4K14A

Crystal structure of staphylococcal nuclease mutant v66i/v99l
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal Structure of Staphylococcal nuclease mutant V66I/V99L
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k14A00
1STBA 1STGA 4N9TA 5M9OA 1JOOA 1NUCA 1SNOA 5CV9A 2EYOA 3P1HA 3NXWA 4B9WA 2RBMA 2KQ3A 4PMBA 3BDLA 4ME5A 2EXZA 4LAAA 1KDCA 2F0KA 2F0IA 3VA5A 1KABA 4KY5A 5JAVA 2HQEA 3ITPA 3NP8A 3SK4A 5HGTA 2EY1A 4QMGA 2EYHA 5C6AA 4H7BA 3BDCA 3MEHA 4S3SA 1A2UA 2PQEA 4ID6A 5CR3A 3QB3A 1SYFA 3D4DA 3D8GA 4WRDA 2F0PA 2F0NA 3TP8A 2F0MA 2WACA 1SNMA 3SR1A 5DAUA 5HURA 3D4WA 1AEXA 4QB4A 2F0WA 2PZUA 5C5MA 1IHZA 4PMCA 5KGUA 5E3FA 2F0UA 2F0QA 1EY0A 2SNMA 4NP5A 1KDBA 2EYFA 3NK9A 1SNDA 3NQTA 4IZ8A 4K5WA 3S9WA 4R8NA 1NSNS 3MVVA 5CV5A 3SHLA 1EY8A 3EVQA 4I65A 3C1EA 4K5XA 1F2ZA 4ZQ3A 3D6CA 5EKKA 5J39A 1U9RA 2F0TA 3EROA 1EZ8A 1SNCA 2PW5A 3E5SA 2EYPA 4G57A 1EY6A 1SYDA 3RUZA 5IGCA 2EY2A 4KV6A 3NUCA 5DEHA 5I6YA 3QOJA 4DF7A 5C5LA 1A3VA 1SYGA 4NMZA 3DMUA 2EYLA 3QOLA 4E6IA 3OWFA 3MXPA 5IODA 4K5VA 3LX0A 5CV6A 4YIJA 1SYBA 1SNPA 1STAA 2NUCA 4K6DA 3ERQA 3SK8A 2EY5A 4EQOA 2OF1A 5IGFA 3SK5A 4RKLA 5C3XA 4HMIA 4DGZA 5CC4A 4KY7A 5J22A 3H6MA 2F0OA 1STHA 2O4XA 1SYCA 2PYKA 3MHBA 4EQPA 5IOCA 3TP7A 1TQOA 1STYA 3EJIA 1STNA 3T16A 4B9XA 2F0VA 3R3OA 2PW7A 5KIXA 2RDFA 3OMCA 5CGKA 4KD3A 1KAAA 3OMGA 4ODGA 4KJNA 5I9OA 1SYEA 2M00A 5IGBA 2EYJA 2PZWA 4KD4A 1TR5A 4ZUJA 2SOBA 5IGEA 4K8JA 2ENBA 1KDAA 4HTHA 4IALA 3V2TA 4TRDA 5IGGA 5KYIA 2F0LA 5E1FA 2F3VA 5NUCA 4EQNA 5C4ZA 4HMJA 1TT2A 5KEEA 1JORA 5CV4A 5K5PA 1EY7A 2F0FA 1A3TA 4WORA 1F2YA 3NHHA 5IIFA 2LKVA 1ENCA 4EVOA 1ENAA 1RKNA 2RKSA 1EY4A 5EGTA 4PNYA 5KRUA 1EY9A 5J1ZA 2OEOA 1JOQA 4K2LA 3TP5A 4K8IA 4KHVA 4NDXA 4J6HA 4OL7A 3HZXA 5F2DA 2F0HA 1JOKA 4J1MA 5I9PA 5JOBA 1F2MA 2KHSA 4ZUIA 1A2TA 2EYMA 3TMEA 4DU9A 4F8MA 5I6WA 3TP6A 2EY6A 2PZTA 1EY5A 4IUNA 2F0SA 2OXPA 3PMFA 4QF4A 2F0EA 4K14A 2SNSA 4F7XA 4NKLA 1EYCA 3MZ5A 1II3A 4KY6A 1EQVA 3SXHA 5CV8A 3C1FA 4N9PA 5KYLA 4RKBA 4KTAA 5ISRA 5C4HA 5IGDA 1EYDA 4DFAA 2QDBA 1SNQA 3OSOA 1EYAA 4MIUA 2F3WA 1EZ6A 4K2KA 2F0JA 1A3UA 3P75A 3DHQA 2F0GA 3HEJA 4KJOA 5CV7A 2F0DA 5EKLA 3U9OA 5C3WA 3T13A 3SK6A
chains in the Genus database with same CATH superfamily
5IYDG 4RWSC 4IQZA 2EXZA 5IT9E 1F9RA 1IKLA 1GM5A 2CWPA 4CKEA 3E9HA 3M3YH 2LXJA 4A3CG 3A7LA 4JOIC 1JJ2A 4FYDA 4S3SA 1I94Q 1R4PB 2WKCA 4GLXA 1I4XA 2KA7A 3TRZA 2RCFA 3UDXA 4A4IA 4JI4Q 2FFKB 1WTQA 4A3EG 1DGSA 2H1EA 2I5LX 5EPJA 4PMCA 4X66Q 3GTJB 2NVQB 3EN2A 4C3JH 4DR1Q 1B2TA 3NBHB 1KDBA 2EYFA 1X65A 3PUWA 3L7ZC 2NZ1D 3G4SA 3BDOA 3HGBA 5IYCG 5CV5A 4DV0L 1AN8A 1IL8A 1NCVA 3GTJH 2PNRC 4X3KA 2J4XA 1LTBD 4JI3L 5EKKA 2F0TA 5IP7G 2V1CC 5FOBB 4YWLA 2F03A 1EIYB 3QG1A 1EWCA 2AQ1B 3KF8B 3J81c 4B3RL 1SYGA 4A3GH 1EU3A 1ONLA 2H4OA 1L0YB 2A8VA 2ZTCA 2ID0A 4A93H 2BA1A 2HD3A 4K6DA 2CCZA 2AUJD 3HOWB 4A3FG 3RD4A 2CW0D 2NBFA 1HCZA 3U50C 1TXYA 1ZYRC 4OGQC 1D1KA 1LO5D 4RH6A 3J80c 4JYAL 3F8TA 3MXGA 3R3OA 3HOYH 4ODGA 2K4KA 1YBYA 1PH6A 3HOWG 4K8JA 3I56A 4BBRH 3IAYA 4V190 5E1FA 4OHJA 4OONA 5KEEA 5JEAH 1Y1VH 1LUZA 2XSCA 4OIKA 1RDPD 3E0EA 1CI3M 1EY4A 2HDLA 1LT3D 4JBMA 2IWHA 1CZGA 3AQQA 4ZUIA 5L37A 3HOUG 3PO2B 3VA7A 1YJWA 5D3IB 3CC7A 5KYLA 4KY6A 2K5HA 1J5EQ 4U68A 1V9PA 4GOPB 1AZQA 3H94A 3E6ZX 1SBBB 1SE3A 2BCOA 3DHQA 3G7LA 3PO2H 2XTIA 2ZTEA 3WOEA 3CD6A 1VQNA 1IYVA 3M4OH 4X66L 4LF6L 1EQRA 3D0FA 2KQ3A 4DR1L 4V0BA 1B3AA 2JXMB 3D31A 2NB0A 4UDUC 1ML0D 2MUYA 4A3JB 4YCUA 1A2UA 4BA2I 2PMZE 2F0PA 2DUDA 3K5OA 5D65A 5I2XA 1CA6A 3HOZB 5KGUA 4QIWB 5IT9c 3W3AA 4A3JG 1NE3A 4PZ6A 1SNDA 2XGTA 3HOZH 2VL6A 2NN6I 3OIQA 4FO2A 4GLAC 1JJCB 2P5ZX 2YV5A 3FMCA 3KF8A 4K5XA 3D6CA 4OO1I 2K32A 3LWEA 4C56C 2A69C 3TREA 3CMAA 5JJIA 4IPHA 2EJFC 1BNZA 4NMZA 5H1SE 4E6IA 1K8MA 2ZXOA 3HS0C 1QB5D 2YTYA 3LX0A 1Q81C 1EOTA 5CYUA 3TQYA 1HXYD 2B63B 2Y0SB 2N3SA 2EZVA 3BG3A 2QA4A 2XRQD 4RKLA 3J81i 4CDCC 1XPUA 3S16B 2RA4A 5EKIA 3UE0A 1STYA 4DR4L 4IUQA 5KIXA 2R61A 1PYWD 3OMCA 3UDGA 2K1BA 4AYBG 2B63G 2Y0SG 3S16H 2ENBA 2CH4W 1EWHA 1SE8A 3UDIA 3H3VI 1DYQA 2VQFQ 3A8JE 2B3GA 1Z9FA 4BXXH 2F0FA 4WORA 4CHTB 3C46A 4X65Q 5J1ZA 2B2WA 1WTXA 3UE1A 1CTMA 3CW2C 4F8MA 1T5XD 1KRTA 2KCMA 4L5SA 1TVXA 1K3BC 2Z1CA 1IL2A 5DM73 3Q24A 1VDZA 5ISRA 2QILA 3PUXA 2I0QA 1EYAA 3J7AV 4IUTA 4BBSB 1A3UA 5GAEC 1RIPA 2TSSA 4IUUA 4U673 2RCNA 2A69D 1MD2D 5ELEA 1VF5C 4C3HB 1V1PB 3NXWA 1J8IA 1MJCA 5G3LD 1RODA 1YNNC 4BBSH 3BJUA 3E9IA 4DV5Q 1SMXA 1S5FD 4HJAA 4DUZQ 3L9AX 4H7BA 3A55A 1ILPA 5FLMG 4Q0FA 1XPOA 1Z6HA 4OWWB 4C3HG 1C8CA 2JA8H 1QJOA 4ZAIA 1Y14B 3K7UC 5IP9G 1E2ZA 3JAML 1LV9A 4R4IA 5EAYA 3S15H 1HRJA 3I4LA 3L3OC 3MVVA 3SHLA 1VCIA 5LMNQ 2R6GA 1N36Q 1K8GA 4DV1Q 1HZ9A 5BR8L 2HHHQ 1SEBD 1Q12A 5DEHA 3S1RB 4L5QA 2D0OA 2Z8LA 4ZK9B 3H15A 3HP3A 2VQFL 3GP7A 2O5IC 2K33A 3SK5A 1Q1EA 4DR5Q 2OT2A 5CC4A 3S1RH 1JE4A 3ULLA 4X3TA 4LJZC 3TZDA 3RZDH 4P71A 1A62A 1KAAA 3OMGA 2KBNA 2EIFA 1LT5D 2SOBA 3GTLH 2QEXA 3LWUA 4IALA 1Q7YC 3MEFA 3MXUA 1JE5A 2XNAC 5FJ8G 3NHHA 5CBAE 3Q22A 4I7AA 3CRLC 3QJYA 1DCZA 3VYTA 3TS2A 1B9NA 4DAYA 2PQAA 1H9JA 3DLLA 3MAQA 1MHWC 2KHSA 1A2TA 2RSOA 4DU9A 4RAUC 4ALPA 2D0PA 4NB3A 1OXUA 2PZTA 2L12A 4GZYC 3HOXB 1WFQA 2XRSD 4DV5L 4DK6C 4DUZL 4JG2A 4JBJA 1B3QA 3M9BA 2F4VQ 3MTSA 4IFDG 2G9DA 1V1PA 5C3WA 1JICA 3HOXG 2Z6KC 1SNOA 1DOLA 3A0JA 2MQHA 4Y7NB 2F0KA 4BWGB 2EY1A 1D5ZC 2ZTDA 3NE5B 2DNEA 3IL8A 2VUMB 5LMNL 3D4DA 1VQIA 2F0NA 1PYBA 4Y7NH 4DV1L 3RMHA 3GTMB 3SR1A 4QB4A 2F0WA 2HHHL 1JCKB 1I4RA 3CP0A 3QO2A 4GKJL 2RDGA 2IX0A 3TZUA 4NP5A 2VUMG 3GTMH 4HIKA 2R93B 3MFYA 5M5YB 4H02A 1R9TB 4DR5L 3ND9A 1F2ZA 3ONAB 3PO3B 1BQQT 3I55A 4GNXC 4A3IH 1EQQA 1K83B 2C5CA 1PH3A 2R93H 1YITA 3RN5A 3TSSA 4RCOA 4ZCKA 1QNKA 1G8ZD 2YYZA 1Q3LA 1PH1A 1N34Q 4K5VA 2MGSA 4NXMQ 3GTQB 2UXDQ 1K83H 2CHBD 2ICEC 3VR2A 3PO3G 3I4NB 4DUYQ 2ES2A 4Y52H 4DN4M 4EQPA 3VYUA 2NZHA 1PFSA 3H09A 3VR4A 2KOLA 4IPDA 4L63B 3NEMA 2PO4A 3GTQH 3K7AH 2B2YA 1KHIA 2B2TC 3M4PA 4KD4A 3I4NH 4KLKA 3KF6B 3I4NG 1PMRA 4C3IH 2ZJRA 1DZ1A 1FGBD 3NTIA 3R2TA 1F2YA 3K0YA 1O7ZA 3T1HL 2JJQA 1ENAA 3OTOQ 4P75A 1HR0W 3PCOB 4EQ5A 4H0LC 2B8FA 1G2SA 3F2UA 4LF4Q 1IZ6A 2KECA 1F2MA 1RCVD 1KXLA 4FXKC 2F0SA 4QF4A 4RHSA 2VNUD 4IPGA 1TY0A 2MHVA 2UXBQ 3MZ5A 1EQVA 4WFN3 1ILQA 4QY7A 3OSOA 4DR2L 1BKBA 4KN4C 4MIUA 2K5WA 4A3BG 3P75A 3GTGH 4KHZA 2KCTA 4OWXB 2CFMA 1LTGD 2UUAQ 1L0WA 1EIGA 3CCUA 1XMOQ 1KAWA 4HR7B 4G7ZC 2MJ8A 3M7GA 2WP8J 4RHRA 4A76A 2A6EC 3ITPA 3SK4A 2Z4HA 3WDNA 3I4MG 4CKBA 2HT1A 1MSHA 3AB9A 5M3MG 1C7YA 2YTVA 2C9OA 4CJ0B 3TP8A 4X64Q 3CXCA 5HURA 4EGVA 4XYOA 1O7IA 1X56A 3RZOB 4WJ4A 1VQPA 1PTOB 4O1NA 2K5NA 1N34L 2B2VA 3CCQA 2QCPX 1KLUD 1LM0A 4NXML 4IZ8A 2UXDL 1U0LA 4QIWE 3Q0AA 3RZOH 1PTOH 4DUYL 2EOTA 1S72A 4HSVA 4B3ML 3HRZC 2UUCQ 1QUQA 2D62A 2UUBQ 5KNBA 1DM0B 1QILA 1UE5A 2WAQB 3MXPA 5C44G 3NQIA 3PF5A 3U4ZA 2SDFA 3MHBA 3OTOL 1HNXL 1MIUA 4XQJA 4FF4A 4LF4L 4IJLA 1STNA 1SLJA 3KBGA 1E1OA 2WAQG 1VQLA 2GVAA 4OXPA 4KI0A 4XT3B 4DK3C 2UXBL 2OTJA 4IFDJ 5KYIA 1A0IA 4A3MB 2A6ED 3J81j 5EQ0A 3IKJA 4A3KG 1ET9A 2RHSB 3FKIB 1G6PA 2RKSA 3I7FA 2VS1A 1CFMA 2KCNA 3CMEA 4OL7A 4XQNA 1GUTA 5F2DA 4A3MH 1KC8C 4AIMA 4JI3Q 1XMOL 3TP6A 1HNWQ 1T9HA 3FKIH 3PMFA 3M7NA 1KQSA 3S1NH 1EYCA 1B8AA 1PRTC 1S5ED 1I6HB 3KLSX 2M2LA 4RA8A 4UHVA 4B3RQ 1O80A 1KD1C 5TSSA 4RGMA 3I91A 1SE4A 5M3FG 4X64L 4HJ8A 4EX5A 2VQEL 1Y1WG 1I6HH 1JOOA 1A8VA 5C0XI 3WOFA 4CDDC 4R4TA 2IX1A 2HQEA 1QVFA 1PLFA 2L1BA 1W3SA 5AJ3L 5GQOA 1GOZA 1STEA 1VQ5A 1DD2A 2WV6D 1WD0A 4R9WA 2OCEA 3QB3A 5FO9B 2IL8A 5COYA 2NYZD 3DEOA 1SNMA 5K36H 1TWAB 3DWPA 2BA0A 2E2HB 1YHAA 4RG1A 2LY7A 5IYDH 4WJ3M 1QG7A 1TWHB 4GLVB 4M1UB 2WIIB 1SFOB 1PV4A 1CHPD 1F9SA 1QE6A 1XTDA 1TWAH 1BO0A 1HQMC 4A3EB 2E2HH 4I65A 4A3CH 2E2IB 4G7HC 3PV0A 1TWHH 3AYHB 3N52A 5J39A 1PH5A 2R3ZA 1SNCA 2B8GA 3CCMA 1EY6A 2RDHA 1G51A 2JA5B 2BOSA 2E2DC 3KOJA 3R2IA 1GXDC 5FKAC 4A3EH 5C4XG 3QOLA 1S40A 1BCPF 1MSGA 1HHVA 1IBKQ 1NBWA 4ABNA 4LF6Q 1PRTD 1YJNA 1I5FA 5IGFA 4CJ1B 2J7ZA 5IYCH 1SYCA 1Z47A 2JA5G 2Q2HA 1O7YA 2JYOA 3JAME 5IP7H 2NVQH 1QVCA 1HNWL 5I9OA 2M00A 4A3FB 2NTTA 1ASYA 1S5DD 2HUGA 4R4QA 1HZBA 1L1OC 1MKHA 2BH2A 1BBUA 4DR7L 4O2DA 2LKVA 1ENCA 1GUSA 2B2UA 4DNRB 4A3FH 4HIOA 4IOCA 4MN3A 3PIP3 3Q23A 1JOQA 3HKSA 3MWYW 3KBXA 2R7ZG 1N9WA 1A15A 1XTCD 3CKIB 3SDZA 5E7NA 1LLRD 1ICWA 4DAMA 3HOWH 4G4KA 5IGDA 2UXCQ 4FDBA 4DNIA 1K3RA 1H95A 3HOUB 1C0AA 1A63A 1G291 2IX3A 3H3VC 2BDNA 1VMPA 1W6JA 2EYOA 5IWAL 5GAGC 5EPLA 3D3RA 3K5MA 1F9QA 3CCSA 4DR4Q 1PH9A 2DJFC 1KDCA 3HOUH 4KHPQ 1IXRA 1VQOA 1PZKD 4BA1I 3J7ZC 1TS5A 3M4QA 3OYYA 5A2QL 1DOKA 4DNTB 1KL9A 1IBKL 2MO0A 