4K19A

The structure of human siderocalin bound to the bacterial siderophore fluvibactin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
174
structure length
174
Chain Sequence
b'SDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Siderocalin Outwits the Coordination Chemistry of Vibriobactin, a Siderophore of Vibrio cholerae.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/inhibitor
total genus 40
structure length 174
sequence length 174
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4k19A00
1HMTA 5H9LA 4RUNA 4D6AA 3KFHA 1KT7A 2HZRA 1LF7A 1PMPA 3I0AA 4M6SA 4QGWA 2WSJA 5F58A 3RSWA 1ZNLA 1BSQA 3RZYA 5HBSA 1KQWA 4NLJA 3BRNA 1I06A 1GT4A 1MUPA 1OPBA 3ZQ3A 2GTFX 1IW2A 1ICNA 4ZFXA 1E02A 1BEBA 3O19A 5HZ6A 4GH7A 1XKIA 3O22A 5C0NA 2LB6A 1X8PA 4YFQA 5LJCA 2FS7A 1HN2A 4ZHFA 2FT9A 2L5PA 3BY0A 1L6MA 5D4AA 3K3LA 1YWBA 3T1DA 1NP1A 4QAEA 4YBUA 2HYSA 1IKJA 3C77X 5LKFA 1AELA 3TGBA 2L68A 2W2FA 4K19A 4MVKA 2WUTA 3I17A 2FR3A 2RD7C 2WQAE 4ZH6A 1CJ5A 2N93A 2HZQA 2NNEA 2KTDA 4YFRA 2OFRX 4XMCA 4AZQA 1SXWA 3PH6A 4TLJA 4EEJA 5H9KA 4EDEA 3UEVA 1OPAA 1UREA 2JOZA 1H91A 3F8AA 3UEWA 3BX8A 3DTQA 4A1YA 1GX8A 3FMZA 3O2YA 1IKEA 3EM0A 1KT3A 1PM1X 3C78X 1ZNGA 4AZNA 3NPOA 2JU7A 5EZ2A 3APUA 1ZRYA 1KT5A 5KICA 1T0VA 3CQNA 4YGZA 3HWDA 3PEDA 3FW4A 4ODDA 4Y0SA 3WJDA 4XMDA 1D3SA 1E06A 5IO6A 3IA8A 2O62A 3BSZE 1OEEA 4LKPA 3VG3A 5FAZA 2JU3A 1BRPA 3WJEA 1ZNDA 2F73A 3WJFA 3FA7A 2A0AA 3F9DA 4A8ZA 4AW8A 2MO5A 1FENA 2A3FX 1BM5A 4ZJ0A 5HZ8A 4ZR2A 5K06A 2PY1A 1TOWA 4ZGUA 2RCQA 4N7CA 3P6CA 3EYCA 3KFGA 1AQBA 1YUPA 1FEMA 3ZUIA 4ORSA 4YCHA 3KFIA 1RLBE 5JR8A 4DQ4A 1TOUA 4ES7A 1YP7A 2P8GA 1KOIA 4GRJA 1B8EA 3SAOA 4ZHCA 3U9PC 4R0BA 1OBUA 4ORUA 3ELXA 1DZJA 1MX7A 2WWPA 4OS0A 1IFCA 5DG4A 4D6BA 1U17A 3FEPA 