4K14A

Crystal structure of staphylococcal nuclease mutant v66i/v99l
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal Structure of Staphylococcal nuclease mutant V66I/V99L
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k14A00
5DAUA 2EYFA 3T13A 5M9OA 5IGBA 3TP5A 2QDBA 4J6HA 2PW5A 3SXHA 4ZUJA 5IOCA 3D6CA 2F0JA 2F0HA 3P75A 4J1MA 1RKNA 3TP6A 5C3WA 1ENCA 4K2KA 1KDBA 4OL7A 4QB4A 5HURA 2EY6A 5KIXA 5DEHA 2EYOA 4K2LA 4K5VA 5IGFA 3D8GA 3MVVA 4KY7A 3QOJA 3QB3A 2F0VA 1TR5A 3S9WA 4S3SA 2F0SA 3MEHA 4HMIA 2SNSA 1EYCA 2F0EA 2F0IA 4NKLA 2F0MA 5EKLA 4EQNA 4EQOA 5KGUA 2EY2A 2F0OA 2O4XA 1SYFA 5C5LA 5I6YA 2ENBA 4N9PA 1EY9A 3DHQA 4DGZA 5IGEA 1SNQA 5EKKA 1JORA 5C6AA 1TT2A 5C4ZA 4NP5A 4K5WA 4MIUA 2OXPA 3T16A 4F8MA 3TMEA 3BDLA 3DMUA 1STHA 5CV6A 1SNCA 1SNDA 2PZWA 5CV4A 1AEXA 4ME5A 4TRDA 3OWFA 5C5MA 2SOBA 4K14A 1NSNS 3QOLA 2EYMA 4ZUIA 1EY7A 2PYKA 5CV9A 4EVOA 5E3FA 3OSOA 5C4HA 1F2YA 5F2DA 1SYBA 2F0UA 2KHSA 1A2TA 2SNMA 4WRDA 3SK8A 3SR1A 4DU9A 4DF7A 4PMBA 3EJIA 1A3TA 5IIFA 4N9TA 2F0KA 1NUCA 1EY0A 2PQEA 1EYAA 1SYGA 1EY8A 4I65A 4G57A 4LAAA 4NMZA 2OEOA 2F0TA 2RDFA 1EZ6A 3NP8A 4R8NA 1EZ8A 2F3VA 4K8JA 4RKLA 5IGGA 5IGCA 5CV5A 5C3XA 1F2ZA 1STNA 2EYHA 2F0PA 2PZTA 1SNMA 1A2UA 3C1EA 3SK4A 1KDCA 2EY1A 4KHVA 5KYIA 3ITPA 1IHZA 4KD3A 4B9WA 2KQ3A 3U9OA 1EYDA 2F0GA 3D4WA 2F0DA 2NUCA 3NHHA 5CR3A 5HGTA 1STBA 1JOQA 4IUNA 5CC4A 3ERQA 4IALA 5KEEA 4ID6A 5KRUA 4DFAA 1JOOA 4E6IA 1KDAA 3SK6A 1EQVA 4HMJA 1SNOA 3BDCA 4K8IA 4WORA 1F2MA 1SNPA 2PZUA 5I6WA 2PW7A 3D4DA 5J22A 5IODA 2EY5A 1JOKA 3VA5A 4KD4A 2F3WA 4NDXA 1KAAA 4YIJA 3R3OA 3RUZA 2F0FA 2EYPA 3E5SA 1SYDA 2HQEA 2WACA 3MXPA 4PMCA 2EYJA 3PMFA 5JOBA 5EGTA 5E1FA 2F0QA 2F0LA 4B9XA 5I9OA 5J39A 2OF1A 3SHLA 2EYLA 3NQTA 3OMCA 4KY6A 5NUCA 3LX0A 3NUCA 3NXWA 3C1FA 5CV7A 4KV6A 5IGDA 3EROA 1EY5A 3OMGA 4KJOA 5CV8A 3TP8A 4HTHA 4K6DA 3EVQA 5KYLA 1STGA 4KTAA 5CGKA 3HZXA 5K5PA 4IZ8A 4ODGA 5ISRA 4PNYA 2M00A 2F0NA 1SYEA 4H7BA 3V2TA 1SYCA 2F0WA 2RBMA 4QMGA 1ENAA 1KABA 4K5XA 4ZQ3A 1A3UA 2RKSA 5JAVA 1A3VA 2LKVA 5J1ZA 3H6MA 4QF4A 4RKBA 4F7XA 1EY6A 1U9RA 1EY4A 1TQOA 3HEJA 3P1HA 2EXZA 1II3A 3TP7A 4EQPA 5I9PA 3MHBA 3NK9A 4KJNA 1STAA 1STYA 3SK5A 3MZ5A 4KY5A
chains in the Genus database with same CATH superfamily
2HHHL 2JXMB 3TP5A 2CQAA 4J6HA 2R93G 3SXHA 4B3MQ 1TS3A 4F88A 3HOYG 1ENCA 1LT6D 4ZRZA 1G6PA 1LYLA 5ELFA 1IBKQ 4UAIA 3K5NA 3BZDB 1O7YA 1TWAB 2F0SA 4S3SA 4JVZA 2UUAQ 1EYCA 4IFDG 1HQRD 1DYQA 5LL6X 3AYHB 1BXTA 2MQHA 1SYFA 3AQQA 1UUPA 1KAWA 3NWTA 3Q6SA 5EKKA 3RR5A 5C4XB 4LF5Q 3L3OC 3T16A 4GN5A 3K7UC 3MFGA 1I6HH 2K14A 1GHJA 3ND9A 4A3GB 2BCOA 4IJHA 4XYQA 4HJ5A 2Z6BA 3W3AA 3J7ZC 3KUPA 3CW2C 4PMBA 2IT1A 2NVTH 2PQEA 1VDZA 4JI7L 3A5ZB 1SDFA 4CBVA 2MNAA 2VY3A 2E5LL 5FO9B 3A7LA 3DWPA 2R92B 2QEXA 3TQYA 4A93H 2B29A 3NHHA 4DA2A 4IUNA 3EBEA 3GTGB 2HUGA 2PPBC 1YJ9A 4E6IA 4A3EH 5T1GA 1CA6A 2XTIA 4G4KA 2TMPA 2PW7A 4N8FA 2JA8H 4KD4A 2F3WA 3K5MA 3S16H 2AUKA 3I4MB 2F0FA 4RG1A 2KA7A 3MXPA 4PMCA 4RGTA 1YVCA 4JBMA 4JI2Q 1LTSD 3C2PA 3M85A 2EYLA 5C3EB 4DR5Q 2NTTA 2Q8IB 1JT8A 4PV1C 1F9PA 3MEFA 5CV8A 2LSSA 1AN8A 4A3MG 3J81c 1FNUA 2WKCA 1TWCB 1HJPA 2WAQG 1N32Q 3K8AA 5C44G 2KENA 1Q8KA 1NMFA 4A4IA 3I56A 5IYDH 5LMUL 1A8VA 2Z8LA 2MJ8A 3L9AX 1RIPA 3T13A 5IGBA 2UU9L 4NXNQ 2PW5A 3QG1A 1G51A 1NE3A 1TS2A 5EKIA 1S3OA 2CQOA 2N55A 5COYA 2VQFQ 4K2LA 5IWAQ 2IY5B 1XYIA 2MPMA 3KF6B 4OONA 4XIGS 4HMIA 2SNSA 1NJIC 5BN4A 3G6JB 4OGQC 1SROA 3GTKH 2IX1A 2PQAB 2R7ZG 4ZK9B 2O5JC 1SMYC 4M8AA 1S5FD 1WTXA 4IOAA 1AEXA 4LFBL 5JJLA 5CV9A 4YY3L 4DV3L 1A2TA 4DUZL 3RZDB 4IOCA 3NE5B 1TWAH 5ELNA 2N88A 1LTTD 2K5WA 4OX9Q 3S17B 4GLAC 3OTOL 1FR3A 1VQ4A 3VR3A 5CBAE 5C3XA 5C4XH 1CSPA 5M3MG 4ZKBB 1RD9D 1MGSA 2VL6A 1BCPF 1CSQA 2BDNA 2A68C 3CPWA 3NTIA 5CR3A 4A3JB 4A3GH 4DNTB 4MTNA 1QVFA 4RMFA 3STBC 3E0EA 4IUQA 4PZ7A 5FLMG 1TIID 3PO3H 1KLUD 1VQLA 1SNPA 2BH2A 1JWSD 4R8IA 4B3RQ 3I2ZA 3HKZG 3A5UA 1O7ZA 5IP9G 4A3KG 4DV0Q 5FOBB 5JVG3 2E2IB 2DJGC 2QCPX 1N36L 5IT9E 1NAPA 3OMCA 4RFBA 2G9DA 3G48A 2R92H 5ELCA 1JQYD 4B3ML 3GP7A 3DLLA 1QZGA 2DNEA 3TEHB 3GTGH 2K32A 2BA0A 2H4OA 2UXDQ 4LUZA 4GNXB 4K5XA 5IYBH 1JE5A 1PH4A 2M2LA 3DM1A 1IBKL 3VR4A 2B2TC 3H6MA 5KNDA 3I4MH 3K5OA 4BBSG 1EY4A 3P1HA 3TP7A 1H9KA 1EEFD 2Z4HA 3IFTA 1PRTB 5C3EH 5DAUA 1JWMD 1TS4A 3NBIA 4JBJA 3K6OA 5EQ0A 4GKJQ 4A3FB 4LF5L 3RZOB 3CKIB 2YYZA 3NEMA 4J1MA 4HCSA 5C3WA 5HURA 1I4RA 4CHTB 3Q8DA 3HOZG 1N34L 2VUMG 1EIGA 1XXGA 1Y1VB 1LV9A 5ELOA 3QOJA 4A3DG 4POGA 1BCPC 2F0MA 3VR2A 3D3RA 1UNSA 1MJCA 1HR0Q 2HD3A 4F87A 1ZKOA 4MIUA 1OXSC 2OXPA 3E3XA 1I94Q 2KCCA 3VDYA 2YU9H 1BKBA 1UE6A 1VQFA 4IPCA 5D3IB 1ASYA 1PTOD 5L37A 4GN4B 3A8KE 5E3FA 1TY0A 1YIJA 4QGUA 2J7ZA 3ERSX 1S72A 3I4LA 5DLQE 1H9MA 5GADC 1B7YB 4FF3A 3EJIA 1I4PA 4DUYQ 1EY0A 1IL8A 2CCZA 1EY8A 1GUWA 1EU3A 4I65A 4ME3A 3CCUA 3AEVA 2O5IC 3HOXB 4JI2L 1SBBB 1AZPA 1SNMA 2VS1A 2A6EC 1Q1EA 4DR5L 1PH6A 2E2JB 1JOQA 2B2TA 2F03A 5KEEA 2K50A 3RZDH 3KBXA 1VQ9A 4LF6Q 1TVXA 1S5CD 5BN5A 4MN3A 4GS3A 3S17H 3I4NB 3TSSA 2GVAA 1KXLA 3HFZB 2VW9A 1KC8C 1D5MC 1QWYA 3QWNA 1VS0A 4L63B 2JSOA 3GV6A 4DR3Q 4Y7NB 1V8QA 4EX5A 4NXNL 3PUZA 1C7YA 1LTLA 3U4ZA 4DK6C 3I55A 4DV4Q 4QUCA 1ESRA 4X66Q 4OWTB 1ENAA 1YNJD 2N3SA 2VQFL 5IWAL 1Q3LA 1CQFA 4LF9Q 4X3UA 2E2IH 3DUZA 4AIMA 3SGIA 4EQPA 4JV5L 3BVGA 1II3A 3PF5A 4A3LG 3C1EA 3SK4A 4R4TA 2EPBA 2XGTA 5M9OA 3JAMi 4P75A 5BN3A 1ICWA 2F0HA 4BY7B 1VQHA 3HOVB 4Q5VA 5KIXA 3HOUG 4ABNA 1D8LA 3J81j 3MXGA 2HT1A 4NB3A 3GTMB 3LNNA 4P72A 3G7LA 4JI3Q 3FKIH 1PYBA 1EFID 4JK1C 3I4OA 2WB1G 1V43A 1X3GA 2D2CC 2HIXA 2OQ0A 1JORA 4OX9L 2YTYA 1X65A 1PFNA 1G91A 4A3FH 2K75A 4OHJA 3RZOH 4X3SA 3I90A 3KLSA 2X6GA 4C56C 1MSGA 1GM5A 2HQLA 1PH8A 3CQZB 1C8CA 1Y1VH 1YHQA 4H02A 1DJRD 3LGJA 1NUCA 3H0GB 3PUXA 1AZQA 2VB3X 2AHOB 4B3RL 1EZ8A 2IHFA 1F2ZA 1F9RA 1MBYA 2NVYB 2FINB 2B2YC 1CKMA 2L11A 1NR2A 2PZTA 2B8FA 2JYOA 3HG9A 4DAVA 1KRTA 3K57A 2F0DA 1CKNA 4QUFA 2EJFC 5KNBA 1QVGA 4LUOA 2Q8TA 2K04A 4IALA 3HS0C 1KLGD 4DFAA 4XQJA 3ICEA 4B08A 1E1TA 1NTGA 1TXYA 2O2LD 5IODA 1D5XC 5J3BA 4A3IB 2UXDL 3F2CA 2EDGA 4JI1Q 3HOXH 1QB5D 2JEBI 3CPFA 1BNZA 3CCSA 3CCEA 3S14B 1X3EA 2KCMA 3CCRA 5DM73 1VQMA 5ELDA 1STGA 4GKJL 5CGKA 2E2JH 4G7ZC 1K3BC 1TWFB 2JA6B 4LUVA 5IT9L 1XPUA 2RDHA 4X64Q 4L5TA 4HAEA 2EJMA 1NNXA 1M90C 3O13A 4PG3A 2JA7H 4FO2A 1MJEA 2RHSB 2K7VA 4JI7Q 1PLFA 4UP8A 5J1ZA 4HEDA 4DR7L 5EJWA 3S15B 1V1QA 4DV1L 1SR3A 1IZ6A 3BU2A 1PRTF 1EQTA 1HTLD 4RGMA 5FO7B 1HZBA 4Y7NH 2EE1A 3KF8B 1ASZA 1I94L 3H09A 4NXMQ 1WD1A 2EY6A 1E0BA 2BA1A 4ULLA 3OPOA 1VQBA 1GUNA 2Y0SB 3AFQA 2JJQA 2XIWA 1OXXK 4NKLA 2B2YA 5JJKA 4EQNA 2L15A 4GKKQ 4DUYL 4K6LA 4K5WA 1JICA 1E22A 1D7QA 2K5VA 3F2BA 1N33Q 2ZJRA 2JA5B 4BY7H 1X56A 3HOVH 3OSOA 3MXNB 2K5QA 3BS1A 1WTVA 2CWAA 1WTPA 3GTMH 1QE6A 3ULJA 2F0KA 3KF6A 5C0XH 1HQMC 5KNCA 2OEOA 4JC0A 2LY7A 2RDFA 5IGGA 4GLVB 2UU9Q 2PNHA 3OHXC 3I8ZA 2EY1A 4KHVA 2PQAA 1HH2P 1TKWB 2B2UA 4DR3L 3QR8A 5TSSA 1DOKA 2DY7A 3CQZH 5KRUA 4MZ9A 4ZLTF 1PRTC 2WV6D 4DXFA 3E9HA 5JPNC 3BDCA 1Z9FA 4DV4L 1PH3A 4X66L 3H0GH 2VXWA 4TVAB 4LF9L 1GJXA 2E2HH 3TZDA 1UEBA 5IE8A 5I4DA 4HIOA 4A3CG 2NVYH 3NUCA 1KRSA 5EPKA 3A54A 2EVBA 1X55A 4KV6A 1FYCA 1BVSA 1JJGA 5D14A 4K6DA 5LHY1 1HUNA 1AE3A 1I5FA 1KNAA 1SMYD 4IN3A 2Z0SA 4OWWB 2CVRA 4H7BA 1FJGQ 3FPPA 5EBDA 4MTKA 2RKSA 2V1CC 3CXCA 3HP3A 1L0YB 4HJAA 1XPOA 4JI3L 1YJWA 5HGTA 2ZJPA 4DV5Q 3CRKC 3TS2A 4KHZA 1RL2A 3K81C 5HGQA 3C46A 3S14H 5IOCA 2E8GA 2K6AA 3MTSA 2QILA 1Y69U 1FNVA 1TWFH 4O2DA 4K2KA 2JA6H 1WJJA 2H5XA 3OW7A 5IGFA 4X65Q 4H0LC 2MFIA 1CTMA 1TR5A 3STBD 1MD2D 5EKLA 3X3MA 2LFNA 2BE5C 4FF1A 1Y1WB 4BBRB 2L55A 5IGEA 4R4CA 2GVBA 3S15H 4HSPA 3A56A 4U68A 4F8MA 2Z6KC 2IPKD 4HIKA 4LFAQ 4EVOA 4JI0Q 2XWBB 4DNRB 2F0UA 5H1SE 1Q86C 3K58A 3CC2A 4IPHA 4JPBW 1XNRL 2F1MA 2ALYB 4GOPB 4JI4Q 1WVLA 3QJYA 5CYUA 2L1BA 2A6HC 2MO0A 5M3FB 4DK3C 2F3VA 1JJ2A 2CKZB 3SEBA 5EPLA 3ZYYX 3H3VH 3M7GA 2K4KA 4JI1L 4NW2A 3PO3G 2NVXB 1YJNA 1J5EQ 3J7AV 2KBNA 2JA5H 1EYDA 4FP5D 1N34Q 1LTBD 4DAYB 4V0BA 2F4VQ 2R93B 2YTXA 2V4DA 4LF4Q 1KDAA 5M5XB 1SNOA 3VR6A 5FJ8H 4X64L 5J22A 3M3YB 3NPPA 1PZJD 1JE4A 3HOYB 1RJTA 1J9OA 3ULPA 1Q1BA 4KI0A 4EQOA 1PHJA 5I9OA 1GUGA 1BCPD 3U9SA 1RHPA 1X3QA 3UDGA 4HCEA 2XSCA 5IYBG 3N6RA 4IPGA 3I4MG 2NTSA 1Q7YC 1SYEA 4NXML 3MWYW 2B3GA 1AP0A 1KD1C 4KN4C 4RHSA 2JP1A 3GO5A 1P8LA 1T5XD 2Z6KA 1XTCD 1U9RA 5DM63 3SK5A 1EWHA 4GKKL 3PGZA 1ML0D 3BVMA 3NWSA 3T1YL 3SVMA 2A69D 1EIYB 2L5TA 2G5DA 1I4GA 1VF7A 1WCMG 4G7OC 1CZWA 4BXXH 1RKNA 1YHAA 1ILPA 2A6ED 1N33L 2WKDA 4K5VA 4M1UB 2NYZD 4LFCL 1W3SA 1WTQA 3S9WA 1QOHA 3J80i 1A0IA 2HIVA 1TS5A 3A8JE 4JI6Q 4A3BG 