2ZJQA 2JA9A 2NN6G 4UPAA 2AMCB 1CUKA 3CF5A 2PCFB 4OO1G 3KLSA 4ZQ3A 2N88A 1E22A 4NXNL 1LTID 1SSOA 1SDFA 2Z6BA 2RQXA 3RUZA 4FF1A 3H0GG 3RR5A 1AW7A 3K6OA 1U4RA 3A7AB 4YY3L 3S24A 3FDTA 1ZYRD 3NBHA 5EBDA 4A3JH 1PXUA 2A73B 2Q2TA 5FO7B 3Q6SA 2EQSA 1NTGA 1YJ9A 2PYKA 1C9OA 2EDGA 3V96A 5CORA 4LFAQ 3KK7A 1W6KA 1D8LA 1QZHA 1WTRA 1VQ7A 2WFWA 3FPUB 3I4OA 2OQKA 4ZUJA 3DM3A 2X69A 1B7YB 4MZ9A 1VQAA 4XXEA 1P16A 5GROA 3ERSX 4DV7Q 1I4HA 2UXCL 4TSSA 2H5XA 1A3TA 4MNOA 1VS0A 3U58A 1BUVT 4AYBB 3BU2A 2OEOA 3J7AF 3CU7A 5IGEA 3ULJA 3JAMc 5LL6S 4KKUA 3CCLA 5I6WA 4HCEA 1FGUA 3I3CA 4JOIA 2QGQA 4IUNA 2N78A 5BR8Q 2B63H 4KHPL 4LUOA 4JI5L 3U9SA 5ELOA 4MTNA 1PTOF 3OW7A 1X3FA 1K8AC 1Y8OB 3J80i 1IBLL 3T13A 2M9VA 2A68C 3DUZA 4BY1B 3BDLA 2F1MA 1E7ZA 1VQFA 1D6EC 4CGYB 2EYHA 4GOPA 4UAIA 4X3UA 1J6QA 3A5ZB 3PUYA 4BY1G 3V05A 3I73A 1D7QA 2NVXB 2WACA 1Q90A 3RLOA 1HFNA 3J7A5 4HIDA 5E3FA 1UE7A 2A74C 1LYLA 2VXWA 3T51B 3C2PA 3ER0A 3TEHB 1JR0D 2IHEA 1XPRA 4LWCA 2NVXH 2K14A 5ELBA 1H9SB 5JVG3 4R8NA 2PI2A 3C1EA 4CKCA 5FLMH 3HKZB 4AH6A 2FXQA 4C3HH 3E5SA 3GDEA 4LFAL 1EIHA 4IOAA 4HIMA 5JJKA 1K9MC 1VQBA 5IP9H 3K5LA 1CSPA 1EEID 3KLRA 2LS01 1QOHA 4QL5A 1KTKA 4DV7L 3AMUA 1STAA 3NPPA 2NUCA 2VB3X 3HKZG 4EQOA 4PZ8A 4RMFA 1JB7A 3C3LA 4A75A 4F87A 2WB1G 1STHA 1K73C 3NTKA 4NPSA 3G48A 1TU2B 3MA2B 2A68D 3ZYYX 3BYYB 4P72A 1Q82C 2B2YC 4FXGC 1R4QB 3D6WA 3V2TA 4GKJQ 4R4CA 1VQ4A 1BCPC 2MPMA 1D1IA 1IBML 1RTNA 4EVOA 1JJGA 1M1KC 1KLGD 2Z0SA 2KEEA 1F9PA 4APVA 5T1GA 2JA7B 1ZKOA 1BR9A 4X62Q 2K04A 4DV4Q 1F77A 3G6EA 1HTPA 1U4LA 2OXPA 1Q8KA 4C2MB 2AHOB 5M5WB 1CQFA 4N9PA 5FLXL 2IT1A 5C4HA 2F3WA 1YNND 4K2KA 1Y8PB 2R92G 2JA7G 1LABA 1AE3A 1X3EA 2KHJA 5FJ8H 4C2MH 2JEBI 3URYA 5M5WH 4OEMB 1SAPA 3D4RA 1E0BA 3EA6A 4YWMA 3QWNA 5JAVA 2JSOA 2Q8TA 3SE0A 2GA4B 1KNAA 3PGZA 3TBIB 1DOMA 3R8BA 5DLQE 2FHTA 4IFDH 3CAMA 3N6RA 4LFBQ 3SGIA 3T1HQ 3AFPA 1H9SA 5JJZA 3HOXH 3PQIA 2VZAA 3K58A 4BY7B 1X3PA 1XX8A 2Q8RE 4JK1C 3TDQA 3NK9A 4LUVA 2B2VC 4DXGA 4LMQD 3H91A 3EVQA 3I72A 1RD9D 1NAPA 2K05A 2NZOA 3HOVB 1PDQA 1WVLA 3JC66 3KJPA 4FP5D 4DR2Q 4DK0A 3S17B 4BY7G 2EXDA 5EBCA 5EPKA 3S1MB 1CZWA 5I6YA 3P20A 4R4OA 1A3VA 2MNAA 3DMUA 1SN8A 1HA5A 3S17H 3T4AC 4OIJA 3HOVG 1SJED 2VUMH 4XTCS 2ZXPA 3K81C 2E75C 1VQ8A 1ASZA 4POFA 4B9XA 1PH4A 4X62L 2LFNA 4MHEA 4JI8L 4DV4L 1N33Q 2K5QA 4KJNA 3BS1A 2EYJA 1V1QA 2F0LA 4JPBW 4DAPA 5M5YH 3OW2A 1R9TH 4PMWA 1YIJA 4XYQA 3PO3H 1VQMA 2CWAA 5D3DA 2K75A 2G9HD 2CVRA 2FMCA 1LACA 2XWBB 1S3OA 1PA6A 4B3MQ 2JA6G 4UY8C 4LF8L 3FHWA 2HQLA 1QZGA 2VW9A 1HH2P 3A5UA 4JI0L 2F0GA 3U4VA 3SK6A 3T56B 4LFBL 1FVIA 2JN4A 1STGA 3NENA 2CH4A 5M9OA 2ZXRA 3F2DA 1HNXQ 4O42A 1SROA 1FR3A 2KJXA 2N8NA 4N8X1 4A3BB 1X55A 1KABA 4UP9A 1HR0Q 1JB3A 4K0KL 4JC0A 5HGTA 2IY5B 2K50A 3CPFA 3IRBA 1I3QB 2PQEA 2RF4A 3S1QB 1HZAA 2L15A 4A3BH 4GNXB 2F0MA 4QGUA 1VQJA 4ULLA 1IHZA 3I4MB 5M3MB 3S1QH 3CC4A 2SNMA 2AQ2B 2FJ2A 1WCMG 3BVMA 3I4MH 4QCLA 3K5NA 1TY2A 3KDFB 1M4VA 5EJWA 3VDYA 4YHHQ 5M3MH 2NVTB 3FRPB 1W2BA 1CQVA 3GTPB 1VQDA 1OXVA 4G57A 3KFUA 4R8IA 1N33L 1N32Q 1UNSA 1LT6D 2VQEQ 4GKKQ 4BS9A 2NVTH 2KVMA 1UE6A 2PI2E 5C3EG 3GTPH 2K7VA 2B39A 1E3PA 1O7LA 5C3XA 2ZM6Q 2PPBC 5AJ3Q 5IOCA 2YTXA 2RHQB 4ZKBB 5A2QE 5IYBG 4LNQA 4HN7A 1GVPA 1M8AA 1L0XB 3NWTA 5C44B 1NMGA 3NTHA 5IGBA 3PIPA 4HTHA 4EQNA 3DXJC 4HMJA 1HZCA 4TQUS 5CV4A 5C44H 2WKDA 1SXTA 4J8QA 4JCVE 3OPOA 3W1BA 4L6TB 5E4WC 2D5DA 1B70B 2B2UC 1VQKA 4JBKA 4JI2L 1OXXK 1P8LA 1JOKA 1EWIA 2F0HA 5IODA 3S9WA 4OWTB 2IW3A 4AYBE 1XYIA 4A3KB 2Y0SE 1KIXA 5BN5A 5LMUL 3KF6A 1IW7C 5AFWA 1HR0L 3E3XA 1GUGA 1EYDA 5G3LF 2QDBA 1SNQA 5ELFA 1VQGA 3BZKA 1WJJA 1Y69U 4FNFA 4A3KH 2F0DA 4IURA 1I4GA 2F52A 1NUCA 1MBYA 2QEJC 3E0JA 3P1HA 5C0XG 4A3DG 2I07B 2Z9HA 1VQCA 1XMQQ 1HJPA 2B29A 3OIPA 4PMBA 1M90C 4UP7A 5D14A 4KY5A 5T1IA 1FNUA 4ZKCB 5M3FB 3G6JB 1Y1WB 3DWAA 4ID6A 4GS3A 5CR3A 1TIID 3P7JA 4YHHL 1B4OA 4DR7Q 1BBXC 5M3FH 1ESFA 4ILWA 2PZUA 3AFQA 1Y1WH 1N32L 2F0UA 1RHPA 4DV2Q 1EY0A 1SR3A 2MFIA 4GKKL 3HG9A 3CPWA 3KDFA 1SMYC 1L2FA 1YEZA 4DV3Q 3GD7A 4KK7A 2XIWA 4AQYL 2ZM6L 4QUFA 2D2CC 1WTOA 1GD7A 3GQBA 3KLWA 4A3LG 1I4QA 3K0XA 3NUCA 4NW2A 3MXNB 2TMPA 5C5LA 1O78A 3CQZB 3HKZE 3OWFA 2A1AA 2E8GA 2Q2UA 5IWAQ 5JPMC 2XN9C 4QQBX 2WINB 1SNPA 1TWCB 3CCJA 1YNJC 1CSQA 1V1OA 1HNZL 2K03A 1TWFB 4KY7A 2E76C 3H6MA 3RNUA 3CQZH 5C4XB 3TN2A 4XQQA 3PIOA 1TWCH 3NSWA 1TWFH 2CW0C 1SFOH 1PRTB 5C4XH 5ELDA 5C4ZA 1JMCA 3S2HB 2E2IH 3RLFA 4G7OC 1NR2A 4PZ7A 1DJRD 5CMDA 4PNYA 1MJEA 1WYDA 3O13A 3A8IE 5CBEE 2JA5H 4J1MA 4QUCA 2EYMA 1K0RA 1FJGQ 4NXNQ 3S2HH 1XMQL 4K14A 4L5TA 1UEBA 4C3JB 3K57A 1SMYD 2R7ZB 4DFAA 1LTSD 3UDFA 4YY3Q 1CKNB 5I4DA 1J9OA 4O0AA 2JEAI 5ELNA 1KRSA 4C3JG 2R7ZH 4B3SL 1BOSA 4RGOS 4DV2L 2B2WC 1YI2A 4A3GB 4DV3L 1TS3A 4P2CB 1CKMA 1UUPA 4IJHA 4A93B 4GOPC 1EOVA 4RGTA 1YNJD 2GN5A 1LTRD 1SYFA 2C35B 4TKOB 5DAUA 1X6OA 4A3GG 4ZLTF 4JV5Q 3HOYB 1LT4D 4KMUC 2D9UA 5FLXE 1A6XA 4A93G 1GHJA 4KKTA 4BBRB 5HY6A 3A54A 1CKOA 1Y1VB 4F88A 1TS2A 4DR3L 3VR6A 4JI5Q 3BYTB 3MXNA 2Q8IB 3X3MA 1I50B 2G5DA 3HOYG 1T5EA 1H9RA 4YCVA 2V4DA 1E1TA 4DV6Q 2ZJPA 1AH9A 2K28A 1H9MA 4P74A 1IBLQ 1OXTA 4BBRG 2ALYB 2UU9L 5JEAG 4LF5L 1Y1VG 4R1JA 1OTCA 1L1OB 1I50H 5JVH3 2EE1A 1BXTA 2O2LD 3PUVA 3IFDA 2OF1A 3BZCA 2K5VA 2NN6H 3H0GB 4HMIA 3I2ZA 4OO1H 3TP7A 3T16A 1FJGL 5E4XA 3M4OB 2EPBA 3H0GH 2AUKA 1I94L 4C1NI 2FMMA 2OWOA 1EIFA 2F3VA 2HDMA 2X6GA 5NUCA 4JI4L 5IIFA 3PO2G 1ZXTA 1E24A 2DNCA 1E2VA 5C0XJ 2ATWA 4KHVA 4NDXA 1BF4A 1PH2A 3TMEA 4B08A 1B50A 1QWYA 1CKNA 2SNSA 3LGJA 1U4MA 2MP1A 3J81L 3C1FA 3W1GA 3H3VH 4RKBA 4KTAA 2L9HA 2BH8A 1WTVA 5GADC 2E5LQ 5HGQA 1E2WA 4KJOA 3HEJA 3U9OA 3PIO3 3B6YA 2AQ3B 1XNQQ 1TKWB 5BN3A 1STBA 3ICEA 2R7DA 1PFMA 1V43A 3A8KE 4JV5L 5JPNC 3J80L 1D5XC 4LAAA 4L5RC 2F0IA 3HOZG 2K6AA 1XJVA 2JQOA 5DNFA 2NWGA 1LTAD 4DA2A 2LXKA 1LTLA 4X6AH 1IBMQ 5LHY1 4DV6L 5C5MA 1EUJA 3RN2A 1VF7A 3T1YQ 3VYSA 1SRUA 2MO1A 2NTSA 2DY8A 4K5WA 1UEAB 3A56A 2E2JB 1IKMA 1PFNA 1EY8A 1PH7A 1G2TA 1JWUD 4LF7Q 3EROA 2KENA 1EZ8A 4BY1H 1HUMA 1SJHD 1CHQD 2CKZB 5IGCA 1L1OA 1J5EL 2E2JH 4KV6A 3QR8A 3QOJA 5FLXc 3SVMA 1VQ9A 1GKHA 2QKIC 1WI5A 1HQRD 4BXXG 5CV6A 1EQTA 1SYBA 3ERQA 2OTLA 2EY5A 3EIVA 4H13C 1HA6A 5FK9C 2ICIA 3T53B 3FEWX 2F3IA 1EFWA 2EJMA 4DAYB 2PQAB 2A19A 3BVGA 4FXDA 5CGKA 1TR5A 2WB1B 5IT9L 4IN3A 1AZPA 4HAEA 4ZRZA 3I90A 1JORA 5K5PA 1EY7A 1SE2A 2E5LL 4DK1A 4JI7Q 2CQOA 5BN4A 4IPCA 1XNQL 5I9PA 1WTHA 3KYHC 2JA8B 1TWGB 4BBSG 2WAQE 2EY6A 2F0EA 2KEDA 2ZT9C 3S15B 2DGYA 1II3A 2EVBA 4JI1Q 2IHFA 3K80C 3BVZA 2K52A 2SEBD 3S2DB 2QF7A 1YZ6A 1TWGH 1EEFD 1EZ6A 3L0OA 3STBC 3GV3A 2JA8G 1AP0A 2I5MX 1B53A 1G91A 3UI2A 1CA5A 4N9TA 5CV9A 2VY3A 4YCWA 4DPGA 3OWEB 1JWSD 3DEPA 1FNVA 3S2DH 3NBIA 1AE2A 1YNXA 2AKWB 3QIAA 4B9WA 5LMNW 3T1YL 2R92B 1K0SA 1XNRQ 1QVGA 3NP8A 4JI8Q 3W2DA 3A74A 3R93A 1UAPA 2KUMA 3ZJYC 1S5CD 4CDFC 3D8GA 1U5KA 1H9KA 3JAMi 5IE8A 4LF7L 3G71A 2L0CA 2R92H 1X3GA 2JA7H 3OHXC 2BE5C 3D4WA 5JEAJ 3RZDB 5KNDA 2F0QA 3GV6A 4UP8A 1PVOA 1GUNA 3GTLB 1ZEQX 4X65L 1DXMA 4LF9Q 2FINB 4LF8Q 1Q1BA 3CCEA 1JQYD 2DJGC 3K8AA 1PRTF 1I6VC 2A6HC 1WD1A 1Q8IA 2PW5A 2EYPA 2LSSA 3TS0A 4JI0Q 4DF7A 4DAVA 1QCBD 3BZDB 4DKAC 1HPCA 1X54A 3I8ZA 4ME3A 1BCPB 4OELB 2YU9B 3SK8A 1WOCA 1Z7TA 4DGZA 4K0KQ 4JI7L 3GTOB 3STBD 1TQOA 1EU4A 4XIGS 4Z9CB 1BCPD 1X32A 1JT8A 2F0VA 1ENFA 3ND8A 1OXSC 2PW7A 3GO5A 1YVCA 2YU9H 1HTLD 4BY7H 4LK1C 2LMCB 1GHKA 1SYEA 4FF3A 3ULPA 3GTOH 1BBWA 1JC7A 4N8FA 4JI1L 5IGGA 3FPPA 1MI2A 1NNXA 1VQHA 5ELCA 3HOVH 3PF4A 5KRUA 2I46A 5A35A 3RLNA 1UE1A 4C1NK 4CJ2C 2A5HA 4K2LA 4K8IA 3TP5A 4FF2A 3HZXA 3S1MH 3Q8DA 4KKSA 2ASBA 4KN7C 2BE5D 3SEBA 5LL6X 3PSIA 2CQAA 1EY5A 1GJXA 4CBVA 2HIVA 1DONA 1XNRL 5CV8A 3M85A 1N36L 3CCVA 1X3QA 4RCNA 1PYSB 2NVYB 3KUPA 4MTKA 4XT1B 1G6ZA 4IFDI 4M8AA 1FD7D 5CV7A 5FO8B 4L8JA 2JA6B 1YHBA 4OX9Q 2A6HD 4A3IB 4RFBA 1VMCA 2RBMA 2NVYH 4PG3A 2JK8A 2L5TA 3EBEA 1FYCA 2PMZB 3K59A 1D5MC 2JA6H 2IJ0A 4QMGA 4LFCQ 4LF9L 2VB2X 3MEHA 3AEVA 2KCCA 2N55A 4A3IG 4TVAB 2J0TD 3MC0B 2R93G 4YWKA 2O5JC 1QUQB 2JE6I 1C4QA 3K7AB 4JI2Q 4DR6Q 2IPKD 1RTOA 1S5BD 1ESRA 3L2PA 4PV1C 3NQTA 1VQEA 4I7ZC 1NSNS 3AU7A 4C3IB 1QNUA 5LMUQ 5I2YA 3CC2A 4LW1A 2RVLA 2JP1A 1U9RA 2OQ0A 1IYUA 1GUWA 2RSNA 5GAHC 5JJLA 4HJ5A 4IUVA 1SYDA 1Y8NB 1WCMB 2EY2A 2L55A 2HCIA 2L4NA 1PTOC 3LNNA 2F4VL 4C3IG 1FL0A 4YIJA 2E74C 1I3QH 1K28A 1F2LA 1WCMH 1UWVA 2HIXA 2F0OA 2O4XA 3GTGB 2Z4IA 3EJIA 5C3EB 1N8RC 4KD3A 1WTPA 1EL0A 1XXGA 3DM1A 1Q46A 5C4JB 1KDAA 4TRDA 4FVMA 1X9NA 2XVSA 4LUZA 1TT2A 4JBWA 1B44D 1GUOA 5C3EH 1IYJB 4HSPA 5DM63 5EGTA 5KNCA 1NJIC 2QDLA 1EY9A 1PZJD 3W5OA 3MFGA 1KNEA 5C4JH 4JW0A 3DWQA 4P73A 4AQYQ 4OX9L 1I4PA 5IYBH 3NELA 1RL2A 3KJOA 1LTTD 2I5HA 4JI6Q 4HCSA 2X6LA 3EQLC 1B1ZA 4LFCL 4B3TQ 4HEDA 3CCRA 3F2BA 5EKLA 2N49A 3VYRA 1GO3E 2Z6KA 1CM9A 1XWEA 3J7YW 1HNZQ 4K6LA 1RF2D 3CHBD 4Q5VA 5IY0A 1EFID 1PZID 1BDOA 2L11A 1B9MA 2Q2IA 4HJ9A 4ME5A 2DN8A 4DR6L 2K5DA 1PTOD 4X3SA 1PHJA 3VA5A 1PFBA 4ZYSA 1RJTA 3FP9A 3NWSA 1ET6A 4CDEC 5C6AA 3BDCA 2GVBA 4JVZA 1CT1D 3F2CA 4A3DB 4WRDA 1YHQA 3HFZB 4PQXA 2HCCA 1AEXA 3M4YA 5C0XH 3J81E 4A3DH 1ICFB 3CRKC 5J3BA 2QW7A 4GN5A 2XWJB 4GNXA 3GTKB 1FNWA 1HUNA 2EJGC 1CK1A 3J80E 4IUPA 3X3NA 1TS4A 4RGNA 4HJ7A 1K8OA 2EYLA 3I70A 1NY4A 1HFGA 4B3SQ 3S1NB 3GTKH 1VQ6A 4DV0Q 1PH8A 2UUAL 5J22A 1EYGA 3WWVA 4A3MG 4GN4B 1D2BA 1S4ZA 4J15A 2AWOA 3OOCA 1C48A 1WTWA 3VR3A 2RDFA 3FKIG 4A3LH 4GN3B 2B2TA 1NMFA 2PZWA 4JI6L 2K01A 2DY7A 1JWMD 5M5XB 3FVQA 1BVSA 4B3TL 4WJWA 3S14B 1RKNA 2WB1E 1IW7D 1AFPA 3EFXD 3F1ZA 2BDOA 4J6HA 3VR5A 4DXFA 4H44C 5JOBA 5M5XH 4IO9A 4DR3Q 2PNHA 2R7FA 1V8QA 4JYAQ 3PUZA 4XDXA 2F4IA 2KHIA 3S14H 4F7XA 3IFTA 4NKLA 1Q86C 3SXHA 1NR4A 4QJFA 1MGSA 2UU9Q 1OO9B 2UUCL 4LF5Q 2F0JA 2AWNA 4POGA 2UUBL 1U4PA 5K36G 3M3YB
