA 4K6DA 5EKLA 4K5WA 3C1FA 3HEJA 3ITPA 1EY8A 3DMUA 3TP7A 5C4ZA 5I9OA 4TRDA 5IGFA 5KGUA 5KYLA 2OEOA 1SNDA 1SYEA 4NMZA 3SK6A 1A3UA 3E5SA 4B9XA 4EVOA 3EVQA 2EY1A 5CGKA 1IHZA 2F0UA 3P75A 5JOBA 2F0LA 5CC4A 1STYA 5IIFA 5JAVA 4WORA 4ODGA 1NSNS 4EQPA 5DEHA 3U9OA 5KRUA 4G57A 3TP5A 1SYFA 5K5PA 1SNCA 2NUCA 4K2LA 3SK8A 1SNMA 2F0DA 4H7BA 5IODA 4S3SA 3TP6A 4KY5A 3D4DA 5CV7A 4ME5A 4NP5A 4RKLA 4K5VA 5F2DA 2EY2A 5IGEA 4K2KA 1EQVA 2SNMA 1EY9A 2PYKA 1EY4A 1F2MA 2EYMA 3QOLA 5CV4A 5EGTA 4DU9A 2F0WA 2RBMA 1EY5A 3SK4A 2SOBA 5E3FA 4EQOA 5J39A 3NXWA 5IGCA 2PQEA 5CV6A 2LKVA 2QDBA 4IUNA 2EYPA 1AEXA 4K8IA 4I65A 1STHA 3SHLA 4DGZA 4QB4A 5E1FA 3TP8A 5IGDA 1JOQA 4HTHA 1EYCA 3HZXA 5C3XA 2EXZA 5HURA 2F0GA 2F3WA 1A2TA 4MIUA 3QB3A 3D8GA 1SNOA 4ZUIA 1KDCA 5CR3A 2F0JA 3DHQA 2F0MA 3OMGA 1EZ8A 4IZ8A 4KY7A 5J1ZA 2KHSA 3VA5A 1SNQA 5C5LA 4WRDA 5I6YA 1EY0A 2RKSA 5IGGA 5KEEA 4KV6A 2EYJA 4N9PA 5C4HA 2ENBA 5I9PA 5I6WA 3D6CA 5ISRA 5CV8A 2F0KA 4N9TA 1EZ6A 4HMJA 4IALA 2F0NA 1RKNA 1ENAA 3BDCA 3RUZA 1SYDA 3QOJA 4QMGA 2KQ3A 3ERQA 3MXPA 2WACA 3NQTA 5KIXA 1A3TA 1SNPA 1JORA 4B9WA 5DAUA 1EY6A 4R8NA 3BDLA 3EROA 3T13A 5C3WA 2EY5A 2F0PA 2F0EA 1EYAA 2OXPA 4KD4A 4EQNA 2SNSA 4OL7A 3NHHA 4HMIA 4KJOA 3NK9A 2HQEA 5C5MA 4DF7A 3MZ5A 4F7XA 3OSOA 2F0IA 2RDFA 3R3OA 4PMBA 4E6IA 4NDXA 4LAAA 3V2TA 3MHBA 2F0HA 3D4WA 3P1HA 4J1MA 4YIJA 2EYLA 1EYDA 5CV9A 4K14A 2F0FA 5C6AA 1TT2A 3SK5A 1II3A 4RKBA 3SR1A 2F3VA 2F0VA 4J6HA 2EYOA 1KDBA
chains in the Genus database with same CATH superfamily
1VQLA 2K5VA 1T5EA 4QJFA 4HJ8A 4JI7Q 3I4OA 4BXXH 4F8MA 3DM3A 1TWCB 3NUCA 1TU2B 1R4PB 3OMCA 2XRSD 1G6ZA 5JEAJ 5DM63 2I07B 3DWAA 1PH3A 5IGBA 2EZVA 3HOZB 1IBMQ 1CZGA 4GZYC 2EOTA 3TS0A 1TWCH 4DR3L 2PO4A 1PH4A 1GUWA 5EKLA 3S1MH 3C1FA 1Y14B 3ITPA 2C9OA 3A8IE 5IWAL 1GHKA 3FRPB 3PUVA 1R4QB 1L2FA 4J8QA 1E22A 3CCLA 1A6XA 2EY1A 4JV5L 1GUSA 5JOBA 4DV0L 1WCMH 3S2DH 3IKJA 3PUZA 4HR7B 3URYA 4DR6Q 3U9OA 1H9SB 4Y52H 2EJMA 4MNOA 3KBGA 1NE3A 2KECA 1EWIA 5G3LF 2EY2A 3FPPA 4FXKC 5ELNA 4RHRA 2ZXRA 3OPOA 1MI2A 3HOXG 4BY1B 5BR8Q 3PCOB 4IPCA 1JE5A 3LWUA 2LXJA 1MJCA 4HN7A 3R2IA 1ILPA 4EX5A 2ES2A 4A3CH 2EXZA 1PTOF 4IZ8A 4JBWA 4BY1H 2YV5A 1S5BD 1L1OA 4UDUC 2E2HB 1CKMA 2ATWA 1VQMA 4IPDA 3KJPA 1JE4A 1RKNA 3KBXA 1G291 4DV3L 2EIFA 2K5QA 1QNUA 1SMYC 4PZ6A 4BY7B 2A5HA 5FK9C 4CHTB 4X62L 1UE7A 1LTRD 4GLAC 3DXJC 1PRTD 2SNSA 2A6HD 4N8FA 1HZBA 4GOPA 2PQAB 1VQ6A 2RDFA 1PYWD 3MFYA 1VQ9A 2CHBD 5C6AA 4YY3Q 4LF5L 4GOPC 3H3VI 2N55A 2Z8LA 4J6HA 1UE5A 3FHWA 4RH6A 4BBSG 3F8TA 1L0WA 1SLJA 2ZTEA 3SXHA 3H6MA 2ZXPA 3S2HB 3B6YA 4UP9A 5J22A 4JVZA 1XPRA 3PO3G 2E2JB 4DR4L 1U4MA 4GN5A 1J5EL 1LTSD 2EYHA 3S1QB 2TSSA 1U9RA 4DR2L 3AEVA 4KTAA 4NXNL 4C1NK 4BS9A 2VNUD 2J4XA 4KI0A 5FLMH 1PH7A 1XTCD 2UUBL 3CXCA 3KYHC 3RNUA 1BCPD 1Z9FA 1CA6A 5IYCG 2NVQH 1FYCA 1N34L 2E2DC 3ULLA 5GAHC 4DUYQ 4LF9L 3HOYB 3Q22A 3H15A 4K2LA 4UHVA 3PIO3 2KVMA 2XTIA 1AP0A 3CMEA 2B8FA 4A3GH 1EQVA 4XYOA 1HQMC 5EGTA 1YEZA 5FJ8G 2EYMA 1G2TA 4A75A 3NEMA 3UE0A 1FL0A 1WCMG 2ZXOA 2G9DA 4I65A 4A3GB 2RCNA 2CQAA 1PZJD 2K50A 5CR3A 1NJIC 3I4NB 1VQ5A 1YHBA 1PTOD 5C0XI 1GUTA 1AW7A 5ELBA 5C4HA 4DV7L 5ELFA 3GTPH 1HH2P 5C0XJ 1SE4A 5GADC 4DK3C 3MXGA 4LUOA 2KQ3A 3MXPA 4IFDJ 2RDGA 4ILWA 4IUTA 5C44B 3GTQH 2AWOA 2PMZE 5C3WA 2Q8TA 2O5JC 1IYUA 3HOUG 2IX3A 4TSSA 2ZT9C 4DNRB 1CUKA 3K0YA 1D5XC 2RVLA 3VYRA 2R93H 2DY8A 4LF7Q 1PZID 2PI2A 3I90A 3BYTB 2RA4A 5T1IA 3JAMc 1Q12A 4JI6Q 1PFBA 4NB3A 3ULPA 4UAIA 1RIPA 1TWHH 1LT3D 1A2UA 1P16A 1LT4D 3SEBA 3H0GB 3KF6A 3IRBA 2WAQE 2Z4IA 1I5FA 1KNAA 1WD0A 2PW7A 2OF1A 3RN5A 3BVMA 1PV4A 1F2ZA 3H0GH 5BN5A 2Z6BA 2UXCL 2MGSA 1HQRD 5LMUL 4A3FB 3TP7A 5IGFA 2EXDA 4KHPL 1PYSB 2FFKB 3HKZG 3UDXA 1Q3LA 2ZM6L 2F0UA 3TN2A 3PSIA 1QILA 3BVZA 3I2ZA 5IIFA 3E3XA 5FO7B 2VQFL 4NW2A 1L0XB 1EOTA 3FVQA 1F9SA 5IODA 4QUFA 2A74C 4KY5A 4R1JA 3HOVG 1DOMA 1KC8C 5IP9G 4IJHA 5G3LD 5C3EB 2QCPX 4A3KG 1EY4A 4YWKA 1FJGQ 4YCVA 3UDIA 4YHHL 5E3FA 1YJNA 3WDNA 3NXWA 1CT1D 1TIID 1HNZL 1H9KA 5JJZA 2O5IC 2Z6KA 1GXDC 3TP8A 4OWTB 5C3XA 2F3WA 1Y69U 2PCFB 3CP0A 3N6RA 3OMGA 2JA7G 2GN5A 2SEBD 4A3MG 2E76C 3G71A 3H94A 1XNRQ 1HR0Q 1BNZA 2VXWA 3VR2A 4CKEA 2B63G 2JA5H 4JI0Q 2RSOA 4LFCQ 1HHVA 4C3JB 3M7NA 2UXBQ 2Q8RE 4DAPA 3Q0AA 2WIIB 1EY6A 4HSPA 4DR3Q 2B63B 4BA1I 4IFDH 1BCPC 2EY5A 4XQJA 1VQDA 1V8QA 3J80E 1PH6A 1XXGA 2Z4HA 1K9MC 5IWAQ 4OL7A 1IW7C 4F7XA 3PUWA 3A7AB 3CKIB 4L5TA 3F2CA 2B2WC 1W6JA 3OTOQ 2EYLA 1EYDA 1JMCA 4CJ2C 2H1EA 1M4VA 2UU9Q 2K04A 1Z6HA 3CCMA 1WTOA 1D2BA 1Q1BA 4POFA 1VQ4A 1STNA 1G91A 1DCZA 4A3CG 3TEHB 2Y0SB 1PXUA 3F2DA 1HZAA 3J80i 5EKIA 4KKTA 2F4VQ 4HSVA 3QG1A 4A3JH 1ZYRD 3K7AH 3P7JA 1GUGA 1YITA 1NUCA 1WTPA 1KABA 3PGZA 1WJJA 4YWMA 3JC66 2K5WA 4JI2Q 1EQTA 4CKCA 3S1MB 4JI4L 2CQOA 1CSQA 3M7GA 2DJGC 2EY6A 2NZHA 5EBCA 2MO0A 1C4QA 1I4QA 1GJXA 3I91A 1F2YA 1CM9A 4MTKA 1ENFA 2R7ZB 2B2UC 2WAQB 4TRDA 1BR9A 5LMNW 4FDBA 1A15A 1UE6A 3EVQA 4QY7A 3KLRA 1EYGA 4MTNA 1EU3A 2NVTH 4IUQA 2QA4A 2IHFA 1EUJA 2VB3X 4NP5A 4APVA 2SNMA 2PYKA 5CV4A 2KBNA 1BBXC 3G48A 1EY5A 4XIGS 4C2MB 4PMWA 2SOBA 3R8BA 3SK4A 4LF5Q 5EJWA 2B8GA 5J39A 5CV6A 3RLFA 2E2HH 4GKKQ 3NPPA 1UE1A 1D6EC 3MXNB 2HDMA 4A93G 4JCVE 3G6JB 4ZUIA 3HP3A 4B3SL 2E2IB 3DHQA 2N3SA 4IFDI 2K6AA 1XJVA 4P75A 2NTSA 1JB7A 4TKOB 4A93B 2PI2E 3MEFA 1LT5D 5COYA 2K1BA 3RN2A 1ENAA 2HCIA 2ALYB 3H3VC 2QEJC 2R7FA 4DR2Q 3ERQA 1NBWA 3J7AV 1J9OA 3K7UC 1PH1A 4XXEA 3NWSA 4PQXA 1HXYD 1BKBA 2NVYB 2DUDA 5C5MA 3PIPA 2AMCB 3OHXC 2I5HA 1O78A 5AJ3Q 1MGSA 4HIDA 3HG9A 5CV9A 2JA7B 2YYZA 5E4WC 1II3A 1NAPA 1FGUA 2VUMB 4R4CA 1EFID 2K5HA 2KJXA 3LX0A 2FJ2A 1IXRA 1JICA 5CV5A 3TREA 5M5YH 1B4OA 4IPHA 1A62A 2Q8IB 2JA7H 1C7YA 3NSWA 1IKMA 4JBKA 4A76A 3QO2A 1TWAH 2JA6H 2CW0D 1RTNA 4A3IB 3STBC 5C3EG 2K75A 3W2DA 2BCOA 2Y0SE 3BG3A 1XNQQ 1EY7A 1K83H 4DV6Q 2H5XA 4BY1G 4HCEA 1EEID 1O7LA 2JK8A 4KY6A 3ICEA 2JEBI 2KCTA 2SDFA 4OWWB 2YTVA 4LF8L 2NYZD 5DNFA 4DR1L 4DV7Q 3E5SA 3E0JA 5CC4A 3PIOA 3QJYA 1H9MA 1KNEA 1QJOA 1I4XA 1NSNS 2KHIA 3T1HQ 2L5TA 2F52A 4LFBL 4X3SA 1ICFB 2G9HD 1B7YB 3NELA 4O0AA 3C3LA 3H0GG 3Q8DA 5CYUA 2MQHA 1X3FA 2B2WA 2RBMA 3PF4A 3I4NH 5E4XA 3K5LA 4B3ML 3M4YA 2IT1A 3M3YB 3RZDH 4OO1I 4RWSC 1HPCA 3S17H 1ET9A 3EN2A 1SNQA 4AQYQ 1B2TA 3KLWA 2LMCB 1PDQA 4GLVB 5D3DA 1EQRA 2IPKD 1JCKB 5CV8A 2UUAL 1OXXK 5GAEC 1BCPB 1AFPA 4K0KQ 4A3KB 2O2LD 1PTOH 3NQTA 5LHY1 3S1NB 2ZJPA 1PFMA 1YJ9A 5M5WB 1RF2D 2AQ3B 1YNXA 3K58A 2B2TC 2JA8H 5EPLA 4GNXA 4DF7A 1VF5C 3OSOA 2XIWA 4DXGA 4E6IA 1MSHA 4KHPQ 4A3BB 4LAAA 1Q8IA 2F0HA 3C2PA 4DV4L 1HCZA 4DV5L 3K6OA 3OW2A 2UUCQ 2JA8B 1TWHB 4PZ8A 1TR5A 1S5FD 3CAMA 4FNFA 3A54A 2I5LX 4C3JG 1I3QH 1PYBA 3Q6SA 4ZCKA 1CA5A 1STGA 3VA7A 4RA8A 4WJ3M 1TKWB 2K52A 3OWFA 1FJGL 3MWYW 1VQBA 1TVXA 4OIJA 1LTBD 1SEBD 2EYFA 4YHHQ 3C1EA 1Y8OB 4PMCA 1FVIA 2L4NA 2PZTA 1Q46A 1YNJD 1AZPA 1D5MC 1JB3A 3NP8A 1JOOA 2I46A 2LXKA 5CMDA 4ZK9B 4K5WA 1XNRL 4RCNA 3HKZE 5C4XH 2ID0A 4Y7NB 1YNND 1K8MA 4BBRB 1CSPA 1DJRD 3DWPA 1I4HA 1QVCA 4G57A 3TP5A 1SNCA 1E2ZA 3DM1A 2F0DA 2OT2A 4DUZL 4CJ1B 1NNXA 1PZKD 4Z9CB 3ZYYX 5C4XB 5IP9H 1EY9A 1V1QA 3HRZC 1LLRD 4JI1Q 3OTOL 2F0WA 3FP9A 4LUZA 5I2YA 3AYHB 2VS1A 3NENA 2CKZB 4JBJA 1E24A 2PQEA 2LKVA 2UU9L 5C4JB 3SHLA 2B29A 1JOQA 2WB1G 1ASYA 3HZXA 2JA5B 4OO1H 5LMNQ 2MUYA 4KY7A 2A69D 3GTOH 4WRDA 1R9TH 1EFWA 2JA6G 5JEAH 2NBFA 3JAMi 3GD7A 3BDCA 2XGTA 3RUZA 2CH4A 2DNEA 2BDOA 2WACA 2GVAA 2IWHA 4DXFA 3V05A 1JWMD 2A68C 1XMOL 2JA9A 3J80L 2KA7A 4LF6Q 3J7YW 2IJ0A 3F2BA 3BS1A 4EGVA 4IOCA 2F0FA 1TT2A 4R4OA 3NQIA 4R4TA 4JOIC 4CDFC 5AFWA 3BYYB 4AYBB 2D9UA 4KJNA 2JE6I 3T16A 4X6AH 3CW2C 2F0OA 1VMCA 1UEAB 4OX9L 1TXYA 4A3MH 1I94Q 4MHEA 1D5ZC 4OHJA 3KF8B 2N8NA 1VQ8A 3D31A 5IOCA 3KDFB 1BXTA 3I73A 4GKKL 4F88A 4ZAIA 1MHWC 1M1KC 4GKJQ 1AN8A 1PH9A 3RLOA 4B3SQ 2LFNA 1SDFA 3J7ZC 2I0QA 3TQYA 2AUKA 4WFN3 5IYDH 4C3HB 3SK6A 1HTPA 4B9XA 1VQ7A 2OTLA 1B44D 1N9WA 3P75A 4C3IH 2F0LA 1IYJB 1TS2A 1L1OC 1Y1WG 2Q2UA 1I50B 1CK1A 1QUQA 4X65L 2E5LQ 1KIXA 5DEHA 3S15B 2D2CC 1SYFA 4JC0A 3HOZG 1JJGA 4ME5A 1TS5A 3TDQA 2WINB 2FINB 4K2KA 1M90C 3MFGA 2KUMA 4HCSA 5A2QE 2E2IH 2CWAA 2DY7A 5EPJA 5IE8A 5JJIA 2MP1A 1VS0A 1N33L 3PO2H 3I4MG 2EE1A 3S1RB 4CGYB 2QKIC 2KCMA 2XSCA 3K5NA 1SNOA 1S72A 2NB0A 1HTLD 3Q23A 2VQEL 4IUVA 3PO2B 4KV6A 1DONA 3CC4A 4DA2A 1YNJC 1ET6A 5ELDA 5J3BA 4QGUA 2RQXA 4I7ZC 1LTID 1QWYA 4L5SA 1XNQL 3K5OA 4DAVA 3QOJA 2WV6D 1W6KA 4UY8C 1DGSA 3VDYA 2VUMH 2NWGA 5FLXc 4DR1Q 2K28A 3PUYA 1N8RC 4YIJA 3D4WA 4L5RC 2A19A 1K8OA 1QVGA 4QCLA 4J15A 3SR1A 2L1BA 2EJGC 1RJTA 5FKAC 3W1BA 4C3IG 