4DV2Q 3PIO3 4YWMA 1QCBD 1WTHA 1UAPA 5G3LF 3S2HB 3DMUA 3ULLA 4JG2A 2PZWA 1AFPA 1Y8OB 1TWGB 5CV4A 3OWEB 2RSOA 1VQOA 1LTRD 3K7AB 5JVH3 1WI5A 2EYMA 4UDUC 2VZAA 2PCFB 2VNUD 3OIQA 2K5DA 1YITA 3FDTA 1PYWD 2UUBQ 1DZ1A 3ND8A 4CKCA 3PCOB 2RF4A 1I4HA 1EYAA 4JV5Q 4POFA 4IUVA 4A3MB 4G57A 2D62A 1E3PA 2XN9C 4BBRH 4C3JG 4R8NA 2ES2A 2Q8RE 1MKHA 3F8TA 1B44D 2WAQB 1SAPA 5C44B 1KDCA 4XDXA 3TS0A 1K0RA 2F0GA 1G2TA 4C3HG 1GUOA 1XJVA 1CHPD 4LF7Q 3RD4A 1B8AA 2XNAC 1EUJA 3HOWB 5EPJA 1B4OA 1FJGL 1FGBD 5AJ3L 3E0JA 5JEAH 1BO0A 3L0OA 3RUZA 1ONLA 1YNXA 4DGZA 3NBHB 3ZJYC 3IL8A 5M3FH 2FJ2A 1C4QA 3PIP3 3PSIA 3C1FA 5CV7A 4DV5L 3MA2B 3PUVA 5EAYA 5KYLA 3S1MB 1LT3D 2R7ZB 3HZXA 4AQYQ 2KCNA 4TQUS 3CF5A 2R93H 2J0TD 3TREA 5M5XH 3C3LA 2RBMA 3H3VC 2HCIA 4X65L 2ZM6Q 4FXGC 5JAVA 3HOYH 1HFGA 2NWGA 4AYBE 5IT9c 2RDGA 3HEJA 1TWHB 5I9PA 4I7AA 4BA2I 3E9IA 2JE6I 4IFDH 5GROA 3PF4A 2YTVA 4YCUA 2NVQB 4PZ6A 3ER0A 4JYAQ 3A8IE 3FKIG 5M3MB 4OL7A 2B63B 2Y0SE 4LFAL 1EWCA 3MVVA 4JI0L 1BOSA 5FLXE 3K0YA 5C0XI 1SJHD 2RQXA 2O4XA 3I3CA 4JI4L 3CCJA 2EJGC 4FVMA 4OO1I 4DR4Q 4JI8Q 3HKZB 4L5RC 3BDLA 1STHA 1Q82C 3P20A 4A3KB 4LJZC 3N52A 2OCEA 4JBKA 2A5HA 2C5CA 1J5EL 4B3SQ 4WJ4A 1KL9A 1PA6A 4XTCS 5IP7G 1H9RA 2HDMA 1HNWQ 2F4VL 4DR7Q 1TWCH 4LF4L 2G9HD 2JEAI 2N8NA 4FNFA 1IYVA 1T5EA 1O7IA 4DV1Q 4BS9A 1JMCA 3CMAA 3T4AC 3S2HH 1LTID 5AFWA 2UXCQ 3F1ZA 4BBSB 1TWGH 2IWHA 1GD7A 3K7AH 1RODA 4OIJA 3T1HQ 1K9MC 1EIHA 3M4OB 1RF2D 3I91A 1QUQA 1L2FA 3D4RA 4OIKA 2NN6H 1BDOA 3HOXG 1QNUA 5GAGC 3D4DA 2EY5A 4MNOA 3MXNA 2KJXA 3HOZB 4A3MH 2EYPA 1JB3A 1U4RA 2EYJA 4CJ2C 1E2VA 5E1FA 2F0QA 5EGTA 1VQ7A 2A69C 2MP1A 4XT1B 3LWEA 4X3KA 5M5WB 3FMCA 4QJFA 1B50A 1PH7A 2BDOA 1CM9A 5C44H 1VQKA 2JA7G 5CORA 4HTHA 1HZAA 3Q23A 1K28A 4KTAA 2KUMA 4KLKA 1ZXTA 2Z9HA 4OWXB 1AE2A 4LF8L 2QW7A 5E4WC 1YNNC 3HOWH 1NCVA 1KABA 4A76A 1EQRA 1A3VA 2CWPA 5D3DA 1OO9B 1SE3A 2L4NA 4C1NI 3MHBA 4JI6L 1STAA 1PYSB 3DWQA 4DV2L 1H9SA 4RA8A 3CCMA 2ID0A 2D0PA 4GOPC 1PFSA 3S1MH 1PH9A 2R7ZH 1HA6A 1XNQL 1KDBA 4A3JH 2OT2A 1QILA 1E2WA 3T51B 2UXBQ 2UUBL 2F0EA 1PRTD 2UUCQ 2VQEQ 4BY7G 1TWHH 1S5BD 3H3VI 3KDFA 3URYA 4CGYB 1KIXA 4Y52H 2NVQH 4GN3B 4TRDA 5IY0A 4ZUIA 5M3MH 5C0XG 2B63H 4PZ8A 2SNMA 4MHEA 4OO1G 3RNUA 1B9NA 4LF7L 4C2MB 3H91A 4LAAA 2J4XA 2F0TA 5FLMH 4HIMA 2ZXRA 1U4PA 1NMGA 1MSHA 3J80E 4DV6Q 3A7AB 2IHEA 1B3QA 5IP9H 3S2DB 4B9WA 1JWUD 2IX3A 3PO2G 1CA5A 1STBA 2A74C 5CC4A 1OXUA 3VYTA 1IXRA 4CDFC 1SE4A 3SK6A 4HMJA 4OXPA 2A19A 4DR2Q 4AQYL 3FHWA 1CKOA 4K8IA 4UPAA 1SLJA 4R9WA 1XPRA 1B3AA 1M1KC 3HOUB 1BQQT 2ZM6L 1DGSA 1EWIA 3S24A 4GOPA 3SHLA 5BR8Q 3DEPA 4IUPA 1EU4A 1IBML 2BE5D 1Z6HA 2WB1B 4BBSH 3EROA 1QG7A 1SRUA 2N78A 1LLRD 3TP8A 3CU7A 4LNQA 1R4PB 5K5PA 4IZ8A 3M4OH 1EOVA 4JYAL 4PNYA 2M00A 1XNRQ 2F0WA 2Q2TA 4FYDA 3U58A 4DAYA 2LKVA 2I5LX 3HOZH 2DJFC 4HIDA 1S40A 5C0XJ 1PMRA 3A55A 5M5WH 2A6HD 2EYFA 2QDBA 1N9WA 1UWVA 3FEWX 3F2DA 4DR4L 4P73A 3GQBA 3D6CA 2NZ1D 4JI8L 3KJOA 5C4JB 4BY1G 4HJ9A 5K36H 2I5HA 4AYBG 4DR6L 1OXTA 2B2UC 4B3SL 1FL0A 1RDPD 2F0IA 3LWUA 1GHKA 1HNWL 5T1IA 3G71A 1EY9A 1LUZA 3VR5A 3I4NH 2I46A 1IBLQ 5FLXL 3GTPB 2I0QA 1HRJA 4QCLA 1SNCA 3VA7A 3J81i 4YHHQ 5C5MA 5LMNW 2M9VA 2R3ZA 2UXCL 3QOLA 1G8ZD 1K8OA 1HNZL 2X6LA 3T1HL 4DU9A 3WOFA 3V05A 1SYGA 4HN7A 3AB9A 3UE1A 1W6JA 1EIFA 4DPGA 3NP8A 3MXUA 1PH2A 5IYCH 2Z1CA 3T1YQ 3EFXD 5CBEE 1NY4A 5KYIA 4B3TQ 1GUTA 3ITPA 2K05A 3U9OA 4CDEC 4RH6A 1U5KA 2K28A 4LFCQ 2K5NA 3L7ZC 1Y8NB 1X3FA 2CH4A 2QDLA 1VQPA 1Z7TA 2IJ0A 2E76C 4WORA 3EQLC 3S1QB 1SJED 4C2MH 2N49A 4NDXA 4RAUC 2K5HA 3HRZC 1O80A 1QNKA 3E5SA 2WACA 2I07B 4A93G 2NZOA 1LTAD 2F0LA 4B9XA 1D2BA 2ZTCA 2BOSA 2GN5A 1B70B 2X69A 1S5ED 3MFYA 1IKMA 4R1JA 3UDXA 4ALPA 4A3EG 4WJWA 4GNXC 3S2DH 1I3QB 3DEOA 4A3LH 4LW1A 1W6KA 2JA8G 2F52A 3VYSA 4DN4M 2QKIC 4R4QA 2F0NA 4P71A 3UDIA 1VQ6A 1HXYD 3SDZA 1ESFA 2ATWA 4QF4A 3HOUH 1HZ9A 2UXBL 1ZYRD 5JJIA 1VCIA 1H9JA 2UUCL 1AW7A 1SE8A 3EN2A 2VQEL 2EQSA 3UDFA 3R2IA 1VQEA 2SDFA 4JI5Q 4ZUJA 3S1NB 4BWGB 2PMZB 1V1PB 1F9QA 2D0OA 1D5ZC 2RVLA 3G6EA 5DEHA 3DWAA 4IPDA 3D8GA 4KKSA 5IYDG 4TSSA 4J8QA 2FXQA 5AJ3Q 3K0XA 1CHQD 1UEAB 3HGBA 4P74A 2EXDA 4A3IH 1C48A 4N9PA 2ZJQA 1VQGA 5C6AA 1TT2A 1HNXL 4L6TB 1SFOB 2B2VC 1PDQA 3TMEA 1PFMA 1WTWA 1TU2B 4QY7A 1ET6A 4DV6L 1T9HA 1G6ZA 2PYKA 1XMQL 4DXGA 4L5SA 1LACA 2JN4A 1F2YA 5F2DA 3VYRA 4BBRG 1LT4D 2NN6I 5IIFA 4C3IB 3T53B 4DR2L 5ELBA 1DOLA 5G3LD 1XMOQ 1EZ6A 4GNXA 4KMUC 3BZCA 3KLWA 1STNA 2XRQD 1I50B 4HJ8A 3GTPH 1BUVT 1L0XB 3GD7A 1A15A 4RHRA 5BR8L 1LM0A 1GO3E 5E7NA 2AQ3B 3JAMc 5JEAG 2AWNA 3ERQA 3J80L 3JAME 1EQVA 1JCKB 1M8AA 1X6OA 2K03A 5EBCA 5I6WA 5C4XG 2HDLA 1YHBA 2WP8J 1D1IA 1GUSA 1WOCA 1VQAA 4YIJA 5GAEC 2HQEA 3PMFA 4A3GG 3TN2A 1KQSA 2K1BA 3ONAB 3M9BA 3CAMA 3V96A 4OEMB 1D1KA 4YCVA 1X3PA 1STEA 2QEJC 4LWCA 1WTRA 1RTNA 4DNIA 2FHTA 3S1QH 3H15A 3S1RB 1B1ZA 3I70A 3UE0A 2B2VA 4EGVA 1G291 2R92G 3D6WA 1EY6A 1ET9A 2KEDA 2EXZA 5KGUA 1G2SA 4KJNA 1STYA 1LABA 1CKNB 2JK8A 2CFMA 2QGQA 2R61A 1IBLL 1CK1A 1I3QH 1ZEQX 4PMWA 1SEBD 2F0JA 4X3TA 3KLSX 4O0AA 4YHHL 3DM3A 2OTLA 3PO3B 3FVQA 1LT5D 5C3EG 1K8MA 4I7ZC 4CJ0B 2EY2A 4TKOB 5JEAJ 3DHQA 2A1AA 2AQ2B 2CW0D 2CH4W 4NP5A 3TRZA 2ZTDA 3S1NH 2RA4A 4ME5A 3OWFA 2YV5A 1YBYA 4B3TL 4LF8Q 1S4ZA 1HA5A 1J6QA 2KECA 1LO5D 3GV3A 2CHBD 1MI2A 4QL5A 1YNND 4R4OA 4RKLA 5IGCA 4RGOS 1SFOH 1GXDC 1BF4A 1A2UA 2NN6G 4IFDJ 2F4IA 4QIWB 1XNQQ 1JC7A 4A3CH 1IKLA 3PQIA 4DAMA 4ID6A 3PUWA 3J81E 2I5MX 1WCMB 2PZUA 1F9SA 1ZYRC 4C3IH 1F2LA 3KLRA 1AH9A 3T56B 1ILQA 4DV7L 1CZGA 1X54A 5A35A 2WINB 1Y1WH 1O7LA 1CFMA 2WB1E 1I50H 5NUCA 4X6AH 1E7ZA 5ELEA 3D31A 2GA4B 4A3BB 3HOWG 2YU9B 3PV0A 4JI5L 2P5ZX 5ISRA 1I6VC 3BG3A 2OWOA 3OIPA 4C1NK 3CD6A 1SYCA 4OELB 5A2QE 5D65A 1EYGA 2AMCB 1IL2A 1NBWA 4DR1L 1YI2A 2R7DA 1EEID 4A3JG 4KY5A 4FXDA 4KKTA 1HCZA 1R9TB 3MC0B 4C3JB 2NVXH 2DY8A 2BH8A 3P75A 3CP0A 2B39A 4XQNA 2EYOA 1VMCA 4ZYSA 1PTOB 4XQQA 2F0VA 3S1RH 4C3HB 3M3YH 1Q12A 1JR0D 3J7YW 3CC4A 2F0OA 5C5LA 5I6YA 2ENBA 5FKAC 4O1NA 1IBMQ 2B63G 5FO8B 2E75C 2L0CA 1XMOL 4DK1A 1U0LA 3FP9A 1Q90A 2KEEA 4H13C 1UE5A 5JPMC 1DOMA 1NSNS 2LXKA 4IO9A 3CRLC 2ZTEA 1M4VA 4YCWA 5FLXc 4HR7B 1D6EC 3SR1A 1L1OB 1CI3M 2HCCA 4U673 4Z9CB 2Q2IA 4A3FG 2LMCB 2KHJA 5CV5A 1VQ5A 3WDNA 1BBUA 3NTKA 1XX8A 2SEBD 1Y1VG 4RWSC 3EIVA 1PH5A 1PH1A 4NPSA 4DR6Q 3BZKA 1VQDA 1W2BA 3KF8A 3GTQB 1SMXA 4ZKCB 1SE2A 3FKIB 1JOKA 1Q8IA 3H94A 3VA5A 1HTPA 3M4YA 5JOBA 2UUAL 3RN5A 2D5DA 2OF1A 3JAML 1MHWC 1DM0B 3G4SA 3J7A5 1P16A 2LXJA 1K0SA 3DXJC 2XVSA 3KK7A 2EZVA 4KJOA 3EVQA 3F2UA 4IQZA 1HNZQ 4H44C 2MHVA 4ODGA 4ZAIA 1VQJA 1HFNA 4QMGA 1WD0A 3GTLB 1WCMH 4J15A 2RCFA 5LMNQ 1VF5C 4IUTA 2A73B 2CW0C 4F7XA 1OXVA 3K80C 2B8GA 3K59A 2VUMB 2DUDA 1Q46A 2IW3A 4K14A 2ZT9C 4A3DB 5K36G 1J8IA 2PMZE 3AFPA 1IW7D 4JOIC 4A3BH 1BR9A 4ZCKA 3RLNA 1B9MA 3RLFA 1S5DD 4QB4A 4AH6A 2OQKA 3W5OA 1F77A 2FFKB 3I4NG 3CCVA 4KY7A 2L12A 2R7FA 2K52A 3K5LA 4JCVE 4APVA 1N8RC 3SE0A 1H95A 3P7JA 1Q81C 4KHPQ 1GOZA 3OYYA 4CKBA 2XRSD 3KOJA 1SNQA 1OTCA 5C4ZA 5HY6A 4WFN3 1YZ6A 1V1OA 1R9TH 1HPCA 3W1GA 1PZID 2MO1A 4C3JH 1K8AC 1PV4A 1V9PA 3A74A 1U4LA 1RTOA 2RCNA 1I4XA 1E2ZA 1B2TA 5IYCG 1V1PA 2JA7B 4WRDA 3SK8A 1PTOH 1SSOA 3RN2A 1R4QB 4Q0FA 4O42A 4C3HH 4IJLA 2B2WC 5CMDA 1N32L 2NZHA 3B6YA 1O78A 3KBGA 4K8JA 5LL6S 5DNFA 3HOVG 4DKAC 4RGNA 3PIOA 3QIAA 4CDDC 4YWKA 4QQBX 4GLXA 3BDOA 2TSSA 1VQIA 1WFQA 3HKSA 1C0AA 3GDEA 3NENA 3R93A 1HHVA 4XT3B 4G7HC 1EQQA 1E1OA 1K83B 4JOIA 2DN8A 1HNXQ 3RMHA 3J80c 4GZYC 2ZXOA 4FF4A 3L2PA 3TBIB 3NQTA 3J81L 4BA1I 3LX0A 1WTOA 3I7FA 1XTDA 2ICIA 1EY5A 3OMGA 1ENFA 4A3KH 1XMQQ 3NSWA 3H0GG 4YWLA 1JJCB 4IUUA 4P2CB 2IX0A 1A62A 2R6GA 1PVOA 1I4QA 3GTOB 3GTQH 1ICFB 1VQNA 1XWEA 1A3UA 4K0KQ 2C9OA 4RKBA 3NK9A 4ILWA 4FXKC 5A2QL 1HUMA 4X62Q 2LS01 1YEZA 1LTGD 3J7AF 4HSVA 1Y14B 3TZUA 4L8JA 1SXTA 3PIPA 1A6XA 4A3IG 2B2WA 1WYDA 2K33A 2KHIA 4DK0A 3GTLH 1PTOF 3QB3A 3U50C 2MUYA 3PO2B 1EFWA 1PZKD 2ASBA 2IL8A 3NTHA 2NB0A 4DR1Q 2HHHQ 2E2HB 5JJZA 2VUMH 2PNRC 3GTJB 5IP7H 4DV0L 2JA6G 4A3DH 3TDQA 4XXEA 5CV6A 3CCLA 1KTKA 3Q0AA 1SNDA 1GVPA 1IYUA 2MGSA 2FMCA 3WWVA 4DAPA 3W1BA 1K8GA 5I2XA 3CC7A 4JBWA 5C4HA 1FD7D 2Q2UA 1FVIA 4WJ3M 4UY8C 1BBWA 4DF7A 3M4QA 1A3TA 4N9TA 3EA6A 3VYUA 1DXMA 2DGYA 4NMZA 3CHBD 1C9OA 2FMMA 2A8VA 1VQCA 3E6ZX 4QIWE 2F3IA 3BVZA 3NELA 2Y0SG 4KD3A 1DD2A 3D4WA 2D9UA 1CUKA 2NUCA 1L0WA 3BYTB 1EOTA 4UHVA 1CT1D 4KN7C 3A0JA 4PQXA 1IYJB 1JOOA 4JW0A 5M5YB 1HR0W 4UP9A 2L9HA 5GAHC 2ICEC 2EIFA 4CDCC 2KOLA 4BY1B 2E5LQ 5LMNL 5GQOA 4AYBB 5J39A 2WAQE 2JA5G 1IW7C 1B53A 4LMQD 2KVMA 1KNEA 1HR0L 4V190 3PUYA 2WIIB 1PTOC 5IGDA 2Z4IA 4RCNA 3IKJA 5FJ8G 1KHIA 3BYYB 3UI2A 4FF2A 3KYHC 4KK7A 2OTJA 4LK1C 3V2TA 4IURA 3QO2A 1K83H 1TY2A 3WOEA 2RHQB 1UE1A 1MIUA 2KCTA 2E2DC 1EL0A 3KJPA 4KHPL 1SN8A 4RCOA 1X32A 3I72A 4IFDI 1L1OC 1GKHA 1QUQB 2AQ1B 3NQIA 5I2YA 1I6HB 3TP6A 1DCZA 3AMUA 2DNCA 1PFBA 3GTOH 2PI2E 4N8X1 1X9NA 2AWOA 2NVTB 3MEHA 4DV7Q 4LF6L 5LMUQ 4R4IA 3R2TA 3CCQA 4OO1H 4BXXG 3KFUA 2NBFA 2EOTA 1UE7A 3NBHA 3FPUB 5E4XA 4HJ7A 4A93B 3M4PA 2E74C 2SOBA 1YNJC 1EY7A 5FK9C 4A75A 3CMEA 1QJOA 3Q22A 1SYBA 3X3NA 2KHSA 3IFDA 4A3EB 3BJUA 3OOCA 3PO2H 2JA8B 3RLOA 3S16B 1E24A 1H9SB 3M7NA 1K73C 2RSNA 4KKUA 4EQ5A 3IAYA 1QVCA 3GTJH 2PI2A 3HKZE 3IRBA 1Z47A 2EYHA 2F0PA 4LFBQ 1BCPB 4FDBA 1IHZA 4CJ1B 4YY3Q 1JB7A 1DONA 2KQ3A 4DV3Q 4C3IG 4DUZQ 1BBXC 3MAQA 4XYOA 5C4JH 1CQVA 1VMPA 1U4MA 1Y1WG 1A63A 1HZCA 1Y8PB 1F2MA 2VB2X 2K01A 2ZXPA 2C35B 3W2DA 3OTOQ 2AKWB 1KAAA 1NR4A 3R3OA 2AUJD 1L1OA 3I73A 1SYDA 4K0KL 3KDFB 1RCVD 2XWJB 1PXUA 1QZHA 4L5QA 3JC66 4KY6A 4CKEA 3NXWA 2QA4A 3OW2A 4X62L 3D0FA 2H1EA 2WFWA 3U4VA 2A68D 5M3FG 1FGUA 5M5YH 4UP7A 4ZQ3A 1K3RA 2Q2HA 1N36Q 1FNWA 4BY1H 2QF7A 2JQOA 1TQOA 3Q24A 3AU7A 3FRPB 3GTKB 1VQ8A 3R8BA 2JA9A 2PO4A 3MZ5A