chains in the Genus database with same CATH topology
4RWSC 4IQZA 2EXZA 5IT9E 1F9RA 1IKLA 4CKEA 3A7LA 4FYDA 4S3SA 1R4PB 2WKCA 1I4XA 2KA7A 2FFKB 1WTQA 2H1EA 5EPJA 3GTJB 4PMCA 2NVQB 1B2TA 1KDBA 2EYFA 3PUWA 3L7ZC 2NZ1D 3BDOA 3HGBA 5CV5A 1AN8A 1IL8A 1NCVA 2PNRC 4X3KA 2J4XA 1LTBD 5EKKA 2F0TA 5FOBB 2F03A 3QG1A 1EWCA 2AQ1B 1SYGA 1EU3A 1ONLA 2H4OA 1L0YB 2ID0A 2BA1A 4K6DA 2AUJD 3HOWB 3RD4A 2CW0D 2NBFA 1HCZA 1ZYRC 4OGQC 1D1KA 1LO5D 4RH6A 3MXGA 3R3OA 4ODGA 4K8JA 3IAYA 4V190 5E1FA 4OHJA 5KEEA 5JEAH 2XSCA 4OIKA 1RDPD 1CI3M 1EY4A 2HDLA 1LT3D 2IWHA 1CZGA 4ZUIA 3PO2B 3VA7A 5D3IB 5KYLA 4KY6A 4U68A 1AZQA 3H94A 3E6ZX 1SBBB 1SE3A 2BCOA 3DHQA 3G7LA 3WOEA 1IYVA 2KQ3A 4V0BA 1B3AA 2JXMB 3D31A 2NB0A 4UDUC 1ML0D 2MUYA 4A3JB 1A2UA 4BA2I 2F0PA 3K5OA 5D65A 5I2XA 1CA6A 3HOZB 5KGUA 4QIWB 3W3AA 1SNDA 3OIQA 2NN6I 4FO2A 4K5XA 3FMCA 3KF8A 3D6CA 4OO1I 2K32A 3LWEA 4C56C 2A69C 2EJFC 1BNZA 4NMZA 4E6IA 1K8MA 2ZXOA 3HS0C 1QB5D 3LX0A 1EOTA 5CYUA 2B63B 1HXYD 2Y0SB 2EZVA 3BG3A 2XRQD 4RKLA 3S16B 2RA4A 5EKIA 1STYA 4IUQA 5KIXA 2R61A 1PYWD 3OMCA 2K1BA 2ENBA 1EWHA 1DYQA 3A8JE 2F0FA 4WORA 4CHTB 3C46A 5J1ZA 2B2WA 1WTXA 1CTMA 4F8MA 1T5XD 1TVXA 2Z1CA 5DM73 3Q24A 1VDZA 5ISRA 2QILA 3PUXA 1EYAA 3J7AV 4IUTA 4BBSB 1A3UA 2TSSA 4IUUA 4U673 2A69D 1MD2D 5ELEA 1VF5C 4C3HB 1V1PB 3NXWA 1J8IA 5G3LD 1RODA 1YNNC 1S5FD 3L9AX 4H7BA 3A55A 1ILPA 4Q0FA 1Z6HA 4C3HG 1C8CA 1QJOA 4ZAIA 1E2ZA 3JAML 1LV9A 1HRJA 3I4LA 3L3OC 3MVVA 3SHLA 1VCIA 2R6GA 1SEBD 1Q12A 5DEHA 3S1RB 2Z8LA 4ZK9B 2O5IC 3HP3A 3GP7A 2K33A 3SK5A 1Q1EA 2OT2A 5CC4A 1JE4A 4X3TA 4LJZC 3TZDA 1KAAA 3OMGA 1LT5D 2SOBA 3LWUA 4IALA 3MXUA 2XNAC 3NHHA 5CBAE 3Q22A 3CRLC 3QJYA 1DCZA 3VYTA 1B9NA 4DAYA 1H9JA 3MAQA 2KHSA 1A2TA 2RSOA 4DU9A 4RAUC 1OXUA 2PZTA 2L12A 4GZYC 3HOXB 2XRSD 3MTSA 4IFDG 2G9DA 1V1PA 5C3WA 1JICA 1SNOA 1DOLA 4Y7NB 2F0KA 4BWGB 2EY1A 1D5ZC 3NE5B 2DNEA 3IL8A 2VUMB 3D4DA 2F0NA 3GTMB 3RMHA 3SR1A 4QB4A 2F0WA 1JCKB 1I4RA 3QO2A 2RDGA 2IX0A 3TZUA 4NP5A 2R93B 3MFYA 5M5YB 1R9TB 3ND9A 1F2ZA 3ONAB 3PO3B 1BQQT 1K83B 2C5CA 3TSSA 4RCOA 1QNKA 1G8ZD 2YYZA 1Q3LA 4K5VA 2MGSA 3GTQB 2CHBD 2ICEC 3VR2A 3I4NB 4DN4M 4EQPA 3VYUA 3VR4A 3H09A 2KOLA 4L63B 2PO4A 2B2YA 2B2TC 4KD4A 1PMRA 1DZ1A 1FGBD 3NTIA 3R2TA 1F2YA 3K0YA 1O7ZA 1ENAA 4H0LC 2B8FA 1G2SA 3F2UA 2KECA 1F2MA 1RCVD 4FXKC 2F0SA 4QF4A 4RHSA 2VNUD 1TY0A 2MHVA 3MZ5A 1EQVA 4WFN3 1ILQA 3OSOA 4KN4C 4MIUA 2K5WA 3P75A 4KHZA 1LTGD 1EIGA 4HR7B 4G7ZC 2MJ8A 3M7GA 2WP8J 4RHRA 2A6EC 3ITPA 3SK4A 2Z4HA 3WDNA 4CKBA 1MSHA 3AB9A 2C9OA 4CJ0B 3TP8A 5HURA 4EGVA 4XYOA 3RZOB 1PTOB 4O1NA 2B2VA 2QCPX 1KLUD 4IZ8A 3Q0AA 1PTOH 2EOTA 4HSVA 3HRZC 2D62A 5KNBA 1DM0B 1QILA 2WAQB 3MXPA 3NQIA 2SDFA 3MHBA 4XQJA 4FF4A 1STNA 3KBGA 4KI0A 4XT3B 4IFDJ 5KYIA 4A3MB 2A6ED 5EQ0A 3IKJA 1ET9A 3FKIB 2RKSA 1CFMA 2KCNA 4OL7A 4XQNA 1GUTA 5F2DA 3TP6A 3PMFA 3M7NA 1EYCA 1PRTC 1S5ED 1I6HB 3KLSX 2M2LA 4RA8A 1O80A 5TSSA 4RGMA 3I91A 1SE4A 1JOOA 5C0XI 3WOFA 2IX1A 2HQEA 1PLFA 2L1BA 1GOZA 1STEA 1DD2A 2WV6D 1WD0A 4R9WA 3QB3A 5FO9B 2IL8A 5COYA 2NYZD 3DEOA 1SNMA 5K36H 1TWAB 3DWPA 2BA0A 2E2HB 2LY7A 1QG7A 1TWHB 4M1UB 2WIIB 1SFOB 1CHPD 1F9SA 1QE6A 1BO0A 1HQMC 4A3EB 4I65A 2E2IB 4G7HC 3PV0A 3N52A 5J39A 2R3ZA 1SNCA 2B8GA 1EY6A 2RDHA 2JA5B 2BOSA 2E2DC 3R2IA 1GXDC 5FKAC 3QOLA 1BCPF 1MSGA 1HHVA 4ABNA 1PRTD 5IGFA 4CJ1B 2J7ZA 1SYCA 1Z47A 1O7YA 2JYOA 3JAME 5I9OA 2M00A 4A3FB 2NTTA 1S5DD 2HUGA 2LKVA 1ENCA 1GUSA 2B2UA 4DNRB 4MN3A 3PIP3 3Q23A 1JOQA 3MWYW 3KBXA 1A15A 1XTCD 3CKIB 3SDZA 1LLRD 1ICWA 4G4KA 5IGDA 3HOUB 1G291 2IX3A 3H3VC 2BDNA 1VMPA 1W6JA 2EYOA 5EPLA 3D3RA 3K5MA 1F9QA 1KDCA 1PZKD 4BA1I 1TS5A 5A2QL 1DOKA 4DNTB 2NN6G 4OO1G 2PCFB 3KLSA 4ZQ3A 2N88A 1LTID 1SSOA 1SDFA 2RQXA 3RUZA 4FF1A 1AW7A 3K6OA 1U4RA 3A7AB 3FDTA 1ZYRD 3NBHA 5EBDA 1PXUA 2A73B 5FO7B 3Q6SA 2PYKA 2EDGA 3V96A 5CORA 3KK7A 1W6KA 1WTRA 3FPUB 4ZUJA 2X69A 4XXEA 1I4HA 4TSSA 1A3TA 1BUVT 4AYBB 2OEOA 3J7AF 3CU7A 5IGEA 5LL6S 4KKUA 5I6WA 4HCEA 3I3CA 4IUNA 3U9SA 1PTOF 3OW7A 1Y8OB 3T13A 2M9VA 2A68C 3DUZA 4BY1B 3BDLA 2F1MA 1D6EC 4CGYB 2EYHA 4UAIA 4X3UA 3PUYA 3V05A 3I73A 2NVXB 2WACA 1Q90A 1HFNA 5E3FA 2A74C 3T51B 2VXWA 3C2PA 1JR0D 5ELBA 1H9SB 5JVG3 4R8NA 3C1EA 4CKCA 3HKZB 3E5SA 1EIHA 3K5LA 1EEID 3KLRA 2LS01 1QOHA 1KTKA 3AMUA 1STAA 2NUCA 3NPPA 2VB3X 4EQOA 3C3LA 4F87A 1STHA 3NTKA 1TU2B 3MA2B 2A68D 3ZYYX 3BYYB 2B2YC 4FXGC 1R4QB 3D6WA 3V2TA 1BCPC 2MPMA 1D1IA 1RTNA 4EVOA 1KLGD 2KEEA 1F9PA 5T1GA 2JA7B 1ZKOA 1BR9A 2K04A 1F77A 1HTPA 1U4LA 2OXPA 4C2MB 5M5WB 1CQFA 4N9PA 5FLXL 2IT1A 5C4HA 2F3WA 1YNND 4K2KA 1Y8PB 1LABA 2JEBI 3URYA 1SAPA 3D4RA 1E0BA 3EA6A 3QWNA 5JAVA 2JSOA 2Q8TA 3SE0A 2GA4B 1KNAA 3TBIB 1DOMA 3R8BA 2FHTA 4IFDH 3N6RA 1H9SA 5JJZA 3K58A 4BY7B 1X3PA 1XX8A 2Q8RE 4JK1C 3TDQA 3NK9A 2B2VC 4DXGA 4LMQD 3H91A 3EVQA 3I72A 1RD9D 1NAPA 2K05A 3HOVB 1PDQA 1WVLA 4FP5D 3S17B 4DK0A 5EPKA 5EBCA 3S1MB 1CZWA 5I6YA 3P20A 1A3VA 3DMUA 1HA5A 3T4AC 4OIJA 1SJED 4XTCS 2ZXPA 2E75C 4B9XA 2LFNA 4MHEA 2K5QA 4KJNA 3BS1A 2EYJA 2F0LA 4DAPA 4PMWA 4XYQA 5D3DA 2G9HD 2CVRA 2FMCA 1LACA 2XWBB 2F0GA 3SK6A 3T56B 1STGA 5M9OA 2ZXRA 4O42A 1FR3A 2KJXA 4A3BB 1KABA 1JB3A 5HGTA 1I3QB 2PQEA 3S1QB 2F0MA 4ULLA 1IHZA 3I4MB 5M3MB 2SNMA 2AQ2B 2FJ2A 3BVMA 4QCLA 3K5NA 1TY2A 1M4VA 5EJWA 2NVTB 3FRPB 1CQVA 3GTPB 1OXVA 4G57A 4R8IA 1UNSA 1LT6D 4BS9A 2KVMA 2K7VA 2B39A 1O7LA 5C3XA 2PPBC 5IOCA 4ZKBB 5A2QE 4HN7A 1M8AA 1L0XB 3NWTA 5C44B 3NTHA 5IGBA 4HTHA 4EQNA 3DXJC 4HMJA 4TQUS 5CV4A 2WKDA 1SXTA 4J8QA 3OPOA 4L6TB 5E4WC 2D5DA 2B2UC 1OXXK 2F0HA 1JOKA 5IODA 3S9WA 2IW3A 1XYIA 4A3KB 5BN5A 1IW7C 5AFWA 1GUGA 1EYDA 5G3LF 2QDBA 1SNQA 5ELFA 1Y69U 4FNFA 2F0DA 4IURA 1I4GA 1NUCA 1MBYA 2QEJC 3E0JA 3P1HA 5C0XG 2I07B 4PMBA 3OIPA 5D14A 4KY5A 5T1IA 1FNUA 4ZKCB 5M3FB 3G6JB 1Y1WB 3DWAA 4ID6A 5CR3A 1TIID 3P7JA 1B4OA 1BBXC 1ESFA 4ILWA 2PZUA 2F0UA 1RHPA 1EY0A 3HG9A 1SMYC 3GD7A 4KK7A 2XIWA 4QUFA 2D2CC 1WTOA 3GQBA 1I4QA 3NUCA 4NW2A 2TMPA 5C5LA 1O78A 3CQZB 3OWFA 5JPMC 2XN9C 2WINB 1SNPA 1TWCB 1YNJC 1V1OA 2K03A 1TWFB 4KY7A 2E76C 3H6MA 5C4XB 3TN2A 4XQQA 3NSWA 2CW0C 1PRTB 5ELDA 5C4ZA 3S2HB 3RLFA 4G7OC 1NR2A 5CMDA 1DJRD 4PNYA 3O13A 3A8IE 5CBEE 4J1MA 4QUCA 2EYMA 4K14A 4C3JB 3K57A 1SMYD 2R7ZB 4DFAA 1LTSD 5I4DA 1J9OA 2JEAI 4C3JG 1BOSA 4RGOS 2B2WC 4A3GB 1TS3A 4P2CB 1UUPA 4A93B 4RGTA 1YNJD 1LTRD 1SYFA 4TKOB 5DAUA 4ZLTF 3HOYB 1LT4D 4KMUC 2D9UA 5FLXE 1A6XA 1GHJA 4KKTA 4BBRB 3A54A 1Y1VB 4F88A 1TS2A 3VR6A 3BYTB 3MXNA 2Q8IB 3X3MA 1I50B 1T5EA 1H9RA 2V4DA 2K28A 1H9MA 1OXTA 5JEAG 5JVH3 2EE1A 1BXTA 2O2LD 3PUVA 3IFDA 2OF1A 2NN6H 3H0GB 4HMIA 4OO1H 3TP7A 3T16A 5E4XA 3M4OB 2EPBA 2AUKA 4C1NI 2FMMA 2F3VA 2HDMA 2X6GA 5NUCA 5IIFA 1ZXTA 2DNCA 1E2VA 5C0XJ 4KHVA 4NDXA 1BF4A 3TMEA 4B08A 1B50A 1QWYA 2SNSA 1U4MA 2MP1A 3J81L 3C1FA 4RKBA 4KTAA 2L9HA 1WTVA 1E2WA 4KJOA 3HEJA 3U9OA 3PIO3 2AQ3B 1TKWB 5BN3A 1STBA 1PFMA 1V43A 3A8KE 5JPNC 3J80L 1D5XC 4LAAA 2F0IA 2K6AA 5DNFA 2NWGA 1LTAD 4DA2A 5LHY1 5C5MA 1VF7A 3VYSA 2NTSA 2DY8A 4K5WA 1UEAB 3A56A 2E2JB 1IKMA 1PFNA 1EY8A 1G2TA 1JWUD 3EROA 1EZ8A 1HUMA 1SJHD 1CHQD 5IGCA 4KV6A 3QOJA 3SVMA 2QKIC 1HQRD 5CV6A 1EQTA 1SYBA 3ERQA 1HA6A 2EY5A 4H13C 5FK9C 2ICIA 3T53B 3FEWX 2EJMA 3BVGA 4FXDA 5CGKA 1TR5A 2WB1B 5IT9L 4IN3A 1AZPA 4HAEA 4ZRZA 3I90A 1JORA 5K5PA 1EY7A 1SE2A 4DK1A 5BN4A 5I9PA 2JA8B 1TWGB 2EY6A 2F0EA 2KEDA 2ZT9C 3S15B 1II3A 2EVBA 3BVZA 2SEBD 3S2DB 2QF7A 1EEFD 1EZ6A 3GV3A 1AP0A 1B53A 1G91A 3UI2A 1CA5A 4N9TA 5CV9A 3OWEB 1JWSD 3DEPA 1FNVA 3NBIA 3QIAA 4B9WA 2R92B 