1O1VA 4GKCA 2WR6A 1SY1A 2NP1A 3U03A 3BDRA 2BLGA 2E4JA 3ELZA 4Y0RA 5B29A 2K23A 3FA9A 5HA1A 3L4RA 5H8TA 4QYPA 3TF6A 1JJXA 1VPRA 1X8QA 4QYNA 1PBOA 2G79A 1G74A 1G85A 1QFVA 4ORRA 3KQ0A 1X8UA 3FR2A 3WVMA 4AZMA 1SXYA 2AT0X 2YG2A 2EU7X 1IFBA 1GXAA 4MVIA 1PEEA 1OBPA 4TQ2A 3GAQA 1AVGI 1DC9A 4XMHA 1LNMA 4CK4A 1A57A 4YBPA 1P6PA 3C76X 4UU3A 5L8NA 4GNYA 3KFFA 3D95A 1FTPA 4IBAA 1QFTA 4RUUA 4O9SA 1N0SA 1GGLA 1LIFA 3JSQA 3NQ3A 3QKGA 3OJYC 4IAXA 3CWKA 4YGGA 2OVEA 3STKA 4NP1A 1B56A 2G78A 3PECA 5EEDA 3TGCA 4A60A 4I9SA 4ZHGA 4YDBA 1X8NA 3EBKA 1X71A 2LBVA 1OEKA 2CM4A 4IB7A 3CQRA 4WFVA 4AYHA 5LJKA 1SY2A 2QO6A 2QO5A 3FLLA 1O8VA 5HTDA 4TNNA 3NQ9A 1JYJA 1ALBA 4XMGA 1GKAB 1ICMA 4OS8A 2ANSA 1S2PA 3FIQA 1JJJA 2NNQA 4HPBA 2R74A 3APVA 1QY1A 4EFGA 1YWAA 4UU2A 3FENA 4BQUA 1HMSA 4N7DA 3FR5A 2AL0X 3P6GA 1KT6A 2CBRA 2ACPX 1OEJA 4AZRA 1BLRA 2WEXA 4YCEA 4QGVA 1QQSA 1MDCA 1ACDA 5EDCA 2QO4A 5IO5A 3Q6LA 1NP4A 1A3YA 2JN3A 2WQ9A 3MVFA 2AMMX 5AQ6A 1KT4A 4AZOA 5KHPA 2AH7X 1DF3A 3CMPA 2Q39A 1TW4A 4YDAA 1EALA 5LJBA 1FE3A 1MX8A 4OMWA 4ORYA 1CRBA 5D47A 2RA6A 3NADA 2KT4B 1ERXA 5EEEA 4I3CA 1AB0A 1QABE 1U0XA 2OVAA 2OVDA 3P6DA 1QG5A 1CBRA 1FDQA 1R0UA 2WEWA 3P6FA 5D45A 5LJGA 1EUOA 5HCDC 4QZUA 5B27A 3PPTA 2QOSC 5F6ZA 2G7BA 3WJBA 4LZUA 1TXLA 4I3BA 2FTBA 2FS6A 4OMXA 4ALOA 2RQ0A 3FA6A 2OZQA 3FEKA 4NYQA 4XMFA 1YIVA 3STMX 2JU8A 4IB9A 3BU9A 2L67A 2K62A 3KZAA 3NR3A 1KZWA 2FRSA 5HZ9A 1ZNHA 3MBTA 2IFBA 4IB8A 2CZUA 5BVQA 3VG5A 5CE4A 1ZNKA 5IO7A 1A2DA 1SY0A 1XCAA 2W2AA 3APXA 4ZHHA 1YWCA 1I05A 4WBKA 1SXUA 3CR6A 4YFPA 1B4MA 1GT1A 3U0DA 5HWZA 1QWDA 2HLVA 2POAA 2X45A 1I4UA 4Y0PA 3ZUOA 4QZTA 2L9CA 3B2JA 5HAEA 1DZPA 4WFUA 1GT5A 5HTEA 4ALBA 4MVLA 4NNTA 1T8VA 1YWDA 5DPQA 3VG7A 5BVSA 3VG2A 5FENA 4I3DA 4YMYA 1JBHA 3B2HA 4GETA 