chains in the Genus database with same CATH topology
2JXMB 3TP5A 2CQAA 4J6HA 3SXHA 1TS3A 4F88A 1ENCA 1LT6D 4ZRZA 5ELFA 4UAIA 3K5NA 3BZDB 1O7YA 1TWAB 2F0SA 4S3SA 1EYCA 4IFDG 1HQRD 1DYQA 5LL6X 1BXTA 1SYFA 1UUPA 3NWTA 3Q6SA 5EKKA 5C4XB 3L3OC 3T16A 3MFGA 1GHJA 3ND9A 4A3GB 2BCOA 4XYQA 3W3AA 3KUPA 4PMBA 2IT1A 2PQEA 1VDZA 1SDFA 4CBVA 5FO9B 3A7LA 3DWPA 2R92B 3NHHA 4DA2A 4IUNA 3GTGB 2HUGA 2PPBC 4E6IA 1CA6A 5T1GA 4G4KA 2TMPA 2PW7A 4KD4A 2F3WA 3K5MA 2AUKA 3I4MB 2F0FA 2KA7A 3MXPA 4PMCA 4RGTA 1LTSD 3C2PA 3M85A 2EYLA 5C3EB 2NTTA 2Q8IB 4PV1C 1F9PA 5CV8A 1AN8A 1FNUA 2WKCA 1TWCB 2Z8LA 2MJ8A 3L9AX 3T13A 5IGBA 2PW5A 3QG1A 1TS2A 5EKIA 2N55A 5COYA 4K2LA 1XYIA 2MPMA 4XIGS 4HMIA 2SNSA 5BN4A 3G6JB 4OGQC 2IX1A 4ZK9B 2O5JC 1SMYC 4M8AA 1S5FD 1WTXA 1AEXA 5CV9A 1A2TA 3RZDB 3NE5B 2N88A 1LTTD 2K5WA 3S17B 1FR3A 3VR3A 5CBAE 5C3XA 4ZKBB 1RD9D 1MGSA 1BCPF 2BDNA 2A68C 3NTIA 5CR3A 4A3JB 4DNTB 4IUQA 1TIID 1KLUD 1SNPA 1JWSD 4R8IA 2E2IB 1O7ZA 5FOBB 5JVG3 2QCPX 5IT9E 1NAPA 3OMCA 4RFBA 2G9DA 5ELCA 1JQYD 3GP7A 2DNEA 2K32A 2BA0A 2H4OA 4K5XA 2M2LA 3DM1A 3VR4A 2B2TC 3H6MA 5KNDA 3K5OA 1EY4A 3P1HA 3TP7A 1H9KA 1EEFD 2Z4HA 3IFTA 1PRTB 5DAUA 1JWMD 1TS4A 3NBIA 3K6OA 5EQ0A 4A3FB 3RZOB 3CKIB 2YYZA 4J1MA 4HCSA 5C3WA 5HURA 1I4RA 4CHTB 1EIGA 1XXGA 1Y1VB 1LV9A 3QOJA 1BCPC 2F0MA 3VR2A 3D3RA 1UNSA 4F87A 1ZKOA 4MIUA 1OXSC 2OXPA 2KCCA 5D3IB 1PTOD 3A8KE 5E3FA 1TY0A 2J7ZA 3I4LA 1H9MA 4FF3A 3EJIA 1I4PA 1EY0A 1IL8A 1EY8A 1GUWA 1EU3A 4I65A 2O5IC 3HOXB 1SBBB 1AZPA 1SNMA 2A6EC 1Q1EA 2E2JB 1JOQA 2B2TA 2F03A 5KEEA 3KBXA 1TVXA 1S5CD 5BN5A 4MN3A 3I4NB 3TSSA 1D5MC 1QWYA 3QWNA 4L63B 2JSOA 3GV6A 4Y7NB 1V8QA 3PUZA 4QUCA 1ESRA 1ENAA 1YNJD 1Q3LA 1CQFA 4X3UA 3DUZA 4EQPA 3BVGA 1II3A 3C1EA 3SK4A 2EPBA 5M9OA 5BN3A 1ICWA 2F0HA 4BY7B 3HOVB 4Q5VA 5KIXA 4ABNA 3MXGA 3GTMB 3LNNA 3G7LA 1EFID 4JK1C 1V43A 2D2CC 1JORA 1PFNA 1G91A 4OHJA 4X3SA 3I90A 3KLSA 2X6GA 4C56C 1MSGA 3CQZB 1C8CA 1DJRD 1NUCA 3H0GB 3PUXA 1AZQA 2VB3X 1EZ8A 1F2ZA 1F9RA 1MBYA 2NVYB 2FINB 2B2YC 2L11A 1NR2A 2PZTA 2B8FA 2JYOA 3HG9A 4DAVA 3K57A 2F0DA 4QUFA 2EJFC 5KNBA 2Q8TA 2K04A 4IALA 3HS0C 1KLGD 4DFAA 4XQJA 4B08A 2O2LD 5IODA 1D5XC 4A3IB 2EDGA 1QB5D 2JEBI 1BNZA 3S14B 5DM73 5ELDA 1STGA 5CGKA 4G7ZC 1TWFB 2JA6B 5IT9L 2RDHA 4HAEA 2EJMA 3O13A 4FO2A 2K7VA 1PLFA 5J1ZA 4HEDA 5EJWA 3S15B 1PRTF 1EQTA 1HTLD 4RGMA 5FO7B 2EE1A 3H09A 1WD1A 2EY6A 1E0BA 2BA1A 4ULLA 3OPOA 1GUNA 2Y0SB 2XIWA 1OXXK 4NKLA 2B2YA 4EQNA 4K6LA 4K5WA 1JICA 2JA5B 3OSOA 2K5QA 3BS1A 1WTVA 1WTPA 1QE6A 2F0KA 5C0XH 1HQMC 5KNCA 2OEOA 2LY7A 2RDFA 5IGGA 3OHXC 3I8ZA 2EY1A 4KHVA 1TKWB 2B2UA 5TSSA 1DOKA 2DY7A 5KRUA 4ZLTF 1PRTC 2WV6D 4DXFA 5JPNC 3BDCA 2VXWA 1GJXA 3TZDA 5I4DA 3NUCA 5EPKA 3A54A 2EVBA 4KV6A 1FYCA 5D14A 4K6DA 5LHY1 1HUNA 1KNAA 1SMYD 4IN3A 2CVRA 4H7BA 3FPPA 5EBDA 2RKSA 3HP3A 1L0YB 5HGTA 3CRKC 4KHZA 3C46A 5IOCA 2K6AA 3MTSA 2QILA 1Y69U 1FNVA 4K2KA 3OW7A 5IGFA 4H0LC 1CTMA 1TR5A 1MD2D 5EKLA 3X3MA 2LFNA 2BE5C 4FF1A 1Y1WB 4BBRB 2L55A 5IGEA 4HSPA 3A56A 4U68A 4F8MA 2IPKD 4EVOA 2XWBB 4DNRB 2F0UA 3K58A 2F1MA 1WVLA 3QJYA 5CYUA 2L1BA 2A6HC 5M3FB 2F3VA 3SEBA 5EPLA 3ZYYX 3M7GA 4NW2A 2NVXB 3J7AV 1EYDA 4FP5D 1LTBD 4V0BA 2R93B 2V4DA 1KDAA 5M5XB 1SNOA 3VR6A 5J22A 3M3YB 1PZJD 3NPPA 1JE4A 3HOYB 1RJTA 1J9OA 1Q1BA 4KI0A 4EQOA 5I9OA 1GUGA 1BCPD 3U9SA 1RHPA 1X3QA 4HCEA 2XSCA 3N6RA 2NTSA 1SYEA 3MWYW 1AP0A 4KN4C 4RHSA 2JP1A 3GO5A 1T5XD 1XTCD 1U9RA 5DM63 3SK5A 1EWHA 1ML0D 3BVMA 3NWSA 3SVMA 2A69D 2L5TA 1I4GA 1VF7A 4G7OC 1CZWA 1RKNA 1ILPA 2A6ED 2WKDA 4K5VA 4M1UB 2NYZD 1WTQA 3S9WA 1QOHA 1TS5A 3A8JE 3PIO3 1QCBD 1UAPA 5G3LF 3S2HB 3DMUA 2PZWA 1AFPA 1Y8OB 1TWGB 5CV4A 3OWEB 2RSOA 1LTRD 3K7AB 5JVH3 2EYMA 4UDUC 2PCFB 2VNUD 3OIQA 2K5DA 3FDTA 1PYWD 1DZ1A 3ND8A 4CKCA 1I4HA 1EYAA 4IUVA 4A3MB 4G57A 2D62A 2XN9C 4C3JG 4R8NA 2Q8RE 1B44D 2WAQB 1SAPA 5C44B 1KDCA 4XDXA 1G2TA 2F0GA 4C3HG 1GUOA 1CHPD 3RD4A 2XNAC 3HOWB 5EPJA 1B4OA 1FGBD 3E0JA 5JEAH 1BO0A 3RUZA 1ONLA 4DGZA 3IL8A 2FJ2A 1C4QA 3PIP3 3C1FA 5CV7A 3MA2B 3PUVA 5KYLA 3S1MB 1LT3D 2R7ZB 3HZXA 2KCNA 4TQUS 2J0TD 3C3LA 2RBMA 3H3VC 2HCIA 4FXGC 5JAVA 1HFGA 2NWGA 2RDGA 3HEJA 1TWHB 5I9PA 4BA2I 2JE6I 4IFDH 2NVQB 3A8IE 5M3MB 4OL7A 2B63B 1EWCA 3MVVA 1BOSA 5FLXE 3K0YA 5C0XI 1SJHD 2RQXA 2O4XA 3I3CA 2EJGC 4FVMA 4OO1I 3HKZB 3BDLA 1STHA 3P20A 4A3KB 4LJZC 3N52A 2A5HA 2C5CA 4XTCS 1H9RA 2HDMA 2G9HD 2JEAI 4FNFA 1IYVA 1T5EA 4BS9A 3T4AC 1LTID 5AFWA 4BBSB 2IWHA 1RODA 4OIJA 1EIHA 3M4OB 1RF2D 3I91A 3D4RA 4OIKA 2NN6H 1BDOA 1QNUA 3D4DA 2EY5A 3MXNA 2KJXA 3HOZB 2EYPA 1JB3A 1U4RA 2EYJA 4CJ2C 1E2VA 5E1FA 2F0QA 5EGTA 2A69C 2MP1A 4XT1B 3LWEA 4X3KA 5M5WB 3FMCA 1B50A 2BDOA 1CM9A 5CORA 4HTHA 3Q23A 4KTAA 2KUMA 1ZXTA 5E4WC 1YNNC 1NCVA 1KABA 1A3VA 5D3DA 1OO9B 1SE3A 2L4NA 4C1NI 3MHBA 1STAA 3DWQA 1H9SA 4RA8A 2ID0A 1HA6A 1KDBA 2OT2A 1QILA 1E2WA 3T51B 2F0EA 1PRTD 1S5BD 3URYA 4CGYB 4TRDA 4ZUIA 5C0XG 2SNMA 4MHEA 4OO1G 1B9NA 4C2MB 3H91A 4LAAA 2J4XA 2F0TA 2ZXRA 1U4PA 1MSHA 3J80E 3A7AB 3S2DB 4B9WA 1JWUD 2IX3A 1CA5A 1STBA 2A74C 5CC4A 1OXUA 3VYTA 1SE4A 3SK6A 4HMJA 4K8IA 4R9WA 1B3AA 3HOUB 1BQQT 3SHLA 3DEPA 4IUPA 1EU4A 2BE5D 1Z6HA 2WB1B 3EROA 1QG7A 1LLRD 3TP8A 3CU7A 1R4PB 5K5PA 4IZ8A 4PNYA 2M00A 2F0WA 4FYDA 4DAYA 2LKVA 5C0XJ 1PMRA 3A55A 2A6HD 2EYFA 2QDBA 3FEWX 3GQBA 3D6CA 2NZ1D 5C4JB 5K36H 1OXTA 2B2UC 2F0IA 1RDPD 3LWUA 1GHKA 5T1IA 1EY9A 3VR5A 2I46A 5FLXL 3GTPB 1HRJA 4QCLA 1SNCA 3VA7A 5C5MA 2M9VA 2R3ZA 3QOLA 1G8ZD 1K8OA 2X6LA 4DU9A 3WOFA 3V05A 1SYGA 4HN7A 3AB9A 1W6JA 3NP8A 3MXUA 2Z1CA 3EFXD 5CBEE 5KYIA 1GUTA 3ITPA 2K05A 3U9OA 4RH6A 2K28A 3L7ZC 1Y8NB 1Z7TA 2IJ0A 2E76C 4WORA 3EQLC 3S1QB 1SJED 4NDXA 4RAUC 3HRZC 1O80A 1QNKA 3E5SA 2WACA 2I07B 1LTAD 2F0LA 4B9XA 1D2BA 2BOSA 2X69A 1S5ED 3MFYA 1IKMA 4WJWA 1I3QB 3DEOA 1W6KA 3VYSA 4DN4M 2QKIC 2F0NA 1HXYD 3SDZA 1ESFA 4QF4A 1ZYRD 1VCIA 1H9JA 1AW7A 3R2IA 2SDFA 4ZUJA 3S1NB 4BWGB 2PMZB 1V1PB 1F9QA 1D5ZC 2RVLA 5DEHA 3DWAA 3D8GA 4KKSA 4TSSA 4J8QA 1CHQD 1UEAB 3HGBA 1C48A 4N9PA 5C6AA 1TT2A 4L6TB 1SFOB 2B2VC 1PDQA 3TMEA 1PFMA 1WTWA 1TU2B 1ET6A 1G6ZA 2PYKA 4DXGA 1LACA 1F2YA 5F2DA 3VYRA 1LT4D 2NN6I 5IIFA 4C3IB 3T53B 5ELBA 1DOLA 5G3LD 1EZ6A 4KMUC 1STNA 2XRQD 1I50B 1BUVT 1L0XB 3GD7A 1A15A 4RHRA 2AQ3B 5JEAG 2AWNA 3ERQA 3J80L 3JAME 1EQVA 1JCKB 1M8AA 2K03A 5EBCA 5I6WA 2HDLA 2WP8J 1D1IA 1GUSA 4YIJA 2HQEA 3PMFA 3TN2A 2K1BA 3ONAB 3V96A 1D1KA 1X3PA 1STEA 2QEJC 1WTRA 1RTNA 2FHTA 3S1RB 1B1ZA 3I70A 2B2VA 4EGVA 1G291 3D6WA 1EY6A 1ET9A 2KEDA 2EXZA 5KGUA 1G2SA 4KJNA 1STYA 1LABA 2R61A 1CK1A 1ZEQX 4PMWA 1SEBD 2F0JA 4X3TA 3KLSX 3PO3B 3FVQA 1LT5D 1K8MA 4I7ZC 4CJ0B 2EY2A 4TKOB 5JEAJ 3DHQA 2AQ2B 2CW0D 4NP5A 2RA4A 4ME5A 3OWFA 1S4ZA 1HA5A 2KECA 1LO5D 3GV3A 2CHBD 1MI2A 1YNND 4RKLA 5IGCA 4RGOS 1GXDC 1BF4A 1A2UA 2NN6G 4IFDJ 2F4IA 4QIWB 1JC7A 1IKLA 4ID6A 3PUWA 3J81E 1WCMB 2PZUA 1F9SA 1ZYRC 1F2LA 3KLRA 3T56B 1ILQA 1CZGA 5A35A 2WINB 1O7LA 1CFMA 5NUCA 5ELEA 3D31A 2GA4B 4A3BB 2YU9B 3PV0A 5ISRA 1I6VC 3BG3A 3OIPA 4C1NK 1SYCA 5A2QE 5D65A 1EEID 4FXDA 4KY5A 4KKTA 1HCZA 1R9TB 3MC0B 4C3JB 2DY8A 3P75A 2B39A 4XQNA 2EYOA 1VMCA 4ZYSA 1PTOB 4XQQA 2F0VA 4C3HB 1Q12A 1JR0D 3J7YW 2F0OA 5C5LA 5I6YA 2ENBA 5FKAC 4O1NA 5FO8B 2E75C 2L0CA 4DK1A 1Q90A 2KEEA 4H13C 5JPMC 1DOMA 1NSNS 3CRLC 1M4VA 4HR7B 1D6EC 3SR1A 1CI3M 2HCCA 4U673 4Z9CB 2LMCB 5CV5A 3WDNA 3NTKA 1XX8A 2SEBD 4RWSC 3KF8A 3GTQB 4ZKCB 1SE2A 3FKIB 1JOKA 1Q8IA 3H94A 3VA5A 1HTPA 3M4YA 5JOBA 2D5DA 2OF1A 3JAML 1DM0B 3DXJC 2XVSA 3KK7A 2EZVA 4KJOA 3EVQA 