3NP8A 3W2DA 3R93A 1UAPA 2KUMA 1S5CD 3D8GA 1H9KA 2L0CA 3OHXC 2BE5C 3D4WA 5JEAJ 3RZDB 5KNDA 2F0QA 3GV6A 1GUNA 3GTLB 1ZEQX 1DXMA 2FINB 1Q1BA 1JQYD 1PRTF 1I6VC 2A6HC 1WD1A 1Q8IA 2PW5A 2EYPA 4DF7A 4DAVA 1QCBD 3BZDB 1HPCA 3I8ZA 1BCPB 2YU9B 3SK8A 1Z7TA 4DGZA 3GTOB 1TQOA 1EU4A 4XIGS 4Z9CB 1BCPD 1X32A 2F0VA 1ENFA 3ND8A 1OXSC 2PW7A 3GO5A 1HTLD 4LK1C 2LMCB 1GHKA 1SYEA 4FF3A 1JC7A 5IGGA 3FPPA 1MI2A 5ELCA 5KRUA 2I46A 5A35A 4C1NK 4CJ2C 2A5HA 4K2LA 4K8IA 3TP5A 4FF2A 3HZXA 4KKSA 4KN7C 2BE5D 3SEBA 5LL6X 2CQAA 1EY5A 1GJXA 4CBVA 1DONA 5CV8A 3M85A 1X3QA 4RCNA 2NVYB 3KUPA 4XT1B 1G6ZA 4IFDI 4M8AA 1FD7D 5CV7A 5FO8B 4L8JA 2JA6B 2A6HD 4A3IB 4RFBA 1VMCA 2RBMA 2L5TA 1FYCA 2PMZB 3K59A 1D5MC 2IJ0A 4QMGA 2VB2X 3MEHA 2KCCA 2N55A 2J0TD 3MC0B 2O5JC 2JE6I 1C4QA 3K7AB 2IPKD 1RTOA 1S5BD 1ESRA 4PV1C 3NQTA 4I7ZC 1NSNS 3AU7A 4C3IB 1QNUA 5I2YA 1GUWA 2RVLA 2JP1A 1U9RA 1IYUA 2RSNA 4IUVA 1SYDA 1Y8NB 1WCMB 2EY2A 2L55A 2HCIA 2L4NA 1PTOC 3LNNA 4C3IG 4YIJA 2E74C 1F2LA 2F0OA 2O4XA 3GTGB 2Z4IA 3EJIA 5C3EB 4KD3A 1WTPA 1EL0A 1XXGA 3DM1A 5C4JB 1KDAA 4TRDA 4FVMA 2XVSA 1TT2A 4JBWA 1B44D 1GUOA 4HSPA 5DM63 5EGTA 5KNCA 1EY9A 1PZJD 3MFGA 1KNEA 3DWQA 1I4PA 1LTTD 4HCSA 2X6LA 3EQLC 1B1ZA 4HEDA 5EKLA 3VYRA 1CM9A 1XWEA 3J7YW 4K6LA 1RF2D 3CHBD 4Q5VA 1EFID 1PZID 1BDOA 2L11A 1B9MA 4ME5A 2DN8A 2K5DA 1PTOD 4X3SA 3VA5A 1PFBA 4ZYSA 1RJTA 3NWSA 1ET6A 5C6AA 3BDCA 1CT1D 4A3DB 4WRDA 4PQXA 2HCCA 1AEXA 3M4YA 5C0XH 3J81E 3CRKC 2XWJB 3GTKB 1FNWA 1HUNA 2EJGC 1CK1A 3J80E 4IUPA 3X3NA 1TS4A 4RGNA 1K8OA 2EYLA 3I70A 1HFGA 3S1NB 5J22A 1D2BA 1S4ZA 2AWOA 3OOCA 1C48A 1WTWA 3VR3A 2RDFA 2B2TA 2PZWA 2K01A 2DY7A 1JWMD 5M5XB 3FVQA 4WJWA 3S14B 1RKNA 1IW7D 1AFPA 3EFXD 2BDOA 4J6HA 3VR5A 4DXFA 4H44C 5JOBA 1V8QA 3PUZA 4XDXA 2F4IA 4F7XA 3IFTA 4NKLA 3SXHA 1NR4A 1MGSA 1OO9B 2F0JA 2AWNA 1U4PA 5K36G 3M3YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STB A;  1STG A;  4N9T A;  5M9O A;  1JOO A;  1NUC A;  1SNO A;  5CV9 A;  2EYO A;  3P1H A;  3NXW A;  4B9W A;  2RBM A;  2KQ3 A;  4PMB A;  3BDL A;  4ME5 A;  2EXZ A;  4LAA A;  1KDC A;  2F0K A;  2F0I A;  3VA5 A;  1KAB A;  4KY5 A;  5JAV A;  2HQE A;  3ITP A;  3NP8 A;  3SK4 A;  5HGT A;  2EY1 A;  4QMG A;  2EYH A;  5C6A A;  4H7B A;  3BDC A;  3MEH A;  4S3S A;  1A2U A;  2PQE A;  4ID6 A;  5CR3 A;  3QB3 A;  1SYF A;  3D4D A;  3D8G A;  4WRD A;  2F0P A;  2F0N A;  3TP8 A;  2F0M A;  2WAC A;  1SNM A;  3SR1 A;  5DAU A;  5HUR A;  3D4W A;  1AEX A;  4QB4 A;  2F0W A;  2PZU A;  5C5M A;  1IHZ A;  4PMC A;  5KGU A;  5E3F A;  2F0U A;  2F0Q A;  1EY0 A;  2SNM A;  4NP5 A;  1KDB A;  2EYF A;  3NK9 A;  1SND A;  3NQT A;  4IZ8 A;  4K5W A;  3S9W A;  4R8N A;  1NSN S;  3MVV A;  5CV5 A;  3SHL A;  1EY8 A;  3EVQ A;  4I65 A;  3C1E A;  4K5X A;  1F2Z A;  4ZQ3 A;  3D6C A;  5EKK A;  5J39 A;  1U9R A;  2F0T A;  3ERO A;  1EZ8 A;  1SNC A;  2PW5 A;  3E5S A;  2EYP A;  4G57 A;  1EY6 A;  1SYD A;  3RUZ A;  5IGC A;  2EY2 A;  4KV6 A;  3NUC A;  5DEH A;  5I6Y A;  3QOJ A;  4DF7 A;  5C5L A;  1A3V A;  1SYG A;  4NMZ A;  3DMU A;  2EYL A;  3QOL A;  4E6I A;  3OWF A;  3MXP A;  5IOD A;  4K5V A;  3LX0 A;  5CV6 A;  4YIJ A;  1SYB A;  1SNP A;  1STA A;  2NUC A;  4K6D A;  3ERQ A;  3SK8 A;  2EY5 A;  4EQO A;  2OF1 A;  5IGF A;  3SK5 A;  4RKL A;  5C3X A;  4HMI A;  4DGZ A;  5CC4 A;  4KY7 A;  5J22 A;  3H6M A;  2F0O A;  1STH A;  2O4X A;  1SYC A;  2PYK A;  3MHB A;  4EQP A;  5IOC A;  3TP7 A;  1TQO A;  1STY A;  3EJI A;  1STN A;  3T16 A;  4B9X A;  2F0V A;  3R3O A;  2PW7 A;  5KIX A;  2RDF A;  3OMC A;  5CGK A;  4KD3 A;  1KAA A;  3OMG A;  4ODG A;  4KJN A;  5I9O A;  1SYE A;  2M00 A;  5IGB A;  2EYJ A;  2PZW A;  4KD4 A;  1TR5 A;  4ZUJ A;  2SOB A;  5IGE A;  4K8J A;  2ENB A;  1KDA A;  4HTH A;  4IAL A;  3V2T A;  4TRD A;  5IGG A;  5KYI A;  2F0L A;  5E1F A;  2F3V A;  5NUC A;  4EQN A;  5C4Z A;  4HMJ A;  1TT2 A;  5KEE A;  1JOR A;  5CV4 A;  5K5P A;  1EY7 A;  2F0F A;  1A3T A;  4WOR A;  1F2Y A;  3NHH A;  5IIF A;  2LKV A;  1ENC A;  4EVO A;  1ENA A;  1RKN A;  2RKS A;  1EY4 A;  5EGT A;  4PNY A;  5KRU A;  1EY9 A;  5J1Z A;  2OEO A;  1JOQ A;  4K2L A;  3TP5 A;  4K8I A;  4KHV A;  4NDX A;  4J6H A;  4OL7 A;  3HZX A;  5F2D A;  2F0H A;  1JOK A;  4J1M A;  5I9P A;  5JOB A;  1F2M A;  2KHS A;  4ZUI A;  1A2T A;  2EYM A;  3TME A;  4DU9 A;  4F8M A;  5I6W A;  3TP6 A;  2EY6 A;  2PZT A;  1EY5 A;  4IUN A;  2F0S A;  2OXP A;  3PMF A;  4QF4 A;  2F0E A;  4K14 A;  2SNS A;  4F7X A;  4NKL A;  1EYC A;  3MZ5 A;  1II3 A;  4KY6 A;  1EQV A;  3SXH A;  5CV8 A;  3C1F A;  4N9P A;  5KYL A;  4RKB A;  4KTA A;  5ISR A;  5C4H A;  5IGD A;  1EYD A;  4DFA A;  2QDB A;  1SNQ A;  3OSO A;  1EYA A;  4MIU A;  2F3W A;  1EZ6 A;  4K2K A;  2F0J A;  1A3U A;  3P75 A;  3DHQ A;  2F0G A;  3HEJ A;  4KJO A;  5CV7 A;  2F0D A;  5EKL A;  3U9O A;  5C3W A;  3T13 A;  3SK6 A; 
#chains in the Genus database with same CATH topology
 5IYD G;  4RWS C;  4IQZ A;  2EXZ A;  5IT9 E;  1F9R A;  1IKL A;  1GM5 A;  2CWP A;  4CKE A;  3E9H A;  3M3Y H;  2LXJ A;  4A3C G;  3A7L A;  4JOI C;  1JJ2 A;  4FYD A;  4S3S A;  1I94 Q;  1R4P B;  2WKC A;  4GLX A;  1I4X A;  2KA7 A;  3TRZ A;  2RCF A;  3UDX A;  4A4I A;  4JI4 Q;  2FFK B;  1WTQ A;  4A3E G;  1DGS A;  2H1E A;  2I5L X;  5EPJ A;  4PMC A;  4X66 Q;  3GTJ B;  2NVQ B;  3EN2 A;  4C3J H;  4DR1 Q;  1B2T A;  3NBH B;  1KDB A;  2EYF A;  1X65 A;  3PUW A;  3L7Z C;  2NZ1 D;  3G4S A;  3BDO A;  3HGB A;  5IYC G;  5CV5 A;  4DV0 L;  1AN8 A;  1IL8 A;  1NCV A;  3GTJ H;  2PNR C;  4X3K A;  2J4X A;  1LTB D;  4JI3 L;  5EKK A;  2F0T A;  5IP7 G;  2V1C C;  5FOB B;  4YWL A;  2F03 A;  1EIY B;  3QG1 A;  1EWC A;  2AQ1 B;  3KF8 B;  3J81 c;  4B3R L;  1SYG A;  4A3G H;  1EU3 A;  1ONL A;  2H4O A;  1L0Y B;  2A8V A;  2ZTC A;  2ID0 A;  4A93 H;  2BA1 A;  2HD3 A;  4K6D A;  2CCZ A;  2AUJ D;  3HOW B;  4A3F G;  3RD4 A;  2CW0 D;  2NBF A;  1HCZ A;  3U50 C;  1TXY A;  1ZYR C;  4OGQ C;  1D1K A;  1LO5 D;  4RH6 A;  3J80 c;  4JYA L;  3F8T A;  3MXG A;  3R3O A;  3HOY H;  4ODG A;  2K4K A;  1YBY A;  1PH6 A;  3HOW G;  4K8J A;  3I56 A;  4BBR H;  3IAY A;  4V19 0;  5E1F A;  4OHJ A;  4OON A;  5KEE A;  5JEA H;  1Y1V H;  1LUZ A;  2XSC A;  4OIK A;  1RDP D;  3E0E A;  1CI3 M;  1EY4 A;  2HDL A;  1LT3 D;  4JBM A;  2IWH A;  1CZG A;  3AQQ A;  4ZUI A;  5L37 A;  3HOU G;  3PO2 B;  3VA7 A;  1YJW A;  5D3I B;  3CC7 A;  5KYL A;  4KY6 A;  2K5H A;  1J5E Q;  4U68 A;  1V9P A;  4GOP B;  1AZQ A;  3H94 A;  3E6Z X;  1SBB B;  1SE3 A;  2BCO A;  3DHQ A;  3G7L A;  3PO2 H;  2XTI A;  2ZTE A;  3WOE A;  3CD6 A;  1VQN A;  1IYV A;  3M4O H;  4X66 L;  4LF6 L;  1EQR A;  3D0F A;  2KQ3 A;  4DR1 L;  4V0B A;  1B3A A;  2JXM B;  3D31 A;  2NB0 A;  4UDU C;  1ML0 D;  2MUY A;  4A3J B;  4YCU A;  1A2U A;  4BA2 I;  2PMZ E;  2F0P A;  2DUD A;  3K5O A;  5D65 A;  5I2X A;  1CA6 A;  3HOZ B;  5KGU A;  4QIW B;  5IT9 c;  3W3A A;  4A3J G;  1NE3 A;  4PZ6 A;  1SND A;  2XGT A;  3HOZ H;  2VL6 A;  2NN6 I;  3OIQ A;  4FO2 A;  4GLA C;  1JJC B;  2P5Z X;  2YV5 A;  3FMC A;  3KF8 A;  4K5X A;  3D6C A;  4OO1 I;  2K32 A;  3LWE A;  4C56 C;  2A69 C;  3TRE A;  3CMA A;  5JJI A;  4IPH A;  2EJF C;  1BNZ A;  4NMZ A;  5H1S E;  4E6I A;  1K8M A;  2ZXO A;  3HS0 C;  1QB5 D;  2YTY A;  3LX0 A;  1Q81 C;  1EOT A;  5CYU A;  3TQY A;  1HXY D;  2B63 B;  2Y0S B;  2N3S A;  2EZV A;  3BG3 A;  2QA4 A;  2XRQ D;  4RKL A;  3J81 i;  4CDC C;  1XPU A;  3S16 B;  2RA4 A;  5EKI A;  3UE0 A;  1STY A;  4DR4 L;  4IUQ A;  5KIX A;  2R61 A;  1PYW D;  3OMC A;  3UDG A;  2K1B A;  4AYB G;  2B63 G;  2Y0S G;  3S16 H;  2ENB A;  2CH4 W;  1EWH A;  1SE8 A;  3UDI A;  3H3V I;  1DYQ A;  2VQF Q;  3A8J E;  2B3G A;  1Z9F A;  4BXX H;  2F0F A;  4WOR A;  4CHT B;  3C46 A;  4X65 Q;  5J1Z A;  2B2W A;  1WTX A;  3UE1 A;  1CTM A;  3CW2 C;  4F8M A;  1T5X D;  1KRT A;  2KCM A;  4L5S A;  1TVX A;  1K3B C;  2Z1C A;  1IL2 A;  5DM7 3;  3Q24 A;  1VDZ A;  5ISR A;  2QIL A;  3PUX A;  2I0Q A;  1EYA A;  3J7A V;  4IUT A;  4BBS B;  1A3U A;  5GAE C;  1RIP A;  2TSS A;  4IUU A;  4U67 3;  2RCN A;  2A69 D;  1MD2 D;  5ELE A;  1VF5 C;  4C3H B;  1V1P B;  3NXW A;  1J8I A;  1MJC A;  5G3L D;  1ROD A;  1YNN C;  4BBS H;  3BJU A;  3E9I A;  4DV5 Q;  1SMX A;  1S5F D;  4HJA A;  4DUZ Q;  3L9A X;  4H7B A;  3A55 A;  1ILP A;  5FLM G;  4Q0F A;  1XPO A;  1Z6H A;  4OWW B;  4C3H G;  1C8C A;  2JA8 H;  1QJO A;  4ZAI A;  1Y14 B;  3K7U C;  5IP9 G;  1E2Z A;  3JAM L;  1LV9 A;  4R4I A;  5EAY A;  3S15 H;  1HRJ A;  3I4L A;  3L3O C;  3MVV A;  3SHL A;  1VCI A;  5LMN Q;  2R6G A;  1N36 Q;  1K8G A;  4DV1 Q;  1HZ9 A;  5BR8 L;  2HHH Q;  1SEB