4TKHA 3B2KA 1LIEA 1EXSA 1KQXA 4LKTA 1ML7A 3HWFA 3G7XA 4EXZA 1KZXA 3FELA 4HPCA 4BOEA 2Q2MA 4Y0QA 3NX2A 1JV4A 5FFHA 1S44A 4YH0A 1HMRA 3HWEA 3HWGA 5F1EA 3APWA 4HPAA 2HNXA 2FLJA 4YGHA 1E00A 2ASNX 2LKKA 4NLIA 1JZUA 4ARHA 2LFOA 1Z24A 1FELA 1DZKA 3S26A 2R56A 4I9RA 4ZHDA 1LKEA 1LIBA 3VG4A 4ZCBA 2CBSA 1SA8A 2AT8X 1SY3A 5H9NA 2GC9A 1EIIA 4PSQA 1U18A 1CBIA 4M7MA 3WJGA 1NGLA 2A2UA 5HZ5A 3D97A 3AKNA 4BVMA 2AT5X 2AT3X 1GT3A 3NP1A 2MM3A 2OFMX 1GKAA 5HCCC 1BRQA 1VYGA 5LJEA 2FR2A 4AZPA 5D48A 1DV9A 2LBAA 3EMMA 1DFVA 3WBGA 5EDBA 1BSYA 4OS3A 2Q9SA 3TGAA 2HMBA 1D2UA 1IIUA 1LIDA 1EIOA 2AKQA 1TVQA 1YP6A 3WXQA 2GJ5A 1ERBA 4DQ3A 3IFBA 3CBSA 3UEUA 3FA8A 3PP6A 2R73A 1LFOA 1X8OA 1A18A 1EW3A 1MVGA 3BLGA 3D96A 5D8JA 3P6EA 1CBQA 1ADLA 2ALLX 3UEXA 1G5WA 4GNWA 4QGXA 4TKJA 2Q2PA 2Q4NA 3FW5A 1GM6A 1X89A 2W2BA 3BU1A 1KGLA 4ZH9A 4GE1A 1BSOA 5LJDA 3STNA 5LKEA 4NNSA 2XKLA 5KIDA 1EPBA 2AT6X 4YKMA 1ZNEA 1SXXA 4HFOA 1O1UA 4IB6A 1BBPA 2X46A 1QY0A 1VYFA 3P6HA 1KXOA 1E5PA 4A1HA 4IMOA 1DZMA 3BS2A 1HBQA 2CM9A 4ORXA 4XMEA 1BJ7A 1RBPA 1CBSA 5HA0A 1HQPA 3NX1A 4KIIA 2DM5A 4LZVA 3B2IA 3CBCA 4IAWA 3DSZA 1I04A 3FR4A 1S7DA 1GX9A 2A2GA 5L8IA 2NNDA 5H9AA 1G7NA 3VG6A 5HCEC 1BWYA 2QM9A 3AKMA 3PH5A 3HK1A 1EQDA 3JS1A 5F7GA 1LICA 1OBQA 2FWVA 4NYRA 1LPJA 5EPQA 4TKBA 1T68X 3WJCA 1HBPA 3TZSA 2XSTA 5L8OA 4ORWA 4HPDA 1EPAA 5HZQA 2CZTA 1JYDA 2MJIA 4YKOA 2A13A 4TJZA 3BX7A 5LJHA 2ACOA 4IMNA 2RCTA 3B2LA 5F6BA 1QY2A 5BVTA 1B0OA 3EBWA 1UZ2X
chains in the Genus database with same CATH superfamily