3F2UA 4IQZA 4H44C 2MHVA 4ODGA 4ZAIA 1HFNA 4QMGA 1WD0A 3GTLB 1VF5C 4IUTA 2A73B 2CW0C 4F7XA 1OXVA 2B8GA 3K59A 2VUMB 2IW3A 4K14A 2ZT9C 4A3DB 5K36G 1J8IA 1IW7D 1BR9A 1B9MA 3RLFA 1S5DD 4QB4A 1F77A 2FFKB 4KY7A 2L12A 3K5LA 3SE0A 3P7JA 1GOZA 4CKBA 2XRSD 1SNQA 5C4ZA 4WFN3 1V1OA 1HPCA 1PZID 1U4LA 1RTOA 1I4XA 1E2ZA 1B2TA 1V1PA 2JA7B 4WRDA 3SK8A 1PTOH 1SSOA 1R4QB 4Q0FA 4O42A 2B2WC 5CMDA 1O78A 3KBGA 4K8JA 5LL6S 5DNFA 4RGNA 3QIAA 3BDOA 2TSSA 3R93A 1HHVA 4XT3B 4G7HC 1K83B 2DN8A 3RMHA 4GZYC 2ZXOA 4FF4A 3TBIB 3NQTA 3J81L 4BA1I 3LX0A 1WTOA 2ICIA 1EY5A 3OMGA 1ENFA 3NSWA 4IUUA 4P2CB 2IX0A 2R6GA 1I4QA 3GTOB 1XWEA 1A3UA 2C9OA 4RKBA 4ILWA 3NK9A 4FXKC 5A2QL 1HUMA 2LS01 1LTGD 3J7AF 4HSVA 3TZUA 4L8JA 1SXTA 1A6XA 2B2WA 2K33A 4DK0A 1PTOF 3QB3A 2MUYA 3PO2B 1PZKD 2IL8A 3NTHA 2NB0A 2E2HB 5JJZA 2PNRC 3GTJB 3TDQA 4XXEA 5CV6A 1KTKA 3Q0AA 1SNDA 1IYUA 2MGSA 2FMCA 4DAPA 5I2XA 4JBWA 5C4HA 1FD7D 4DF7A 1A3TA 4N9TA 3EA6A 3VYUA 1DXMA 4NMZA 3CHBD 2FMMA 3E6ZX 3BVZA 4KD3A 1DD2A 3D4WA 2D9UA 2NUCA 3BYTB 1EOTA 1CT1D 4KN7C 4PQXA 1JOOA 5M5YB 2L9HA 2ICEC 2KOLA 4BY1B 4AYBB 5J39A 1IW7C 1B53A 4LMQD 2KVMA 1KNEA 4V190 3PUYA 2WIIB 1PTOC 5IGDA 2Z4IA 4RCNA 3IKJA 3BYYB 3UI2A 4FF2A 4KK7A 4LK1C 3V2TA 4IURA 3QO2A 1TY2A 3WOEA 1EL0A 2E2DC 4RCOA 1X32A 3I72A 4IFDI 2AQ1B 3NQIA 5I2YA 1I6HB 3TP6A 1DCZA 3AMUA 2DNCA 1PFBA 2AWOA 2NVTB 3MEHA 3R2TA 4OO1H 2NBFA 2EOTA 3NBHA 3FPUB 5E4XA 4A93B 2E74C 2SOBA 1YNJC 1EY7A 5FK9C 3Q22A 1QJOA 1SYBA 3X3NA 2KHSA 3IFDA 4A3EB 3OOCA 2JA8B 3S16B 1H9SB 3M7NA 2RSNA 4KKUA 3IAYA 1Z47A 2EYHA 2F0PA 1BCPB 1IHZA 4CJ1B 1DONA 2KQ3A 4C3IG 1BBXC 3MAQA 4XYOA 1CQVA 1VMPA 1U4MA 1Y8PB 1F2MA 2K01A 2VB2X 2ZXPA 3W2DA 1KAAA 1NR4A 3R3OA 2AUJD 3I73A 1SYDA 1RCVD 2XWJB 1PXUA 4CKEA 4KY6A 3NXWA 2H1EA 2A68D 4ZQ3A 1FNWA 2QF7A 1TQOA 3Q24A 3AU7A 3FRPB 3GTKB 3R8BA 2PO4A 3MZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAU A;  2EYF A;  3T13 A;  5M9O A;  5IGB A;  3TP5 A;  2QDB A;  4J6H A;  2PW5 A;  3SXH A;  4ZUJ A;  5IOC A;  3D6C A;  2F0J A;  2F0H A;  3P75 A;  4J1M A;  1RKN A;  3TP6 A;  5C3W A;  1ENC A;  4K2K A;  1KDB A;  4OL7 A;  4QB4 A;  5HUR A;  2EY6 A;  5KIX A;  5DEH A;  2EYO A;  4K2L A;  4K5V A;  5IGF A;  3D8G A;  3MVV A;  4KY7 A;  3QOJ A;  3QB3 A;  2F0V A;  1TR5 A;  3S9W A;  4S3S A;  2F0S A;  3MEH A;  4HMI A;  2SNS A;  1EYC A;  2F0E A;  2F0I A;  4NKL A;  2F0M A;  5EKL A;  4EQN A;  4EQO A;  5KGU A;  2EY2 A;  2F0O A;  2O4X A;  1SYF A;  5C5L A;  5I6Y A;  2ENB A;  4N9P A;  1EY9 A;  3DHQ A;  4DGZ A;  5IGE A;  1SNQ A;  5EKK A;  1JOR A;  5C6A A;  1TT2 A;  5C4Z A;  4NP5 A;  4K5W A;  4MIU A;  2OXP A;  3T16 A;  4F8M A;  3TME A;  3BDL A;  3DMU A;  1STH A;  5CV6 A;  1SNC A;  1SND A;  2PZW A;  5CV4 A;  1AEX A;  4ME5 A;  4TRD A;  3OWF A;  5C5M A;  2SOB A;  4K14 A;  1NSN S;  3QOL A;  2EYM A;  4ZUI A;  1EY7 A;  2PYK A;  5CV9 A;  4EVO A;  5E3F A;  3OSO A;  5C4H A;  1F2Y A;  5F2D A;  1SYB A;  2F0U A;  2KHS A;  1A2T A;  2SNM A;  4WRD A;  3SK8 A;  3SR1 A;  4DU9 A;  4DF7 A;  4PMB A;  3EJI A;  1A3T A;  5IIF A;  4N9T A;  2F0K A;  1NUC A;  1EY0 A;  2PQE A;  1EYA A;  1SYG A;  1EY8 A;  4I65 A;  4G57 A;  4LAA A;  4NMZ A;  2OEO A;  2F0T A;  2RDF A;  1EZ6 A;  3NP8 A;  4R8N A;  1EZ8 A;  2F3V A;  4K8J A;  4RKL A;  5IGG A;  5IGC A;  5CV5 A;  5C3X A;  1F2Z A;  1STN A;  2EYH A;  2F0P A;  2PZT A;  1SNM A;  1A2U A;  3C1E A;  3SK4 A;  1KDC A;  2EY1 A;  4KHV A;  5KYI A;  3ITP A;  1IHZ A;  4KD3 A;  4B9W A;  2KQ3 A;  3U9O A;  1EYD A;  2F0G A;  3D4W A;  2F0D A;  2NUC A;  3NHH A;  5CR3 A;  5HGT A;  1STB A;  1JOQ A;  4IUN A;  5CC4 A;  3ERQ A;  4IAL A;  5KEE A;  4ID6 A;  5KRU A;  4DFA A;  1JOO A;  4E6I A;  1KDA A;  3SK6 A;  1EQV A;  4HMJ A;  1SNO A;  3BDC A;  4K8I A;  4WOR A;  1F2M A;  1SNP A;  2PZU A;  5I6W A;  2PW7 A;  3D4D A;  5J22 A;  5IOD A;  2EY5 A;  1JOK A;  3VA5 A;  4KD4 A;  2F3W A;  4NDX A;  1KAA A;  4YIJ A;  3R3O A;  3RUZ A;  2F0F A;  2EYP A;  3E5S A;  1SYD A;  2HQE A;  2WAC A;  3MXP A;  4PMC A;  2EYJ A;  3PMF A;  5JOB A;  5EGT A;  5E1F A;  2F0Q A;  2F0L A;  4B9X A;  5I9O A;  5J39 A;  2OF1 A;  3SHL A;  2EYL A;  3NQT A;  3OMC A;  4KY6 A;  5NUC A;  3LX0 A;  3NUC A;  3NXW A;  3C1F A;  5CV7 A;  4KV6 A;  5IGD A;  3ERO A;  1EY5 A;  3OMG A;  4KJO A;  5CV8 A;  3TP8 A;  4HTH A;  4K6D A;  3EVQ A;  5KYL A;  1STG A;  4KTA A;  5CGK A;  3HZX A;  5K5P A;  4IZ8 A;  4ODG A;  5ISR A;  4PNY A;  2M00 A;  2F0N A;  1SYE A;  4H7B A;  3V2T A;  1SYC A;  2F0W A;  2RBM A;  4QMG A;  1ENA A;  1KAB A;  4K5X A;  4ZQ3 A;  1A3U A;  2RKS A;  5JAV A;  1A3V A;  2LKV A;  5J1Z A;  3H6M A;  4QF4 A;  4RKB A;  4F7X A;  1EY6 A;  1U9R A;  1EY4 A;  1TQO A;  3HEJ A;  3P1H A;  2EXZ A;  1II3 A;  3TP7 A;  4EQP A;  5I9P A;  3MHB A;  3NK9 A;  4KJN A;  1STA A;  1STY A;  3SK5 A;  3MZ5 A;  4KY5 A; 
#chains in the Genus database with same CATH topology
 2HHH L;  2JXM B;  3TP5 A;  2CQA A;  4J6H A;  2R93 G;  3SXH A;  4B3M Q;  1TS3 A;  4F88 A;  3HOY G;  1ENC A;  1LT6 D;  4ZRZ A;  1G6P A;  1LYL A;  5ELF A;  1IBK Q;  4UAI A;  3K5N A;  3BZD B;  1O7Y A;  1TWA B;  2F0S A;  4S3S A;  4JVZ A;  2UUA Q;  1EYC A;  4IFD G;  1HQR D;  1DYQ A;  5LL6 X;  3AYH B;  1BXT A;  2MQH A;  1SYF A;  3AQQ A;  1UUP A;  1KAW A;  3NWT A;  3Q6S A;  5EKK A;  3RR5 A;  5C4X B;  4LF5 Q;  3L3O C;  3T16 A;  4GN5 A;  3K7U C;  3MFG A;  1I6H H;  2K14 A;  1GHJ A;  3ND9 A;  4A3G B;  2BCO A;  4IJH A;  4XYQ A;  4HJ5 A;  2Z6B A;  3W3A A;  3J7Z C;  3KUP A;  3CW2 C;  4PMB A;  2IT1 A;  2NVT H;  2PQE A;  1VDZ A;  4JI7 L;  3A5Z B;  1SDF A;  4CBV A;  2MNA A;  2VY3 A;  2E5L L;  5FO9 B;  3A7L A;  3DWP A;  2R92 B;  2QEX A;  3TQY A;  4A93 H;  2B29 A;  3NHH A;  4DA2 A;  4IUN A;  3EBE A;  3GTG B;  2HUG A;  2PPB C;  1YJ9 A;  4E6I A;  4A3E H;  5T1G A;  1CA6 A;  2XTI A;  4G4K A;  2TMP A;  2PW7 A;  4N8F A;  2JA8 H;  4KD4 A;  2F3W A;  3K5M A;  3S16 H;  2AUK A;  3I4M B;  2F0F A;  4RG1 A;  2KA7 A;  3MXP A;  4PMC A;  4RGT A;  1YVC A;  4JBM A;  4JI2 Q;  1LTS D;  3C2P A;  3M85 A;  2EYL A;  5C3E B;  4DR5 Q;  2NTT A;  2Q8I B;  1JT8 A;  4PV1 C;  1F9P A;  3MEF A;  5CV8 A;  2LSS A;  1AN8 A;  4A3M G;  3J81 c;  1FNU A;  2WKC A;  1TWC B;  1HJP A;  2WAQ G;  1N32 Q;  3K8A A;  5C44 G;  2KEN A;  1Q8K A;  1NMF A;  4A4I A;  3I56 A;  5IYD H;  5LMU L;  1A8V A;  2Z8L A;  2MJ8 A;  3L9A X;  1RIP A;  3T13 A;  5IGB A;  2UU9 L;  4NXN Q;  2PW5 A;  3QG1 A;  1G51 A;  1NE3 A;  1TS2 A;  5EKI A;  1S3O A;  2CQO A;  2N55 A;  5COY A;  2VQF Q;  4K2L A;  5IWA Q;  2IY5 B;  1XYI A;  2MPM A;  3KF6 B;  4OON A;  4XIG S;  4HMI A;  2SNS A;  1NJI C;  5BN4 A;  3G6J B;  4OGQ C;  1SRO A;  3GTK H;  2IX1 A;  2PQA B;  2R7Z G;  4ZK9 B;  2O5J C;  1SMY C;  4M8A A;  1S5F D;  1WTX A;  4IOA A;  1AEX A;  4LFB L;  5JJL A;  5CV9 A;  4YY3 L;  4DV3 L;  1A2T A;  4DUZ L;  3RZD B;  4IOC A;  3NE5 B;  1TWA H;  5ELN A;  2N88 A;  1LTT D;  2K5W A;  4OX9 Q;  3S17 B;  4GLA C;  3OTO L;  1FR3 A;  1VQ4 A;  3VR3 A;  5CBA E;  5C3X A;  5C4X H;  1CSP A;  5M3M G;  4ZKB B;  1RD9 D;  1MGS A;  2VL6 A;  1BCP F;  1CSQ A;  2BDN A;  2A68 C;  3CPW A;  3NTI A;  5CR3 A;  4A3J B;  4A3G H;  4DNT B;  4MTN A;  1QVF A;  4RMF A;  3STB C;  3E0E A;  4IUQ A;  4PZ7 A;  5FLM G;  1TII D;  3PO3 H;  1KLU D;  1VQL A;  1SNP A;  2BH2 A;  1JWS D;  4R8I A;  4B3R Q;  3I2Z A;  3HKZ G;  3A5U A;  1O7Z A;  5IP9 G;  4A3K G;  4DV0 Q;  5FOB B;  5JVG 3;  2E2I B;  2DJG C;  2QCP X;  1N36 L;  5IT9 E;  1NAP A;  3OMC A;  4RFB A;  2G9D A;  3G48 A;  2R92 H;  5ELC A;  1JQY D;  4B3M L;  3GP7 A;  3DLL A;  1QZG A;  2DNE A;  3TEH B;  3GTG H;  2K32 A;  2BA0 A;  2H4O A;  2UXD Q;  4LUZ A;  4GNX B;  4K5X A;  5IYB H;  1JE5 A;  1PH4 A;  2M2L A;  3DM1 A;  1IBK L;  3VR4 A;  2B2T C;  3H6M A;  5KND A;  3I4M H;  3K5O A;  4BBS G;  1EY4 A;  3P1H A;  3TP7 A;  1H9K A;  1EEF D;  2Z4H A;  3IFT A;  1PRT B;  5C3E H;  5DAU A;  1JWM D;  1TS4 A;  3NBI A;  4JBJ A;  3K6O A;  5EQ0 A;  4GKJ Q;  4A3F B;  4LF5 L;  3RZO B;  3CKI B;  2YYZ A;  3NEM A;  4J1M A;  4HCS A;  5C3W A;  5HUR A;  1I4R A;  4CHT B;  3Q8D A;  3HOZ G;  1N34 L;  2VUM G;  1EIG A;  1XXG A;  1Y1V B;  1LV9 A;  5ELO A;  3QOJ A;  4A3D G;  4POG A;  1BCP C;  2F0M A;  3VR2 A;  3D3R A;  1UNS A;  1MJC A;  1HR0 Q;  2HD3 A;  4F87 A;  1ZKO A;  4MIU A;  1OXS C;  2OXP A;  3E3X A;  1I94 Q;  2KCC A;  3VDY A;  2YU9 H;  1BKB A;  1UE6 A;  1VQF A;  4IPC A;  5D3I B;  1ASY A;  1PTO D;  5L37 A;  4GN4 B;  3A8K E;  5E3F A;  1TY0 A;  1YIJ A;  4QGU A;  2J7Z A;  3ERS X;  1S72 A;  3I4L A;  5DLQ E;  1H9M A;  5GAD C;  1B7Y