D;  1Q12 A;  5DEH A;  3S1R B;  4L5Q A;  2D0O A;  2Z8L A;  4ZK9 B;  3H15 A;  3HP3 A;  2VQF L;  3GP7 A;  2O5I C;  2K33 A;  3SK5 A;  1Q1E A;  4DR5 Q;  2OT2 A;  5CC4 A;  3S1R H;  1JE4 A;  3ULL A;  4X3T A;  4LJZ C;  3TZD A;  3RZD H;  4P71 A;  1A62 A;  1KAA A;  3OMG A;  2KBN A;  2EIF A;  1LT5 D;  2SOB A;  3GTL H;  2QEX A;  3LWU A;  4IAL A;  1Q7Y C;  3MEF A;  3MXU A;  1JE5 A;  2XNA C;  5FJ8 G;  3NHH A;  5CBA E;  3Q22 A;  4I7A A;  3CRL C;  3QJY A;  1DCZ A;  3VYT A;  3TS2 A;  1B9N A;  4DAY A;  2PQA A;  1H9J A;  3DLL A;  3MAQ A;  1MHW C;  2KHS A;  1A2T A;  2RSO A;  4DU9 A;  4RAU C;  4ALP A;  2D0P A;  4NB3 A;  1OXU A;  2PZT A;  2L12 A;  4GZY C;  3HOX B;  1WFQ A;  2XRS D;  4DV5 L;  4DK6 C;  4DUZ L;  4JG2 A;  4JBJ A;  1B3Q A;  3M9B A;  2F4V Q;  3MTS A;  4IFD G;  2G9D A;  1V1P A;  5C3W A;  1JIC A;  3HOX G;  2Z6K C;  1SNO A;  1DOL A;  3A0J A;  2MQH A;  4Y7N B;  2F0K A;  4BWG B;  2EY1 A;  1D5Z C;  2ZTD A;  3NE5 B;  2DNE A;  3IL8 A;  2VUM B;  5LMN L;  3D4D A;  1VQI A;  2F0N A;  1PYB A;  4Y7N H;  4DV1 L;  3RMH A;  3GTM B;  3SR1 A;  4QB4 A;  2F0W A;  2HHH L;  1JCK B;  1I4R A;  3CP0 A;  3QO2 A;  4GKJ L;  2RDG A;  2IX0 A;  3TZU A;  4NP5 A;  2VUM G;  3GTM H;  4HIK A;  2R93 B;  3MFY A;  5M5Y B;  4H02 A;  1R9T B;  4DR5 L;  3ND9 A;  1F2Z A;  3ONA B;  3PO3 B;  1BQQ T;  3I55 A;  4GNX C;  4A3I H;  1EQQ A;  1K83 B;  2C5C A;  1PH3 A;  2R93 H;  1YIT A;  3RN5 A;  3TSS A;  4RCO A;  4ZCK A;  1QNK A;  1G8Z D;  2YYZ A;  1Q3L A;  1PH1 A;  1N34 Q;  4K5V A;  2MGS A;  4NXM Q;  3GTQ B;  2UXD Q;  1K83 H;  2CHB D;  2ICE C;  3VR2 A;  3PO3 G;  3I4N B;  4DUY Q;  2ES2 A;  4Y52 H;  4DN4 M;  4EQP A;  3VYU A;  2NZH A;  1PFS A;  3H09 A;  3VR4 A;  2KOL A;  4IPD A;  4L63 B;  3NEM A;  2PO4 A;  3GTQ H;  3K7A H;  2B2Y A;  1KHI A;  2B2T C;  3M4P A;  4KD4 A;  3I4N H;  4KLK A;  3KF6 B;  3I4N G;  1PMR A;  4C3I H;  2ZJR A;  1DZ1 A;  1FGB D;  3NTI A;  3R2T A;  1F2Y A;  3K0Y A;  1O7Z A;  3T1H L;  2JJQ A;  1ENA A;  3OTO Q;  4P75 A;  1HR0 W;  3PCO B;  4EQ5 A;  4H0L C;  2B8F A;  1G2S A;  3F2U A;  4LF4 Q;  1IZ6 A;  2KEC A;  1F2M A;  1RCV D;  1KXL A;  4FXK C;  2F0S A;  4QF4 A;  4RHS A;  2VNU D;  4IPG A;  1TY0 A;  2MHV A;  2UXB Q;  3MZ5 A;  1EQV A;  4WFN 3;  1ILQ A;  4QY7 A;  3OSO A;  4DR2 L;  1BKB A;  4KN4 C;  4MIU A;  2K5W A;  4A3B G;  3P75 A;  3GTG H;  4KHZ A;  2KCT A;  4OWX B;  2CFM A;  1LTG D;  2UUA Q;  1L0W A;  1EIG A;  3CCU A;  1XMO Q;  1KAW A;  4HR7 B;  4G7Z C;  2MJ8 A;  3M7G A;  2WP8 J;  4RHR A;  4A76 A;  2A6E C;  3ITP A;  3SK4 A;  2Z4H A;  3WDN A;  3I4M G;  4CKB A;  2HT1 A;  1MSH A;  3AB9 A;  5M3M G;  1C7Y A;  2YTV A;  2C9O A;  4CJ0 B;  3TP8 A;  4X64 Q;  3CXC A;  5HUR A;  4EGV A;  4XYO A;  1O7I A;  1X56 A;  3RZO B;  4WJ4 A;  1VQP A;  1PTO B;  4O1N A;  2K5N A;  1N34 L;  2B2V A;  3CCQ A;  2QCP X;  1KLU D;  1LM0 A;  4NXM L;  4IZ8 A;  2UXD L;  1U0L A;  4QIW E;  3Q0A A;  3RZO H;  1PTO H;  4DUY L;  2EOT A;  1S72 A;  4HSV A;  4B3M L;  3HRZ C;  2UUC Q;  1QUQ A;  2D62 A;  2UUB Q;  5KNB A;  1DM0 B;  1QIL A;  1UE5 A;  2WAQ B;  3MXP A;  5C44 G;  3NQI A;  3PF5 A;  3U4Z A;  2SDF A;  3MHB A;  3OTO L;  1HNX L;  1MIU A;  4XQJ A;  4FF4 A;  4LF4 L;  4IJL A;  1STN A;  1SLJ A;  3KBG A;  1E1O A;  2WAQ G;  1VQL A;  2GVA A;  4OXP A;  4KI0 A;  4XT3 B;  4DK3 C;  2UXB L;  2OTJ A;  4IFD J;  5KYI A;  1A0I A;  4A3M B;  2A6E D;  3J81 j;  5EQ0 A;  3IKJ A;  4A3K G;  1ET9 A;  2RHS B;  3FKI B;  1G6P A;  2RKS A;  3I7F A;  2VS1 A;  1CFM A;  2KCN A;  3CME A;  4OL7 A;  4XQN A;  1GUT A;  5F2D A;  4A3M H;  1KC8 C;  4AIM A;  4JI3 Q;  1XMO L;  3TP6 A;  1HNW Q;  1T9H A;  3FKI H;  3PMF A;  3M7N A;  1KQS A;  3S1N H;  1EYC A;  1B8A A;  1PRT C;  1S5E D;  1I6H B;  3KLS X;  2M2L A;  4RA8 A;  4UHV A;  4B3R Q;  1O80 A;  1KD1 C;  5TSS A;  4RGM A;  3I91 A;  1SE4 A;  5M3F G;  4X64 L;  4HJ8 A;  4EX5 A;  2VQE L;  1Y1W G;  1I6H H;  1JOO A;  1A8V A;  5C0X I;  3WOF A;  4CDD C;  4R4T A;  2IX1 A;  2HQE A;  1QVF A;  1PLF A;  2L1B A;  1W3S A;  5AJ3 L;  5GQO A;  1GOZ A;  1STE A;  1VQ5 A;  1DD2 A;  2WV6 D;  1WD0 A;  4R9W A;  2OCE A;  3QB3 A;  5FO9 B;  2IL8 A;  5COY A;  2NYZ D;  3DEO A;  1SNM A;  5K36 H;  1TWA B;  3DWP A;  2BA0 A;  2E2H B;  1YHA A;  4RG1 A;  2LY7 A;  5IYD H;  4WJ3 M;  1QG7 A;  1TWH B;  4GLV B;  4M1U B;  2WII B;  1SFO B;  1PV4 A;  1CHP D;  1F9S A;  1QE6 A;  1XTD A;  1TWA H;  1BO0 A;  1HQM C;  4A3E B;  2E2H H;  4I65 A;  4A3C H;  2E2I B;  4G7H C;  3PV0 A;  1TWH H;  3AYH B;  3N52 A;  5J39 A;  1PH5 A;  2R3Z A;  1SNC A;  2B8G A;  3CCM A;  1EY6 A;  2RDH A;  1G51 A;  2JA5 B;  2BOS A;  2E2D C;  3KOJ A;  3R2I A;  1GXD C;  5FKA C;  4A3E H;  5C4X G;  3QOL A;  1S40 A;  1BCP F;  1MSG A;  1HHV A;  1IBK Q;  1NBW A;  4ABN A;  4LF6 Q;  1PRT D;  1YJN A;  1I5F A;  5IGF A;  4CJ1 B;  2J7Z A;  5IYC H;  1SYC A;  1Z47 A;  2JA5 G;  2Q2H A;  1O7Y A;  2JYO A;  3JAM E;  5IP7 H;  2NVQ H;  1QVC A;  1HNW L;  5I9O A;  2M00 A;  4A3F B;  2NTT A;  1ASY A;  1S5D D;  2HUG A;  4R4Q A;  1HZB A;  1L1O C;  1MKH A;  2BH2 A;  1BBU A;  4DR7 L;  4O2D A;  2LKV A;  1ENC A;  1GUS A;  2B2U A;  4DNR B;  4A3F H;  4HIO A;  4IOC A;  4MN3 A;  3PIP 3;  3Q23 A;  1JOQ A;  3HKS A;  3MWY W;  3KBX A;  2R7Z G;  1N9W A;  1A15 A;  1XTC D;  3CKI B;  3SDZ A;  5E7N A;  1LLR D;  1ICW A;  4DAM A;  3HOW H;  4G4K A;  5IGD A;  2UXC Q;  4FDB A;  4DNI A;  1K3R A;  1H95 A;  3HOU B;  1C0A A;  1A63 A;  1G29 1;  2IX3 A;  3H3V C;  2BDN A;  1VMP A;  1W6J A;  2EYO A;  5IWA L;  5GAG C;  5EPL A;  3D3R A;  3K5M A;  1F9Q A;  3CCS A;  4DR4 Q;  1PH9 A;  2DJF C;  1KDC A;  3HOU H;  4KHP Q;  1IXR A;  1VQO A;  1PZK D;  4BA1 I;  3J7Z C;  1TS5 A;  3M4Q A;  3OYY A;  5A2Q L;  1DOK A;  4DNT B;  1KL9 A;  1IBK L;  2MO0 A;  2ZJQ A;  2JA9 A;  2NN6 G;  4UPA A;  2AMC B;  1CUK A;  3CF5 A;  2PCF B;  4OO1 G;  3KLS A;  4ZQ3 A;  2N88 A;  1E22 A;  4NXN L;  1LTI D;  1SSO A;  1SDF A;  2Z6B A;  2RQX A;  3RUZ A;  4FF1 A;  3H0G G;  3RR5 A;  1AW7 A;  3K6O A;  1U4R A;  3A7A B;  4YY3 L;  3S24 A;  3FDT A;  1ZYR D;  3NBH A;  5EBD A;  4A3J H;  1PXU A;  2A73 B;  2Q2T A;  5FO7 B;  3Q6S A;  2EQS A;  1NTG A;  1YJ9 A;  2PYK A;  1C9O A;  2EDG A;  3V96 A;  5COR A;  4LFA Q;  3KK7 A;  1W6K A;  1D8L A;  1QZH A;  1WTR A;  1VQ7 A;  2WFW A;  3FPU B;  3I4O A;  2OQK A;  4ZUJ A;  3DM3 A;  2X69 A;  1B7Y B;  4MZ9 A;  1VQA A;  4XXE A;  1P16 A;  5GRO A;  3ERS X;  4DV7 Q;  1I4H A;  2UXC L;  4TSS A;  2H5X A;  1A3T A;  4MNO A;  1VS0 A;  3U58 A;  1BUV T;  4AYB B;  3BU2 A;  2OEO A;  3J7A F;  3CU7 A;  5IGE A;  3ULJ A;  3JAM c;  5LL6 S;  4KKU A;  3CCL A;  5I6W A;  4HCE A;  1FGU A;  3I3C A;  4JOI A;  2QGQ A;  4IUN A;  2N78 A;  5BR8 Q;  2B63 H;  4KHP L;  4LUO A;  4JI5 L;  3U9S A;  5ELO A;  4MTN A;  1PTO F;  3OW7 A;  1X3F A;  1K8A C;  1Y8O B;  3J80 i;  1IBL L;  3T13 A;  2M9V A;  2A68 C;  3DUZ A;  4BY1 B;  3BDL A;  2F1M A;  1E7Z A;  1VQF A;  1D6E C;  4CGY B;  2EYH A;  4GOP A;  4UAI A;  4X3U A;  1J6Q A;  3A5Z B;  3PUY A;  4BY1 G;  3V05 A;  3I73 A;  1D7Q A;  2NVX B;  2WAC A;  1Q90 A;  3RLO A;  1HFN A;  3J7A 5;  4HID A;  5E3F A;  1UE7 A;  2A74 C;  1LYL A;  2VXW A;  3T51 B;  3C2P A;  3ER0 A;  3TEH B;  1JR0 D;  2IHE A;  1XPR A;  4LWC A;  2NVX H;  2K14 A;  5ELB A;  1H9S B;  5JVG 3;  4R8N A;  2PI2 A;  3C1E A;  4CKC A;  5FLM H;  3HKZ B;  4AH6 A;  2FXQ A;  4C3H H;  3E5S A;  3GDE A;  4LFA L;  1EIH A;  4IOA A;  4HIM A;  5JJK A;  1K9M C;  1VQB A;  5IP9 H;  3K5L A;  1CSP A;  1EEI D;  3KLR A;  2LS0 1;  1QOH A;  4QL5 A;  1KTK A;  4DV7 L;  3AMU A;  1STA A;  3NPP A;  2NUC A;  2VB3 X;  3HKZ G;  4EQO A;  4PZ8 A;  4RMF A;  1JB7 A;  3C3L A;  4A75 A;  4F87 A;  2WB1 G;  1STH A;  1K73 C;  3NTK A;  4NPS A;  3G48 A;  1TU2 B;  3MA2 B;  2A68 D;  3ZYY X;  3BYY B;  4P72 A;  1Q82 C;  2B2Y C;  4FXG C;  1R4Q B;  3D6W A;  3V2T A;  4GKJ Q;  4R4C A;  1VQ4 A;  1BCP C;  2MPM A;  1D1I A;  1IBM L;  1RTN A;  4EVO A;  1JJG A;  1M1K C;  1KLG D;  2Z0S A;  2KEE A;  1F9P A;  4APV A;  5T1G A;  2JA7 B;  1ZKO A;  1BR9 A;  4X62 Q;  2K04 A;  4DV4 Q;  1F77 A;  3G6E A;  1HTP A;  1U4L A;  2OXP A;  1Q8K A;  4C2M B;  2AHO B;  5M5W B;  1CQF A;  4N9P A;  5FLX L;  2IT1 A;  5C4H A;  2F3W A;  1YNN D;  4K2K A;  1Y8P B;  2R92 G;  2JA7 G;  1LAB A;  1AE3 A;  1X3E A;  2KHJ A;  5FJ8 H;  4C2M H;  2JEB I;  3URY A;  5M5W H;  4OEM B;  1SAP A;  3D4R A;  1E0B A;  3EA6 A;  4YWM A;  3QWN A;  5JAV A;  2JSO A;  2Q8T A;  3SE0 A;  2GA4 B;  1KNA A;  3PGZ A;  3TBI B;  1DOM A;  3R8B A;  5DLQ E;  2FHT A;  4IFD H;  3CAM A;  3N6R