1TWAB 1PRTF 4FF1A 1F77A 2JA6B 4G7OC 4A3IH 2K14A 4XDXA 3S16B 3RR5A 5LL6X 3SVMA 3NBHA 5LL6S 4Q5VA 3IL8A 1KAAA 3HOWB 2OWOA 3J81i 3R2TA 2L12A 3W3AA 4DNIA 1K3BC 1E3PA 2O4XA 1STBA 5DM73 3ERSX 4ZKCB 1HFNA 1RD9D 4B3MQ 3UI2A 1LV9A 2A69C 1LTLA 2ASBA 4YCUA 1LT6D 2N49A 5EKKA 2Q2TA 2RDHA 4AH6A 4HIKA 1SYEA 1H9SA 3WOFA 5M3MH 3A0JA 4JI5L 2A68D 3GQBA 5M3FG 1EQQA 1D1KA 4G7HC 3CC7A 3MA2B 2VZAA 4CDCC 3EFXD 4KKSA 4LK1C 5CBAE 5M3MB 3TSSA 2FHTA 4ABNA 1DYQA 4A3DG 5BN4A 1SE8A 3E0EA 3GTJB 1PVOA 2DGYA 4DV5Q 1F9PA 3J7A5 3GTPB 2K5NA 2A6EC 3NE5B 1X3QA 1E0BA 1KL9A 2X6LA 2L0CA 4HJ7A 5DLQE 4BWGB 3M4PA 1IYVA 3CCSA 3HKSA 1B9NA 3OYYA 4R8IA 2DJFC 1HNXQ 1WFQA 5C44H 3GTQB 3RLNA 1BUVT 2KHJA 4N9TA 3S24A 4H13C 3KJOA 4XTCS 4GNXC 4RG1A 4XQNA 1SFOB 3I4MH 3ULJA 3A8JE 1AH9A 3PUXA 2R93B 3VR5A 4MZ9A 4A3IG 2IW3A 2WB1B 4ZLTF 3PQIA 1X55A 1E2WA 2AQ2B 3MHBA 4L63B 2K05A 3DWQA 2HHHL 3K81C 4HEDA 2MHVA 4R4IA 4TVAB 1HR0W 2F0VA 3TBIB 3KDFA 4QF4A 5IT9L 1VQPA 4JYAL 4B08A 5A2QL 3G6EA 2D0PA 3U50C 2NN6G 4F87A 4B3RQ 2VUMG 2KOLA 4DR7Q 4A3LH 4JPBW 2RSNA 2N88A 1ML0D 2L11A 2X6GA 3D6WA 4JI1L 4A3EB 4YY3L 1N32Q 4A3FH 1HA6A 4ME3A 4EQ5A 3RD4A 3S2HH 3AU7A 1JOKA 3ZJYC 1SMXA 5IP7H 2E2JH 1U4RA 4CBVA 3T56B 3E9HA 4V190 5LMNL 3PMFA 2MPMA 4K6DA 3QIAA 1LYLA 3WWVA 4DAMA 2NVXH 4BBSB 3DMUA 1PRTB 3HS0C 4IQZA 4B3TQ 1I4PA 3T1YL 4DR4Q 4NPSA 1W3SA 4DNTB 1J5EQ 3D3RA 3I56A 2BH2A 3HOWG 2WKDA 1XX8A 4PZ7A 2NVXB 2ICEC 4LFAL 2ZTCA 2Z0SA 3HKZB 5JJLA 4DAYB 3I3CA 1XMOQ 5EAYA 4BY7G 2PPBC 4IUPA 2NVQB 3TZDA 3QOLA 1SMYD 2MFIA 1FNUA 4AIMA 2UXDL 5GROA 3S14B 3PIP3 1PRTC 5JJKA 4RHSA 3U9SA 5IGDA 4DUYL 1SR3A 4LF9Q 4RCOA 1C48A 2YU9H 1YBYA 1Q1EA 5HURA 3G4SA 3IFDA 1NY4A 4OONA 1YVCA 2K03A 1EIYB 4DV1Q 2KENA 1GVPA 3PF5A 1Y1WH 1YHQA 4QMGA 3HOXB 1MBYA 3T53B 5KIXA 1NCVA 4GKJL 2Q2HA 1O80A 4UP8A 4JI7L 1HZ9A 2HIVA 1BCPF 3MZ5A 1PA6A 1J8IA 3L3OC 4A3DH 5TSSA 3CCQA 4J1MA 3BZCA 5JVG3 1RODA 2QGQA 5FLXL 2F3VA 2CWPA 2EYOA 4X65Q 2E5LL 3U4VA 1OXSC 4DFAA 4RAUC 2QF7A 4A3BG 2KCCA 3TS2A 3HOYG 1BQQT 1SYBA 4OXPA 4JOIA 1XMQQ 3J7AF 3E9IA 2L15A 4LNQA 2A6ED 1UWVA 2R7ZH 5KNBA 4C56C 2A6HC 1MJEA 3G7LA 4H02A 1DM0B 4GLXA 1ENCA 1XWEA 2NVTB 1WCMB 1WD1A 1ZXTA 3S15H 2VQEQ 2Y0SG 1A3UA 2RHSB 3LWEA 1LTGD 4XT1B 1TWFB 4QQBX 2P5ZX 1IHZA 4X3KA 2R92H 3PO3B 1K8AC 3M4OH 5GQOA 2N78A 1F2LA 1I4RA 1V9PA 2JJQA 2JQOA 4Q0FA 1M8AA 4C2MH 4S3SA 5CV7A 4RKLA 1TWFH 4YWLA 4FP5D 4IURA 5H1SE 1AZQA 5LMUQ 3AMUA 3M4OB 1Z7TA 1CI3M 2B2YA 2A73B 3CPWA 3NBIA 2C35B 2ZM6Q 1CQVA 2QDBA 2E74C 1STHA 1VQFA 1EYCA 4V0BA 2VQFQ 2E8GA 3QB3A 1IBKQ 1LABA 2ICIA 4PG3A 4MN3A 3FKIH 1BDOA 3HOUB 3VA5A 1YJWA 5C5LA 2MO1A 1EY0A 2JA8G 3NTHA 3K59A 1B3QA 3EA6A 3MC0B 5E7NA 2F0KA 3DLLA 1BF4A 3FKIB 4KN4C 5IY0A 1EOVA 1HNZQ 3NTIA 1A3TA 1X32A 4G4KA 4P72A 4POGA 1PHJA 3VR3A 1D8LA 2IHEA 3NK9A 3I4LA 2F0IA 1MSGA 1PFSA 1HR0L 1PH5A 4NDXA 3Q24A 2GA4B 4C3HG 2R92G 3KF6B 3MVVA 1PTOC 1UUPA 2UXBL 1LTAD 3M4QA 2F0QA 4X3UA 4XT3B 4IOAA 2GVBA 1S5DD 2UUBQ 5KYIA 4O1NA 4LW1A 2AQ1B 4BBRG 2X69A 4AYBE 2XWJB 3BDOA 4KD3A 1MIUA 2MJ8A 3VYTA 1LTTD 1QZHA 4GS3A 1HZCA 1GHJA 2J0TD 2F03A 1C8CA 3HOYH 2QW7A 4DAYA 2CCZA 1AE2A 1CFMA 3HOZH 1SJHD 4K6LA 3P20A 1FR3A 4FXGC 5HGQA 4JI2L 1FD7D 1B9MA 5JAVA 5L37A 3I4NG 4DK0A 3MAQA 2IX1A 4GN3B 3SK8A 2A8VA 2V4DA 1TS3A 3D4DA 4JK1C 2M2LA 2EVBA 2MNAA 1B1ZA 3SDZA 1MD2D 3S2DB 1T9HA 5IT9E 1KLGD 2BE5C 1HUMA 3AFQA 1VMPA 2F4IA 1G2SA 4ZRZA 1CKOA 1V1OA 2WAQG 2HDLA 5JPMC 4ULLA 4K8IA 1V1PA 3HOVH 1VQCA 4QB4A 3ND9A 2WKCA 1X9NA 4DKAC 4A3KH 3R93A 2F0MA 3S1NH 4B3RL 2DNCA 2FXQA 1N36Q 3I4MB 1X6OA 5KEEA 3HOVB 3SGIA 2XN9C 1A8VA 2WB1E 4IALA 1ILQA 4I7AA 4LF4Q 3A56A 1SNPA 1BBWA 3BDLA 1TY2A 2VL6A 3EROA 4JI3L 4JI6L 1NR4A 2OXPA 4KD4A 4P73A 2B2VA 3IFTA 4HMIA 1WTVA 1BO0A 2HQEA 3J81E 4FO2A 3T1YQ 1SE2A 4FF4A 2LSSA 3P1HA 4FF2A 1B53A 3AB9A 4RKBA 2NVYH 3H3VH 2YTXA 5CORA 2M00A 2R3ZA 3W5OA 1O7IA 2JYOA 2UXCQ 2PW5A 4NKLA 4NXML 3H09A 4DV2Q 1LO5D 3M9BA 5FOBB 3ND8A 1BBUA 1WI5A 4CKBA 5M5YB 2UXDQ 4KHVA 5IYDG 5NUCA 4ZQ3A 2JEAI 1IW7D 5I4DA 1JWUD 1IL2A 1SXTA 4FXDA 3CCUA 2DN8A 1PH2A 3S9WA 3KLSA 1L1OB 5D3IB 2VB2X 2BA1A 4NMZA 4DV1L 1C0AA 3CU7A 1HUNA 2HD3A 2L9HA 2B2VC 1RL2A 1G6PA 2V1CC 1ZYRC 5C4XG 4P2CB 4KLKA 2B3GA 4ODGA 4DV6L 1WVLA 4QL5A 5K5PA 1U0LA 3S14H 3L0OA 5C4JH 1K28A 1EWHA 4K5VA 1Q86C 1IBLQ 4LF8Q 4L8JA 3CD6A 3E6ZX 5I2XA 1WTQA 3L9AX 1VQGA 1L0YB 4JI0L 1JT8A 4LFCL 1SSOA 1E2VA 3GTOB 1B70B 2RCFA 4QIWE 1NMFA 2EYPA 1EIHA 4X3TA 2VW9A 2C5CA 2K7VA 1JR0D 1S5CD 2OQ0A 3GTKH 1A2TA 3OIPA 1OXTA 4QUCA 1K73C 2KHSA 3OWEB 1WTWA 2D5DA 5I6YA 2A1AA 2EDGA 3T51B 1XMQL 2B63H 2HQLA 4N9PA 4FF3A 5I6WA 2Q2IA 5JEAG 3GTKB 3J80c 1EZ6A 4HMJA 4G7ZC 1G8ZD 4KKUA 1DD2A 3CRLC 1H95A 1JORA 4A3EG 1QUQB 4O42A 2XNAC 3O13A 2CW0C 1K0SA 3STBD 1H9JA 2F4VL 1Q82C 1EYAA 1GO3E 1FGBD 4XQQA 4IO9A 3R3OA 4JI4Q 5C44G 4OIKA 2TMPA 2BDNA 4A3JB 2JN4A 2CFMA 1VQOA 2NTTA 3K7AB 3GTMH 2PNRC 1DOLA 4RGOS 4OO1G 3A55A 3I70A 3OIQA 3A8KE 4ID6A 4A3BH 2BE5D 1QNKA 4A3JG 4OELB 3GTMB 1ONLA 5C0XH 1I6HH 1TWGH 4ZUJA 4DV4Q 2H4OA 4DR5L 4C3HH 1UNSA 2E75C 2UUCL 1HNWL 2PZUA 1RCVD 1OXUA 1HA5A 3KUPA 3A74A 1IBKL 3PO3H 2R92B 4K8JA 3FPUB 1WTRA 3RZOB 2D62A 3K80C 2J7ZA 1I6HB 3HEJA 3J81j 5ELOA 3CCVA 4YCWA 5C4ZA 5KGUA 4CJ0B 4IFDG 1SNDA 1KHIA 1Y8NB 3CCJA 2CH4W 3A7LA 4HJ9A 4X64L 1ZEQX 1Q7YC 4A3FG 1CHPD 2NUCA 3TP6A 3L7ZC 1KAWA 2K33A 3U58A 2Z6KC 2QEXA 2KCNA 1JJCB 2YTYA 3U4ZA 2XVSA 3H91A 4R4QA 2R93G 3FDTA 4IUNA 1AEXA 4DGZA 5KRUA 3CPFA 3JAML 5C3EH 3A5ZB 4A93H 4HTHA 5D65A 3CCRA 1SRUA 4MIUA 3TZUA 3CC2A 4UPAA 1KDCA 5JVH3 2F0JA 5J1ZA 4IUUA 4L6TB 1S3OA 4TQUS 4GNXB 3MXNA 2FMMA 1CHQD 1RTOA 5AJ3L 3NBHB 1BVSA 3GV6A 3J81c 1IL8A 1VQHA 3FMCA 3OOCA 1Y8PB 1SYDA 1TY0A 1WYDA 1U5KA 4B9WA 1GUNA 3CRKC 1VQKA 4LMQD 3T13A 2HCCA 2F0PA 5KNDA 1E1TA 1ASZA 2K5DA 3UDFA 1HJPA 3I55A 4IPGA 2JA5G 2RF4A 3F1ZA 5EPKA 4C3JH 1G51A 4IJLA 5D14A 1EU4A 1KDBA 5HGTA 4WJWA 3D0FA 4JI8L 2R7ZG 1VQJA 1S5ED 3KF8A 2PZWA 1OXVA 3I72A 3QR8A 2JSOA 1FNWA 2F0SA 2FMCA 2Z9HA 3A5UA 1HRJA 4CDEC 1B8AA 1EWCA 2EQSA 3MEHA 3IAYA 4LF6L 3DUZA 2JXMB 4RMFA 1SJED 3JAME 2BOSA 4OGQC 5M9OA 2F0TA 4K5XA 5ELEA 3T1HL 2D0OA 1VQEA 4LFBQ 3TMEA 1KRTA 1UEBA 2QDLA 4OX9Q 5JPNC 1EY8A 1YI2A 1I94L 1ZKOA 1OO9B 1N36L 3NTKA 1X65A 2EPBA 2OEOA 3AQQA 3BZKA 3L2PA 4X66L 1MKHA 1XTDA 1LACA 5C0XG 2K32A 1Q90A 4U673 1LUZA 2IX0A 2AUJD 1STYA 1Q81C 3T4AC 4LF4L 4N8X1 3AFPA 2VY3A 1X3EA 4ALPA 1CQFA 3WOEA 3ONAB 3GTJH 2R6GA 1U4LA 1VF7A 1X3GA 1Q8KA 4H7BA 4R9WA 4KK7A 5IT9c 2LY7A 4JI3Q 1F9QA 2I5MX 4RGNA 4AQYL 1SE3A 1JWSD 4HJAA 3RZDB 1F2MA 4GN4B 3UE1A 1SROA 1V43A 3CMAA 2UUAQ 3UDGA 1KRSA 3S17B 3OW7A 3X3MA 4K0KL 2F1MA 4A3LG 2K01A 1D1IA 1VCIA 5IGCA 5FO8B 1IBML 1WOCA 5KNCA 4ZKBB 1BOSA 3GTLB 5FJ8H 3HFZB 4WJ4A 4NXMQ 4DV2L 1KQSA 1VQAA 1YNNC 2WP8J 1WTHA 5M5WH 1PH8A 2RKSA 5IGGA 1GM5A 3EBEA 1JJ2A 5ISRA 4DN4M 4JV5Q 4HIMA 1CKNA 1DZ1A 5CBEE 1YZ6A 3GTLH 1JQYD 4DV0Q 2F0NA 2IL8A 1B50A 4JBMA 1IKLA 1N33Q 1EIFA 4DR6L 5FLXE 1S40A 2PQAA 3GO5A 3DEOA 1VDZA 4R8NA 4H0LC 1S4ZA 3K8AA 4DPGA 2F0EA 3ER0A 1D7QA 2XRQD 3V2TA 1PFNA 1W2BA 4BY7H 3MTSA 5BR8L 2K4KA 4IN3A 1DXMA 3VR4A 4A3EH 2G5DA 3GP7A 1STAA 1SAPA 2XWBB 1IBLL 1KDAA 1KD1C 2ZJQA 1SYCA 1RDPD 3W1GA 3S16H 2JP1A 4DV3Q 3PV0A 3HOWH 2OTJA 1QOHA 4DUZQ 4X62Q 2NN6I 1EL0A 2PNHA 3X3NA 2OCEA 3S1QH 1DOKA 5I9OA 4BXXG 5KYLA 1K83B 1OTCA 1SBBB 4OEMB 5CGKA 4JG2A 2M9VA 5IYBH 1QE6A 3BU2A 3CHBD 1F9RA 1XPUA 4HIOA 4WORA 4RGMA 1ESRA 3K0XA 1XPOA 1EIGA 4KHZA 4CDDC 4HAEA 3VYSA 4P74A 5F2DA 3QWNA 3FKIG 1A63A 4DU9A 4UP7A 4BA2I 4U68A 3GTGH 4JI5Q 4RGTA 3KK7A 5IYCH 1K8GA 5E1FA 4LWCA 1ESFA 4NXNQ 4KMUC 3KOJA 2F0GA 2IY5B 4L5QA 1Y1WB 2L55A 3I8ZA 1EZ8A 3GTGB 4JW0A 1HFGA 1GUOA 2ZTDA 2PMZB 2EYJA 5GAGC 5IP7G 3LNNA 3D6CA 2BA0A 4AYBG 1QCBD 1E7ZA 1B3AA 3M3YH 4KN7C 4DR5Q 1N34Q 3CF5A 3KFUA 1KLUD 4A3DB 1GKHA 1HNWQ 1IZ6A 3GV3A 4DK6C 5T1GA 1KTKA 5DAUA 1GD7A 1I4GA 3J81L 2NZ1D 4LJZC 2KEDA 4KJOA 1WTXA 1KXLA 4PMBA 1PTOB 1HNXL 2CVRA 1V1PB 1VQNA 2B39A 4A3MB 1PMRA 1SFOH 2R7DA 3SK5A 5IYBG 3KLSX 2F3IA 4X64Q 1SNMA 4HJ5A 4OWXB 1TWGB 3EJIA 3N52A 2LS01 1X3PA 3PO2G 4GOPB 4P71A 1A3VA 4LUVA 1Y1VG 3NWTA 2QILA 1SN8A 2AHOB 1SYGA 5EBDA 1TS4A 1ICWA 2HUGA 1T5XD 3RZOH 2ZJRA 3V96A 2HHHQ 5ELCA 2B2YC 1A0IA 3F2UA 5M5XB 1CKNB 1K3RA 1Y1VB 1P8LA 3RMHA 4PNYA 1I3QB 1E1OA 3MXUA 1EEFD 4JYAQ 3M85A 5A35A 4C3IB 4M8AA 1LM0A 1TQOA 5K36G 4A3GG 1I50H 4FVMA 2OQKA 3EQLC 2HIXA 5M5XH 1XYIA 1NTGA 4DR7L 1Y1VH 4EVOA 1J6QA 2HT1A 3BVGA 1X56A 2NZOA 3HGBA 1FNVA 1N32L 5HY6A 4H44C 4XYQA 2AKWB 1QVFA 4EQPA 4LF7L 3I7FA 4BBSH 5FO9B 5FLMG 2B2TA 1CTMA 1STEA 1YIJA 1PLFA 3D4RA 3BJUA 3FEWX 1NR2A 4RFBA 4A4IA 4C1NI 5K36H 4M1UB 3S1RH 3CQZH 1NMGA 5IGEA 1H9RA 4Y7NH 1VQIA 4B3TL 4BBRH 5M3FH 3HOUH 1O7ZA 4EQOA 1O7YA 1YHAA 2KEEA 2Z1CA 2EJFC 2NN6H 1AE3A 4JI8Q 3LGJA 1I6VC 1X54A 2R61A 3CQZB 3DEPA 4LFAQ 1RHPA 3K5MA 1QG7A 2AWNA 3D8GA 5M3FB 4ZYSA 4FYDA 3GDEA 1Z47A 3EIVA 3VYUA 4QIWB 1QB5D 1CZWA 4DK1A 5I9PA 1QZGA 2ENBA 1C9OA 3TRZA 2YU9B 1U4PA 3K57A 4O2DA 2B2UA 5M3MG 1GOZA 3BZDB 2RHQB 1R9TB 2WFWA 3VR6A 3C46A 2BH8A 4EQNA 3SE0A 3NHHA 5BN3A 1UAPA 3HOXH 3CCEA 4X66Q 1JC7A 1K0RA 4K14A 5EQ0A 4PV1C