B;  4FF3 A;  3EJI A;  1I4P A;  4DUY Q;  1EY0 A;  1IL8 A;  2CCZ A;  1EY8 A;  1GUW A;  1EU3 A;  4I65 A;  4ME3 A;  3CCU A;  3AEV A;  2O5I C;  3HOX B;  4JI2 L;  1SBB B;  1AZP A;  1SNM A;  2VS1 A;  2A6E C;  1Q1E A;  4DR5 L;  1PH6 A;  2E2J B;  1JOQ A;  2B2T A;  2F03 A;  5KEE A;  2K50 A;  3RZD H;  3KBX A;  1VQ9 A;  4LF6 Q;  1TVX A;  1S5C D;  5BN5 A;  4MN3 A;  4GS3 A;  3S17 H;  3I4N B;  3TSS A;  2GVA A;  1KXL A;  3HFZ B;  2VW9 A;  1KC8 C;  1D5M C;  1QWY A;  3QWN A;  1VS0 A;  4L63 B;  2JSO A;  3GV6 A;  4DR3 Q;  4Y7N B;  1V8Q A;  4EX5 A;  4NXN L;  3PUZ A;  1C7Y A;  1LTL A;  3U4Z A;  4DK6 C;  3I55 A;  4DV4 Q;  4QUC A;  1ESR A;  4X66 Q;  4OWT B;  1ENA A;  1YNJ D;  2N3S A;  2VQF L;  5IWA L;  1Q3L A;  1CQF A;  4LF9 Q;  4X3U A;  2E2I H;  3DUZ A;  4AIM A;  3SGI A;  4EQP A;  4JV5 L;  3BVG A;  1II3 A;  3PF5 A;  4A3L G;  3C1E A;  3SK4 A;  4R4T A;  2EPB A;  2XGT A;  5M9O A;  3JAM i;  4P75 A;  5BN3 A;  1ICW A;  2F0H A;  4BY7 B;  1VQH A;  3HOV B;  4Q5V A;  5KIX A;  3HOU G;  4ABN A;  1D8L A;  3J81 j;  3MXG A;  2HT1 A;  4NB3 A;  3GTM B;  3LNN A;  4P72 A;  3G7L A;  4JI3 Q;  3FKI H;  1PYB A;  1EFI D;  4JK1 C;  3I4O A;  2WB1 G;  1V43 A;  1X3G A;  2D2C C;  2HIX A;  2OQ0 A;  1JOR A;  4OX9 L;  2YTY A;  1X65 A;  1PFN A;  1G91 A;  4A3F H;  2K75 A;  4OHJ A;  3RZO H;  4X3S A;  3I90 A;  3KLS A;  2X6G A;  4C56 C;  1MSG A;  1GM5 A;  2HQL A;  1PH8 A;  3CQZ B;  1C8C A;  1Y1V H;  1YHQ A;  4H02 A;  1DJR D;  3LGJ A;  1NUC A;  3H0G B;  3PUX A;  1AZQ A;  2VB3 X;  2AHO B;  4B3R L;  1EZ8 A;  2IHF A;  1F2Z A;  1F9R A;  1MBY A;  2NVY B;  2FIN B;  2B2Y C;  1CKM A;  2L11 A;  1NR2 A;  2PZT A;  2B8F A;  2JYO A;  3HG9 A;  4DAV A;  1KRT A;  3K57 A;  2F0D A;  1CKN A;  4QUF A;  2EJF C;  5KNB A;  1QVG A;  4LUO A;  2Q8T A;  2K04 A;  4IAL A;  3HS0 C;  1KLG D;  4DFA A;  4XQJ A;  3ICE A;  4B08 A;  1E1T A;  1NTG A;  1TXY A;  2O2L D;  5IOD A;  1D5X C;  5J3B A;  4A3I B;  2UXD L;  3F2C A;  2EDG A;  4JI1 Q;  3HOX H;  1QB5 D;  2JEB I;  3CPF A;  1BNZ A;  3CCS A;  3CCE A;  3S14 B;  1X3E A;  2KCM A;  3CCR A;  5DM7 3;  1VQM A;  5ELD A;  1STG A;  4GKJ L;  5CGK A;  2E2J H;  4G7Z C;  1K3B C;  1TWF B;  2JA6 B;  4LUV A;  5IT9 L;  1XPU A;  2RDH A;  4X64 Q;  4L5T A;  4HAE A;  2EJM A;  1NNX A;  1M90 C;  3O13 A;  4PG3 A;  2JA7 H;  4FO2 A;  1MJE A;  2RHS B;  2K7V A;  4JI7 Q;  1PLF A;  4UP8 A;  5J1Z A;  4HED A;  4DR7 L;  5EJW A;  3S15 B;  1V1Q A;  4DV1 L;  1SR3 A;  1IZ6 A;  3BU2 A;  1PRT F;  1EQT A;  1HTL D;  4RGM A;  5FO7 B;  1HZB A;  4Y7N H;  2EE1 A;  3KF8 B;  1ASZ A;  1I94 L;  3H09 A;  4NXM Q;  1WD1 A;  2EY6 A;  1E0B A;  2BA1 A;  4ULL A;  3OPO A;  1VQB A;  1GUN A;  2Y0S B;  3AFQ A;  2JJQ A;  2XIW A;  1OXX K;  4NKL A;  2B2Y A;  5JJK A;  4EQN A;  2L15 A;  4GKK Q;  4DUY L;  4K6L A;  4K5W A;  1JIC A;  1E22 A;  1D7Q A;  2K5V A;  3F2B A;  1N33 Q;  2ZJR A;  2JA5 B;  4BY7 H;  1X56 A;  3HOV H;  3OSO A;  3MXN B;  2K5Q A;  3BS1 A;  1WTV A;  2CWA A;  1WTP A;  3GTM H;  1QE6 A;  3ULJ A;  2F0K A;  3KF6 A;  5C0X H;  1HQM C;  5KNC A;  2OEO A;  4JC0 A;  2LY7 A;  2RDF A;  5IGG A;  4GLV B;  2UU9 Q;  2PNH A;  3OHX C;  3I8Z A;  2EY1 A;  4KHV A;  2PQA A;  1HH2 P;  1TKW B;  2B2U A;  4DR3 L;  3QR8 A;  5TSS A;  1DOK A;  2DY7 A;  3CQZ H;  5KRU A;  4MZ9 A;  4ZLT F;  1PRT C;  2WV6 D;  4DXF A;  3E9H A;  5JPN C;  3BDC A;  1Z9F A;  4DV4 L;  1PH3 A;  4X66 L;  3H0G H;  2VXW A;  4TVA B;  4LF9 L;  1GJX A;  2E2H H;  3TZD A;  1UEB A;  5IE8 A;  5I4D A;  4HIO A;  4A3C G;  2NVY H;  3NUC A;  1KRS A;  5EPK A;  3A54 A;  2EVB A;  1X55 A;  4KV6 A;  1FYC A;  1BVS A;  1JJG A;  5D14 A;  4K6D A;  5LHY 1;  1HUN A;  1AE3 A;  1I5F A;  1KNA A;  1SMY D;  4IN3 A;  2Z0S A;  4OWW B;  2CVR A;  4H7B A;  1FJG Q;  3FPP A;  5EBD A;  4MTK A;  2RKS A;  2V1C C;  3CXC A;  3HP3 A;  1L0Y B;  4HJA A;  1XPO A;  4JI3 L;  1YJW A;  5HGT A;  2ZJP A;  4DV5 Q;  3CRK C;  3TS2 A;  4KHZ A;  1RL2 A;  3K81 C;  5HGQ A;  3C46 A;  3S14 H;  5IOC A;  2E8G A;  2K6A A;  3MTS A;  2QIL A;  1Y69 U;  1FNV A;  1TWF H;  4O2D A;  4K2K A;  2JA6 H;  1WJJ A;  2H5X A;  3OW7 A;  5IGF A;  4X65 Q;  4H0L C;  2MFI A;  1CTM A;  1TR5 A;  3STB D;  1MD2 D;  5EKL A;  3X3M A;  2LFN A;  2BE5 C;  4FF1 A;  1Y1W B;  4BBR B;  2L55 A;  5IGE A;  4R4C A;  2GVB A;  3S15 H;  4HSP A;  3A56 A;  4U68 A;  4F8M A;  2Z6K C;  2IPK D;  4HIK A;  4LFA Q;  4EVO A;  4JI0 Q;  2XWB B;  4DNR B;  2F0U A;  5H1S E;  1Q86 C;  3K58 A;  3CC2 A;  4IPH A;  4JPB W;  1XNR L;  2F1M A;  2ALY B;  4GOP B;  4JI4 Q;  1WVL A;  3QJY A;  5CYU A;  2L1B A;  2A6H C;  2MO0 A;  5M3F B;  4DK3 C;  2F3V A;  1JJ2 A;  2CKZ B;  3SEB A;  5EPL A;  3ZYY X;  3H3V H;  3M7G A;  2K4K A;  4JI1 L;  4NW2 A;  3PO3 G;  2NVX B;  1YJN A;  1J5E Q;  3J7A V;  2KBN A;  2JA5 H;  1EYD A;  4FP5 D;  1N34 Q;  1LTB D;  4DAY B;  4V0B A;  2F4V Q;  2R93 B;  2YTX A;  2V4D A;  4LF4 Q;  1KDA A;  5M5X B;  1SNO A;  3VR6 A;  5FJ8 H;  4X64 L;  5J22 A;  3M3Y B;  3NPP A;  1PZJ D;  1JE4 A;  3HOY B;  1RJT A;  1J9O A;  3ULP A;  1Q1B A;  4KI0 A;  4EQO A;  1PHJ A;  5I9O A;  1GUG A;  1BCP D;  3U9S A;  1RHP A;  1X3Q A;  3UDG A;  4HCE A;  2XSC A;  5IYB G;  3N6R A;  4IPG A;  3I4M G;  2NTS A;  1Q7Y C;  1SYE A;  4NXM L;  3MWY W;  2B3G A;  1AP0 A;  1KD1 C;  4KN4 C;  4RHS A;  2JP1 A;  3GO5 A;  1P8L A;  1T5X D;  2Z6K A;  1XTC D;  1U9R A;  5DM6 3;  3SK5 A;  1EWH A;  4GKK L;  3PGZ A;  1ML0 D;  3BVM A;  3NWS A;  3T1Y L;  3SVM A;  2A69 D;  1EIY B;  2L5T A;  2G5D A;  1I4G A;  1VF7 A;  1WCM G;  4G7O C;  1CZW A;  4BXX H;  1RKN A;  1YHA A;  1ILP A;  2A6E D;  1N33 L;  2WKD A;  4K5V A;  4M1U B;  2NYZ D;  4LFC L;  1W3S A;  1WTQ A;  3S9W A;  1QOH A;  3J80 i;  1A0I A;  2HIV A;  1TS5 A;  3A8J E;  4JI6 Q;  4A3B G;  4DV2 Q;  3PIO 3;  4YWM A;  1QCB D;  1WTH A;  1UAP A;  5G3L F;  3S2H B;  3DMU A;  3ULL A;  4JG2 A;  2PZW A;  1AFP A;  1Y8O B;  1TWG B;  5CV4 A;  3OWE B;  2RSO A;  1VQO A;  1LTR D;  3K7A B;  5JVH 3;  1WI5 A;  2EYM A;  4UDU C;  2VZA A;  2PCF B;  2VNU D;  3OIQ A;  2K5D A;  1YIT A;  3FDT A;  1PYW D;  2UUB Q;  1DZ1 A;  3ND8 A;  4CKC A;  3PCO B;  2RF4 A;  1I4H A;  1EYA A;  4JV5 Q;  4POF A;  4IUV A;  4A3M B;  4G57 A;  2D62 A;  1E3P A;  2XN9 C;  4BBR H;  4C3J G;  4R8N A;  2ES2 A;  2Q8R E;  1MKH A;  3F8T A;  1B44 D;  2WAQ B;  1SAP A;  5C44 B;  1KDC A;  4XDX A;  3TS0 A;  1K0R A;  2F0G A;  1G2T A;  4C3H G;  1GUO A;  1XJV A;  1CHP D;  4LF7 Q;  3RD4 A;  1B8A A;  2XNA C;  1EUJ A;  3HOW B;  5EPJ A;  1B4O A;  1FJG L;  1FGB D;  5AJ3 L;  3E0J A;  5JEA H;  1BO0 A;  3L0O A;  3RUZ A;  1ONL A;  1YNX A;  4DGZ A;  3NBH B;  3ZJY C;  3IL8 A;  5M3F H;  2FJ2 A;  1C4Q A;  3PIP 3;  3PSI A;  3C1F A;  5CV7 A;  4DV5 L;  3MA2 B;  3PUV A;  5EAY A;  5KYL A;  3S1M B;  1LT3 D;  2R7Z B;  3HZX A;  4AQY Q;  2KCN A;  4TQU S;  3CF5 A;  2R93 H;  2J0T D;  3TRE A;  5M5X H;  3C3L A;  2RBM A;  3H3V C;  2HCI A;  4X65 L;  2ZM6 Q;  4FXG C;  5JAV A;  3HOY H;  1HFG A;  2NWG A;  4AYB E;  5IT9 c;  2RDG A;  3HEJ A;  1TWH B;  5I9P A;  4I7A A;  4BA2 I;  3E9I A;  2JE6 I;  4IFD H;  5GRO A;  3PF4 A;  2YTV A;  4YCU A;  2NVQ B;  4PZ6 A;  3ER0 A;  4JYA Q;  3A8I E;  3FKI G;  5M3M B;  4OL7 A;  2B63 B;  2Y0S E;  4LFA L;  1EWC A;  3MVV A;  4JI0 L;  1BOS A;  5FLX E;  3K0Y A;  5C0X I;  1SJH D;  2RQX A;  2O4X A;  3I3C A;  4JI4 L;  3CCJ A;  2EJG C;  4FVM A;  4OO1 I;  4DR4 Q;  4JI8 Q;  3HKZ B;  4L5R C;  3BDL A;  1STH A;  1Q82 C;  3P20 A;  4A3K B;  4LJZ C;  3N52 A;  2OCE A;  4JBK A;  2A5H A;  2C5C A;  1J5E L;  4B3S Q;  4WJ4 A;  1KL9 A;  1PA6 A;  4XTC S;  5IP7 G;  1H9R A;  2HDM A;  1HNW Q;  2F4V L;  4DR7 Q;  1TWC H;  4LF4 L;  2G9H D;  2JEA I;  2N8N A;  4FNF A;  1IYV A;  1T5E A;  1O7I A;  4DV1 Q;  4BS9 A;  1JMC A;  3CMA A;  3T4A C;  3S2H H;  1LTI D;  5AFW A;  2UXC Q;  3F1Z A;  4BBS B;  1TWG H;  2IWH A;  1GD7 A;  3K7A H;  1ROD A;  4OIJ A;  3T1H Q;  1K9M C;  1EIH A;  3M4O B;  1RF2 D;  3I91 A;  1QUQ A;  1L2F A;  3D4R A;  4OIK A;  2NN6 H;  1BDO A;  3HOX G;  1QNU A;  5GAG C;  3D4D A;  2EY5 A;  4MNO A;  3MXN A;  2KJX A;  3HOZ B;  4A3M H;  2EYP A;  1JB3 A;  1U4R A;  2EYJ A;  4CJ2 C;  1E2V A;  5E1F A;  2F0Q A;  5EGT A;  1VQ7 A;  2A69 C;  2MP1 A;  4XT1 B;  3LWE A;  4X3K A;  5M5W B;  3FMC A;  4QJF A;  1B50 A;  1PH7 A;  2BDO A;  1CM9 A;  5C44 H;  1VQK A;  2JA7 G;  5COR A;  4HTH A;  1HZA A;  3Q23 A;  1K28 A;  4KTA A;  2KUM A;  4KLK A;  1ZXT A;  2Z9H A;  4OWX B;  1AE2 A;  4LF8 L;  2QW7 A;  5E4W C;  1YNN C;  3HOW H;  1NCV A;  1KAB A;  4A76 A;  1EQR A;  1A3V A;  2CWP A;  5D3D