A;  4LFB Q;  3SGI A;  3T1H Q;  3AFP A;  1H9S A;  5JJZ A;  3HOX H;  3PQI A;  2VZA A;  3K58 A;  4BY7 B;  1X3P A;  1XX8 A;  2Q8R E;  4JK1 C;  3TDQ A;  3NK9 A;  4LUV A;  2B2V C;  4DXG A;  4LMQ D;  3H91 A;  3EVQ A;  3I72 A;  1RD9 D;  1NAP A;  2K05 A;  2NZO A;  3HOV B;  1PDQ A;  1WVL A;  3JC6 6;  3KJP A;  4FP5 D;  4DR2 Q;  4DK0 A;  3S17 B;  4BY7 G;  2EXD A;  5EBC A;  5EPK A;  3S1M B;  1CZW A;  5I6Y A;  3P20 A;  4R4O A;  1A3V A;  2MNA A;  3DMU A;  1SN8 A;  1HA5 A;  3S17 H;  3T4A C;  4OIJ A;  3HOV G;  1SJE D;  2VUM H;  4XTC S;  2ZXP A;  3K81 C;  2E75 C;  1VQ8 A;  1ASZ A;  4POF A;  4B9X A;  1PH4 A;  4X62 L;  2LFN A;  4MHE A;  4JI8 L;  4DV4 L;  1N33 Q;  2K5Q A;  4KJN A;  3BS1 A;  2EYJ A;  1V1Q A;  2F0L A;  4JPB W;  4DAP A;  5M5Y H;  3OW2 A;  1R9T H;  4PMW A;  1YIJ A;  4XYQ A;  3PO3 H;  1VQM A;  2CWA A;  5D3D A;  2K75 A;  2G9H D;  2CVR A;  2FMC A;  1LAC A;  2XWB B;  1S3O A;  1PA6 A;  4B3M Q;  2JA6 G;  4UY8 C;  4LF8 L;  3FHW A;  2HQL A;  1QZG A;  2VW9 A;  1HH2 P;  3A5U A;  4JI0 L;  2F0G A;  3U4V A;  3SK6 A;  3T56 B;  4LFB L;  1FVI A;  2JN4 A;  1STG A;  3NEN A;  2CH4 A;  5M9O A;  2ZXR A;  3F2D A;  1HNX Q;  4O42 A;  1SRO A;  1FR3 A;  2KJX A;  2N8N A;  4N8X 1;  4A3B B;  1X55 A;  1KAB A;  4UP9 A;  1HR0 Q;  1JB3 A;  4K0K L;  4JC0 A;  5HGT A;  2IY5 B;  2K50 A;  3CPF A;  3IRB A;  1I3Q B;  2PQE A;  2RF4 A;  3S1Q B;  1HZA A;  2L15 A;  4A3B H;  4GNX B;  2F0M A;  4QGU A;  1VQJ A;  4ULL A;  1IHZ A;  3I4M B;  5M3M B;  3S1Q H;  3CC4 A;  2SNM A;  2AQ2 B;  2FJ2 A;  1WCM G;  3BVM A;  3I4M H;  4QCL A;  3K5N A;  1TY2 A;  3KDF B;  1M4V A;  5EJW A;  3VDY A;  4YHH Q;  5M3M H;  2NVT B;  3FRP B;  1W2B A;  1CQV A;  3GTP B;  1VQD A;  1OXV A;  4G57 A;  3KFU A;  4R8I A;  1N33 L;  1N32 Q;  1UNS A;  1LT6 D;  2VQE Q;  4GKK Q;  4BS9 A;  2NVT H;  2KVM A;  1UE6 A;  2PI2 E;  5C3E G;  3GTP H;  2K7V A;  2B39 A;  1E3P A;  1O7L A;  5C3X A;  2ZM6 Q;  2PPB C;  5AJ3 Q;  5IOC A;  2YTX A;  2RHQ B;  4ZKB B;  5A2Q E;  5IYB G;  4LNQ A;  4HN7 A;  1GVP A;  1M8A A;  1L0X B;  3NWT A;  5C44 B;  1NMG A;  3NTH A;  5IGB A;  3PIP A;  4HTH A;  4EQN A;  3DXJ C;  4HMJ A;  1HZC A;  4TQU S;  5CV4 A;  5C44 H;  2WKD A;  1SXT A;  4J8Q A;  4JCV E;  3OPO A;  3W1B A;  4L6T B;  5E4W C;  2D5D A;  1B70 B;  2B2U C;  1VQK A;  4JBK A;  4JI2 L;  1OXX K;  1P8L A;  1JOK A;  1EWI A;  2F0H A;  5IOD A;  3S9W A;  4OWT B;  2IW3 A;  4AYB E;  1XYI A;  4A3K B;  2Y0S E;  1KIX A;  5BN5 A;  5LMU L;  3KF6 A;  1IW7 C;  5AFW A;  1HR0 L;  3E3X A;  1GUG A;  1EYD A;  5G3L F;  2QDB A;  1SNQ A;  5ELF A;  1VQG A;  3BZK A;  1WJJ A;  1Y69 U;  4FNF A;  4A3K H;  2F0D A;  4IUR A;  1I4G A;  2F52 A;  1NUC A;  1MBY A;  2QEJ C;  3E0J A;  3P1H A;  5C0X G;  4A3D G;  2I07 B;  2Z9H A;  1VQC A;  1XMQ Q;  1HJP A;  2B29 A;  3OIP A;  4PMB A;  1M90 C;  4UP7 A;  5D14 A;  4KY5 A;  5T1I A;  1FNU A;  4ZKC B;  5M3F B;  3G6J B;  1Y1W B;  3DWA A;  4ID6 A;  4GS3 A;  5CR3 A;  1TII D;  3P7J A;  4YHH L;  1B4O A;  4DR7 Q;  1BBX C;  5M3F H;  1ESF A;  4ILW A;  2PZU A;  3AFQ A;  1Y1W H;  1N32 L;  2F0U A;  1RHP A;  4DV2 Q;  1EY0 A;  1SR3 A;  2MFI A;  4GKK L;  3HG9 A;  3CPW A;  3KDF A;  1SMY C;  1L2F A;  1YEZ A;  4DV3 Q;  3GD7 A;  4KK7 A;  2XIW A;  4AQY L;  2ZM6 L;  4QUF A;  2D2C C;  1WTO A;  1GD7 A;  3GQB A;  3KLW A;  4A3L G;  1I4Q A;  3K0X A;  3NUC A;  4NW2 A;  3MXN B;  2TMP A;  5C5L A;  1O78 A;  3CQZ B;  3HKZ E;  3OWF A;  2A1A A;  2E8G A;  2Q2U A;  5IWA Q;  5JPM C;  2XN9 C;  4QQB X;  2WIN B;  1SNP A;  1TWC B;  3CCJ A;  1YNJ C;  1CSQ A;  1V1O A;  1HNZ L;  2K03 A;  1TWF B;  4KY7 A;  2E76 C;  3H6M A;  3RNU A;  3CQZ H;  5C4X B;  3TN2 A;  4XQQ A;  3PIO A;  1TWC H;  3NSW A;  1TWF H;  2CW0 C;  1SFO H;  1PRT B;  5C4X H;  5ELD A;  5C4Z A;  1JMC A;  3S2H B;  2E2I H;  3RLF A;  4G7O C;  1NR2 A;  4PZ7 A;  1DJR D;  5CMD A;  4PNY A;  1MJE A;  1WYD A;  3O13 A;  3A8I E;  5CBE E;  2JA5 H;  4J1M A;  4QUC A;  2EYM A;  1K0R A;  1FJG Q;  4NXN Q;  3S2H H;  1XMQ L;  4K14 A;  4L5T A;  1UEB A;  4C3J B;  3K57 A;  1SMY D;  2R7Z B;  4DFA A;  1LTS D;  3UDF A;  4YY3 Q;  1CKN B;  5I4D A;  1J9O A;  4O0A A;  2JEA I;  5ELN A;  1KRS A;  4C3J G;  2R7Z H;  4B3S L;  1BOS A;  4RGO S;  4DV2 L;  2B2W C;  1YI2 A;  4A3G B;  4DV3 L;  1TS3 A;  4P2C B;  1CKM A;  1UUP A;  4IJH A;  4A93 B;  4GOP C;  1EOV A;  4RGT A;  1YNJ D;  2GN5 A;  1LTR D;  1SYF A;  2C35 B;  4TKO B;  5DAU A;  1X6O A;  4A3G G;  4ZLT F;  4JV5 Q;  3HOY B;  1LT4 D;  4KMU C;  2D9U A;  5FLX E;  1A6X A;  4A93 G;  1GHJ A;  4KKT A;  4BBR B;  5HY6 A;  3A54 A;  1CKO A;  1Y1V B;  4F88 A;  1TS2 A;  4DR3 L;  3VR6 A;  4JI5 Q;  3BYT B;  3MXN A;  2Q8I B;  3X3M A;  1I50 B;  2G5D A;  3HOY G;  1T5E A;  1H9R A;  4YCV A;  2V4D A;  1E1T A;  4DV6 Q;  2ZJP A;  1AH9 A;  2K28 A;  1H9M A;  4P74 A;  1IBL Q;  1OXT A;  4BBR G;  2ALY B;  2UU9 L;  5JEA G;  4LF5 L;  1Y1V G;  4R1J A;  1OTC A;  1L1O B;  1I50 H;  5JVH 3;  2EE1 A;  1BXT A;  2O2L D;  3PUV A;  3IFD A;  2OF1 A;  3BZC A;  2K5V A;  2NN6 H;  3H0G B;  4HMI A;  3I2Z A;  4OO1 H;  3TP7 A;  3T16 A;  1FJG L;  5E4X A;  3M4O B;  2EPB A;  3H0G H;  2AUK A;  1I94 L;  4C1N I;  2FMM A;  2OWO A;  1EIF A;  2F3V A;  2HDM A;  2X6G A;  5NUC A;  4JI4 L;  5IIF A;  3PO2 G;  1ZXT A;  1E24 A;  2DNC A;  1E2V A;  5C0X J;  2ATW A;  4KHV A;  4NDX A;  1BF4 A;  1PH2 A;  3TME A;  4B08 A;  1B50 A;  1QWY A;  1CKN A;  2SNS A;  3LGJ A;  1U4M A;  2MP1 A;  3J81 L;  3C1F A;  3W1G A;  3H3V H;  4RKB A;  4KTA A;  2L9H A;  2BH8 A;  1WTV A;  5GAD C;  2E5L Q;  5HGQ A;  1E2W A;  4KJO A;  3HEJ A;  3U9O A;  3PIO 3;  3B6Y A;  2AQ3 B;  1XNQ Q;  1TKW B;  5BN3 A;  1STB A;  3ICE A;  2R7D A;  1PFM A;  1V43 A;  3A8K E;  4JV5 L;  5JPN C;  3J80 L;  1D5X C;  4LAA A;  4L5R C;  2F0I A;  3HOZ G;  2K6A A;  1XJV A;  2JQO A;  5DNF A;  2NWG A;  1LTA D;  4DA2 A;  2LXK A;  1LTL A;  4X6A H;  1IBM Q;  5LHY 1;  4DV6 L;  5C5M A;  1EUJ A;  3RN2 A;  1VF7 A;  3T1Y Q;  3VYS A;  1SRU A;  2MO1 A;  2NTS A;  2DY8 A;  4K5W A;  1UEA B;  3A56 A;  2E2J B;  1IKM A;  1PFN A;  1EY8 A;  1PH7 A;  1G2T A;  1JWU D;  4LF7 Q;  3ERO A;  2KEN A;  1EZ8 A;  4BY1 H;  1HUM A;  1SJH D;  1CHQ D;  2CKZ B;  5IGC A;  1L1O A;  1J5E L;  2E2J H;  4KV6 A;  3QR8 A;  3QOJ A;  5FLX c;  3SVM A;  1VQ9 A;  1GKH A;  2QKI C;  1WI5 A;  1HQR D;  4BXX G;  5CV6 A;  1EQT A;  1SYB A;  3ERQ A;  2OTL A;  2EY5 A;  3EIV A;  4H13 C;  1HA6 A;  5FK9 C;  2ICI A;  3T53 B;  3FEW X;  2F3I A;  1EFW A;  2EJM A;  4DAY B;  2PQA B;  2A19 A;  3BVG A;  4FXD A;  5CGK A;  1TR5 A;  2WB1 B;  5IT9 L;  4IN3 A;  1AZP A;  4HAE A;  4ZRZ A;  3I90 A;  1JOR A;  5K5P A;  1EY7 A;  1SE2 A;  2E5L L;  4DK1 A;  4JI7 Q;  2CQO A;  5BN4 A;  4IPC A;  1XNQ L;  5I9P A;  1WTH A;  3KYH C;  2JA8 B;  1TWG B;  4BBS G;  2WAQ E;  2EY6 A;  2F0E A;  2KED A;  2ZT9 C;  3S15 B;  2DGY A;  1II3 A;  2EVB A;  4JI1 Q;  2IHF A;  3K80 C;  3BVZ A;  2K52 A;  2SEB D;  3S2D B;  2QF7 A;  1YZ6 A;  1TWG H;  1EEF D;  1EZ6 A;  3L0O A;  3STB C;  3GV3 A;  2JA8 G;  1AP0 A;  2I5M X;  1B53 A;  1G91 A;  3UI2 A;  1CA5 A;  4N9T A;  5CV9 A;  2VY3 A;  4YCW A;  4DPG A;  3OWE B;  1JWS D;  3DEP A;  1FNV A;  3S2D H;  3NBI A;  1AE2 A;  1YNX A;  2AKW B;  3QIA A;  4B9W A;  5LMN W;  3T1Y L;  2R92 B;  1K0S A;  1XNR Q;  1QVG A;  3NP8 A;  4JI8 Q;  3W2D A;  3A74 A;  3R93 A;  1UAP A;  2KUM A;  3ZJY C;  1S5C D;  4CDF C;  3D8G A;  1U5K A;  1H9K A;  3JAM i;  5IE8 A;  4LF7 L;  3G71 A;  2L0C A;  2R92 H;  1X3G A;  2JA7 H;  3OHX C;  2BE5 C;  3D4W A;  5JEA J;  3RZD B;  5KND A;  2F0Q A;  3GV6 A;  4UP8 A;  1PVO A;  1GUN A;  3GTL B;  1ZEQ X;  4X65 L;  1DXM A;  4LF9 Q;  2FIN B;  4LF8 Q;  1Q1B A;  3CCE A;  1JQY D;  2DJG C;  3K8A A;  1PRT F;  1I6V C;  2A6H C;  1WD1 A;  1Q8I A;  2PW5 A;  2EYP A;  2LSS A;  3TS0 A;  4JI0 Q;  4DF7 A;  4DAV A;  1QCB D;  3BZD B;  4DKA C;  1HPC A;  1X54 A;  3I8Z A;  4ME3 A;  1BCP B;  4OEL B;  2YU9 B;  3SK8 A;  1WOC A;  1Z7T A;  4DGZ A;  4K0K Q;  4JI7 L;  3GTO B;  3STB D;  1TQO A;  1EU4 A;  4XIG S;  4Z9C B;  1BCP D;  1X32 A;  1JT8 A;  2F0V A;  1ENF A;  3ND8 A;  1OXS C;  2PW7 A;  3GO5 A;  1YVC A;  2YU9 H;  1HTL D;  4BY7 H;  4LK1 C;  2LMC B;  1GHK A;  1SYE A;  4FF3 A;  3ULP A;  3GTO H;  1BBW A;  1JC7 A;  4N8F A;  4JI1 L;  5IGG A;  3FPP A;  1MI2 A;  1NNX A;  1VQH A;  5ELC A;  3HOV H;  3PF4 A;  5KRU A;  2I46 A;  5A35 A;  3RLN A;  1UE1 A;  4C1N K;  4CJ2 C;  2A5H A;  4K2L A;  4K8I A;  3TP5 A;  4FF2 A;  3HZX A;  3S1M H;  3Q8D A;  4KKS A;  2ASB A;  4KN7 C;  2BE5 D;  3SEB A;  5LL6 X;  