chains in the Genus database with same CATH topology
1T5EA 4F8MA 1TWCB 3NUCA 1TU2B 1R4PB 3OMCA 2XRSD 1G6ZA 5JEAJ 5DM63 2I07B 3DWAA 5IGBA 2EZVA 3HOZB 1CZGA 4GZYC 2EOTA 2PO4A 1GUWA 5EKLA 3C1FA 3ITPA 1GHKA 2C9OA 3A8IE 3FRPB 3PUVA 1R4QB 4J8QA 1A6XA 2EY1A 1GUSA 5JOBA 3IKJA 3PUZA 4HR7B 3URYA 3U9OA 1H9SB 2EJMA 3KBGA 2KECA 5G3LF 2EY2A 3FPPA 4FXKC 4RHRA 2ZXRA 3OPOA 1MI2A 4BY1B 3LWUA 4HN7A 3R2IA 1ILPA 2EXZA 1PTOF 4IZ8A 4JBWA 1S5BD 4UDUC 2E2HB 1JE4A 1RKNA 3KBXA 1G291 2K5QA 1QNUA 1SMYC 4BY7B 2A5HA 5FK9C 4CHTB 1LTRD 3DXJC 1PRTD 2SNSA 2A6HD 2RDFA 1PYWD 3MFYA 2CHBD 5C6AA 2N55A 2Z8LA 4J6HA 4RH6A 3SXHA 3H6MA 2ZXPA 3S2HB 5J22A 2E2JB 1U4MA 1LTSD 2EYHA 3S1QB 2TSSA 1U9RA 4KTAA 4C1NK 4BS9A 2VNUD 2J4XA 4KI0A 1XTCD 1BCPD 1CA6A 1FYCA 2E2DC 3HOYB 3Q22A 4K2LA 3PIO3 2KVMA 1AP0A 2B8FA 1EQVA 4XYOA 1HQMC 5EGTA 2EYMA 1G2TA 2ZXOA 2G9DA 4I65A 4A3GB 2CQAA 1PZJD 5CR3A 3I4NB 1PTOD 5C0XI 1GUTA 1AW7A 5ELBA 5C4HA 5ELFA 5C0XJ 1SE4A 3MXGA 2KQ3A 3MXPA 4IFDJ 2RDGA 4ILWA 4IUTA 5C44B 2AWOA 5C3WA 2Q8TA 2O5JC 1IYUA 2IX3A 4TSSA 2ZT9C 4DNRB 3K0YA 1D5XC 2RVLA 3VYRA 2DY8A 1PZID 3I90A 3BYTB 2RA4A 5T1IA 1Q12A 1PFBA 4UAIA 1LT3D 1A2UA 3SEBA 1LT4D 3H0GB 2Z4IA 1KNAA 1WD0A 2PW7A 2OF1A 3BVMA 1F2ZA 5BN5A 2MGSA 1HQRD 4A3FB 3TP7A 5IGFA 2FFKB 1Q3LA 2F0UA 3TN2A 1QILA 3BVZA 5IIFA 5FO7B 4NW2A 1L0XB 1EOTA 3FVQA 1F9SA 5IODA 4QUFA 2A74C 4KY5A 1DOMA 5G3LD 5C3EB 2QCPX 1EY4A 5E3FA 3WDNA 3NXWA 1CT1D 1TIID 2O5IC 1H9KA 5JJZA 1GXDC 3TP8A 5C3XA 2F3WA 1Y69U 2PCFB 3N6RA 3OMGA 2SEBD 2E76C 3H94A 1BNZA 2VXWA 3VR2A 4CKEA 2RSOA 1HHVA 4C3JB 3M7NA 2Q8RE 4DAPA 3Q0AA 2WIIB 1EY6A 4HSPA 2B63B 4BA1I 4IFDH 1BCPC 2EY5A 4XQJA 1V8QA 3J80E 1XXGA 2Z4HA 4OL7A 1IW7C 4F7XA 3PUWA 3A7AB 3CKIB 2B2WC 1W6JA 2EYLA 1EYDA 4CJ2C 2H1EA 1M4VA 2K04A 1Z6HA 1WTOA 1D2BA 1Q1BA 1STNA 1G91A 1DCZA 2Y0SB 1PXUA 5EKIA 4KKTA 4HSVA 3QG1A 1ZYRD 3P7JA 1WTPA 1GUGA 1NUCA 1KABA 2K5WA 1EQTA 4CKCA 3S1MB 3M7GA 2EY6A 5EBCA 1C4QA 1I4QA 1GJXA 3I91A 1F2YA 1CM9A 1ENFA 2R7ZB 2B2UC 2WAQB 4TRDA 1BR9A 1A15A 3EVQA 3KLRA 1EU3A 4IUQA 2VB3X 4NP5A 2SNMA 2PYKA 5CV4A 1BBXC 1EY5A 4XIGS 4C2MB 4PMWA 2SOBA 3R8BA 3SK4A 5EJWA 2B8GA 5J39A 5CV6A 3RLFA 3NPPA 1D6EC 2HDMA 3G6JB 4ZUIA 3HP3A 2E2IB 3DHQA 4IFDI 2K6AA 2NTSA 4TKOB 4A93B 1LT5D 5COYA 2K1BA 1ENAA 2HCIA 3H3VC 2QEJC 3ERQA 3J7AV 1J9OA 4XXEA 3NWSA 4PQXA 1HXYD 2NVYB 5C5MA 3OHXC 1O78A 1MGSA 3HG9A 5CV9A 2JA7B 2YYZA 5E4WC 1II3A 1NAPA 2VUMB 1EFID 2KJXA 3LX0A 2FJ2A 1JICA 5CV5A 1B4OA 2Q8IB 1IKMA 3NSWA 3QO2A 2CW0D 1RTNA 4A3IB 3W2DA 2BCOA 3BG3A 1EY7A 4HCEA 1EEID 1O7LA 4KY6A 2JEBI 2SDFA 2NYZD 5DNFA 3E5SA 3E0JA 5CC4A 3QJYA 1H9MA 1KNEA 1QJOA 1I4XA 1NSNS 2L5TA 4X3SA 2G9HD 3C3LA 5CYUA 2B2WA 2RBMA 5E4XA 3K5LA 3M4YA 2IT1A 3M3YB 4OO1I 4RWSC 1HPCA 1ET9A 1SNQA 1B2TA 2LMCB 1PDQA 5D3DA 2IPKD 1JCKB 5CV8A 1OXXK 1BCPB 1AFPA 4A3KB 2O2LD 1PTOH 3NQTA 5LHY1 3S1NB 1PFMA 5M5WB 1RF2D 2AQ3B 3K58A 2B2TC 5EPLA 4DF7A 1VF5C 3OSOA 2XIWA 4DXGA 4E6IA 1MSHA 4A3BB 4LAAA 1Q8IA 2F0HA 3C2PA 1HCZA 3K6OA 2JA8B 1TWHB 1TR5A 1S5FD 4FNFA 3A54A 4C3JG 3Q6SA 1CA5A 1STGA 3VA7A 4RA8A 1TKWB 3OWFA 3MWYW 4OIJA 1TVXA 1LTBD 1SEBD 2EYFA 3C1EA 1Y8OB 4PMCA 2L4NA 2PZTA 1YNJD 1AZPA 1D5MC 1JB3A 3NP8A 1JOOA 2I46A 5CMDA 4ZK9B 4K5WA 4RCNA 2ID0A 4Y7NB 1YNND 1K8MA 4BBRB 1DJRD 3DWPA 1I4HA 4G57A 3TP5A 1SNCA 1E2ZA 3DM1A 2F0DA 2OT2A 4CJ1B 1PZKD 4Z9CB 3ZYYX 5C4XB 1EY9A 3HRZC 1LLRD 2F0WA 5I2YA 2PQEA 2LKVA 5C4JB 3SHLA 1JOQA 3HZXA 2JA5B 4OO1H 2MUYA 4KY7A 2A69D 4WRDA 5JEAH 2NBFA 3GD7A 3BDCA 3RUZA 2DNEA 2BDOA 2WACA 2IWHA 4DXFA 3V05A 1JWMD 2A68C 3J80L 2KA7A 3J7YW 2IJ0A 3BS1A 4EGVA 2F0FA 1TT2A 3NQIA 5AFWA 3BYYB 4AYBB 2D9UA 4KJNA 2JE6I 3T16A 2F0OA 1VMCA 1UEAB 4MHEA 1D5ZC 4OHJA 3D31A 5IOCA 1BXTA 3I73A 4F88A 4ZAIA 1AN8A 2LFNA 1SDFA 2AUKA 4WFN3 4C3HB 3SK6A 1HTPA 4B9XA 1B44D 3P75A 2F0LA 1TS2A 1I50B 1CK1A 5DEHA 3S15B 2D2CC 1SYFA 4ME5A 1TS5A 3TDQA 2WINB 2FINB 4K2KA 3MFGA 2KUMA 4HCSA 5A2QE 2DY7A 5EPJA 2MP1A 2EE1A 3S1RB 4CGYB 2QKIC 2XSCA 3K5NA 1SNOA 2NB0A 1HTLD 3Q23A 4IUVA 3PO2B 4KV6A 1DONA 4DA2A 1YNJC 1ET6A 5ELDA 2RQXA 4I7ZC 1LTID 1QWYA 3K5OA 4DAVA 3QOJA 2WV6D 1W6KA 2NWGA 2K28A 3PUYA 4YIJA 3D4WA 1K8OA 4QCLA 3SR1A 2L1BA 2EJGC 1RJTA 5FKAC 4C3IG 1TWAB 1PRTF 4FF1A 1F77A 2JA6B 4G7OC 4XDXA 3S16B 5LL6X 3SVMA 3NBHA 5LL6S 4Q5VA 3IL8A 1KAAA 3HOWB 3R2TA 2L12A 3W3AA 2O4XA 1STBA 5DM73 1HFNA 4ZKCB 1RD9D 3UI2A 1LV9A 2A69C 1LT6D 5EKKA 2RDHA 1SYEA 1H9SA 3WOFA 2A68D 3GQBA 1D1KA 4G7HC 3MA2B 3EFXD 4KKSA 4LK1C 5CBAE 5M3MB 3TSSA 2FHTA 4ABNA 1DYQA 5BN4A 3GTJB 1F9PA 3GTPB 2A6EC 3NE5B 1X3QA 1E0BA 2X6LA 2L0CA 4BWGB 1IYVA 1B9NA 4R8IA 3GTQB 1BUVT 4N9TA 4H13C 4XTCS 4XQNA 1SFOB 3A8JE 3PUXA 2R93B 3VR5A 2IW3A 2WB1B 4ZLTF 1E2WA 2AQ2B 3MHBA 4L63B 2K05A 3DWQA 4HEDA 2MHVA 2F0VA 3TBIB 4QF4A 5IT9L 4B08A 5A2QL 4F87A 2NN6G 2KOLA 2RSNA 2N88A 1ML0D 2L11A 2X6GA 3D6WA 4A3EB 1HA6A 3RD4A 3AU7A 1JOKA 1U4RA 4CBVA 3T56B 4V190 3PMFA 2MPMA 4K6DA 3QIAA 4BBSB 3DMUA 1PRTB 3HS0C 4IQZA 1I4PA 4DNTB 3D3RA 2WKDA 1XX8A 2NVXB 2ICEC 3HKZB 3I3CA 2PPBC 4IUPA 2NVQB 3TZDA 3QOLA 1SMYD 1FNUA 3S14B 3PIP3 1PRTC 4RHSA 3U9SA 5IGDA 4RCOA 1C48A 5HURA 1Q1EA 3IFDA 2K03A 4QMGA 3HOXB 1MBYA 3T53B 5KIXA 1NCVA 1O80A 1BCPF 3MZ5A 1J8IA 3L3OC 5TSSA 4J1MA 5JVG3 1RODA 5FLXL 2F3VA 2EYOA 1OXSC 4DFAA 4RAUC 2QF7A 2KCCA 1BQQT 1SYBA 3J7AF 2A6ED 5KNBA 4C56C 2A6HC 3G7LA 1DM0B 1ENCA 1XWEA 2NVTB 1WCMB 1WD1A 1ZXTA 1A3UA 3LWEA 1LTGD 4XT1B 1TWFB 1IHZA 4X3KA 3PO3B 1F2LA 1I4RA 4Q0FA 1M8AA 4S3SA 5CV7A 4RKLA 4FP5D 4IURA 1AZQA 3AMUA 3M4OB 1Z7TA 1CI3M 2B2YA 2A73B 3NBIA 1CQVA 2QDBA 2E74C 1STHA 1EYCA 4V0BA 3QB3A 1LABA 2ICIA 4MN3A 1BDOA 3HOUB 3VA5A 5C5LA 1EY0A 3NTHA 3K59A 3EA6A 3MC0B 2F0KA 1BF4A 3FKIB 4KN4C 3NTIA 1A3TA 1X32A 4G4KA 3VR3A 3NK9A 3I4LA 2F0IA 1MSGA 4NDXA 3Q24A 2GA4B 4C3HG 3MVVA 1PTOC 1UUPA 1LTAD 2F0QA 4X3UA 4XT3B 1S5DD 5KYIA 4O1NA 2AQ1B 2X69A 2XWJB 3BDOA 4KD3A 2MJ8A 3VYTA 1LTTD 1GHJA 2J0TD 2F03A 1C8CA 4DAYA 1CFMA 1SJHD 4K6LA 3P20A 1FR3A 4FXGC 1FD7D 1B9MA 5JAVA 4DK0A 3MAQA 2IX1A 3SK8A 2V4DA 1TS3A 3D4DA 4JK1C 2M2LA 2EVBA 1B1ZA 3SDZA 1MD2D 3S2DB 5IT9E 1KLGD 2BE5C 1HUMA 1VMPA 2F4IA 1G2SA 4ZRZA 1V1OA 2HDLA 5JPMC 4ULLA 4K8IA 1V1PA 4QB4A 3ND9A 2WKCA 3R93A 2F0MA 2DNCA 3I4MB 5KEEA 3HOVB 2XN9C 4IALA 1ILQA 3A56A 1SNPA 3BDLA 1TY2A 3EROA 1NR4A 2OXPA 4KD4A 2B2VA 3IFTA 1WTVA 4HMIA 1BO0A 2HQEA 3J81E 4FO2A 4FF4A 1SE2A 3P1HA 4FF2A 1B53A 3AB9A 4RKBA 5CORA 2M00A 2R3ZA 2JYOA 2PW5A 4NKLA 3H09A 1LO5D 5FOBB 3ND8A 4CKBA 5M5YB 4KHVA 5NUCA 4ZQ3A 2JEAI 1IW7D 5I4DA 1JWUD 1SXTA 4FXDA 2DN8A 3S9WA 3KLSA 5D3IB 2VB2X 2BA1A 4NMZA 3CU7A 1HUNA 2L9HA 2B2VC 1ZYRC 4P2CB 4ODGA 1WVLA 5K5PA 1EWHA 4K5VA 4L8JA 3E6ZX 5I2XA 1WTQA 3L9AX 1L0YB 1SSOA 1E2VA 3GTOB 2EYPA 1EIHA 4X3TA 2C5CA 2K7VA 1JR0D 1S5CD 1A2TA 3OIPA 1OXTA 4QUCA 2KHSA 3OWEB 1WTWA 2D5DA 5I6YA 2EDGA 3T51B 4N9PA 4FF3A 5I6WA 5JEAG 3GTKB 1EZ6A 4HMJA 4G7ZC 1G8ZD 4KKUA 1DD2A 3CRLC 1JORA 4O42A 2XNAC 3O13A 2CW0C 1H9JA 1EYAA 1FGBD 4XQQA 3R3OA 4OIKA 2TMPA 2BDNA 4A3JB 2NTTA 3K7AB 2PNRC 1DOLA 4RGOS 4OO1G 3A55A 3I70A 3OIQA 3A8KE 4ID6A 2BE5D 1QNKA 3GTMB 1ONLA 5C0XH 4ZUJA 2H4OA 1UNSA 2E75C 2PZUA 1RCVD 1OXUA 1HA5A 3KUPA 2R92B 4K8JA 3FPUB 1WTRA 3RZOB 2D62A 1I6HB 2J7ZA 3HEJA 5C4ZA 5KGUA 4CJ0B 4IFDG 1SNDA 1Y8NB 3A7LA 1ZEQX 1CHPD 2NUCA 3TP6A 3L7ZC 2K33A 2KCNA 2XVSA 3H91A 3FDTA 4IUNA 1AEXA 4DGZA 5KRUA 3JAML 4HTHA 5D65A 4MIUA 3TZUA 1KDCA 5JVH3 2F0JA 5J1ZA 4IUUA 4L6TB 4TQUS 3MXNA 2FMMA 1CHQD 1RTOA 3GV6A 1IL8A 3FMCA 3OOCA 1Y8PB 1SYDA 1TY0A 4B9WA 1GUNA 3CRKC 4LMQD 3T13A 2HCCA 2F0PA 5KNDA 2K5DA 5EPKA 5D14A 1EU4A 1KDBA 5HGTA 4WJWA 1S5ED 3KF8A 2PZWA 1OXVA 3I72A 2JSOA 1FNWA 2F0SA 2FMCA 1HRJA 1EWCA 3MEHA 3IAYA 3DUZA 2JXMB 1SJED 3JAME 2BOSA 4OGQC 5M9OA 2F0TA 4K5XA 5ELEA 3TMEA 5JPNC 1EY8A 1ZKOA 1OO9B 3NTKA 2EPBA 2OEOA 1LACA 5C0XG 2K32A 1Q90A 4U673 2IX0A 2AUJD 1STYA 3T4AC 1CQFA 3WOEA 3ONAB 2R6GA 1U4LA 1VF7A 4H7BA 4R9WA 4KK7A 2LY7A 1F9QA 4RGNA 1SE3A 1JWSD 3RZDB 1F2MA 1V43A 3S17B 3OW7A 3X3MA 2F1MA 