A;  1OO9 B;  1SE3 A;  2L4N A;  4C1N I;  3MHB A;  4JI6 L;  1STA A;  1PYS B;  3DWQ A;  4DV2 L;  1H9S A;  4RA8 A;  3CCM A;  2ID0 A;  2D0P A;  4GOP C;  1PFS A;  3S1M H;  1PH9 A;  2R7Z H;  1HA6 A;  1XNQ L;  1KDB A;  4A3J H;  2OT2 A;  1QIL A;  1E2W A;  3T51 B;  2UXB Q;  2UUB L;  2F0E A;  1PRT D;  2UUC Q;  2VQE Q;  4BY7 G;  1TWH H;  1S5B D;  3H3V I;  3KDF A;  3URY A;  4CGY B;  1KIX A;  4Y52 H;  2NVQ H;  4GN3 B;  4TRD A;  5IY0 A;  4ZUI A;  5M3M H;  5C0X G;  2B63 H;  4PZ8 A;  2SNM A;  4MHE A;  4OO1 G;  3RNU A;  1B9N A;  4LF7 L;  4C2M B;  3H91 A;  4LAA A;  2J4X A;  2F0T A;  5FLM H;  4HIM A;  2ZXR A;  1U4P A;  1NMG A;  1MSH A;  3J80 E;  4DV6 Q;  3A7A B;  2IHE A;  1B3Q A;  5IP9 H;  3S2D B;  4B9W A;  1JWU D;  2IX3 A;  3PO2 G;  1CA5 A;  1STB A;  2A74 C;  5CC4 A;  1OXU A;  3VYT A;  1IXR A;  4CDF C;  1SE4 A;  3SK6 A;  4HMJ A;  4OXP A;  2A19 A;  4DR2 Q;  4AQY L;  3FHW A;  1CKO A;  4K8I A;  4UPA A;  1SLJ A;  4R9W A;  1XPR A;  1B3A A;  1M1K C;  3HOU B;  1BQQ T;  2ZM6 L;  1DGS A;  1EWI A;  3S24 A;  4GOP A;  3SHL A;  5BR8 Q;  3DEP A;  4IUP A;  1EU4 A;  1IBM L;  2BE5 D;  1Z6H A;  2WB1 B;  4BBS H;  3ERO A;  1QG7 A;  1SRU A;  2N78 A;  1LLR D;  3TP8 A;  3CU7 A;  4LNQ A;  1R4P B;  5K5P A;  4IZ8 A;  3M4O H;  1EOV A;  4JYA L;  4PNY A;  2M00 A;  1XNR Q;  2F0W A;  2Q2T A;  4FYD A;  3U58 A;  4DAY A;  2LKV A;  2I5L X;  3HOZ H;  2DJF C;  4HID A;  1S40 A;  5C0X J;  1PMR A;  3A55 A;  5M5W H;  2A6H D;  2EYF A;  2QDB A;  1N9W A;  1UWV A;  3FEW X;  3F2D A;  4DR4 L;  4P73 A;  3GQB A;  3D6C A;  2NZ1 D;  4JI8 L;  3KJO A;  5C4J B;  4BY1 G;  4HJ9 A;  5K36 H;  2I5H A;  4AYB G;  4DR6 L;  1OXT A;  2B2U C;  4B3S L;  1FL0 A;  1RDP D;  2F0I A;  3LWU A;  1GHK A;  1HNW L;  5T1I A;  3G71 A;  1EY9 A;  1LUZ A;  3VR5 A;  3I4N H;  2I46 A;  1IBL Q;  5FLX L;  3GTP B;  2I0Q A;  1HRJ A;  4QCL A;  1SNC A;  3VA7 A;  3J81 i;  4YHH Q;  5C5M A;  5LMN W;  2M9V A;  2R3Z A;  2UXC L;  3QOL A;  1G8Z D;  1K8O A;  1HNZ L;  2X6L A;  3T1H L;  4DU9 A;  3WOF A;  3V05 A;  1SYG A;  4HN7 A;  3AB9 A;  3UE1 A;  1W6J A;  1EIF A;  4DPG A;  3NP8 A;  3MXU A;  1PH2 A;  5IYC H;  2Z1C A;  3T1Y Q;  3EFX D;  5CBE E;  1NY4 A;  5KYI A;  4B3T Q;  1GUT A;  3ITP A;  2K05 A;  3U9O A;  4CDE C;  4RH6 A;  1U5K A;  2K28 A;  4LFC Q;  2K5N A;  3L7Z C;  1Y8N B;  1X3F A;  2CH4 A;  2QDL A;  1VQP A;  1Z7T A;  2IJ0 A;  2E76 C;  4WOR A;  3EQL C;  3S1Q B;  1SJE D;  4C2M H;  2N49 A;  4NDX A;  4RAU C;  2K5H A;  3HRZ C;  1O80 A;  1QNK A;  3E5S A;  2WAC A;  2I07 B;  4A93 G;  2NZO A;  1LTA D;  2F0L A;  4B9X A;  1D2B A;  2ZTC A;  2BOS A;  2GN5 A;  1B70 B;  2X69 A;  1S5E D;  3MFY A;  1IKM A;  4R1J A;  3UDX A;  4ALP A;  4A3E G;  4WJW A;  4GNX C;  3S2D H;  1I3Q B;  3DEO A;  4A3L H;  4LW1 A;  1W6K A;  2JA8 G;  2F52 A;  3VYS A;  4DN4 M;  2QKI C;  4R4Q A;  2F0N A;  4P71 A;  3UDI A;  1VQ6 A;  1HXY D;  3SDZ A;  1ESF A;  2ATW A;  4QF4 A;  3HOU H;  1HZ9 A;  2UXB L;  1ZYR D;  5JJI A;  1VCI A;  1H9J A;  2UUC L;  1AW7 A;  1SE8 A;  3EN2 A;  2VQE L;  2EQS A;  3UDF A;  3R2I A;  1VQE A;  2SDF A;  4JI5 Q;  4ZUJ A;  3S1N B;  4BWG B;  2PMZ B;  1V1P B;  1F9Q A;  2D0O A;  1D5Z C;  2RVL A;  3G6E A;  5DEH A;  3DWA A;  4IPD A;  3D8G A;  4KKS A;  5IYD G;  4TSS A;  4J8Q A;  2FXQ A;  5AJ3 Q;  3K0X A;  1CHQ D;  1UEA B;  3HGB A;  4P74 A;  2EXD A;  4A3I H;  1C48 A;  4N9P A;  2ZJQ A;  1VQG A;  5C6A A;  1TT2 A;  1HNX L;  4L6T B;  1SFO B;  2B2V C;  1PDQ A;  3TME A;  1PFM A;  1WTW A;  1TU2 B;  4QY7 A;  1ET6 A;  4DV6 L;  1T9H A;  1G6Z A;  2PYK A;  1XMQ L;  4DXG A;  4L5S A;  1LAC A;  2JN4 A;  1F2Y A;  5F2D A;  3VYR A;  4BBR G;  1LT4 D;  2NN6 I;  5IIF A;  4C3I B;  3T53 B;  4DR2 L;  5ELB A;  1DOL A;  5G3L D;  1XMO Q;  1EZ6 A;  4GNX A;  4KMU C;  3BZC A;  3KLW A;  1STN A;  2XRQ D;  1I50 B;  4HJ8 A;  3GTP H;  1BUV T;  1L0X B;  3GD7 A;  1A15 A;  4RHR A;  5BR8 L;  1LM0 A;  1GO3 E;  5E7N A;  2AQ3 B;  3JAM c;  5JEA G;  2AWN A;  3ERQ A;  3J80 L;  3JAM E;  1EQV A;  1JCK B;  1M8A A;  1X6O A;  2K03 A;  5EBC A;  5I6W A;  5C4X G;  2HDL A;  1YHB A;  2WP8 J;  1D1I A;  1GUS A;  1WOC A;  1VQA A;  4YIJ A;  5GAE C;  2HQE A;  3PMF A;  4A3G G;  3TN2 A;  1KQS A;  2K1B A;  3ONA B;  3M9B A;  3CAM A;  3V96 A;  4OEM B;  1D1K A;  4YCV A;  1X3P A;  1STE A;  2QEJ C;  4LWC A;  1WTR A;  1RTN A;  4DNI A;  2FHT A;  3S1Q H;  3H15 A;  3S1R B;  1B1Z A;  3I70 A;  3UE0 A;  2B2V A;  4EGV A;  1G29 1;  2R92 G;  3D6W A;  1EY6 A;  1ET9 A;  2KED A;  2EXZ A;  5KGU A;  1G2S A;  4KJN A;  1STY A;  1LAB A;  1CKN B;  2JK8 A;  2CFM A;  2QGQ A;  2R61 A;  1IBL L;  1CK1 A;  1I3Q H;  1ZEQ X;  4PMW A;  1SEB D;  2F0J A;  4X3T A;  3KLS X;  4O0A A;  4YHH L;  3DM3 A;  2OTL A;  3PO3 B;  3FVQ A;  1LT5 D;  5C3E G;  1K8M A;  4I7Z C;  4CJ0 B;  2EY2 A;  4TKO B;  5JEA J;  3DHQ A;  2A1A A;  2AQ2 B;  2CW0 D;  2CH4 W;  4NP5 A;  3TRZ A;  2ZTD A;  3S1N H;  2RA4 A;  4ME5 A;  3OWF A;  2YV5 A;  1YBY A;  4B3T L;  4LF8 Q;  1S4Z A;  1HA5 A;  1J6Q A;  2KEC A;  1LO5 D;  3GV3 A;  2CHB D;  1MI2 A;  4QL5 A;  1YNN D;  4R4O A;  4RKL A;  5IGC A;  4RGO S;  1SFO H;  1GXD C;  1BF4 A;  1A2U A;  2NN6 G;  4IFD J;  2F4I A;  4QIW B;  1XNQ Q;  1JC7 A;  4A3C H;  1IKL A;  3PQI A;  4DAM A;  4ID6 A;  3PUW A;  3J81 E;  2I5M X;  1WCM B;  2PZU A;  1F9S A;  1ZYR C;  4C3I H;  1F2L A;  3KLR A;  1AH9 A;  3T56 B;  1ILQ A;  4DV7 L;  1CZG A;  1X54 A;  5A35 A;  2WIN B;  1Y1W H;  1O7L A;  1CFM A;  2WB1 E;  1I50 H;  5NUC A;  4X6A H;  1E7Z A;  5ELE A;  3D31 A;  2GA4 B;  4A3B B;  3HOW G;  2YU9 B;  3PV0 A;  4JI5 L;  2P5Z X;  5ISR A;  1I6V C;  3BG3 A;  2OWO A;  3OIP A;  4C1N K;  3CD6 A;  1SYC A;  4OEL B;  5A2Q E;  5D65 A;  1EYG A;  2AMC B;  1IL2 A;  1NBW A;  4DR1 L;  1YI2 A;  2R7D A;  1EEI D;  4A3J G;  4KY5 A;  4FXD A;  4KKT A;  1HCZ A;  1R9T B;  3MC0 B;  4C3J B;  2NVX H;  2DY8 A;  2BH8 A;  3P75 A;  3CP0 A;  2B39 A;  4XQN A;  2EYO A;  1VMC A;  4ZYS A;  1PTO B;  4XQQ A;  2F0V A;  3S1R H;  4C3H B;  3M3Y H;  1Q12 A;  1JR0 D;  3J7Y W;  3CC4 A;  2F0O A;  5C5L A;  5I6Y A;  2ENB A;  5FKA C;  4O1N A;  1IBM Q;  2B63 G;  5FO8 B;  2E75 C;  2L0C A;  1XMO L;  4DK1 A;  1U0L A;  3FP9 A;  1Q90 A;  2KEE A;  4H13 C;  1UE5 A;  5JPM C;  1DOM A;  1NSN S;  2LXK A;  4IO9 A;  3CRL C;  2ZTE A;  1M4V A;  4YCW A;  5FLX c;  4HR7 B;  1D6E C;  3SR1 A;  1L1O B;  1CI3 M;  2HCC A;  4U67 3;  4Z9C B;  2Q2I A;  4A3F G;  2LMC B;  2KHJ A;  5CV5 A;  1VQ5 A;  3WDN A;  1BBU A;  3NTK A;  1XX8 A;  2SEB D;  1Y1V G;  4RWS C;  3EIV A;  1PH5 A;  1PH1 A;  4NPS A;  4DR6 Q;  3BZK A;  1VQD A;  1W2B A;  3KF8 A;  3GTQ B;  1SMX A;  4ZKC B;  1SE2 A;  3FKI B;  1JOK A;  1Q8I A;  3H94 A;  3VA5 A;  1HTP A;  3M4Y A;  5JOB A;  2UUA L;  3RN5 A;  2D5D A;  2OF1 A;  3JAM L;  1MHW C;  1DM0 B;  3G4S A;  3J7A 5;  1P16 A;  2LXJ A;  1K0S A;  3DXJ C;  2XVS A;  3KK7 A;  2EZV A;  4KJO A;  3EVQ A;  3F2U A;  4IQZ A;  1HNZ Q;  4H44 C;  2MHV A;  4ODG A;  4ZAI A;  1VQJ A;  1HFN A;  4QMG A;  1WD0 A;  3GTL B;  1WCM H;  4J15 A;  2RCF A;  5LMN Q;  1VF5 C;  4IUT A;  2A73 B;  2CW0 C;  4F7X A;  1OXV A;  3K80 C;  2B8G A;  3K59 A;  2VUM B;  2DUD A;  1Q46 A;  2IW3 A;  4K14 A;  2ZT9 C;  4A3D B;  5K36 G;  1J8I A;  2PMZ E;  3AFP A;  1IW7 D;  4JOI C;  4A3B H;  1BR9 A;  4ZCK A;  3RLN A;  1B9M A;  3RLF A;  1S5D D;  4QB4 A;  4AH6 A;  2OQK A;  3W5O A;  1F77 A;  2FFK B;  3I4N G;  3CCV A;  4KY7 A;  2L12 A;  2R7F A;  2K52 A;  3K5L A;  4JCV E;  4APV A;  1N8R C;  3SE0 A;  1H95 A;  3P7J A;  1Q81 C;  4KHP Q;  1GOZ A;  3OYY A;  4CKB A;  2XRS D;  3KOJ A;  1SNQ A;  1OTC A;  5C4Z A;  5HY6 A;  4WFN 3;  1YZ6 A;  1V1O A;  1R9T H;  1HPC A;  3W1G A;  1PZI D;  2MO1 A;  4C3J H;  1K8A C;  1PV4 A;  1V9P A;  3A74 A;  1U4L A;  1RTO A;  2RCN A;  1I4X A;  1E2Z A;  1B2T A;  5IYC G;  1V1P A;  2JA7 B;  4WRD A;  3SK8 A;  1PTO H;  1SSO A;  3RN2 A;  1R4Q B;  4Q0F A;  4O42 A;  4C3H H;  4IJL A;  2B2W C;  5CMD A;  1N32 L;  2NZH A;  3B6Y A;  1O78 A;  3KBG A;  4K8J A;  5LL6 S;  5DNF A;  3HOV G;  4DKA C;  4RGN A;  3PIO A;  3QIA A;  4CDD C;  4YWK A;  4QQB X;  4GLX A;  3BDO A;  2TSS A;  1VQI A;  1WFQ A;  3HKS A;  1C0A A;  3GDE A;  3NEN A;  3R93 A;  1HHV A;  4XT3 B;  4G7H C;  1EQQ A;  1E1O A;  1K83 B;  4JOI A;  2DN8 A;  1HNX Q;  3RMH A;  3J80 c;  4GZY C;  2ZXO A;  4FF4 A;  3L2P A;  3TBI B;  3NQT A;  3J81 L;  4BA1 I;  3LX0 A;  1WTO A;  3I7F A;  1XTD A;  2ICI A;  1EY5 A;  3OMG A;  1ENF A;  4A3K H;  1XMQ Q;  3NSW A;  3H0G G;  4YWL A;  1JJC B;  4IUU A;  4P2C B;  2IX0 A;  1A62 A;  2R6G A;  