3PSI A;  2CQA A;  1EY5 A;  1GJX A;  4CBV A;  2HIV A;  1DON A;  1XNR L;  5CV8 A;  3M85 A;  1N36 L;  3CCV A;  1X3Q A;  4RCN A;  1PYS B;  2NVY B;  3KUP A;  4MTK A;  4XT1 B;  1G6Z A;  4IFD I;  4M8A A;  1FD7 D;  5CV7 A;  5FO8 B;  4L8J A;  2JA6 B;  1YHB A;  4OX9 Q;  2A6H D;  4A3I B;  4RFB A;  1VMC A;  2RBM A;  2NVY H;  4PG3 A;  2JK8 A;  2L5T A;  3EBE A;  1FYC A;  2PMZ B;  3K59 A;  1D5M C;  2JA6 H;  2IJ0 A;  4QMG A;  4LFC Q;  4LF9 L;  2VB2 X;  3MEH A;  3AEV A;  2KCC A;  2N55 A;  4A3I G;  4TVA B;  2J0T D;  3MC0 B;  2R93 G;  4YWK A;  2O5J C;  1QUQ B;  2JE6 I;  1C4Q A;  3K7A B;  4JI2 Q;  4DR6 Q;  2IPK D;  1RTO A;  1S5B D;  1ESR A;  3L2P A;  4PV1 C;  3NQT A;  1VQE A;  4I7Z C;  1NSN S;  3AU7 A;  4C3I B;  1QNU A;  5LMU Q;  5I2Y A;  3CC2 A;  4LW1 A;  2RVL A;  2JP1 A;  1U9R A;  2OQ0 A;  1IYU A;  1GUW A;  2RSN A;  5GAH C;  5JJL A;  4HJ5 A;  4IUV A;  1SYD A;  1Y8N B;  1WCM B;  2EY2 A;  2L55 A;  2HCI A;  2L4N A;  1PTO C;  3LNN A;  2F4V L;  4C3I G;  1FL0 A;  4YIJ A;  2E74 C;  1I3Q H;  1K28 A;  1F2L A;  1WCM H;  1UWV A;  2HIX A;  2F0O A;  2O4X A;  3GTG B;  2Z4I A;  3EJI A;  5C3E B;  1N8R C;  4KD3 A;  1WTP A;  1EL0 A;  1XXG A;  3DM1 A;  1Q46 A;  5C4J B;  1KDA A;  4TRD A;  4FVM A;  1X9N A;  2XVS A;  4LUZ A;  1TT2 A;  4JBW A;  1B44 D;  1GUO A;  5C3E H;  1IYJ B;  4HSP A;  5DM6 3;  5EGT A;  5KNC A;  1NJI C;  2QDL A;  1EY9 A;  1PZJ D;  3W5O A;  3MFG A;  1KNE A;  5C4J H;  4JW0 A;  3DWQ A;  4P73 A;  4AQY Q;  4OX9 L;  1I4P A;  5IYB H;  3NEL A;  1RL2 A;  3KJO A;  1LTT D;  2I5H A;  4JI6 Q;  4HCS A;  2X6L A;  3EQL C;  1B1Z A;  4LFC L;  4B3T Q;  4HED A;  3CCR A;  3F2B A;  5EKL A;  2N49 A;  3VYR A;  1GO3 E;  2Z6K A;  1CM9 A;  1XWE A;  3J7Y W;  1HNZ Q;  4K6L A;  1RF2 D;  3CHB D;  4Q5V A;  5IY0 A;  1EFI D;  1PZI D;  1BDO A;  2L11 A;  1B9M A;  2Q2I A;  4HJ9 A;  4ME5 A;  2DN8 A;  4DR6 L;  2K5D A;  1PTO D;  4X3S A;  1PHJ A;  3VA5 A;  1PFB A;  4ZYS A;  1RJT A;  3FP9 A;  3NWS A;  1ET6 A;  4CDE C;  5C6A A;  3BDC A;  2GVB A;  4JVZ A;  1CT1 D;  3F2C A;  4A3D B;  4WRD A;  1YHQ A;  3HFZ B;  4PQX A;  2HCC A;  1AEX A;  3M4Y A;  5C0X H;  3J81 E;  4A3D H;  1ICF B;  3CRK C;  5J3B A;  2QW7 A;  4GN5 A;  2XWJ B;  4GNX A;  3GTK B;  1FNW A;  1HUN A;  2EJG C;  1CK1 A;  3J80 E;  4IUP A;  3X3N A;  1TS4 A;  4RGN A;  4HJ7 A;  1K8O A;  2EYL A;  3I70 A;  1NY4 A;  1HFG A;  4B3S Q;  3S1N B;  3GTK H;  1VQ6 A;  4DV0 Q;  1PH8 A;  2UUA L;  5J22 A;  1EYG A;  3WWV A;  4A3M G;  4GN4 B;  1D2B A;  1S4Z A;  4J15 A;  2AWO A;  3OOC A;  1C48 A;  1WTW A;  3VR3 A;  2RDF A;  3FKI G;  4A3L H;  4GN3 B;  2B2T A;  1NMF A;  2PZW A;  4JI6 L;  2K01 A;  2DY7 A;  1JWM D;  5M5X B;  3FVQ A;  1BVS A;  4B3T L;  4WJW A;  3S14 B;  1RKN A;  2WB1 E;  1IW7 D;  1AFP A;  3EFX D;  3F1Z A;  2BDO A;  4J6H A;  3VR5 A;  4DXF A;  4H44 C;  5JOB A;  5M5X H;  4IO9 A;  4DR3 Q;  2PNH A;  2R7F A;  1V8Q A;  4JYA Q;  3PUZ A;  4XDX A;  2F4I A;  2KHI A;  3S14 H;  4F7X A;  3IFT A;  4NKL A;  1Q86 C;  3SXH A;  1NR4 A;  4QJF A;  1MGS A;  2UU9 Q;  1OO9 B;  2UUC L;  4LF5 Q;  2F0J A;  2AWN A;  4POG A;  2UUB L;  1U4P A;  5K36 G;  3M3Y B; 
#chains in the Genus database with same CATH homology
 4RWS C;  4IQZ A;  2EXZ A;  5IT9 E;  1F9R A;  1IKL A;  4CKE A;  3A7L A;  4FYD A;  4S3S A;  1R4P B;  2WKC A;  1I4X A;  2KA7 A;  2FFK B;  1WTQ A;  2H1E A;  5EPJ A;  3GTJ B;  4PMC A;  2NVQ B;  1B2T A;  1KDB A;  2EYF A;  3PUW A;  3L7Z C;  2NZ1 D;  3BDO A;  3HGB A;  5CV5 A;  1AN8 A;  1IL8 A;  1NCV A;  2PNR C;  4X3K A;  2J4X A;  1LTB D;  5EKK A;  2F0T A;  5FOB B;  2F03 A;  3QG1 A;  1EWC A;  2AQ1 B;  1SYG A;  1EU3 A;  1ONL A;  2H4O A;  1L0Y B;  2ID0 A;  2BA1 A;  4K6D A;  2AUJ D;  3HOW B;  3RD4 A;  2CW0 D;  2NBF A;  1HCZ A;  1ZYR C;  4OGQ C;  1D1K A;  1LO5 D;  4RH6 A;  3MXG A;  3R3O A;  4ODG A;  4K8J A;  3IAY A;  4V19 0;  5E1F A;  4OHJ A;  5KEE A;  5JEA H;  2XSC A;  4OIK A;  1RDP D;  1CI3 M;  1EY4 A;  2HDL A;  1LT3 D;  2IWH A;  1CZG A;  4ZUI A;  3PO2 B;  3VA7 A;  5D3I B;  5KYL A;  4KY6 A;  4U68 A;  1AZQ A;  3H94 A;  3E6Z X;  1SBB B;  1SE3 A;  2BCO A;  3DHQ A;  3G7L A;  3WOE A;  1IYV A;  2KQ3 A;  4V0B A;  1B3A A;  2JXM B;  3D31 A;  2NB0 A;  4UDU C;  1ML0 D;  2MUY A;  4A3J B;  1A2U A;  4BA2 I;  2F0P A;  3K5O A;  5D65 A;  5I2X A;  1CA6 A;  3HOZ B;  5KGU A;  4QIW B;  3W3A A;  1SND A;  3OIQ A;  2NN6 I;  4FO2 A;  4K5X A;  3FMC A;  3KF8 A;  3D6C A;  4OO1 I;  2K32 A;  3LWE A;  4C56 C;  2A69 C;  2EJF C;  1BNZ A;  4NMZ A;  4E6I A;  1K8M A;  2ZXO A;  3HS0 C;  1QB5 D;  3LX0 A;  1EOT A;  5CYU A;  2B63 B;  1HXY D;  2Y0S B;  2EZV A;  3BG3 A;  2XRQ D;  4RKL A;  3S16 B;  2RA4 A;  5EKI A;  1STY A;  4IUQ A;  5KIX A;  2R61 A;  1PYW D;  3OMC A;  2K1B A;  2ENB A;  1EWH A;  1DYQ A;  3A8J E;  2F0F A;  4WOR A;  4CHT B;  3C46 A;  5J1Z A;  2B2W A;  1WTX A;  1CTM A;  4F8M A;  1T5X D;  1TVX A;  2Z1C A;  5DM7 3;  3Q24 A;  1VDZ A;  5ISR A;  2QIL A;  3PUX A;  1EYA A;  3J7A V;  4IUT A;  4BBS B;  1A3U A;  2TSS A;  4IUU A;  4U67 3;  2A69 D;  1MD2 D;  5ELE A;  1VF5 C;  4C3H B;  1V1P B;  3NXW A;  1J8I A;  5G3L D;  1ROD A;  1YNN C;  1S5F D;  3L9A X;  4H7B A;  3A55 A;  1ILP A;  4Q0F A;  1Z6H A;  4C3H G;  1C8C A;  1QJO A;  4ZAI A;  1E2Z A;  3JAM L;  1LV9 A;  1HRJ A;  3I4L A;  3L3O C;  3MVV A;  3SHL A;  1VCI A;  2R6G A;  1SEB D;  1Q12 A;  5DEH A;  3S1R B;  2Z8L A;  4ZK9 B;  2O5I C;  3HP3 A;  3GP7 A;  2K33 A;  3SK5 A;  1Q1E A;  2OT2 A;  5CC4 A;  1JE4 A;  4X3T A;  4LJZ C;  3TZD A;  1KAA A;  3OMG A;  1LT5 D;  2SOB A;  3LWU A;  4IAL A;  3MXU A;  2XNA C;  3NHH A;  5CBA E;  3Q22 A;  3CRL C;  3QJY A;  1DCZ A;  3VYT A;  1B9N A;  4DAY A;  1H9J A;  3MAQ A;  2KHS A;  1A2T A;  2RSO A;  4DU9 A;  4RAU C;  1OXU A;  2PZT A;  2L12 A;  4GZY C;  3HOX B;  2XRS D;  3MTS A;  4IFD G;  2G9D A;  1V1P A;  5C3W A;  1JIC A;  1SNO A;  1DOL A;  4Y7N B;  2F0K A;  4BWG B;  2EY1 A;  1D5Z C;  3NE5 B;  2DNE A;  3IL8 A;  2VUM B;  3D4D A;  2F0N A;  3GTM B;  3RMH A;  3SR1 A;  4QB4 A;  2F0W A;  1JCK B;  1I4R A;  3QO2 A;  2RDG A;  2IX0 A;  3TZU A;  4NP5 A;  2R93 B;  3MFY A;  5M5Y B;  1R9T B;  3ND9 A;  1F2Z A;  3ONA B;  3PO3 B;  1BQQ T;  1K83 B;  2C5C A;  3TSS A;  4RCO A;  1QNK A;  1G8Z D;  2YYZ A;  1Q3L A;  4K5V A;  2MGS A;  3GTQ B;  2CHB D;  2ICE C;  3VR2 A;  3I4N B;  4DN4 M;  4EQP A;  3VYU A;  3VR4 A;  3H09 A;  2KOL A;  4L63 B;  2PO4 A;  2B2Y A;  2B2T C;  4KD4 A;  1PMR A;  1DZ1 A;  1FGB D;  3NTI A;  3R2T A;  1F2Y A;  3K0Y A;  1O7Z A;  1ENA A;  4H0L C;  2B8F A;  1G2S A;  3F2U A;  2KEC A;  1F2M A;  1RCV D;  4FXK C;  2F0S A;  4QF4 A;  4RHS A;  2VNU D;  1TY0 A;  2MHV A;  3MZ5 A;  1EQV A;  4WFN 3;  1ILQ A;  3OSO A;  4KN4 C;  4MIU A;  2K5W A;  3P75 A;  4KHZ A;  1LTG D;  1EIG A;  4HR7 B;  4G7Z C;  2MJ8 A;  3M7G A;  2WP8 J;  4RHR A;  2A6E C;  3ITP A;  3SK4 A;  2Z4H A;  3WDN A;  4CKB A;  1MSH A;  3AB9 A;  2C9O A;  4CJ0 B;  3TP8 A;  5HUR A;  4EGV A;  4XYO A;  3RZO B;  1PTO B;  4O1N A;  2B2V A;  2QCP X;  1KLU D;  4IZ8 A;  3Q0A A;  1PTO H;  2EOT A;  4HSV A;  3HRZ C;  2D62 A;  5KNB A;  1DM0 B;  1QIL A;  2WAQ B;  3MXP A;  3NQI A;  2SDF A;  3MHB A;  4XQJ A;  4FF4 A;  1STN A;  3KBG A;  4KI0 A;  4XT3 B;  4IFD J;  5KYI A;  4A3M B;  2A6E D;  5EQ0 A;  3IKJ A;  1ET9 A;  3FKI B;  2RKS A;  1CFM A;  2KCN A;  4OL7 A;  4XQN A;  1GUT A;  5F2D A;  3TP6 A;  3PMF A;  3M7N A;  1EYC A;  1PRT C;  1S5E D;  1I6H B;  3KLS X;  2M2L A;  4RA8 A;  1O80 A;  5TSS A;  4RGM A;  3I91 A;  1SE4 A;  1JOO A;  5C0X I;  3WOF A;  2IX1 A;  2HQE A;  1PLF A;  2L1B A;  1GOZ A;  1STE A;  1DD2 A;  2WV6 D;  1WD0 A;  4R9W A;  3QB3 A;  5FO9 B;  2IL8 A;  5COY A;  2NYZ D;  3DEO A;  1SNM A;  5K36 H;  1TWA B;  3DWP A;  2BA0 A;  2E2H B;  2LY7 A;  1QG7 A;  1TWH B;  4M1U B;  2WII B;  1SFO B;  1CHP D;  1F9S A;  1QE6 A;  1BO0 A;  1HQM C;  4A3E B;  4I65 A;  2E2I B;  4G7H C;  3PV0 A;  3N52 A;  5J39 A;  2R3Z A;  1SNC A;  2B8G A;  1EY6 A;  2RDH A;  2JA5 B;  2BOS A;  2E2D C;  3R2I A;  1GXD C;  5FKA C;  3QOL A;  1BCP F;  1MSG A;  1HHV A;  4ABN A;  1PRT D;  5IGF A;  4CJ1 B;  2J7Z A;  1SYC A;  1Z47 A;  1O7Y A;  2JYO A;  3JAM E;  5I9O A;  2M00 A;  4A3F B;  2NTT A;  1S5D D;  2HUG A;  2LKV A;  1ENC A;  1GUS A;  2B2U A;  4DNR B;  4MN3 A;  3PIP 3;  3Q23 A;  1JOQ A;  3MWY W;  3KBX A;  1A15 A;  1XTC D;  3CKI B;  3SDZ A;  1LLR D;  1ICW A;  4G4K A;  5IGD A;  3HOU B;  1G29 1;  2IX3 A;  3H3V C;  2BDN A;  1VMP A;  1W6J A;  2EYO A;  5EPL A;  3D3R A;  3K5M A;  1F9Q A;  1KDC A;  1PZK D;  4BA1 I;  1TS5 