2K01A 1D1IA 1VCIA 5IGCA 5FO8B 5KNCA 4ZKBB 1BOSA 3GTLB 1YNNC 2WP8J 2RKSA 5IGGA 5ISRA 4DN4M 1DZ1A 5CBEE 1JQYD 2F0NA 2IL8A 1B50A 1IKLA 5FLXE 3GO5A 3DEOA 1VDZA 4R8NA 4H0LC 1S4ZA 2F0EA 2XRQD 3V2TA 1PFNA 3MTSA 4IN3A 1DXMA 3VR4A 3GP7A 1STAA 1SAPA 2XWBB 1KDAA 1SYCA 1RDPD 2JP1A 3PV0A 1QOHA 2NN6I 1EL0A 3X3NA 1DOKA 5I9OA 5KYLA 1K83B 1SBBB 5CGKA 2M9VA 1QE6A 3CHBD 1F9RA 4WORA 4RGMA 1ESRA 1EIGA 4KHZA 4HAEA 3VYSA 5F2DA 3QWNA 4DU9A 4BA2I 4U68A 4RGTA 3KK7A 5E1FA 1ESFA 4KMUC 2F0GA 1Y1WB 2L55A 3I8ZA 1EZ8A 3GTGB 1HFGA 1GUOA 2PMZB 2EYJA 3LNNA 3D6CA 2BA0A 1QCBD 1B3AA 4KN7C 1KLUD 4A3DB 3GV3A 5T1GA 1KTKA 5DAUA 1I4GA 3J81L 2NZ1D 4LJZC 2KEDA 1WTXA 4KJOA 4PMBA 1PTOB 2CVRA 1V1PB 2B39A 4A3MB 1PMRA 3SK5A 3KLSX 1SNMA 1TWGB 3EJIA 3N52A 2LS01 1X3PA 1A3VA 3NWTA 2QILA 1SYGA 5EBDA 1TS4A 1ICWA 2HUGA 1T5XD 3V96A 5ELCA 2B2YC 3F2UA 5M5XB 1Y1VB 3RMHA 4PNYA 1I3QB 3MXUA 1EEFD 3M85A 5A35A 4C3IB 4M8AA 1TQOA 5K36G 4FVMA 3EQLC 1XYIA 4EVOA 3BVGA 3HGBA 1FNVA 4H44C 4XYQA 4EQPA 5FO9B 2B2TA 1CTMA 1STEA 1PLFA 3D4RA 3FEWX 1NR2A 4RFBA 4C1NI 5K36H 4M1UB 5IGEA 1H9RA 1O7ZA 4EQOA 1O7YA 2KEEA 2Z1CA 2EJFC 2NN6H 1I6VC 2R61A 3CQZB 3DEPA 1RHPA 3K5MA 1QG7A 2AWNA 3D8GA 5M3FB 4ZYSA 4FYDA 1Z47A 3VYUA 4QIWB 1QB5D 1CZWA 4DK1A 5I9PA 2ENBA 2YU9B 1U4PA 3K57A 2B2UA 1GOZA 3BZDB 1R9TB 3VR6A 3C46A 4EQNA 3SE0A 3NHHA 5BN3A 1UAPA 1JC7A 4K14A 5EQ0A 4PV1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGT A;  1TR5 A;  3LX0 A;  3MVV A;  4QF4 A;  5CV5 A;  4DFA A;  2M00 A;  1STN A;  2F0Q A;  4KJN A;  2PZW A;  3EJI A;  3T16 A;  2F0O A;  4ID6 A;  1STA A;  3SXH A;  3H6M A;  2PW5 A;  4NKL A;  2F0S A;  1A3V A;  1SYB A;  1KAA A;  4F8M A;  5J22 A;  1STG A;  5KYI A;  1KDA A;  1NUC A;  1SYG A;  3NUC A;  3OWF A;  1KAB A;  3OMC A;  1A2U A;  3MEH A;  2EYF A;  2EYH A;  3C1E A;  2O4X A;  1STB A;  4KHV A;  4PMC A;  1SYC A;  2EY6 A;  4ZUJ A;  4KD3 A;  4ZQ3 A;  5NUC A;  5IGB A;  1EY7 A;  5IOC A;  1U9R A;  2PZT A;  5M9O A;  1JOK A;  2F0T A;  2PW7 A;  4K5X A;  4PNY A;  2PZU A;  2OF1 A;  4KTA A;  3NP8 A;  1ENC A;  1JOO A;  1F2Y A;  4KY6 A;  3TME A;  4K8J A;  3S9W A;  1TQO A;  3PMF A;  1F2Z A;  5EKK A;  4K6D A;  5EKL A;  4K5W A;  3C1F A;  3HEJ A;  3ITP A;  1EY8 A;  3DMU A;  3TP7 A;  5C4Z A;  5I9O A;  4TRD A;  5IGF A;  5KGU A;  5KYL A;  2OEO A;  1SND A;  1SYE A;  4NMZ A;  3SK6 A;  1A3U A;  3E5S A;  4B9X A;  4EVO A;  3EVQ A;  2EY1 A;  5CGK A;  1IHZ A;  2F0U A;  3P75 A;  5JOB A;  2F0L A;  5CC4 A;  1STY A;  5IIF A;  5JAV A;  4WOR A;  4ODG A;  1NSN S;  4EQP A;  5DEH A;  3U9O A;  5KRU A;  4G57 A;  3TP5 A;  1SYF A;  5K5P A;  1SNC A;  2NUC A;  4K2L A;  3SK8 A;  1SNM A;  2F0D A;  4H7B A;  5IOD A;  4S3S A;  3TP6 A;  4KY5 A;  3D4D A;  5CV7 A;  4ME5 A;  4NP5 A;  4RKL A;  4K5V A;  5F2D A;  2EY2 A;  5IGE A;  4K2K A;  1EQV A;  2SNM A;  1EY9 A;  2PYK A;  1EY4 A;  1F2M A;  2EYM A;  3QOL A;  5CV4 A;  5EGT A;  4DU9 A;  2F0W A;  2RBM A;  1EY5 A;  3SK4 A;  2SOB A;  5E3F A;  4EQO A;  5J39 A;  3NXW A;  5IGC A;  2PQE A;  5CV6 A;  2LKV A;  2QDB A;  4IUN A;  2EYP A;  1AEX A;  4K8I A;  4I65 A;  1STH A;  3SHL A;  4DGZ A;  4QB4 A;  5E1F A;  3TP8 A;  5IGD A;  1JOQ A;  4HTH A;  1EYC A;  3HZX A;  5C3X A;  2EXZ A;  5HUR A;  2F0G A;  2F3W A;  1A2T A;  4MIU A;  3QB3 A;  3D8G A;  1SNO A;  4ZUI A;  1KDC A;  5CR3 A;  2F0J A;  3DHQ A;  2F0M A;  3OMG A;  1EZ8 A;  4IZ8 A;  4KY7 A;  5J1Z A;  2KHS A;  3VA5 A;  1SNQ A;  5C5L A;  4WRD A;  5I6Y A;  1EY0 A;  2RKS A;  5IGG A;  5KEE A;  4KV6 A;  2EYJ A;  4N9P A;  5C4H A;  2ENB A;  5I9P A;  5I6W A;  3D6C A;  5ISR A;  5CV8 A;  2F0K A;  4N9T A;  1EZ6 A;  4HMJ A;  4IAL A;  2F0N A;  1RKN A;  1ENA A;  3BDC A;  3RUZ A;  1SYD A;  3QOJ A;  4QMG A;  2KQ3 A;  3ERQ A;  3MXP A;  2WAC A;  3NQT A;  5KIX A;  1A3T A;  1SNP A;  1JOR A;  4B9W A;  5DAU A;  1EY6 A;  4R8N A;  3BDL A;  3ERO A;  3T13 A;  5C3W A;  2EY5 A;  2F0P A;  2F0E A;  1EYA A;  2OXP A;  4KD4 A;  4EQN A;  2SNS A;  4OL7 A;  3NHH A;  4HMI A;  4KJO A;  3NK9 A;  2HQE A;  5C5M A;  4DF7 A;  3MZ5 A;  4F7X A;  3OSO A;  2F0I A;  2RDF A;  3R3O A;  4PMB A;  4E6I A;  4NDX A;  4LAA A;  3V2T A;  3MHB A;  2F0H A;  3D4W A;  3P1H A;  4J1M A;  4YIJ A;  2EYL A;  1EYD A;  5CV9 A;  4K14 A;  2F0F A;  5C6A A;  1TT2 A;  3SK5 A;  1II3 A;  4RKB A;  3SR1 A;  2F3V A;  2F0V A;  4J6H A;  2EYO A;  1KDB A; 
#chains in the Genus database with same CATH topology
 1VQL A;  2K5V A;  1T5E A;  4QJF A;  4HJ8 A;  4JI7 Q;  3I4O A;  4BXX H;  4F8M A;  3DM3 A;  1TWC B;  3NUC A;  1TU2 B;  1R4P B;  3OMC A;  2XRS D;  1G6Z A;  5JEA J;  5DM6 3;  2I07 B;  3DWA A;  1PH3 A;  5IGB A;  2EZV A;  3HOZ B;  1IBM Q;  1CZG A;  4GZY C;  2EOT A;  3TS0 A;  1TWC H;  4DR3 L;  2PO4 A;  1PH4 A;  1GUW A;  5EKL A;  3S1M H;  3C1F A;  1Y14 B;  3ITP A;  2C9O A;  3A8I E;  5IWA L;  1GHK A;  3FRP B;  3PUV A;  1R4Q B;  1L2F A;  4J8Q A;  1E22 A;  3CCL A;  1A6X A;  2EY1 A;  4JV5 L;  1GUS A;  5JOB A;  4DV0 L;  1WCM H;  3S2D H;  3IKJ A;  3PUZ A;  4HR7 B;  3URY A;  4DR6 Q;  3U9O A;  1H9S B;  4Y52 H;  2EJM A;  4MNO A;  3KBG A;  1NE3 A;  2KEC A;  1EWI A;  5G3L F;  2EY2 A;  3FPP A;  4FXK C;  5ELN A;  4RHR A;  2ZXR A;  3OPO A;  1MI2 A;  3HOX G;  4BY1 B;  5BR8 Q;  3PCO B;  4IPC A;  1JE5 A;  3LWU A;  2LXJ A;  1MJC A;  4HN7 A;  3R2I A;  1ILP A;  4EX5 A;  2ES2 A;  4A3C H;  2EXZ A;  1PTO F;  4IZ8 A;  4JBW A;  4BY1 H;  2YV5 A;  1S5B D;  1L1O A;  4UDU C;  2E2H B;  1CKM A;  2ATW A;  1VQM A;  4IPD A;  3KJP A;  1JE4 A;  1RKN A;  3KBX A;  1G29 1;  4DV3 L;  2EIF A;  2K5Q A;  1QNU A;  1SMY C;  4PZ6 A;  4BY7 B;  2A5H A;  5FK9 C;  4CHT B;  4X62 L;  1UE7 A;  1LTR D;  4GLA C;  3DXJ C;  1PRT D;  2SNS A;  2A6H D;  4N8F A;  1HZB A;  4GOP A;  2PQA B;  1VQ6 A;  2RDF A;  1PYW D;  3MFY A;  1VQ9 A;  2CHB D;  5C6A A;  4YY3 Q;  4LF5 L;  4GOP C;  3H3V I;  2N55 A;  2Z8L A;  4J6H A;  1UE5 A;  3FHW A;  4RH6 A;  4BBS G;  3F8T A;  1L0W A;  1SLJ A;  2ZTE A;  3SXH A;  3H6M A;  2ZXP A;  3S2H B;  3B6Y A;  4UP9 A;  5J22 A;  4JVZ A;  1XPR A;  3PO3 G;  2E2J B;  4DR4 L;  1U4M A;  4GN5 A;  1J5E L;  1LTS D;  2EYH A;  3S1Q B;  2TSS A;  1U9R A;  4DR2 L;  3AEV A;  4KTA A;  4NXN L;  4C1N K;  4BS9 A;  2VNU D;  2J4X A;  4KI0 A;  5FLM H;  1PH7 A;  1XTC D;  2UUB L;  3CXC A;  3KYH C;  3RNU A;  1BCP D;  1Z9F A;  1CA6 A;  5IYC G;  2NVQ H;  1FYC A;  1N34 L;  2E2D C;  3ULL A;  5GAH C;  4DUY Q;  4LF9 L;  3HOY B;  3Q22 A;  3H15 A;  4K2L A;  4UHV A;  3PIO 3;  2KVM A;  2XTI A;  1AP0 A;  3CME A;  2B8F A;  4A3G H;  1EQV A;  4XYO A;  1HQM C;  5EGT A;  1YEZ A;  5FJ8 G;  2EYM A;  1G2T A;  4A75 A;  3NEM A;  3UE0 A;  1FL0 A;  1WCM G;  2ZXO A;  2G9D A;  4I65 A;  4A3G B;  2RCN A;  2CQA A;  1PZJ D;  2K50 A;  5CR3 A;  1NJI C;  3I4N B;  1VQ5 A;  1YHB A;  1PTO D;  5C0X I;  1GUT A;  1AW7 A;  5ELB A;  5C4H A;  4DV7 L;  5ELF A;  3GTP H;  1HH2 P;  5C0X J;  1SE4 A;  5GAD C;  4DK3 C;  3MXG A;  4LUO A;  2KQ3 A;  3MXP A;  4IFD J;  2RDG A;  4ILW A;  4IUT A;  5C44 B;  3GTQ H;  2AWO A;  2PMZ E;  5C3W A;  2Q8T A;  2O5J C;  1IYU A;  3HOU G;  2IX3 A;  4TSS A;  2ZT9 C;  4DNR B;  1CUK A;  3K0Y A;  1D5X C;  2RVL A;  3VYR A;  2R93 H;  2DY8 A;  4LF7 Q;  1PZI D;  2PI2 A;  3I90 A;  3BYT B;  2RA4 A;  5T1I A;  3JAM c;  1Q12 A;  4JI6 Q;  1PFB A;  4NB3 A;  3ULP A;  4UAI A;  1RIP A;  1TWH H;  1LT3 D;  1A2U A;  1P16 A;  1LT4 D;  3SEB A;  3H0G B;  3KF6 A;  3IRB A;  2WAQ E;  2Z4I A;  1I5F A;  1KNA A;  1WD0 A;  2PW7 A;  2OF1 A;  3RN5 A;  3BVM A;  1PV4 A;  1F2Z A;  3H0G H;  5BN5 A;  2Z6B A;  2UXC L;  2MGS A;  1HQR D;  5LMU L;  4A3F B;  3TP7 A;  5IGF A;  2EXD A;  4KHP L;  1PYS B;  2FFK B;  3HKZ G;  3UDX A;  1Q3L A;  2ZM6 L;  2F0U A;  3TN2 A;  3PSI A;  1QIL A;  3BVZ A;  3I2Z A;  5IIF A;  3E3X A;  5FO7 B;  2VQF L;  4NW2 A;  1L0X B;  1EOT A;  3FVQ A;  1F9S A;  5IOD A;  4QUF A;  2A74 C;  4KY5 A;  4R1J A;  3HOV G;  1DOM A;  1KC8 C;  5IP9 G;  4IJH A;  5G3L D;  5C3E B;  2QCP X;  4A3K G;  1EY4 A;  4YWK A;  1FJG Q;  4YCV A;  3UDI A;  4YHH L;  5E3F A;  1YJN A;  3WDN A;  3NXW A;  1CT1 D;  1TII D;  1HNZ L;  1H9K A;  5JJZ A;  2O5I C;  2Z6K A;  1GXD C;  3TP8 A;  4OWT B;  5C3X A;  2F3W A;  1Y69 U;  2PCF B;  3CP0 A;  3N6R A;  3OMG A;  2JA7 G;  2GN5 A;  2SEB D;  4A3M G;  2E76 C;  3G71 A;  3H94 A;  1XNR Q;  1HR0 Q;  1BNZ A;  2VXW A;  3VR2 A;  4CKE A;  2B63 G;  2JA5 H;  4JI0 Q;  2RSO A;  4LFC Q;  1HHV A;  4C3J B;  3M7N A;  2UXB Q;  2Q8R E;  4DAP A;  3Q0A A;  2WII