1PVO A;  1I4Q A;  3GTO B;  3GTQ H;  1ICF B;  1VQN A;  1XWE A;  1A3U A;  4K0K Q;  2C9O A;  4RKB A;  3NK9 A;  4ILW A;  4FXK C;  5A2Q L;  1HUM A;  4X62 Q;  2LS0 1;  1YEZ A;  1LTG D;  3J7A F;  4HSV A;  1Y14 B;  3TZU A;  4L8J A;  1SXT A;  3PIP A;  1A6X A;  4A3I G;  2B2W A;  1WYD A;  2K33 A;  2KHI A;  4DK0 A;  3GTL H;  1PTO F;  3QB3 A;  3U50 C;  2MUY A;  3PO2 B;  1EFW A;  1PZK D;  2ASB A;  2IL8 A;  3NTH A;  2NB0 A;  4DR1 Q;  2HHH Q;  2E2H B;  5JJZ A;  2VUM H;  2PNR C;  3GTJ B;  5IP7 H;  4DV0 L;  2JA6 G;  4A3D H;  3TDQ A;  4XXE A;  5CV6 A;  3CCL A;  1KTK A;  3Q0A A;  1SND A;  1GVP A;  1IYU A;  2MGS A;  2FMC A;  3WWV A;  4DAP A;  3W1B A;  1K8G A;  5I2X A;  3CC7 A;  4JBW A;  5C4H A;  1FD7 D;  2Q2U A;  1FVI A;  4WJ3 M;  4UY8 C;  1BBW A;  4DF7 A;  3M4Q A;  1A3T A;  4N9T A;  3EA6 A;  3VYU A;  1DXM A;  2DGY A;  4NMZ A;  3CHB D;  1C9O A;  2FMM A;  2A8V A;  1VQC A;  3E6Z X;  4QIW E;  2F3I A;  3BVZ A;  3NEL A;  2Y0S G;  4KD3 A;  1DD2 A;  3D4W A;  2D9U A;  1CUK A;  2NUC A;  1L0W A;  3BYT B;  1EOT A;  4UHV A;  1CT1 D;  4KN7 C;  3A0J A;  4PQX A;  1IYJ B;  1JOO A;  4JW0 A;  5M5Y B;  1HR0 W;  4UP9 A;  2L9H A;  5GAH C;  2ICE C;  2EIF A;  4CDC C;  2KOL A;  4BY1 B;  2E5L Q;  5LMN L;  5GQO A;  4AYB B;  5J39 A;  2WAQ E;  2JA5 G;  1IW7 C;  1B53 A;  4LMQ D;  2KVM A;  1KNE A;  1HR0 L;  4V19 0;  3PUY A;  2WII B;  1PTO C;  5IGD A;  2Z4I A;  4RCN A;  3IKJ A;  5FJ8 G;  1KHI A;  3BYY B;  3UI2 A;  4FF2 A;  3KYH C;  4KK7 A;  2OTJ A;  4LK1 C;  3V2T A;  4IUR A;  3QO2 A;  1K83 H;  1TY2 A;  3WOE A;  2RHQ B;  1UE1 A;  1MIU A;  2KCT A;  2E2D C;  1EL0 A;  3KJP A;  4KHP L;  1SN8 A;  4RCO A;  1X32 A;  3I72 A;  4IFD I;  1L1O C;  1GKH A;  1QUQ B;  2AQ1 B;  3NQI A;  5I2Y A;  1I6H B;  3TP6 A;  1DCZ A;  3AMU A;  2DNC A;  1PFB A;  3GTO H;  2PI2 E;  4N8X 1;  1X9N A;  2AWO A;  2NVT B;  3MEH A;  4DV7 Q;  4LF6 L;  5LMU Q;  4R4I A;  3R2T A;  3CCQ A;  4OO1 H;  4BXX G;  3KFU A;  2NBF A;  2EOT A;  1UE7 A;  3NBH A;  3FPU B;  5E4X A;  4HJ7 A;  4A93 B;  3M4P A;  2E74 C;  2SOB A;  1YNJ C;  1EY7 A;  5FK9 C;  4A75 A;  3CME A;  1QJO A;  3Q22 A;  1SYB A;  3X3N A;  2KHS A;  3IFD A;  4A3E B;  3BJU A;  3OOC A;  3PO2 H;  2JA8 B;  3RLO A;  3S16 B;  1E24 A;  1H9S B;  3M7N A;  1K73 C;  2RSN A;  4KKU A;  4EQ5 A;  3IAY A;  1QVC A;  3GTJ H;  2PI2 A;  3HKZ E;  3IRB A;  1Z47 A;  2EYH A;  2F0P A;  4LFB Q;  1BCP B;  4FDB A;  1IHZ A;  4CJ1 B;  4YY3 Q;  1JB7 A;  1DON A;  2KQ3 A;  4DV3 Q;  4C3I G;  4DUZ Q;  1BBX C;  3MAQ A;  4XYO A;  5C4J H;  1CQV A;  1VMP A;  1U4M A;  1Y1W G;  1A63 A;  1HZC A;  1Y8P B;  1F2M A;  2VB2 X;  2K01 A;  2ZXP A;  2C35 B;  3W2D A;  3OTO Q;  2AKW B;  1KAA A;  1NR4 A;  3R3O A;  2AUJ D;  1L1O A;  3I73 A;  1SYD A;  4K0K L;  3KDF B;  1RCV D;  2XWJ B;  1PXU A;  1QZH A;  4L5Q A;  3JC6 6;  4KY6 A;  4CKE A;  3NXW A;  2QA4 A;  3OW2 A;  4X62 L;  3D0F A;  2H1E A;  2WFW A;  3U4V A;  2A68 D;  5M3F G;  1FGU A;  5M5Y H;  4UP7 A;  4ZQ3 A;  1K3R A;  2Q2H A;  1N36 Q;  1FNW A;  4BY1 H;  2QF7 A;  2JQO A;  1TQO A;  3Q24 A;  3AU7 A;  3FRP B;  3GTK B;  1VQ8 A;  3R8B A;  2JA9 A;  2PO4 A;  3MZ5 A; 
#chains in the Genus database with same CATH homology
 2JXM B;  3TP5 A;  2CQA A;  4J6H A;  3SXH A;  1TS3 A;  4F88 A;  1ENC A;  1LT6 D;  4ZRZ A;  5ELF A;  4UAI A;  3K5N A;  3BZD B;  1O7Y A;  1TWA B;  2F0S A;  4S3S A;  1EYC A;  4IFD G;  1HQR D;  1DYQ A;  5LL6 X;  1BXT A;  1SYF A;  1UUP A;  3NWT A;  3Q6S A;  5EKK A;  5C4X B;  3L3O C;  3T16 A;  3MFG A;  1GHJ A;  3ND9 A;  4A3G B;  2BCO A;  4XYQ A;  3W3A A;  3KUP A;  4PMB A;  2IT1 A;  2PQE A;  1VDZ A;  1SDF A;  4CBV A;  5FO9 B;  3A7L A;  3DWP A;  2R92 B;  3NHH A;  4DA2 A;  4IUN A;  3GTG B;  2HUG A;  2PPB C;  4E6I A;  1CA6 A;  5T1G A;  4G4K A;  2TMP A;  2PW7 A;  4KD4 A;  2F3W A;  3K5M A;  2AUK A;  3I4M B;  2F0F A;  2KA7 A;  3MXP A;  4PMC A;  4RGT A;  1LTS D;  3C2P A;  3M85 A;  2EYL A;  5C3E B;  2NTT A;  2Q8I B;  4PV1 C;  1F9P A;  5CV8 A;  1AN8 A;  1FNU A;  2WKC A;  1TWC B;  2Z8L A;  2MJ8 A;  3L9A X;  3T13 A;  5IGB A;  2PW5 A;  3QG1 A;  1TS2 A;  5EKI A;  2N55 A;  5COY A;  4K2L A;  1XYI A;  2MPM A;  4XIG S;  4HMI A;  2SNS A;  5BN4 A;  3G6J B;  4OGQ C;  2IX1 A;  4ZK9 B;  2O5J C;  1SMY C;  4M8A A;  1S5F D;  1WTX A;  1AEX A;  5CV9 A;  1A2T A;  3RZD B;  3NE5 B;  2N88 A;  1LTT D;  2K5W A;  3S17 B;  1FR3 A;  3VR3 A;  5CBA E;  5C3X A;  4ZKB B;  1RD9 D;  1MGS A;  1BCP F;  2BDN A;  2A68 C;  3NTI A;  5CR3 A;  4A3J B;  4DNT B;  4IUQ A;  1TII D;  1KLU D;  1SNP A;  1JWS D;  4R8I A;  2E2I B;  1O7Z A;  5FOB B;  5JVG 3;  2QCP X;  5IT9 E;  1NAP A;  3OMC A;  4RFB A;  2G9D A;  5ELC A;  1JQY D;  3GP7 A;  2DNE A;  2K32 A;  2BA0 A;  2H4O A;  4K5X A;  2M2L A;  3DM1 A;  3VR4 A;  2B2T C;  3H6M A;  5KND A;  3K5O A;  1EY4 A;  3P1H A;  3TP7 A;  1H9K A;  1EEF D;  2Z4H A;  3IFT A;  1PRT B;  5DAU A;  1JWM D;  1TS4 A;  3NBI A;  3K6O A;  5EQ0 A;  4A3F B;  3RZO B;  3CKI B;  2YYZ A;  4J1M A;  4HCS A;  5C3W A;  5HUR A;  1I4R A;  4CHT B;  1EIG A;  1XXG A;  1Y1V B;  1LV9 A;  3QOJ A;  1BCP C;  2F0M A;  3VR2 A;  3D3R A;  1UNS A;  4F87 A;  1ZKO A;  4MIU A;  1OXS C;  2OXP A;  2KCC A;  5D3I B;  1PTO D;  3A8K E;  5E3F A;  1TY0 A;  2J7Z A;  3I4L A;  1H9M A;  4FF3 A;  3EJI A;  1I4P A;  1EY0 A;  1IL8 A;  1EY8 A;  1GUW A;  1EU3 A;  4I65 A;  2O5I C;  3HOX B;  1SBB B;  1AZP A;  1SNM A;  2A6E C;  1Q1E A;  2E2J B;  1JOQ A;  2B2T A;  2F03 A;  5KEE A;  3KBX A;  1TVX A;  1S5C D;  5BN5 A;  4MN3 A;  3I4N B;  3TSS A;  1D5M C;  1QWY A;  3QWN A;  4L63 B;  2JSO A;  3GV6 A;  4Y7N B;  1V8Q A;  3PUZ A;  4QUC A;  1ESR A;  1ENA A;  1YNJ D;  1Q3L A;  1CQF A;  4X3U A;  3DUZ A;  4EQP A;  3BVG A;  1II3 A;  3C1E A;  3SK4 A;  2EPB A;  5M9O A;  5BN3 A;  1ICW A;  2F0H A;  4BY7 B;  3HOV B;  4Q5V A;  5KIX A;  4ABN A;  3MXG A;  3GTM B;  3LNN A;  3G7L A;  1EFI D;  4JK1 C;  1V43 A;  2D2C C;  1JOR A;  1PFN A;  1G91 A;  4OHJ A;  4X3S A;  3I90 A;  3KLS A;  2X6G A;  4C56 C;  1MSG A;  3CQZ B;  1C8C A;  1DJR D;  1NUC A;  3H0G B;  3PUX A;  1AZQ A;  2VB3 X;  1EZ8 A;  1F2Z A;  1F9R A;  1MBY A;  2NVY B;  2FIN B;  2B2Y C;  2L11 A;  1NR2 A;  2PZT A;  2B8F A;  2JYO A;  3HG9 A;  4DAV A;  3K57 A;  2F0D A;  4QUF A;  2EJF C;  5KNB A;  2Q8T A;  2K04 A;  4IAL A;  3HS0 C;  1KLG D;  4DFA A;  4XQJ A;  4B08 A;  2O2L D;  5IOD A;  1D5X C;  4A3I B;  2EDG A;  1QB5 D;  2JEB I;  1BNZ A;  3S14 B;  5DM7 3;  5ELD A;  1STG A;  5CGK A;  4G7Z C;  1TWF B;  2JA6 B;  5IT9 L;  2RDH A;  4HAE A;  2EJM A;  3O13 A;  4FO2 A;  2K7V A;  1PLF A;  5J1Z A;  4HED A;  5EJW A;  3S15 B;  1PRT F;  1EQT A;  1HTL D;  4RGM A;  5FO7 B;  2EE1 A;  3H09 A;  1WD1 A;  2EY6 A;  1E0B A;  2BA1 A;  4ULL A;  3OPO A;  1GUN A;  2Y0S B;  2XIW A;  1OXX K;  4NKL A;  2B2Y A;  4EQN A;  4K6L A;  4K5W A;  1JIC A;  2JA5 B;  3OSO A;  2K5Q A;  3BS1 A;  1WTV A;  1WTP A;  1QE6 A;  2F0K A;  5C0X H;  1HQM C;  5KNC A;  2OEO A;  2LY7 A;  2RDF A;  5IGG A;  3OHX C;  3I8Z A;  2EY1 A;  4KHV A;  1TKW B;  2B2U A;  5TSS A;  1DOK A;  2DY7 A;  5KRU A;  4ZLT F;  1PRT C;  2WV6 D;  4DXF A;  5JPN C;  3BDC A;  2VXW A;  1GJX A;  3TZD A;  5I4D A;  3NUC A;  5EPK A;  3A54 A;  2EVB A;  4KV6 A;  1FYC A;  5D14 A;  4K6D A;  5LHY 1;  1HUN A;  1KNA A;  1SMY D;  4IN3 A;  2CVR A;  4H7B A;  3FPP A;  5EBD A;  2RKS A;  3HP3 A;  1L0Y B;  5HGT A;  3CRK C;  4KHZ A;  3C46 A;  5IOC A;  2K6A A;  3MTS A;  2QIL A;  1Y69 U;  1FNV A;  4K2K A;  3OW7 A;  5IGF A;  4H0L C;  1CTM A;  1TR5 A;  1MD2 D;  5EKL A;  3X3M A;  2LFN A;  2BE5 C;  4FF1 A;  1Y1W B;  4BBR B;  2L55 A;  5IGE A;  4HSP A;  3A56 A;  4U68 A;  4F8M A;  2IPK D;  4EVO A;  2XWB B;  4DNR B;  2F0U A;  3K58 A;  2F1M A;  1WVL A;  3QJY A;  5CYU A;  2L1B A;  2A6H C;  5M3F B;  2F3V A;  3SEB A;  5EPL A;  3ZYY X;  3M7G A;  4NW2 A;  2NVX B;  3J7A V;  1EYD A;  4FP5 D;  1LTB D;  4V0B A;  2R93 B;  2V4D A;  1KDA A;  5M5X B;  1SNO A;  3VR6 A;  5J22 A;  3M3Y B;  1PZJ D;  3NPP A;  1JE4 A;  3HOY B;  1RJT A;  1J9O A;  1Q1B A;  4KI0 A;  4EQO A;  5I9O A;  1GUG A;  1BCP D;  3U9S A;  1RHP A;  1X3Q A;  4HCE A;  2XSC A;  3N6R A;  2NTS A;  1SYE A;  3MWY W;  1AP0 A;  4KN4 C;  4RHS A;  2JP1 A;  3GO5 A;  1T5X D;  1XTC D;  1U9R A;  5DM6 3;  3SK5 A;  1EWH A;  1ML0 D;  3BVM A;  3NWS A;  3SVM A;  2A69 D;  2L5T A;  1I4G A;  1VF7 A;  4G7O C;  1CZW A;  1RKN A;  1ILP A;  2A6E D;  2WKD A;  4K5V A;  4M1U B;  2NYZ D;  1WTQ A;  3S9W A;  1QOH A;  1TS5 A;  3A8J E;  3PIO 3;  1QCB D;  1UAP A;  5G3L F;  3S2H B;  3DMU A;  2PZW A;  