A;  5A2Q L;  1DOK A;  4DNT B;  2NN6 G;  4OO1 G;  2PCF B;  3KLS A;  4ZQ3 A;  2N88 A;  1LTI D;  1SSO A;  1SDF A;  2RQX A;  3RUZ A;  4FF1 A;  1AW7 A;  3K6O A;  1U4R A;  3A7A B;  3FDT A;  1ZYR D;  3NBH A;  5EBD A;  1PXU A;  2A73 B;  5FO7 B;  3Q6S A;  2PYK A;  2EDG A;  3V96 A;  5COR A;  3KK7 A;  1W6K A;  1WTR A;  3FPU B;  4ZUJ A;  2X69 A;  4XXE A;  1I4H A;  4TSS A;  1A3T A;  1BUV T;  4AYB B;  2OEO A;  3J7A F;  3CU7 A;  5IGE A;  5LL6 S;  4KKU A;  5I6W A;  4HCE A;  3I3C A;  4IUN A;  3U9S A;  1PTO F;  3OW7 A;  1Y8O B;  3T13 A;  2M9V A;  2A68 C;  3DUZ A;  4BY1 B;  3BDL A;  2F1M A;  1D6E C;  4CGY B;  2EYH A;  4UAI A;  4X3U A;  3PUY A;  3V05 A;  3I73 A;  2NVX B;  2WAC A;  1Q90 A;  1HFN A;  5E3F A;  2A74 C;  3T51 B;  2VXW A;  3C2P A;  1JR0 D;  5ELB A;  1H9S B;  5JVG 3;  4R8N A;  3C1E A;  4CKC A;  3HKZ B;  3E5S A;  1EIH A;  3K5L A;  1EEI D;  3KLR A;  2LS0 1;  1QOH A;  1KTK A;  3AMU A;  1STA A;  2NUC A;  3NPP A;  2VB3 X;  4EQO A;  3C3L A;  4F87 A;  1STH A;  3NTK A;  1TU2 B;  3MA2 B;  2A68 D;  3ZYY X;  3BYY B;  2B2Y C;  4FXG C;  1R4Q B;  3D6W A;  3V2T A;  1BCP C;  2MPM A;  1D1I A;  1RTN A;  4EVO A;  1KLG D;  2KEE A;  1F9P A;  5T1G A;  2JA7 B;  1ZKO A;  1BR9 A;  2K04 A;  1F77 A;  1HTP A;  1U4L A;  2OXP A;  4C2M B;  5M5W B;  1CQF A;  4N9P A;  5FLX L;  2IT1 A;  5C4H A;  2F3W A;  1YNN D;  4K2K A;  1Y8P B;  1LAB A;  2JEB I;  3URY A;  1SAP A;  3D4R A;  1E0B A;  3EA6 A;  3QWN A;  5JAV A;  2JSO A;  2Q8T A;  3SE0 A;  2GA4 B;  1KNA A;  3TBI B;  1DOM A;  3R8B A;  2FHT A;  4IFD H;  3N6R A;  1H9S A;  5JJZ A;  3K58 A;  4BY7 B;  1X3P A;  1XX8 A;  2Q8R E;  4JK1 C;  3TDQ A;  3NK9 A;  2B2V C;  4DXG A;  4LMQ D;  3H91 A;  3EVQ A;  3I72 A;  1RD9 D;  1NAP A;  2K05 A;  3HOV B;  1PDQ A;  1WVL A;  4FP5 D;  3S17 B;  4DK0 A;  5EPK A;  5EBC A;  3S1M B;  1CZW A;  5I6Y A;  3P20 A;  1A3V A;  3DMU A;  1HA5 A;  3T4A C;  4OIJ A;  1SJE D;  4XTC S;  2ZXP A;  2E75 C;  4B9X A;  2LFN A;  4MHE A;  2K5Q A;  4KJN A;  3BS1 A;  2EYJ A;  2F0L A;  4DAP A;  4PMW A;  4XYQ A;  5D3D A;  2G9H D;  2CVR A;  2FMC A;  1LAC A;  2XWB B;  2F0G A;  3SK6 A;  3T56 B;  1STG A;  5M9O A;  2ZXR A;  4O42 A;  1FR3 A;  2KJX A;  4A3B B;  1KAB A;  1JB3 A;  5HGT A;  1I3Q B;  2PQE A;  3S1Q B;  2F0M A;  4ULL A;  1IHZ A;  3I4M B;  5M3M B;  2SNM A;  2AQ2 B;  2FJ2 A;  3BVM A;  4QCL A;  3K5N A;  1TY2 A;  1M4V A;  5EJW A;  2NVT B;  3FRP B;  1CQV A;  3GTP B;  1OXV A;  4G57 A;  4R8I A;  1UNS A;  1LT6 D;  4BS9 A;  2KVM A;  2K7V A;  2B39 A;  1O7L A;  5C3X A;  2PPB C;  5IOC A;  4ZKB B;  5A2Q E;  4HN7 A;  1M8A A;  1L0X B;  3NWT A;  5C44 B;  3NTH A;  5IGB A;  4HTH A;  4EQN A;  3DXJ C;  4HMJ A;  4TQU S;  5CV4 A;  2WKD A;  1SXT A;  4J8Q A;  3OPO A;  4L6T B;  5E4W C;  2D5D A;  2B2U C;  1OXX K;  2F0H A;  1JOK A;  5IOD A;  3S9W A;  2IW3 A;  1XYI A;  4A3K B;  5BN5 A;  1IW7 C;  5AFW A;  1GUG A;  1EYD A;  5G3L F;  2QDB A;  1SNQ A;  5ELF A;  1Y69 U;  4FNF A;  2F0D A;  4IUR A;  1I4G A;  1NUC A;  1MBY A;  2QEJ C;  3E0J A;  3P1H A;  5C0X G;  2I07 B;  4PMB A;  3OIP A;  5D14 A;  4KY5 A;  5T1I A;  1FNU A;  4ZKC B;  5M3F B;  3G6J B;  1Y1W B;  3DWA A;  4ID6 A;  5CR3 A;  1TII D;  3P7J A;  1B4O A;  1BBX C;  1ESF A;  4ILW A;  2PZU A;  2F0U A;  1RHP A;  1EY0 A;  3HG9 A;  1SMY C;  3GD7 A;  4KK7 A;  2XIW A;  4QUF A;  2D2C C;  1WTO A;  3GQB A;  1I4Q A;  3NUC A;  4NW2 A;  2TMP A;  5C5L A;  1O78 A;  3CQZ B;  3OWF A;  5JPM C;  2XN9 C;  2WIN B;  1SNP A;  1TWC B;  1YNJ C;  1V1O A;  2K03 A;  1TWF B;  4KY7 A;  2E76 C;  3H6M A;  5C4X B;  3TN2 A;  4XQQ A;  3NSW A;  2CW0 C;  1PRT B;  5ELD A;  5C4Z A;  3S2H B;  3RLF A;  4G7O C;  1NR2 A;  5CMD A;  1DJR D;  4PNY A;  3O13 A;  3A8I E;  5CBE E;  4J1M A;  4QUC A;  2EYM A;  4K14 A;  4C3J B;  3K57 A;  1SMY D;  2R7Z B;  4DFA A;  1LTS D;  5I4D A;  1J9O A;  2JEA I;  4C3J G;  1BOS A;  4RGO S;  2B2W C;  4A3G B;  1TS3 A;  4P2C B;  1UUP A;  4A93 B;  4RGT A;  1YNJ D;  1LTR D;  1SYF A;  4TKO B;  5DAU A;  4ZLT F;  3HOY B;  1LT4 D;  4KMU C;  2D9U A;  5FLX E;  1A6X A;  1GHJ A;  4KKT A;  4BBR B;  3A54 A;  1Y1V B;  4F88 A;  1TS2 A;  3VR6 A;  3BYT B;  3MXN A;  2Q8I B;  3X3M A;  1I50 B;  1T5E A;  1H9R A;  2V4D A;  2K28 A;  1H9M A;  1OXT A;  5JEA G;  5JVH 3;  2EE1 A;  1BXT A;  2O2L D;  3PUV A;  3IFD A;  2OF1 A;  2NN6 H;  3H0G B;  4HMI A;  4OO1 H;  3TP7 A;  3T16 A;  5E4X A;  3M4O B;  2EPB A;  2AUK A;  4C1N I;  2FMM A;  2F3V A;  2HDM A;  2X6G A;  5NUC A;  5IIF A;  1ZXT A;  2DNC A;  1E2V A;  5C0X J;  4KHV A;  4NDX A;  1BF4 A;  3TME A;  4B08 A;  1B50 A;  1QWY A;  2SNS A;  1U4M A;  2MP1 A;  3J81 L;  3C1F A;  4RKB A;  4KTA A;  2L9H A;  1WTV A;  1E2W A;  4KJO A;  3HEJ A;  3U9O A;  3PIO 3;  2AQ3 B;  1TKW B;  5BN3 A;  1STB A;  1PFM A;  1V43 A;  3A8K E;  5JPN C;  3J80 L;  1D5X C;  4LAA A;  2F0I A;  2K6A A;  5DNF A;  2NWG A;  1LTA D;  4DA2 A;  5LHY 1;  5C5M A;  1VF7 A;  3VYS A;  2NTS A;  2DY8 A;  4K5W A;  1UEA B;  3A56 A;  2E2J B;  1IKM A;  1PFN A;  1EY8 A;  1G2T A;  1JWU D;  3ERO A;  1EZ8 A;  1HUM A;  1SJH D;  1CHQ D;  5IGC A;  4KV6 A;  3QOJ A;  3SVM A;  2QKI C;  1HQR D;  5CV6 A;  1EQT A;  1SYB A;  3ERQ A;  1HA6 A;  2EY5 A;  4H13 C;  5FK9 C;  2ICI A;  3T53 B;  3FEW X;  2EJM A;  3BVG A;  4FXD A;  5CGK A;  1TR5 A;  2WB1 B;  5IT9 L;  4IN3 A;  1AZP A;  4HAE A;  4ZRZ A;  3I90 A;  1JOR A;  5K5P A;  1EY7 A;  1SE2 A;  4DK1 A;  5BN4 A;  5I9P A;  2JA8 B;  1TWG B;  2EY6 A;  2F0E A;  2KED A;  2ZT9 C;  3S15 B;  1II3 A;  2EVB A;  3BVZ A;  2SEB D;  3S2D B;  2QF7 A;  1EEF D;  1EZ6 A;  3GV3 A;  1AP0 A;  1B53 A;  1G91 A;  3UI2 A;  1CA5 A;  4N9T A;  5CV9 A;  3OWE B;  1JWS D;  3DEP A;  1FNV A;  3NBI A;  3QIA A;  4B9W A;  2R92 B;  3NP8 A;  3W2D A;  3R93 A;  1UAP A;  2KUM A;  1S5C D;  3D8G A;  1H9K A;  2L0C A;  3OHX C;  2BE5 C;  3D4W A;  5JEA J;  3RZD B;  5KND A;  2F0Q A;  3GV6 A;  1GUN A;  3GTL B;  1ZEQ X;  1DXM A;  2FIN B;  1Q1B A;  1JQY D;  1PRT F;  1I6V C;  2A6H C;  1WD1 A;  1Q8I A;  2PW5 A;  2EYP A;  4DF7 A;  4DAV A;  1QCB D;  3BZD B;  1HPC A;  3I8Z A;  1BCP B;  2YU9 B;  3SK8 A;  1Z7T A;  4DGZ A;  3GTO B;  1TQO A;  1EU4 A;  4XIG S;  4Z9C B;  1BCP D;  1X32 A;  2F0V A;  1ENF A;  3ND8 A;  1OXS C;  2PW7 A;  3GO5 A;  1HTL D;  4LK1 C;  2LMC B;  1GHK A;  1SYE A;  4FF3 A;  1JC7 A;  5IGG A;  3FPP A;  1MI2 A;  5ELC A;  5KRU A;  2I46 A;  5A35 A;  4C1N K;  4CJ2 C;  2A5H A;  4K2L A;  4K8I A;  3TP5 A;  4FF2 A;  3HZX A;  4KKS A;  4KN7 C;  2BE5 D;  3SEB A;  5LL6 X;  2CQA A;  1EY5 A;  1GJX A;  4CBV A;  1DON A;  5CV8 A;  3M85 A;  1X3Q A;  4RCN A;  2NVY B;  3KUP A;  4XT1 B;  1G6Z A;  4IFD I;  4M8A A;  1FD7 D;  5CV7 A;  5FO8 B;  4L8J A;  2JA6 B;  2A6H D;  4A3I B;  4RFB A;  1VMC A;  2RBM A;  2L5T A;  1FYC A;  2PMZ B;  3K59 A;  1D5M C;  2IJ0 A;  4QMG A;  2VB2 X;  3MEH A;  2KCC A;  2N55 A;  2J0T D;  3MC0 B;  2O5J C;  2JE6 I;  1C4Q A;  3K7A B;  2IPK D;  1RTO A;  1S5B D;  1ESR A;  4PV1 C;  3NQT A;  4I7Z C;  1NSN S;  3AU7 A;  4C3I B;  1QNU A;  5I2Y A;  1GUW A;  2RVL A;  2JP1 A;  1U9R A;  1IYU A;  2RSN A;  4IUV A;  1SYD A;  1Y8N B;  1WCM B;  2EY2 A;  2L55 A;  2HCI A;  2L4N A;  1PTO C;  3LNN A;  4C3I G;  4YIJ A;  2E74 C;  1F2L A;  2F0O A;  2O4X A;  3GTG B;  2Z4I A;  3EJI A;  5C3E B;  4KD3 A;  1WTP A;  1EL0 A;  1XXG A;  3DM1 A;  5C4J B;  1KDA A;  4TRD A;  4FVM A;  2XVS A;  1TT2 A;  4JBW A;  1B44 D;  1GUO A;  4HSP A;  5DM6 3;  5EGT A;  5KNC A;  1EY9 A;  1PZJ D;  3MFG A;  1KNE A;  3DWQ A;  1I4P A;  1LTT D;  4HCS A;  2X6L A;  3EQL C;  1B1Z A;  4HED A;  5EKL A;  3VYR A;  1CM9 A;  1XWE A;  3J7Y W;  4K6L A;  1RF2 D;  3CHB D;  4Q5V A;  1EFI D;  1PZI D;  1BDO A;  2L11 A;  1B9M A;  4ME5 A;  2DN8 A;  2K5D A;  1PTO D;  4X3S A;  3VA5 A;  1PFB A;  4ZYS A;  1RJT A;  3NWS A;  1ET6 A;  5C6A A;  3BDC A;  1CT1 D;  4A3D B;  4WRD A;  4PQX A;  2HCC A;  1AEX A;  3M4Y A;  5C0X H;  3J81 E;  3CRK C;  2XWJ B;  3GTK B;  1FNW A;  1HUN A;  2EJG C;  1CK1 A;  3J80 E;  4IUP A;  3X3N A;  1TS4 A;  4RGN A;  1K8O A;  2EYL A;  3I70 A;  1HFG A;  3S1N B;  5J22 A;  1D2B A;  1S4Z A;  2AWO A;  3OOC A;  1C48 A;  1WTW A;  3VR3 A;  2RDF A;  2B2T A;  2PZW A;  2K01 A;  2DY7 A;  1JWM D;  5M5X B;  3FVQ A;  4WJW A;  3S14 B;  1RKN A;  1IW7 D;  1AFP A;  3EFX D;  2BDO A;  4J6H A;  3VR5 A;  4DXF A;  4H44 C;  5JOB A;  1V8Q A;  3PUZ A;  4XDX A;  2F4I A;  4F7X A;  3IFT A;  4NKL A;  3SXH A;  1NR4 A;  1MGS A;  1OO9 B;  2F0J A;  2AWN A;  1U4P A;  5K36 G;  3M3Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...