B;  1EY6 A;  4HSP A;  4DR3 Q;  2B63 B;  4BA1 I;  4IFD H;  1BCP C;  2EY5 A;  4XQJ A;  1VQD A;  1V8Q A;  3J80 E;  1PH6 A;  1XXG A;  2Z4H A;  1K9M C;  5IWA Q;  4OL7 A;  1IW7 C;  4F7X A;  3PUW A;  3A7A B;  3CKI B;  4L5T A;  3F2C A;  2B2W C;  1W6J A;  3OTO Q;  2EYL A;  1EYD A;  1JMC A;  4CJ2 C;  2H1E A;  1M4V A;  2UU9 Q;  2K04 A;  1Z6H A;  3CCM A;  1WTO A;  1D2B A;  1Q1B A;  4POF A;  1VQ4 A;  1STN A;  1G91 A;  1DCZ A;  4A3C G;  3TEH B;  2Y0S B;  1PXU A;  3F2D A;  1HZA A;  3J80 i;  5EKI A;  4KKT A;  2F4V Q;  4HSV A;  3QG1 A;  4A3J H;  1ZYR D;  3K7A H;  3P7J A;  1GUG A;  1YIT A;  1NUC A;  1WTP A;  1KAB A;  3PGZ A;  1WJJ A;  4YWM A;  3JC6 6;  2K5W A;  4JI2 Q;  1EQT A;  4CKC A;  3S1M B;  4JI4 L;  2CQO A;  1CSQ A;  3M7G A;  2DJG C;  2EY6 A;  2NZH A;  5EBC A;  2MO0 A;  1C4Q A;  1I4Q A;  1GJX A;  3I91 A;  1F2Y A;  1CM9 A;  4MTK A;  1ENF A;  2R7Z B;  2B2U C;  2WAQ B;  4TRD A;  1BR9 A;  5LMN W;  4FDB A;  1A15 A;  1UE6 A;  3EVQ A;  4QY7 A;  3KLR A;  1EYG A;  4MTN A;  1EU3 A;  2NVT H;  4IUQ A;  2QA4 A;  2IHF A;  1EUJ A;  2VB3 X;  4NP5 A;  4APV A;  2SNM A;  2PYK A;  5CV4 A;  2KBN A;  1BBX C;  3G48 A;  1EY5 A;  4XIG S;  4C2M B;  4PMW A;  2SOB A;  3R8B A;  3SK4 A;  4LF5 Q;  5EJW A;  2B8G A;  5J39 A;  5CV6 A;  3RLF A;  2E2H H;  4GKK Q;  3NPP A;  1UE1 A;  1D6E C;  3MXN B;  2HDM A;  4A93 G;  4JCV E;  3G6J B;  4ZUI A;  3HP3 A;  4B3S L;  2E2I B;  3DHQ A;  2N3S A;  4IFD I;  2K6A A;  1XJV A;  4P75 A;  2NTS A;  1JB7 A;  4TKO B;  4A93 B;  2PI2 E;  3MEF A;  1LT5 D;  5COY A;  2K1B A;  3RN2 A;  1ENA A;  2HCI A;  2ALY B;  3H3V C;  2QEJ C;  2R7F A;  4DR2 Q;  3ERQ A;  1NBW A;  3J7A V;  1J9O A;  3K7U C;  1PH1 A;  4XXE A;  3NWS A;  4PQX A;  1HXY D;  1BKB A;  2NVY B;  2DUD A;  5C5M A;  3PIP A;  2AMC B;  3OHX C;  2I5H A;  1O78 A;  5AJ3 Q;  1MGS A;  4HID A;  3HG9 A;  5CV9 A;  2JA7 B;  2YYZ A;  5E4W C;  1II3 A;  1NAP A;  1FGU A;  2VUM B;  4R4C A;  1EFI D;  2K5H A;  2KJX A;  3LX0 A;  2FJ2 A;  1IXR A;  1JIC A;  5CV5 A;  3TRE A;  5M5Y H;  1B4O A;  4IPH A;  1A62 A;  2Q8I B;  2JA7 H;  1C7Y A;  3NSW A;  1IKM A;  4JBK A;  4A76 A;  3QO2 A;  1TWA H;  2JA6 H;  2CW0 D;  1RTN A;  4A3I B;  3STB C;  5C3E G;  2K75 A;  3W2D A;  2BCO A;  2Y0S E;  3BG3 A;  1XNQ Q;  1EY7 A;  1K83 H;  4DV6 Q;  2H5X A;  4BY1 G;  4HCE A;  1EEI D;  1O7L A;  2JK8 A;  4KY6 A;  3ICE A;  2JEB I;  2KCT A;  2SDF A;  4OWW B;  2YTV A;  4LF8 L;  2NYZ D;  5DNF A;  4DR1 L;  4DV7 Q;  3E5S A;  3E0J A;  5CC4 A;  3PIO A;  3QJY A;  1H9M A;  1KNE A;  1QJO A;  1I4X A;  1NSN S;  2KHI A;  3T1H Q;  2L5T A;  2F52 A;  4LFB L;  4X3S A;  1ICF B;  2G9H D;  1B7Y B;  3NEL A;  4O0A A;  3C3L A;  3H0G G;  3Q8D A;  5CYU A;  2MQH A;  1X3F A;  2B2W A;  2RBM A;  3PF4 A;  3I4N H;  5E4X A;  3K5L A;  4B3M L;  3M4Y A;  2IT1 A;  3M3Y B;  3RZD H;  4OO1 I;  4RWS C;  1HPC A;  3S17 H;  1ET9 A;  3EN2 A;  1SNQ A;  4AQY Q;  1B2T A;  3KLW A;  2LMC B;  1PDQ A;  4GLV B;  5D3D A;  1EQR A;  2IPK D;  1JCK B;  5CV8 A;  2UUA L;  1OXX K;  5GAE C;  1BCP B;  1AFP A;  4K0K Q;  4A3K B;  2O2L D;  1PTO H;  3NQT A;  5LHY 1;  3S1N B;  2ZJP A;  1PFM A;  1YJ9 A;  5M5W B;  1RF2 D;  2AQ3 B;  1YNX A;  3K58 A;  2B2T C;  2JA8 H;  5EPL A;  4GNX A;  4DF7 A;  1VF5 C;  3OSO A;  2XIW A;  4DXG A;  4E6I A;  1MSH A;  4KHP Q;  4A3B B;  4LAA A;  1Q8I A;  2F0H A;  3C2P A;  4DV4 L;  1HCZ A;  4DV5 L;  3K6O A;  3OW2 A;  2UUC Q;  2JA8 B;  1TWH B;  4PZ8 A;  1TR5 A;  1S5F D;  3CAM A;  4FNF A;  3A54 A;  2I5L X;  4C3J G;  1I3Q H;  1PYB A;  3Q6S A;  4ZCK A;  1CA5 A;  1STG A;  3VA7 A;  4RA8 A;  4WJ3 M;  1TKW B;  2K52 A;  3OWF A;  1FJG L;  3MWY W;  1VQB A;  1TVX A;  4OIJ A;  1LTB D;  1SEB D;  2EYF A;  4YHH Q;  3C1E A;  1Y8O B;  4PMC A;  1FVI A;  2L4N A;  2PZT A;  1Q46 A;  1YNJ D;  1AZP A;  1D5M C;  1JB3 A;  3NP8 A;  1JOO A;  2I46 A;  2LXK A;  5CMD A;  4ZK9 B;  4K5W A;  1XNR L;  4RCN A;  3HKZ E;  5C4X H;  2ID0 A;  4Y7N B;  1YNN D;  1K8M A;  4BBR B;  1CSP A;  1DJR D;  3DWP A;  1I4H A;  1QVC A;  4G57 A;  3TP5 A;  1SNC A;  1E2Z A;  3DM1 A;  2F0D A;  2OT2 A;  4DUZ L;  4CJ1 B;  1NNX A;  1PZK D;  4Z9C B;  3ZYY X;  5C4X B;  5IP9 H;  1EY9 A;  1V1Q A;  3HRZ C;  1LLR D;  4JI1 Q;  3OTO L;  2F0W A;  3FP9 A;  4LUZ A;  5I2Y A;  3AYH B;  2VS1 A;  3NEN A;  2CKZ B;  4JBJ A;  1E24 A;  2PQE A;  2LKV A;  2UU9 L;  5C4J B;  3SHL A;  2B29 A;  1JOQ A;  2WB1 G;  1ASY A;  3HZX A;  2JA5 B;  4OO1 H;  5LMN Q;  2MUY A;  4KY7 A;  2A69 D;  3GTO H;  4WRD A;  1R9T H;  1EFW A;  2JA6 G;  5JEA H;  2NBF A;  3JAM i;  3GD7 A;  3BDC A;  2XGT A;  3RUZ A;  2CH4 A;  2DNE A;  2BDO A;  2WAC A;  2GVA A;  2IWH A;  4DXF A;  3V05 A;  1JWM D;  2A68 C;  1XMO L;  2JA9 A;  3J80 L;  2KA7 A;  4LF6 Q;  3J7Y W;  2IJ0 A;  3F2B A;  3BS1 A;  4EGV A;  4IOC A;  2F0F A;  1TT2 A;  4R4O A;  3NQI A;  4R4T A;  4JOI C;  4CDF C;  5AFW A;  3BYY B;  4AYB B;  2D9U A;  4KJN A;  2JE6 I;  3T16 A;  4X6A H;  3CW2 C;  2F0O A;  1VMC A;  1UEA B;  4OX9 L;  1TXY A;  4A3M H;  1I94 Q;  4MHE A;  1D5Z C;  4OHJ A;  3KF8 B;  2N8N A;  1VQ8 A;  3D31 A;  5IOC A;  3KDF B;  1BXT A;  3I73 A;  4GKK L;  4F88 A;  4ZAI A;  1MHW C;  1M1K C;  4GKJ Q;  1AN8 A;  1PH9 A;  3RLO A;  4B3S Q;  2LFN A;  1SDF A;  3J7Z C;  2I0Q A;  3TQY A;  2AUK A;  4WFN 3;  5IYD H;  4C3H B;  3SK6 A;  1HTP A;  4B9X A;  1VQ7 A;  2OTL A;  1B44 D;  1N9W A;  3P75 A;  4C3I H;  2F0L A;  1IYJ B;  1TS2 A;  1L1O C;  1Y1W G;  2Q2U A;  1I50 B;  1CK1 A;  1QUQ A;  4X65 L;  2E5L Q;  1KIX A;  5DEH A;  3S15 B;  2D2C C;  1SYF A;  4JC0 A;  3HOZ G;  1JJG A;  4ME5 A;  1TS5 A;  3TDQ A;  2WIN B;  2FIN B;  4K2K A;  1M90 C;  3MFG A;  2KUM A;  4HCS A;  5A2Q E;  2E2I H;  2CWA A;  2DY7 A;  5EPJ A;  5IE8 A;  5JJI A;  2MP1 A;  1VS0 A;  1N33 L;  3PO2 H;  3I4M G;  2EE1 A;  3S1R B;  4CGY B;  2QKI C;  2KCM A;  2XSC A;  3K5N A;  1SNO A;  1S72 A;  2NB0 A;  1HTL D;  3Q23 A;  2VQE L;  4IUV A;  3PO2 B;  4KV6 A;  1DON A;  3CC4 A;  4DA2 A;  1YNJ C;  1ET6 A;  5ELD A;  5J3B A;  4QGU A;  2RQX A;  4I7Z C;  1LTI D;  1QWY A;  4L5S A;  1XNQ L;  3K5O A;  4DAV A;  3QOJ A;  2WV6 D;  1W6K A;  4UY8 C;  1DGS A;  3VDY A;  2VUM H;  2NWG A;  5FLX c;  4DR1 Q;  2K28 A;  3PUY A;  1N8R C;  4YIJ A;  3D4W A;  4L5R C;  2A19 A;  1K8O A;  1QVG A;  4QCL A;  4J15 A;  3SR1 A;  2L1B A;  2EJG C;  1RJT A;  5FKA C;  3W1B A;  4C3I G;  1TWA B;  1PRT F;  4FF1 A;  1F77 A;  2JA6 B;  4G7O C;  4A3I H;  2K14 A;  4XDX A;  3S16 B;  3RR5 A;  5LL6 X;  3SVM A;  3NBH A;  5LL6 S;  4Q5V A;  3IL8 A;  1KAA A;  3HOW B;  2OWO A;  3J81 i;  3R2T A;  2L12 A;  3W3A A;  4DNI A;  1K3B C;  1E3P A;  2O4X A;  1STB A;  5DM7 3;  3ERS X;  4ZKC B;  1HFN A;  1RD9 D;  4B3M Q;  3UI2 A;  1LV9 A;  2A69 C;  1LTL A;  2ASB A;  4YCU A;  1LT6 D;  2N49 A;  5EKK A;  2Q2T A;  2RDH A;  4AH6 A;  4HIK A;  1SYE A;  1H9S A;  3WOF A;  5M3M H;  3A0J A;  4JI5 L;  2A68 D;  3GQB A;  5M3F G;  1EQQ A;  1D1K A;  4G7H C;  3CC7 A;  3MA2 B;  2VZA A;  4CDC C;  3EFX D;  4KKS A;  4LK1 C;  5CBA E;  5M3M B;  3TSS A;  2FHT A;  4ABN A;  1DYQ A;  4A3D G;  5BN4 A;  1SE8 A;  3E0E A;  3GTJ B;  1PVO A;  2DGY A;  4DV5 Q;  1F9P A;  3J7A 5;  3GTP B;  2K5N A;  2A6E C;  3NE5 B;  1X3Q A;  1E0B A;  1KL9 A;  2X6L A;  2L0C A;  4HJ7 A;  5DLQ E;  4BWG B;  3M4P A;  1IYV A;  3CCS A;  3HKS A;  1B9N A;  3OYY A;  4R8I A;  2DJF C;  1HNX Q;  1WFQ A;  5C44 H;  3GTQ B;  3RLN A;  1BUV T;  2KHJ A;  4N9T A;  3S24 A;  4H13 C;  3KJO A;  4XTC S;  4GNX C;  4RG1 A;  4XQN A;  1SFO B;  3I4M H;  3ULJ A;  3A8J E;  1AH9 A;  3PUX A;  2R93 B;  3VR5 A;  4MZ9 A;  4A3I G;  2IW3 A;  2WB1 B;  4ZLT F;  3PQI A;  1X55 A;  1E2W A;  2AQ2 B;  3MHB A;  4L63 B;  2K05 A;  3DWQ A;  2HHH L;  3K81 C;  4HED A;  2MHV A;  4R4I A;  4TVA B;  1HR0 W;  2F0V A;  3TBI B;  3KDF A;  4QF4 A;  5IT9 L;  1VQP A;  4JYA L;  4B08 A;  5A2Q L;  3G6E A;  2D0P A;  3U50 C;  2NN6 G;  4F87 A;  4B3R Q;  2VUM G;  2KOL A;  4DR7 Q;  4A3L H;  4JPB W;  2RSN A;  2N88 A;  1ML0 D;  2L11 A;  2X6G A;  3D6W A;  4JI1 L;  4A3E B;  4YY3 L;  1N32 Q;  4A3F H;  1HA6 A;  4ME3 A;  4EQ5 A;  3RD4 A;  3S2H H;  3AU7 A;  1JOK A;  3ZJY C;  1SMX A;  5IP7 H;  2E2J H;  1U4R A;  4CBV A;  3T56 B;  3E9H A;  4V19 0;  5LMN L;  3PMF A;  2MPM A;  4K6D A;  3QIA A;  1LYL A;  3WWV A;  4DAM A;  2NVX H;  4BBS B;  3DMU A;  1PRT B;  3HS0 C;  4IQZ A;  4B3T Q;  1I4P A;  3T1Y L;  4DR4 Q;  4NPS A;  1W3S A;  4DNT B;  1J5E Q;  3D3R A;  3I56 A;  2BH2 A;  3HOW G;  2WKD