1AFP A;  1Y8O B;  1TWG B;  5CV4 A;  3OWE B;  2RSO A;  1LTR D;  3K7A B;  5JVH 3;  2EYM A;  4UDU C;  2PCF B;  2VNU D;  3OIQ A;  2K5D A;  3FDT A;  1PYW D;  1DZ1 A;  3ND8 A;  4CKC A;  1I4H A;  1EYA A;  4IUV A;  4A3M B;  4G57 A;  2D62 A;  2XN9 C;  4C3J G;  4R8N A;  2Q8R E;  1B44 D;  2WAQ B;  1SAP A;  5C44 B;  1KDC A;  4XDX A;  1G2T A;  2F0G A;  4C3H G;  1GUO A;  1CHP D;  3RD4 A;  2XNA C;  3HOW B;  5EPJ A;  1B4O A;  1FGB D;  3E0J A;  5JEA H;  1BO0 A;  3RUZ A;  1ONL A;  4DGZ A;  3IL8 A;  2FJ2 A;  1C4Q A;  3PIP 3;  3C1F A;  5CV7 A;  3MA2 B;  3PUV A;  5KYL A;  3S1M B;  1LT3 D;  2R7Z B;  3HZX A;  2KCN A;  4TQU S;  2J0T D;  3C3L A;  2RBM A;  3H3V C;  2HCI A;  4FXG C;  5JAV A;  1HFG A;  2NWG A;  2RDG A;  3HEJ A;  1TWH B;  5I9P A;  4BA2 I;  2JE6 I;  4IFD H;  2NVQ B;  3A8I E;  5M3M B;  4OL7 A;  2B63 B;  1EWC A;  3MVV A;  1BOS A;  5FLX E;  3K0Y A;  5C0X I;  1SJH D;  2RQX A;  2O4X A;  3I3C A;  2EJG C;  4FVM A;  4OO1 I;  3HKZ B;  3BDL A;  1STH A;  3P20 A;  4A3K B;  4LJZ C;  3N52 A;  2A5H A;  2C5C A;  4XTC S;  1H9R A;  2HDM A;  2G9H D;  2JEA I;  4FNF A;  1IYV A;  1T5E A;  4BS9 A;  3T4A C;  1LTI D;  5AFW A;  4BBS B;  2IWH A;  1ROD A;  4OIJ A;  1EIH A;  3M4O B;  1RF2 D;  3I91 A;  3D4R A;  4OIK A;  2NN6 H;  1BDO A;  1QNU A;  3D4D A;  2EY5 A;  3MXN A;  2KJX A;  3HOZ B;  2EYP A;  1JB3 A;  1U4R A;  2EYJ A;  4CJ2 C;  1E2V A;  5E1F A;  2F0Q A;  5EGT A;  2A69 C;  2MP1 A;  4XT1 B;  3LWE A;  4X3K A;  5M5W B;  3FMC A;  1B50 A;  2BDO A;  1CM9 A;  5COR A;  4HTH A;  3Q23 A;  4KTA A;  2KUM A;  1ZXT A;  5E4W C;  1YNN C;  1NCV A;  1KAB A;  1A3V A;  5D3D A;  1OO9 B;  1SE3 A;  2L4N A;  4C1N I;  3MHB A;  1STA A;  3DWQ A;  1H9S A;  4RA8 A;  2ID0 A;  1HA6 A;  1KDB A;  2OT2 A;  1QIL A;  1E2W A;  3T51 B;  2F0E A;  1PRT D;  1S5B D;  3URY A;  4CGY B;  4TRD A;  4ZUI A;  5C0X G;  2SNM A;  4MHE A;  4OO1 G;  1B9N A;  4C2M B;  3H91 A;  4LAA A;  2J4X A;  2F0T A;  2ZXR A;  1U4P A;  1MSH A;  3J80 E;  3A7A B;  3S2D B;  4B9W A;  1JWU D;  2IX3 A;  1CA5 A;  1STB A;  2A74 C;  5CC4 A;  1OXU A;  3VYT A;  1SE4 A;  3SK6 A;  4HMJ A;  4K8I A;  4R9W A;  1B3A A;  3HOU B;  1BQQ T;  3SHL A;  3DEP A;  4IUP A;  1EU4 A;  2BE5 D;  1Z6H A;  2WB1 B;  3ERO A;  1QG7 A;  1LLR D;  3TP8 A;  3CU7 A;  1R4P B;  5K5P A;  4IZ8 A;  4PNY A;  2M00 A;  2F0W A;  4FYD A;  4DAY A;  2LKV A;  5C0X J;  1PMR A;  3A55 A;  2A6H D;  2EYF A;  2QDB A;  3FEW X;  3GQB A;  3D6C A;  2NZ1 D;  5C4J B;  5K36 H;  1OXT A;  2B2U C;  2F0I A;  1RDP D;  3LWU A;  1GHK A;  5T1I A;  1EY9 A;  3VR5 A;  2I46 A;  5FLX L;  3GTP B;  1HRJ A;  4QCL A;  1SNC A;  3VA7 A;  5C5M A;  2M9V A;  2R3Z A;  3QOL A;  1G8Z D;  1K8O A;  2X6L A;  4DU9 A;  3WOF A;  3V05 A;  1SYG A;  4HN7 A;  3AB9 A;  1W6J A;  3NP8 A;  3MXU A;  2Z1C A;  3EFX D;  5CBE E;  5KYI A;  1GUT A;  3ITP A;  2K05 A;  3U9O A;  4RH6 A;  2K28 A;  3L7Z C;  1Y8N B;  1Z7T A;  2IJ0 A;  2E76 C;  4WOR A;  3EQL C;  3S1Q B;  1SJE D;  4NDX A;  4RAU C;  3HRZ C;  1O80 A;  1QNK A;  3E5S A;  2WAC A;  2I07 B;  1LTA D;  2F0L A;  4B9X A;  1D2B A;  2BOS A;  2X69 A;  1S5E D;  3MFY A;  1IKM A;  4WJW A;  1I3Q B;  3DEO A;  1W6K A;  3VYS A;  4DN4 M;  2QKI C;  2F0N A;  1HXY D;  3SDZ A;  1ESF A;  4QF4 A;  1ZYR D;  1VCI A;  1H9J A;  1AW7 A;  3R2I A;  2SDF A;  4ZUJ A;  3S1N B;  4BWG B;  2PMZ B;  1V1P B;  1F9Q A;  1D5Z C;  2RVL A;  5DEH A;  3DWA A;  3D8G A;  4KKS A;  4TSS A;  4J8Q A;  1CHQ D;  1UEA B;  3HGB A;  1C48 A;  4N9P A;  5C6A A;  1TT2 A;  4L6T B;  1SFO B;  2B2V C;  1PDQ A;  3TME A;  1PFM A;  1WTW A;  1TU2 B;  1ET6 A;  1G6Z A;  2PYK A;  4DXG A;  1LAC A;  1F2Y A;  5F2D A;  3VYR A;  1LT4 D;  2NN6 I;  5IIF A;  4C3I B;  3T53 B;  5ELB A;  1DOL A;  5G3L D;  1EZ6 A;  4KMU C;  1STN A;  2XRQ D;  1I50 B;  1BUV T;  1L0X B;  3GD7 A;  1A15 A;  4RHR A;  2AQ3 B;  5JEA G;  2AWN A;  3ERQ A;  3J80 L;  3JAM E;  1EQV A;  1JCK B;  1M8A A;  2K03 A;  5EBC A;  5I6W A;  2HDL A;  2WP8 J;  1D1I A;  1GUS A;  4YIJ A;  2HQE A;  3PMF A;  3TN2 A;  2K1B A;  3ONA B;  3V96 A;  1D1K A;  1X3P A;  1STE A;  2QEJ C;  1WTR A;  1RTN A;  2FHT A;  3S1R B;  1B1Z A;  3I70 A;  2B2V A;  4EGV A;  1G29 1;  3D6W A;  1EY6 A;  1ET9 A;  2KED A;  2EXZ A;  5KGU A;  1G2S A;  4KJN A;  1STY A;  1LAB A;  2R61 A;  1CK1 A;  1ZEQ X;  4PMW A;  1SEB D;  2F0J A;  4X3T A;  3KLS X;  3PO3 B;  3FVQ A;  1LT5 D;  1K8M A;  4I7Z C;  4CJ0 B;  2EY2 A;  4TKO B;  5JEA J;  3DHQ A;  2AQ2 B;  2CW0 D;  4NP5 A;  2RA4 A;  4ME5 A;  3OWF A;  1S4Z A;  1HA5 A;  2KEC A;  1LO5 D;  3GV3 A;  2CHB D;  1MI2 A;  1YNN D;  4RKL A;  5IGC A;  4RGO S;  1GXD C;  1BF4 A;  1A2U A;  2NN6 G;  4IFD J;  2F4I A;  4QIW B;  1JC7 A;  1IKL A;  4ID6 A;  3PUW A;  3J81 E;  1WCM B;  2PZU A;  1F9S A;  1ZYR C;  1F2L A;  3KLR A;  3T56 B;  1ILQ A;  1CZG A;  5A35 A;  2WIN B;  1O7L A;  1CFM A;  5NUC A;  5ELE A;  3D31 A;  2GA4 B;  4A3B B;  2YU9 B;  3PV0 A;  5ISR A;  1I6V C;  3BG3 A;  3OIP A;  4C1N K;  1SYC A;  5A2Q E;  5D65 A;  1EEI D;  4FXD A;  4KY5 A;  4KKT A;  1HCZ A;  1R9T B;  3MC0 B;  4C3J B;  2DY8 A;  3P75 A;  2B39 A;  4XQN A;  2EYO A;  1VMC A;  4ZYS A;  1PTO B;  4XQQ A;  2F0V A;  4C3H B;  1Q12 A;  1JR0 D;  3J7Y W;  2F0O A;  5C5L A;  5I6Y A;  2ENB A;  5FKA C;  4O1N A;  5FO8 B;  2E75 C;  2L0C A;  4DK1 A;  1Q90 A;  2KEE A;  4H13 C;  5JPM C;  1DOM A;  1NSN S;  3CRL C;  1M4V A;  4HR7 B;  1D6E C;  3SR1 A;  1CI3 M;  2HCC A;  4U67 3;  4Z9C B;  2LMC B;  5CV5 A;  3WDN A;  3NTK A;  1XX8 A;  2SEB D;  4RWS C;  3KF8 A;  3GTQ B;  4ZKC B;  1SE2 A;  3FKI B;  1JOK A;  1Q8I A;  3H94 A;  3VA5 A;  1HTP A;  3M4Y A;  5JOB A;  2D5D A;  2OF1 A;  3JAM L;  1DM0 B;  3DXJ C;  2XVS A;  3KK7 A;  2EZV A;  4KJO A;  3EVQ A;  3F2U A;  4IQZ A;  4H44 C;  2MHV A;  4ODG A;  4ZAI A;  1HFN A;  4QMG A;  1WD0 A;  3GTL B;  1VF5 C;  4IUT A;  2A73 B;  2CW0 C;  4F7X A;  1OXV A;  2B8G A;  3K59 A;  2VUM B;  2IW3 A;  4K14 A;  2ZT9 C;  4A3D B;  5K36 G;  1J8I A;  1IW7 D;  1BR9 A;  1B9M A;  3RLF A;  1S5D D;  4QB4 A;  1F77 A;  2FFK B;  4KY7 A;  2L12 A;  3K5L A;  3SE0 A;  3P7J A;  1GOZ A;  4CKB A;  2XRS D;  1SNQ A;  5C4Z A;  4WFN 3;  1V1O A;  1HPC A;  1PZI D;  1U4L A;  1RTO A;  1I4X A;  1E2Z A;  1B2T A;  1V1P A;  2JA7 B;  4WRD A;  3SK8 A;  1PTO H;  1SSO A;  1R4Q B;  4Q0F A;  4O42 A;  2B2W C;  5CMD A;  1O78 A;  3KBG A;  4K8J A;  5LL6 S;  5DNF A;  4RGN A;  3QIA A;  3BDO A;  2TSS A;  3R93 A;  1HHV A;  4XT3 B;  4G7H C;  1K83 B;  2DN8 A;  3RMH A;  4GZY C;  2ZXO A;  4FF4 A;  3TBI B;  3NQT A;  3J81 L;  4BA1 I;  3LX0 A;  1WTO A;  2ICI A;  1EY5 A;  3OMG A;  1ENF A;  3NSW A;  4IUU A;  4P2C B;  2IX0 A;  2R6G A;  1I4Q A;  3GTO B;  1XWE A;  1A3U A;  2C9O A;  4RKB A;  4ILW A;  3NK9 A;  4FXK C;  5A2Q L;  1HUM A;  2LS0 1;  1LTG D;  3J7A F;  4HSV A;  3TZU A;  4L8J A;  1SXT A;  1A6X A;  2B2W A;  2K33 A;  4DK0 A;  1PTO F;  3QB3 A;  2MUY A;  3PO2 B;  1PZK D;  2IL8 A;  3NTH A;  2NB0 A;  2E2H B;  5JJZ A;  2PNR C;  3GTJ B;  3TDQ A;  4XXE A;  5CV6 A;  1KTK A;  3Q0A A;  1SND A;  1IYU A;  2MGS A;  2FMC A;  4DAP A;  5I2X A;  4JBW A;  5C4H A;  1FD7 D;  4DF7 A;  1A3T A;  4N9T A;  3EA6 A;  3VYU A;  1DXM A;  4NMZ A;  3CHB D;  2FMM A;  3E6Z X;  3BVZ A;  4KD3 A;  1DD2 A;  3D4W A;  2D9U A;  2NUC A;  3BYT B;  1EOT A;  1CT1 D;  4KN7 C;  4PQX A;  1JOO A;  5M5Y B;  2L9H A;  2ICE C;  2KOL A;  4BY1 B;  4AYB B;  5J39 A;  1IW7 C;  1B53 A;  4LMQ D;  2KVM A;  1KNE A;  4V19 0;  3PUY A;  2WII B;  1PTO C;  5IGD A;  2Z4I A;  4RCN A;  3IKJ A;  3BYY B;  3UI2 A;  4FF2 A;  4KK7 A;  4LK1 C;  3V2T A;  4IUR A;  3QO2 A;  1TY2 A;  3WOE A;  1EL0 A;  2E2D C;  4RCO A;  1X32 A;  3I72 A;  4IFD I;  2AQ1 B;  3NQI A;  5I2Y A;  1I6H B;  3TP6 A;  1DCZ A;  3AMU A;  2DNC A;  1PFB A;  2AWO A;  2NVT B;  3MEH A;  3R2T A;  4OO1 H;  2NBF A;  2EOT A;  3NBH A;  3FPU B;  5E4X A;  4A93 B;  2E74 C;  2SOB A;  1YNJ C;  1EY7 A;  5FK9 C;  3Q22 A;  1QJO A;  1SYB A;  3X3N A;  2KHS A;  3IFD A;  4A3E B;  3OOC A;  2JA8 B;  3S16 B;  1H9S B;  3M7N A;  2RSN A;  4KKU A;  3IAY A;  1Z47 A;  2EYH A;  2F0P A;  1BCP B;  1IHZ A;  4CJ1 B;  1DON A;  2KQ3 A;  4C3I G;  1BBX C;  3MAQ A;  4XYO A;  1CQV A;  1VMP A;  1U4M A;  1Y8P B;  1F2M A;  2K01 A;  2VB2 X;  2ZXP A;  3W2D A;  1KAA A;  1NR4 A;  3R3O A;  2AUJ D;  3I73 A;  1SYD A;  1RCV D;  2XWJ B;  1PXU A;  4CKE A;  4KY6 A;  3NXW A;  2H1E A;  2A68 D;  4ZQ3 A;  1FNW A;  2QF7 A;  1TQO A;  3Q24 A;  3AU7 A;  3FRP B;  3GTK B;  3R8B A;  2PO4 A;  3MZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...