A;  1XX8 A;  4PZ7 A;  2NVX B;  2ICE C;  4LFA L;  2ZTC A;  2Z0S A;  3HKZ B;  5JJL A;  4DAY B;  3I3C A;  1XMO Q;  5EAY A;  4BY7 G;  2PPB C;  4IUP A;  2NVQ B;  3TZD A;  3QOL A;  1SMY D;  2MFI A;  1FNU A;  4AIM A;  2UXD L;  5GRO A;  3S14 B;  3PIP 3;  1PRT C;  5JJK A;  4RHS A;  3U9S A;  5IGD A;  4DUY L;  1SR3 A;  4LF9 Q;  4RCO A;  1C48 A;  2YU9 H;  1YBY A;  1Q1E A;  5HUR A;  3G4S A;  3IFD A;  1NY4 A;  4OON A;  1YVC A;  2K03 A;  1EIY B;  4DV1 Q;  2KEN A;  1GVP A;  3PF5 A;  1Y1W H;  1YHQ A;  4QMG A;  3HOX B;  1MBY A;  3T53 B;  5KIX A;  1NCV A;  4GKJ L;  2Q2H A;  1O80 A;  4UP8 A;  4JI7 L;  1HZ9 A;  2HIV A;  1BCP F;  3MZ5 A;  1PA6 A;  1J8I A;  3L3O C;  4A3D H;  5TSS A;  3CCQ A;  4J1M A;  3BZC A;  5JVG 3;  1ROD A;  2QGQ A;  5FLX L;  2F3V A;  2CWP A;  2EYO A;  4X65 Q;  2E5L L;  3U4V A;  1OXS C;  4DFA A;  4RAU C;  2QF7 A;  4A3B G;  2KCC A;  3TS2 A;  3HOY G;  1BQQ T;  1SYB A;  4OXP A;  4JOI A;  1XMQ Q;  3J7A F;  3E9I A;  2L15 A;  4LNQ A;  2A6E D;  1UWV A;  2R7Z H;  5KNB A;  4C56 C;  2A6H C;  1MJE A;  3G7L A;  4H02 A;  1DM0 B;  4GLX A;  1ENC A;  1XWE A;  2NVT B;  1WCM B;  1WD1 A;  1ZXT A;  3S15 H;  2VQE Q;  2Y0S G;  1A3U A;  2RHS B;  3LWE A;  1LTG D;  4XT1 B;  1TWF B;  4QQB X;  2P5Z X;  1IHZ A;  4X3K A;  2R92 H;  3PO3 B;  1K8A C;  3M4O H;  5GQO A;  2N78 A;  1F2L A;  1I4R A;  1V9P A;  2JJQ A;  2JQO A;  4Q0F A;  1M8A A;  4C2M H;  4S3S A;  5CV7 A;  4RKL A;  1TWF H;  4YWL A;  4FP5 D;  4IUR A;  5H1S E;  1AZQ A;  5LMU Q;  3AMU A;  3M4O B;  1Z7T A;  1CI3 M;  2B2Y A;  2A73 B;  3CPW A;  3NBI A;  2C35 B;  2ZM6 Q;  1CQV A;  2QDB A;  2E74 C;  1STH A;  1VQF A;  1EYC A;  4V0B A;  2VQF Q;  2E8G A;  3QB3 A;  1IBK Q;  1LAB A;  2ICI A;  4PG3 A;  4MN3 A;  3FKI H;  1BDO A;  3HOU B;  3VA5 A;  1YJW A;  5C5L A;  2MO1 A;  1EY0 A;  2JA8 G;  3NTH A;  3K59 A;  1B3Q A;  3EA6 A;  3MC0 B;  5E7N A;  2F0K A;  3DLL A;  1BF4 A;  3FKI B;  4KN4 C;  5IY0 A;  1EOV A;  1HNZ Q;  3NTI A;  1A3T A;  1X32 A;  4G4K A;  4P72 A;  4POG A;  1PHJ A;  3VR3 A;  1D8L A;  2IHE A;  3NK9 A;  3I4L A;  2F0I A;  1MSG A;  1PFS A;  1HR0 L;  1PH5 A;  4NDX A;  3Q24 A;  2GA4 B;  4C3H G;  2R92 G;  3KF6 B;  3MVV A;  1PTO C;  1UUP A;  2UXB L;  1LTA D;  3M4Q A;  2F0Q A;  4X3U A;  4XT3 B;  4IOA A;  2GVB A;  1S5D D;  2UUB Q;  5KYI A;  4O1N A;  4LW1 A;  2AQ1 B;  4BBR G;  2X69 A;  4AYB E;  2XWJ B;  3BDO A;  4KD3 A;  1MIU A;  2MJ8 A;  3VYT A;  1LTT D;  1QZH A;  4GS3 A;  1HZC A;  1GHJ A;  2J0T D;  2F03 A;  1C8C A;  3HOY H;  2QW7 A;  4DAY A;  2CCZ A;  1AE2 A;  1CFM A;  3HOZ H;  1SJH D;  4K6L A;  3P20 A;  1FR3 A;  4FXG C;  5HGQ A;  4JI2 L;  1FD7 D;  1B9M A;  5JAV A;  5L37 A;  3I4N G;  4DK0 A;  3MAQ A;  2IX1 A;  4GN3 B;  3SK8 A;  2A8V A;  2V4D A;  1TS3 A;  3D4D A;  4JK1 C;  2M2L A;  2EVB A;  2MNA A;  1B1Z A;  3SDZ A;  1MD2 D;  3S2D B;  1T9H A;  5IT9 E;  1KLG D;  2BE5 C;  1HUM A;  3AFQ A;  1VMP A;  2F4I A;  1G2S A;  4ZRZ A;  1CKO A;  1V1O A;  2WAQ G;  2HDL A;  5JPM C;  4ULL A;  4K8I A;  1V1P A;  3HOV H;  1VQC A;  4QB4 A;  3ND9 A;  2WKC A;  1X9N A;  4DKA C;  4A3K H;  3R93 A;  2F0M A;  3S1N H;  4B3R L;  2DNC A;  2FXQ A;  1N36 Q;  3I4M B;  1X6O A;  5KEE A;  3HOV B;  3SGI A;  2XN9 C;  1A8V A;  2WB1 E;  4IAL A;  1ILQ A;  4I7A A;  4LF4 Q;  3A56 A;  1SNP A;  1BBW A;  3BDL A;  1TY2 A;  2VL6 A;  3ERO A;  4JI3 L;  4JI6 L;  1NR4 A;  2OXP A;  4KD4 A;  4P73 A;  2B2V A;  3IFT A;  4HMI A;  1WTV A;  1BO0 A;  2HQE A;  3J81 E;  4FO2 A;  3T1Y Q;  1SE2 A;  4FF4 A;  2LSS A;  3P1H A;  4FF2 A;  1B53 A;  3AB9 A;  4RKB A;  2NVY H;  3H3V H;  2YTX A;  5COR A;  2M00 A;  2R3Z A;  3W5O A;  1O7I A;  2JYO A;  2UXC Q;  2PW5 A;  4NKL A;  4NXM L;  3H09 A;  4DV2 Q;  1LO5 D;  3M9B A;  5FOB B;  3ND8 A;  1BBU A;  1WI5 A;  4CKB A;  5M5Y B;  2UXD Q;  4KHV A;  5IYD G;  5NUC A;  4ZQ3 A;  2JEA I;  1IW7 D;  5I4D A;  1JWU D;  1IL2 A;  1SXT A;  4FXD A;  3CCU A;  2DN8 A;  1PH2 A;  3S9W A;  3KLS A;  1L1O B;  5D3I B;  2VB2 X;  2BA1 A;  4NMZ A;  4DV1 L;  1C0A A;  3CU7 A;  1HUN A;  2HD3 A;  2L9H A;  2B2V C;  1RL2 A;  1G6P A;  2V1C C;  1ZYR C;  5C4X G;  4P2C B;  4KLK A;  2B3G A;  4ODG A;  4DV6 L;  1WVL A;  4QL5 A;  5K5P A;  1U0L A;  3S14 H;  3L0O A;  5C4J H;  1K28 A;  1EWH A;  4K5V A;  1Q86 C;  1IBL Q;  4LF8 Q;  4L8J A;  3CD6 A;  3E6Z X;  5I2X A;  1WTQ A;  3L9A X;  1VQG A;  1L0Y B;  4JI0 L;  1JT8 A;  4LFC L;  1SSO A;  1E2V A;  3GTO B;  1B70 B;  2RCF A;  4QIW E;  1NMF A;  2EYP A;  1EIH A;  4X3T A;  2VW9 A;  2C5C A;  2K7V A;  1JR0 D;  1S5C D;  2OQ0 A;  3GTK H;  1A2T A;  3OIP A;  1OXT A;  4QUC A;  1K73 C;  2KHS A;  3OWE B;  1WTW A;  2D5D A;  5I6Y A;  2A1A A;  2EDG A;  3T51 B;  1XMQ L;  2B63 H;  2HQL A;  4N9P A;  4FF3 A;  5I6W A;  2Q2I A;  5JEA G;  3GTK B;  3J80 c;  1EZ6 A;  4HMJ A;  4G7Z C;  1G8Z D;  4KKU A;  1DD2 A;  3CRL C;  1H95 A;  1JOR A;  4A3E G;  1QUQ B;  4O42 A;  2XNA C;  3O13 A;  2CW0 C;  1K0S A;  3STB D;  1H9J A;  2F4V L;  1Q82 C;  1EYA A;  1GO3 E;  1FGB D;  4XQQ A;  4IO9 A;  3R3O A;  4JI4 Q;  5C44 G;  4OIK A;  2TMP A;  2BDN A;  4A3J B;  2JN4 A;  2CFM A;  1VQO A;  2NTT A;  3K7A B;  3GTM H;  2PNR C;  1DOL A;  4RGO S;  4OO1 G;  3A55 A;  3I70 A;  3OIQ A;  3A8K E;  4ID6 A;  4A3B H;  2BE5 D;  1QNK A;  4A3J G;  4OEL B;  3GTM B;  1ONL A;  5C0X H;  1I6H H;  1TWG H;  4ZUJ A;  4DV4 Q;  2H4O A;  4DR5 L;  4C3H H;  1UNS A;  2E75 C;  2UUC L;  1HNW L;  2PZU A;  1RCV D;  1OXU A;  1HA5 A;  3KUP A;  3A74 A;  1IBK L;  3PO3 H;  2R92 B;  4K8J A;  3FPU B;  1WTR A;  3RZO B;  2D62 A;  3K80 C;  2J7Z A;  1I6H B;  3HEJ A;  3J81 j;  5ELO A;  3CCV A;  4YCW A;  5C4Z A;  5KGU A;  4CJ0 B;  4IFD G;  1SND A;  1KHI A;  1Y8N B;  3CCJ A;  2CH4 W;  3A7L A;  4HJ9 A;  4X64 L;  1ZEQ X;  1Q7Y C;  4A3F G;  1CHP D;  2NUC A;  3TP6 A;  3L7Z C;  1KAW A;  2K33 A;  3U58 A;  2Z6K C;  2QEX A;  2KCN A;  1JJC B;  2YTY A;  3U4Z A;  2XVS A;  3H91 A;  4R4Q A;  2R93 G;  3FDT A;  4IUN A;  1AEX A;  4DGZ A;  5KRU A;  3CPF A;  3JAM L;  5C3E H;  3A5Z B;  4A93 H;  4HTH A;  5D65 A;  3CCR A;  1SRU A;  4MIU A;  3TZU A;  3CC2 A;  4UPA A;  1KDC A;  5JVH 3;  2F0J A;  5J1Z A;  4IUU A;  4L6T B;  1S3O A;  4TQU S;  4GNX B;  3MXN A;  2FMM A;  1CHQ D;  1RTO A;  5AJ3 L;  3NBH B;  1BVS A;  3GV6 A;  3J81 c;  1IL8 A;  1VQH A;  3FMC A;  3OOC A;  1Y8P B;  1SYD A;  1TY0 A;  1WYD A;  1U5K A;  4B9W A;  1GUN A;  3CRK C;  1VQK A;  4LMQ D;  3T13 A;  2HCC A;  2F0P A;  5KND A;  1E1T A;  1ASZ A;  2K5D A;  3UDF A;  1HJP A;  3I55 A;  4IPG A;  2JA5 G;  2RF4 A;  3F1Z A;  5EPK A;  4C3J H;  1G51 A;  4IJL A;  5D14 A;  1EU4 A;  1KDB A;  5HGT A;  4WJW A;  3D0F A;  4JI8 L;  2R7Z G;  1VQJ A;  1S5E D;  3KF8 A;  2PZW A;  1OXV A;  3I72 A;  3QR8 A;  2JSO A;  1FNW A;  2F0S A;  2FMC A;  2Z9H A;  3A5U A;  1HRJ A;  4CDE C;  1B8A A;  1EWC A;  2EQS A;  3MEH A;  3IAY A;  4LF6 L;  3DUZ A;  2JXM B;  4RMF A;  1SJE D;  3JAM E;  2BOS A;  4OGQ C;  5M9O A;  2F0T A;  4K5X A;  5ELE A;  3T1H L;  2D0O A;  1VQE A;  4LFB Q;  3TME A;  1KRT A;  1UEB A;  2QDL A;  4OX9 Q;  5JPN C;  1EY8 A;  1YI2 A;  1I94 L;  1ZKO A;  1OO9 B;  1N36 L;  3NTK A;  1X65 A;  2EPB A;  2OEO A;  3AQQ A;  3BZK A;  3L2P A;  4X66 L;  1MKH A;  1XTD A;  1LAC A;  5C0X G;  2K32 A;  1Q90 A;  4U67 3;  1LUZ A;  2IX0 A;  2AUJ D;  1STY A;  1Q81 C;  3T4A C;  4LF4 L;  4N8X 1;  3AFP A;  2VY3 A;  1X3E A;  4ALP A;  1CQF A;  3WOE A;  3ONA B;  3GTJ H;  2R6G A;  1U4L A;  1VF7 A;  1X3G A;  1Q8K A;  4H7B A;  4R9W A;  4KK7 A;  5IT9 c;  2LY7 A;  4JI3 Q;  1F9Q A;  2I5M X;  4RGN A;  4AQY L;  1SE3 A;  1JWS D;  4HJA A;  3RZD B;  1F2M A;  4GN4 B;  3UE1 A;  1SRO A;  1V43 A;  3CMA A;  2UUA Q;  3UDG A;  1KRS A;  3S17 B;  3OW7 A;  3X3M A;  4K0K L;  2F1M A;  4A3L G;  2K01 A;  1D1I A;  1VCI A;  5IGC A;  5FO8 B;  1IBM L;  1WOC A;  5KNC A;  4ZKB B;  1BOS A;  3GTL B;  5FJ8 H;  3HFZ B;  4WJ4 A;  4NXM Q;  4DV2 L;  1KQS A;  1VQA A;  1YNN C;  2WP8 J;  1WTH A;  5M5W H;  1PH8 A;  2RKS A;  5IGG A;  1GM5 A;  3EBE A;  1JJ2 A;  5ISR A;  4DN4 M;  4JV5 Q;  4HIM A;  1CKN A;  1DZ1 A;  5CBE E;  1YZ6 A;  3GTL H;  1JQY D;  4DV0 Q;  2F0N A;  2IL8 A;  1B50 A;  4JBM A;  1IKL A;  1N33 Q;  1EIF A;  4DR6 L;  5FLX E;  1S40 A;  2PQA A;  3GO5 A;  3DEO A;  1VDZ A;  4R8N A;  4H0L C;  1S4Z A;  3K8A A;  4DPG A;  2F0E A;  3ER0 A;  1D7Q A;  2XRQ D;  3V2T A;  1PFN A;  1W2B A;  4BY7 H;  3MTS A;  5BR8 L;  2K4K A;  4IN3 A;  1DXM A;  3VR4 A;  4A3E H;  2G5D A;  3GP7 A;  1STA A;  1SAP A;  2XWB B;  1IBL L;  1KDA A;  1KD1 C;  2ZJQ A;  1SYC A;  1RDP D;  3W1G A;  3S16 H;  2JP1 A;  4DV3 Q;  3PV0 A;  3HOW H;  2OTJ A;  1QOH A;  4DUZ Q;  4X62 Q;  2NN6 I;  1EL0 A;  2PNH A;  3X3N A;  2OCE A;  3S1Q H;  1DOK A;  5I9O A;  4BXX G;  5KYL A;  1K83 B;  1OTC A;  1SBB B;  4OEM B;  5CGK A;  4JG2 A;  2M9V A;  5IYB H;  1QE6 A;  3BU2 A;  3CHB D;  1F9R A;  1XPU A;  4HIO A;  4WOR A;  4RGM A;  1ESR A;  3K0X A;  1XPO A;  1EIG A;  4KHZ A;  4CDD C;  4HAE A;  3VYS A;  4P74 A;  5F2D A;  3QWN A;  3FKI G;  1A63 A;  4DU9 A;  4UP7 A;  4BA2 I;  4U68 A;  3GTG H;  4JI5 Q;  4RGT A;  3KK7 A;  5IYC H;  1K8G A;  5E1F A;  4LWC A;  1ESF A;  4NXN Q;  4KMU C;  3KOJ A;  2F0G A;  2IY5 B;  4L5Q A;  1Y1W B;  2L55 A;  3I8Z A;  1EZ8 A;  3GTG B;  4JW0 A;  1HFG A;  1GUO A;  2ZTD A;  2PMZ B;  2EYJ A;  5GAG C;  5IP7 G;  3LNN A;  3D6C A;  2BA0 A;  4AYB G;  1QCB D;  1E7Z A;  1B3A A;  3M3Y H;  4KN7 C;  4DR5 Q;  1N34 Q;  3CF5 A;  3KFU A;  1KLU D;  4A3D B;  1GKH A;  1HNW Q;  1IZ6 A;  3GV3 A;  4DK6 C;  5T1G A;  1KTK A;  5DAU A;  1GD7 A;  1I4G A;  3J81 L;  2NZ1 D;  4LJZ C;  2KED A;  4KJO A;  1WTX A;  1KXL A;  4PMB A;  1PTO B;  1HNX L;  2CVR A;  1V1P B;  1VQN A;  2B39 A;  4A3M B;  1PMR A;  1SFO H;  2R7D A;  3SK5 A;  5IYB G;  3KLS X;  2F3I A;  4X64 Q;  1SNM A;  4HJ5 A;  4OWX B;  1TWG B;  3EJI A;  3N52 A;  2LS0 1;  1X3P A;  3PO2 G;  4GOP B;  4P71 A;  1A3V A;  4LUV A;  1Y1V G;  3NWT A;  2QIL A;  1SN8 A;  2AHO B;  1SYG A;  5EBD A;  1TS4 A;  1ICW A;  2HUG A;  1T5X D;  3RZO H;  2ZJR A;  3V96 A;  2HHH Q;  5ELC A;  2B2Y C;  1A0I A;  3F2U A;  5M5X B;  1CKN B;  1K3R A;  1Y1V B;  1P8L A;  3RMH A;  4PNY A;  1I3Q B;  1E1O A;  3MXU A;  1EEF D;  4JYA Q;  3M85 A;  5A35 A;  4C3I B;  4M8A A;  1LM0 A;  1TQO A;  5K36 G;  4A3G G;  1I50 H;  4FVM A;  2OQK A;  3EQL C;  2HIX A;  5M5X H;  1XYI A;  1NTG A;  4DR7 L;  1Y1V H;  4EVO A;  1J6Q A;  2HT1 A;  3BVG A;  1X56 A;  2NZO A;  3HGB A;  1FNV A;  1N32 L;  5HY6 A;  4H44 C;  4XYQ A;  2AKW B;  1QVF A;  4EQP A;  4LF7 L;  3I7F A;  4BBS H;  5FO9 B;  5FLM G;  2B2T A;  1CTM A;  1STE A;  1YIJ A;  1PLF A;  3D4R A;  3BJU A;  3FEW X;  1NR2 A;  4RFB A;  4A4I A;  4C1N I;  5K36 H;  4M1U B;  3S1R H;  3CQZ H;  1NMG A;  5IGE A;  1H9R A;  4Y7N H;  1VQI A;  4B3T L;  4BBR H;  5M3F H;  3HOU H;  1O7Z A;  4EQO A;  1O7Y A;  1YHA A;  2KEE A;  2Z1C A;  2EJF C;  2NN6 H;  1AE3 A;  4JI8 Q;  3LGJ A;  1I6V C;  1X54 A;  2R61 A;  3CQZ B;  3DEP A;  4LFA Q;  1RHP A;  3K5M A;  1QG7 A;  2AWN A;  3D8G A;  5M3F B;  4ZYS A;  4FYD A;  3GDE A;  1Z47 A;  3EIV A;  3VYU A;  4QIW B;  1QB5 D;  1CZW A;  4DK1 A;  5I9P A;  1QZG A;  2ENB A;  1C9O A;  3TRZ A;  2YU9 B;  1U4P A;  3K57 A;  4O2D A;  2B2U A;  5M3M G;  1GOZ A;  3BZD B;  2RHQ B;  1R9T B;  2WFW A;  3VR6 A;  3C46 A;  2BH8 A;  4EQN A;  3SE0 A;  3NHH A;  5BN3 A;  1UAP A;  3HOX H;  3CCE A;  4X66 Q;  1JC7 A;  1K0R A;  4K14 A;  5EQ0 A;  4PV1 C; 
#chains in the Genus database with same CATH homology
 1T5E A;  4F8M A;  1TWC B;  3NUC A;  1TU2 B;  1R4P B;  3OMC A;  2XRS D;  1G6Z A;  5JEA J;  5DM6 3;  2I07 B;  3DWA A;  5IGB A;  2EZV A;  3HOZ B;  1CZG A;  4GZY C;  2EOT A;  2PO4 A;  1GUW A;  5EKL A;  3C1F A;  3ITP A;  1GHK A;  2C9O A;  3A8I E;  3FRP B;  3PUV A;  1R4Q B;  4J8Q A;  1A6X A;  2EY1 A;  1GUS A;  5JOB A;  3IKJ A;  3PUZ A;  4HR7 B;  3URY A;  3U9O A;  1H9S B;  2EJM A;  3KBG A;  2KEC A;  5G3L F;  2EY2 A;  3FPP A;  4FXK C;  4RHR A;  2ZXR A;  3OPO A;  1MI2 A;  4BY1 B;  3LWU A;  4HN7 A;  3R2I A;  1ILP A;  2EXZ A;  1PTO F;  4IZ8 A;  4JBW A;  1S5B D;  4UDU C;  2E2H B;  1JE4 A;  1RKN A;  3KBX A;  1G29 1;  2K5Q A;  1QNU A;  1SMY C;  4BY7 B;  2A5H A;  5FK9 C;  4CHT B;  1LTR D;  3DXJ C;  1PRT D;  2SNS A;  2A6H D;  2RDF A;  1PYW D;  3MFY A;  2CHB D;  5C6A A;  2N55 A;  2Z8L A;  4J6H A;  4RH6 A;  3SXH A;  3H6M A;  2ZXP A;  3S2H B;  5J22 A;  2E2J B;  1U4M A;  1LTS D;  2EYH A;  3S1Q B;  2TSS A;  1U9R A;  4KTA A;  4C1N K;  4BS9 A;  2VNU D;  2J4X A;  4KI0 A;  1XTC D;  1BCP D;  1CA6 A;  1FYC A;  2E2D C;  3HOY B;  3Q22 A;  4K2L A;  3PIO 3;  2KVM A;  1AP0 A;  2B8F A;  1EQV A;  4XYO A;  1HQM C;  5EGT A;  2EYM A;  1G2T A;  2ZXO A;  2G9D A;  4I65 A;  4A3G B;  2CQA A;  1PZJ D;  5CR3 A;  3I4N B;  1PTO D;  5C0X I;  1GUT A;  1AW7 A;  5ELB A;  5C4H A;  5ELF A;  5C0X J;  1SE4 A;  3MXG A;  2KQ3 A;  3MXP A;  4IFD J;  2RDG A;  4ILW A;  4IUT A;  5C44 B;  2AWO A;  5C3W A;  2Q8T A;  2O5J C;  1IYU A;  2IX3 A;  4TSS A;  2ZT9 C;  4DNR B;  3K0Y A;  1D5X C;  2RVL A;  3VYR A;  2DY8 A;  1PZI D;  3I90 A;  3BYT B;  2RA4 A;  5T1I A;  1Q12 A;  1PFB A;  4UAI A;  1LT3 D;  1A2U A;  3SEB A;  1LT4 D;  3H0G B;  2Z4I A;  1KNA A;  1WD0 A;  2PW7 A;  2OF1 A;  3BVM A;  1F2Z A;  5BN5 A;  2MGS A;  1HQR D;  4A3F B;  3TP7 A;  5IGF A;  2FFK B;  1Q3L A;  2F0U A;  3TN2 A;  1QIL A;  3BVZ A;  5IIF A;  5FO7 B;  4NW2 A;  1L0X B;  1EOT A;  3FVQ A;  1F9S A;  5IOD A;  4QUF A;  2A74 C;  4KY5 A;  1DOM A;  5G3L D;  5C3E B;  2QCP X;  1EY4 A;  5E3F A;  3WDN A;  3NXW A;  1CT1 D;  1TII D;  2O5I C;  1H9K A;  5JJZ A;  1GXD C;  3TP8 A;  5C3X A;  2F3W A;  1Y69 U;  2PCF B;  3N6R A;  3OMG A;  2SEB D;  2E76 C;  3H94 A;  1BNZ A;  2VXW A;  3VR2 A;  4CKE A;  2RSO A;  1HHV A;  4C3J B;  3M7N A;  2Q8R E;  4DAP A;  3Q0A A;  2WII B;  1EY6 A;  4HSP A;  2B63 B;  4BA1 I;  4IFD H;  1BCP C;  2EY5 A;  4XQJ A;  1V8Q A;  3J80 E;  1XXG A;  2Z4H A;  4OL7 A;  1IW7 C;  4F7X A;  3PUW A;  3A7A B;  3CKI B;  2B2W C;  1W6J A;  2EYL A;  1EYD A;  4CJ2 C;  2H1E A;  1M4V A;  2K04 A;  1Z6H A;  1WTO A;  1D2B A;  1Q1B A;  1STN A;  1G91 A;  1DCZ A;  2Y0S B;  1PXU A;  5EKI A;  4KKT A;  4HSV A;  3QG1 A;  1ZYR D;  3P7J A;  1WTP A;  1GUG A;  1NUC A;  1KAB A;  2K5W A;  1EQT A;  4CKC A;  3S1M B;  3M7G A;  2EY6 A;  5EBC A;  1C4Q A;  1I4Q A;  1GJX A;  3I91 A;  1F2Y A;  1CM9 A;  1ENF A;  2R7Z B;  2B2U C;  2WAQ B;  4TRD A;  1BR9 A;  1A15 A;  3EVQ A;  3KLR A;  1EU3 A;  4IUQ A;  2VB3 X;  4NP5 A;  2SNM A;  2PYK A;  5CV4 A;  1BBX C;  1EY5 A;  4XIG S;  4C2M B;  4PMW A;  2SOB A;  3R8B A;  3SK4 A;  5EJW A;  2B8G A;  5J39 A;  5CV6 A;  3RLF A;  3NPP A;  1D6E C;  2HDM A;  3G6J B;  4ZUI A;  3HP3 A;  2E2I B;  3DHQ A;  4IFD I;  2K6A A;  2NTS A;  4TKO B;  4A93 B;  1LT5 D;  5COY A;  2K1B A;  1ENA A;  2HCI A;  3H3V C;  2QEJ C;  3ERQ A;  3J7A V;  1J9O A;  4XXE A;  3NWS A;  4PQX A;  1HXY D;  2NVY B;  5C5M A;  3OHX C;  1O78 A;  1MGS A;  3HG9 A;  5CV9 A;  2JA7 B;  2YYZ A;  5E4W C;  1II3 A;  1NAP A;  2VUM B;  1EFI D;  2KJX A;  3LX0 A;  2FJ2 A;  1JIC A;  5CV5 A;  1B4O A;  2Q8I B;  1IKM A;  3NSW A;  3QO2 A;  2CW0 D;  1RTN A;  4A3I B;  3W2D A;  2BCO A;  3BG3 A;  1EY7 A;  4HCE A;  1EEI D;  1O7L A;  4KY6 A;  2JEB I;  2SDF A;  2NYZ D;  5DNF A;  3E5S A;  3E0J A;  5CC4 A;  3QJY A;  1H9M A;  1KNE A;  1QJO A;  1I4X A;  1NSN S;  2L5T A;  4X3S A;  2G9H D;  3C3L A;  5CYU A;  2B2W A;  2RBM A;  5E4X A;  3K5L A;  3M4Y A;  2IT1 A;  3M3Y B;  4OO1 I;  4RWS C;  1HPC A;  1ET9 A;  1SNQ A;  1B2T A;  2LMC B;  1PDQ A;  5D3D A;  2IPK D;  1JCK B;  5CV8 A;  1OXX K;  1BCP B;  1AFP A;  4A3K B;  2O2L D;  1PTO H;  3NQT A;  5LHY 1;  3S1N B;  1PFM A;  5M5W B;  1RF2 D;  2AQ3 B;  3K58 A;  2B2T C;  5EPL A;  4DF7 A;  1VF5 C;  3OSO A;  2XIW A;  4DXG A;  4E6I A;  1MSH A;  4A3B B;  4LAA A;  1Q8I A;  2F0H A;  3C2P A;  1HCZ A;  3K6O A;  2JA8 B;  1TWH B;  1TR5 A;  1S5F D;  4FNF A;  3A54 A;  4C3J G;  3Q6S A;  1CA5 A;  1STG A;  3VA7 A;  4RA8 A;  1TKW B;  3OWF A;  3MWY W;  4OIJ A;  1TVX A;  1LTB D;  1SEB D;  2EYF A;  3C1E A;  1Y8O B;  4PMC A;  2L4N A;  2PZT A;  1YNJ D;  1AZP A;  1D5M C;  1JB3 A;  3NP8 A;  1JOO A;  2I46 A;  5CMD A;  4ZK9 B;  4K5W A;  4RCN A;  2ID0 A;  4Y7N B;  1YNN D;  1K8M A;  4BBR B;  1DJR D;  3DWP A;  1I4H A;  4G57 A;  3TP5 A;  1SNC A;  1E2Z A;  3DM1 A;  2F0D A;  2OT2 A;  4CJ1 B;  1PZK D;  4Z9C B;  3ZYY X;  5C4X B;  1EY9 A;  3HRZ C;  1LLR D;  2F0W A;  5I2Y A;  2PQE A;  2LKV A;  5C4J B;  3SHL A;  1JOQ A;  3HZX A;  2JA5 B;  4OO1 H;  2MUY A;  4KY7 A;  2A69 D;  4WRD A;  5JEA H;  2NBF A;  3GD7 A;  3BDC A;  3RUZ A;  2DNE A;  2BDO A;  2WAC A;  2IWH A;  4DXF A;  3V05 A;  1JWM D;  2A68 C;  3J80 L;  2KA7 A;  3J7Y W;  2IJ0 A;  3BS1 A;  4EGV A;  2F0F A;  1TT2 A;  3NQI A;  5AFW A;  3BYY B;  4AYB B;  2D9U A;  4KJN A;  2JE6 I;  3T16 A;  2F0O A;  1VMC A;  1UEA B;  4MHE A;  1D5Z C;  4OHJ A;  3D31 A;  5IOC A;  1BXT A;  3I73 A;  4F88 A;  4ZAI A;  1AN8 A;  2LFN A;  1SDF A;  2AUK A;  4WFN 3;  4C3H B;  3SK6 A;  1HTP A;  4B9X A;  1B44 D;  3P75 A;  2F0L A;  1TS2 A;  1I50 B;  1CK1 A;  5DEH A;  3S15 B;  2D2C C;  1SYF A;  4ME5 A;  1TS5 A;  3TDQ A;  2WIN B;  2FIN B;  4K2K A;  3MFG A;  2KUM A;  4HCS A;  5A2Q E;  2DY7 A;  5EPJ A;  2MP1 A;  2EE1 A;  3S1R B;  4CGY B;  2QKI C;  2XSC A;  3K5N A;  1SNO A;  2NB0 A;  1HTL D;  3Q23 A;  4IUV A;  3PO2 B;  4KV6 A;  1DON A;  4DA2 A;  1YNJ C;  1ET6 A;  5ELD A;  2RQX A;  4I7Z C;  1LTI D;  1QWY A;  3K5O A;  4DAV A;  3QOJ A;  2WV6 D;  1W6K A;  2NWG A;  2K28 A;  3PUY A;  4YIJ A;  3D4W A;  1K8O A;  4QCL A;  3SR1 A;  2L1B A;  2EJG C;  1RJT A;  5FKA C;  4C3I G;  1TWA B;  1PRT F;  4FF1 A;  1F77 A;  2JA6 B;  4G7O C;  4XDX A;  3S16 B;  5LL6 X;  3SVM A;  3NBH A;  5LL6 S;  4Q5V A;  3IL8 A;  1KAA A;  3HOW B;  3R2T A;  2L12 A;  3W3A A;  2O4X A;  1STB A;  5DM7 3;  1HFN A;  4ZKC B;  1RD9 D;  3UI2 A;  1LV9 A;  2A69 C;  1LT6 D;  5EKK A;  2RDH A;  1SYE A;  1H9S A;  3WOF A;  2A68 D;  3GQB A;  1D1K A;  4G7H C;  3MA2 B;  3EFX D;  4KKS A;  4LK1 C;  5CBA E;  5M3M B;  3TSS A;  2FHT A;  4ABN A;  1DYQ A;  5BN4 A;  3GTJ B;  1F9P A;  3GTP B;  2A6E C;  3NE5 B;  1X3Q A;  1E0B A;  2X6L A;  2L0C A;  4BWG B;  1IYV A;  1B9N A;  4R8I A;  3GTQ B;  1BUV T;  4N9T A;  4H13 C;  4XTC S;  4XQN A;  1SFO B;  3A8J E;  3PUX A;  2R93 B;  3VR5 A;  2IW3 A;  2WB1 B;  4ZLT F;  1E2W A;  2AQ2 B;  3MHB A;  4L63 B;  2K05 A;  3DWQ A;  4HED A;  2MHV A;  2F0V A;  3TBI B;  4QF4 A;  5IT9 L;  4B08 A;  5A2Q L;  4F87 A;  2NN6 G;  2KOL A;  2RSN A;  2N88 A;  1ML0 D;  2L11 A;  2X6G A;  3D6W A;  4A3E B;  1HA6 A;  3RD4 A;  3AU7 A;  1JOK A;  1U4R A;  4CBV A;  3T56 B;  4V19 0;  3PMF A;  2MPM A;  4K6D A;  3QIA A;  4BBS B;  3DMU A;  1PRT B;  3HS0 C;  4IQZ A;  1I4P A;  4DNT B;  3D3R A;  2WKD A;  1XX8 A;  2NVX B;  2ICE C;  3HKZ B;  3I3C A;  2PPB C;  4IUP A;  2NVQ B;  3TZD A;  3QOL A;  1SMY D;  1FNU A;  3S14 B;  3PIP 3;  1PRT C;  4RHS A;  3U9S A;  5IGD A;  4RCO A;  1C48 A;  5HUR A;  1Q1E A;  3IFD A;  2K03 A;  4QMG A;  3HOX B;  1MBY A;  3T53 B;  5KIX A;  1NCV A;  1O80 A;  1BCP F;  3MZ5 A;  1J8I A;  3L3O C;  5TSS A;  4J1M A;  5JVG 3;  1ROD A;  5FLX L;  2F3V A;  2EYO A;  1OXS C;  4DFA A;  4RAU C;  2QF7 A;  2KCC A;  1BQQ T;  1SYB A;  3J7A F;  2A6E D;  5KNB A;  4C56 C;  2A6H C;  3G7L A;  1DM0 B;  1ENC A;  1XWE A;  2NVT B;  1WCM B;  1WD1 A;  1ZXT A;  1A3U A;  3LWE A;  1LTG D;  4XT1 B;  1TWF B;  1IHZ A;  4X3K A;  3PO3 B;  1F2L A;  1I4R A;  4Q0F A;  1M8A A;  4S3S A;  5CV7 A;  4RKL A;  4FP5 D;  4IUR A;  1AZQ A;  3AMU A;  3M4O B;  1Z7T A;  1CI3 M;  2B2Y A;  2A73 B;  3NBI A;  1CQV A;  2QDB A;  2E74 C;  1STH A;  1EYC A;  4V0B A;  3QB3 A;  1LAB A;  2ICI A;  4MN3 A;  1BDO A;  3HOU B;  3VA5 A;  5C5L A;  1EY0 A;  3NTH A;  3K59 A;  3EA6 A;  3MC0 B;  2F0K A;  1BF4 A;  3FKI B;  4KN4 C;  3NTI A;  1A3T A;  1X32 A;  4G4K A;  3VR3 A;  3NK9 A;  3I4L A;  2F0I A;  1MSG A;  4NDX A;  3Q24 A;  2GA4 B;  4C3H G;  3MVV A;  1PTO C;  1UUP A;  1LTA D;  2F0Q A;  4X3U A;  4XT3 B;  1S5D D;  5KYI A;  4O1N A;  2AQ1 B;  2X69 A;  2XWJ B;  3BDO A;  4KD3 A;  2MJ8 A;  3VYT A;  1LTT D;  1GHJ A;  2J0T D;  2F03 A;  1C8C A;  4DAY A;  1CFM A;  1SJH D;  4K6L A;  3P20 A;  1FR3 A;  4FXG C;  1FD7 D;  1B9M A;  5JAV A;  4DK0 A;  3MAQ A;  2IX1 A;  3SK8 A;  2V4D A;  1TS3 A;  3D4D A;  4JK1 C;  2M2L A;  2EVB A;  1B1Z A;  3SDZ A;  1MD2 D;  3S2D B;  5IT9 E;  1KLG D;  2BE5 C;  1HUM A;  1VMP A;  2F4I A;  1G2S A;  4ZRZ A;  1V1O A;  2HDL A;  5JPM C;  4ULL A;  4K8I A;  1V1P A;  4QB4 A;  3ND9 A;  2WKC A;  3R93 A;  2F0M A;  2DNC A;  3I4M B;  5KEE A;  3HOV B;  2XN9 C;  4IAL A;  1ILQ A;  3A56 A;  1SNP A;  3BDL A;  1TY2 A;  3ERO A;  1NR4 A;  2OXP A;  4KD4 A;  2B2V A;  3IFT A;  1WTV A;  4HMI A;  1BO0 A;  2HQE A;  3J81 E;  4FO2 A;  4FF4 A;  1SE2 A;  3P1H A;  4FF2 A;  1B53 A;  3AB9 A;  4RKB A;  5COR A;  2M00 A;  2R3Z A;  2JYO A;  2PW5 A;  4NKL A;  3H09 A;  1LO5 D;  5FOB B;  3ND8 A;  4CKB A;  5M5Y B;  4KHV A;  5NUC A;  4ZQ3 A;  2JEA I;  1IW7 D;  5I4D A;  1JWU D;  1SXT A;  4FXD A;  2DN8 A;  3S9W A;  3KLS A;  5D3I B;  2VB2 X;  2BA1 A;  4NMZ A;  3CU7 A;  1HUN A;  2L9H A;  2B2V C;  1ZYR C;  4P2C B;  4ODG A;  1WVL A;  5K5P A;  1EWH A;  4K5V A;  4L8J A;  3E6Z X;  5I2X A;  1WTQ A;  3L9A X;  1L0Y B;  1SSO A;  1E2V A;  3GTO B;  2EYP A;  1EIH A;  4X3T A;  2C5C A;  2K7V A;  1JR0 D;  1S5C D;  1A2T A;  3OIP A;  1OXT A;  4QUC A;  2KHS A;  3OWE B;  1WTW A;  2D5D A;  5I6Y A;  2EDG A;  3T51 B;  4N9P A;  4FF3 A;  5I6W A;  5JEA G;  3GTK B;  1EZ6 A;  4HMJ A;  4G7Z C;  1G8Z D;  4KKU A;  1DD2 A;  3CRL C;  1JOR A;  4O42 A;  2XNA C;  3O13 A;  2CW0 C;  1H9J A;  1EYA A;  1FGB D;  4XQQ A;  3R3O A;  4OIK A;  2TMP A;  2BDN A;  4A3J B;  2NTT A;  3K7A B;  2PNR C;  1DOL A;  4RGO S;  4OO1 G;  3A55 A;  3I70 A;  3OIQ A;  3A8K E;  4ID6 A;  2BE5 D;  1QNK A;  3GTM B;  1ONL A;  5C0X H;  4ZUJ A;  2H4O A;  1UNS A;  2E75 C;  2PZU A;  1RCV D;  1OXU A;  1HA5 A;  3KUP A;  2R92 B;  4K8J A;  3FPU B;  1WTR A;  3RZO B;  2D62 A;  1I6H B;  2J7Z A;  3HEJ A;  5C4Z A;  5KGU A;  4CJ0 B;  4IFD G;  1SND A;  1Y8N B;  3A7L A;  1ZEQ X;  1CHP D;  2NUC A;  3TP6 A;  3L7Z C;  2K33 A;  2KCN A;  2XVS A;  3H91 A;  3FDT A;  4IUN A;  1AEX A;  4DGZ A;  5KRU A;  3JAM L;  4HTH A;  5D65 A;  4MIU A;  3TZU A;  1KDC A;  5JVH 3;  2F0J A;  5J1Z A;  4IUU A;  4L6T B;  4TQU S;  3MXN A;  2FMM A;  1CHQ D;  1RTO A;  3GV6 A;  1IL8 A;  3FMC A;  3OOC A;  1Y8P B;  1SYD A;  1TY0 A;  4B9W A;  1GUN A;  3CRK C;  4LMQ D;  3T13 A;  2HCC A;  2F0P A;  5KND A;  2K5D A;  5EPK A;  5D14 A;  1EU4 A;  1KDB A;  5HGT A;  4WJW A;  1S5E D;  3KF8 A;  2PZW A;  1OXV A;  3I72 A;  2JSO A;  1FNW A;  2F0S A;  2FMC A;  1HRJ A;  1EWC A;  3MEH A;  3IAY A;  3DUZ A;  2JXM B;  1SJE D;  3JAM E;  2BOS A;  4OGQ C;  5M9O A;  2F0T A;  4K5X A;  5ELE A;  3TME A;  5JPN C;  1EY8 A;  1ZKO A;  1OO9 B;  3NTK A;  2EPB A;  2OEO A;  1LAC A;  5C0X G;  2K32 A;  1Q90 A;  4U67 3;  2IX0 A;  2AUJ D;  1STY A;  3T4A C;  1CQF A;  3WOE A;  3ONA B;  2R6G A;  1U4L A;  1VF7 A;  4H7B A;  4R9W A;  4KK7 A;  2LY7 A;  1F9Q A;  4RGN A;  1SE3 A;  1JWS D;  3RZD B;  1F2M A;  1V43 A;  3S17 B;  3OW7 A;  3X3M A;  2F1M A;  2K01 A;  1D1I A;  1VCI A;  5IGC A;  5FO8 B;  5KNC A;  4ZKB B;  1BOS A;  3GTL B;  1YNN C;  2WP8 J;  2RKS A;  5IGG A;  5ISR A;  4DN4 M;  1DZ1 A;  5CBE E;  1JQY D;  2F0N A;  2IL8 A;  1B50 A;  1IKL A;  5FLX E;  3GO5 A;  3DEO A;  1VDZ A;  4R8N A;  4H0L C;  1S4Z A;  2F0E A;  2XRQ D;  3V2T A;  1PFN A;  3MTS A;  4IN3 A;  1DXM A;  3VR4 A;  3GP7 A;  1STA A;  1SAP A;  2XWB B;  1KDA A;  1SYC A;  1RDP D;  2JP1 A;  3PV0 A;  1QOH A;  2NN6 I;  1EL0 A;  3X3N A;  1DOK A;  5I9O A;  5KYL A;  1K83 B;  1SBB B;  5CGK A;  2M9V A;  1QE6 A;  3CHB D;  1F9R A;  4WOR A;  4RGM A;  1ESR A;  1EIG A;  4KHZ A;  4HAE A;  3VYS A;  5F2D A;  3QWN A;  4DU9 A;  4BA2 I;  4U68 A;  4RGT A;  3KK7 A;  5E1F A;  1ESF A;  4KMU C;  2F0G A;  1Y1W B;  2L55 A;  3I8Z A;  1EZ8 A;  3GTG B;  1HFG A;  1GUO A;  2PMZ B;  2EYJ A;  3LNN A;  3D6C A;  2BA0 A;  1QCB D;  1B3A A;  4KN7 C;  1KLU D;  4A3D B;  3GV3 A;  5T1G A;  1KTK A;  5DAU A;  1I4G A;  3J81 L;  2NZ1 D;  4LJZ C;  2KED A;  1WTX A;  4KJO A;  4PMB A;  1PTO B;  2CVR A;  1V1P B;  2B39 A;  4A3M B;  1PMR A;  3SK5 A;  3KLS X;  1SNM A;  1TWG B;  3EJI A;  3N52 A;  2LS0 1;  1X3P A;  1A3V A;  3NWT A;  2QIL A;  1SYG A;  5EBD A;  1TS4 A;  1ICW A;  2HUG A;  1T5X D;  3V96 A;  5ELC A;  2B2Y C;  3F2U A;  5M5X B;  1Y1V B;  3RMH A;  4PNY A;  1I3Q B;  3MXU A;  1EEF D;  3M85 A;  5A35 A;  4C3I B;  4M8A A;  1TQO A;  5K36 G;  4FVM A;  3EQL C;  1XYI A;  4EVO A;  3BVG A;  3HGB A;  1FNV A;  4H44 C;  4XYQ A;  4EQP A;  5FO9 B;  2B2T A;  1CTM A;  1STE A;  1PLF A;  3D4R A;  3FEW X;  1NR2 A;  4RFB A;  4C1N I;  5K36 H;  4M1U B;  5IGE A;  1H9R A;  1O7Z A;  4EQO A;  1O7Y A;  2KEE A;  2Z1C A;  2EJF C;  2NN6 H;  1I6V C;  2R61 A;  3CQZ B;  3DEP A;  1RHP A;  3K5M A;  1QG7 A;  2AWN A;  3D8G A;  5M3F B;  4ZYS A;  4FYD A;  1Z47 A;  3VYU A;  4QIW B;  1QB5 D;  1CZW A;  4DK1 A;  5I9P A;  2ENB A;  2YU9 B;  1U4P A;  3K57 A;  2B2U A;  1GOZ A;  3BZD B;  1R9T B;  3VR6 A;  3C46 A;  4EQN A;  3SE0 A;  3NHH A;  5BN3 A;  1UAP A;  1JC7 A;  4K14 A;  5EQ0 A;  4PV1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...