1JJUA 1HMTA 1VWOB 1SWJA 3RDOA 5H9LA 4O49A 1N9YA 4RUNA 4D6AA 2I5ZO 1SWUA 2X55A 3KFHA 4U8UO 2RTIB 1KT7A 1SWFA 1LF7A 2HZRA 1PMPA 4GDAA 1SWDA 3I0AA 3OE3A 4GD9A 4M6SA 4CSBA 2IZCB 4QGWA 4L3RA 3RDUA 2WSJA 5F58A 3VHMA 3RSWA 1ZNLA 1BSQA 4JNJA 5HBSA 3NBXX 1KQWA 4NLJA 3BRNA 3RZYA 1I06A 4KT5A 1GT4A 1MUPA 1OPBA 3ZQ3A 3FIDA 2GTFX 2Z4IA 1VWJB 5FQ7E 1IW2A 2AF5A 1ICNA 4C5PA 4ZFXA 1STRB 3PQSA 1E02A 4PJ2A 1BEBA 3O19A 5HZ6A 1IJ8A 4GH7A 1XKIA 3O22A 5C0NA 2LB6A 4KC7A 1X8PA 4YFQA 4QRLA 2FS7A 3MM0A 5LJCA 1RXJA 2RTQB 1HN2A 1K3BA 1VWHB 1LELA 2MHDA 3T6LA 2FT9A 2L5PA 3BY0A 1KL5A 1L6MA 1VWNB 3K3LA 1STSB 1YWBA 5D4AA 3T1DA 1NP1A 4QAEA 4YBUA 2HYSA 4IRWA 2IZFB 1IKJA 4Y59A 1SRHA 1VWRB 3C77X 2OYBO 5LKFA 1AELA 2BC3A 3LV4A 3TGBA 4Z2VA 3VE2A 2L68A 1RXKA 2W2FA 4K19A 2WUTA 4MVKA 4CDEA 3I17A 3WJDA 1SWAA 2FR3A 2IZJA 2RD7C 2WQAE 2N93A 3PQUA 4ZH6A 1CJ5A 4BJ8A 2FGSA 1Y9LA 2HZQA 2NNEA 3Q34A 2KTDA 5CSEA 4YFRA 2OFRX 5KICA 4XMCA 4AZQA 1VWIB 1SXWA 3PH6A 4TLJA 1VWQB 3KVNA 4EEJA 5H9KA 2RTEB 4EDEA 3UEVA 2Y3FA 2ZSCA 1OPAA 1UREA 3VU1A 1SWOA 2GH7A 1H91A 2JOZA 3F8AA 3UEWA 3BX8A 1SWBA 3DTQA 3LTWA 4A1YA 1GX8A 3EW1A 3FMZA 4DNEA 3O2YA 1IKEA 2G5LA 3EM0A 1KT3A 3HPEA 3RDSA 1PM1X 3C78X 1RAVA 1ZNGA 1AVEA 4AZNA 3ZW0A 3NPOA 4Y5DA 2JU7A 5EZ2A 3APUA 1ZRYA 1KT5A 1MM9A 1T0VA 3CQNA 4JGLA 3HWDA 3PEDA 3FW4A 4O4XA 2RTBB 4ODDA 4Y0SA 4XMDA 5F2BA 1D3SA 1E06A 2OF8A 5IO6A 3IA8A 4CDFA 2O62A 3BSZE 2QCBA 3RDQA 1OEEA 4LKPA 3VG3A 3D9WA 4GDZA 5FAZA 2JU3A 1BRPA 3WJEA 1JIWI 1SMPI 1ZNDA 5IRAA 2F73A 3WJFA 3FA7A 2A0AA 3F9DA 3ZW1B 4A8ZA 2MO5A 4AW8A 1FENA 2A3FX 1BM5A 4ZJ0A 5HZ8A 2C1SA 2FHNX 4ZR2A 5K06A 2PY1A 1TOWA 4ZGUA 3OBLA 2RCQA 4NV7A 4Z27A 4N7CA 5CHKA 3LHNA 3P6CA 5K68A 4Z2OA 3EYCA 2IZDB 4EQAC 3KFGA 1AQBA 1YUPA 4O4OA 3PDFA 1LUQA 3SLJA 2FKJA 1FEMA 3ZUIA 4ORSA 1Y55X 4YCHA 3T2XA 2BS6A 3KFIA 1RLBE 1WBIA 5JR8A 4DQ4A 1TOUA 3H3IA 1W6FA 4ES7A 4BCSA 1YP7A 2P8GA 1KOIA 4GRJA 1B8EA 3SAOA 4ZHCA 3CKGA 1VYOA 3U9PC 4CPEA 1UYOX 1OBUA 2YMSA 4R0BA 4ORUA 4BX5A 1SWLA 3ELXA 4GJSA 1DZJA 1MX7A 2WWPA 4OS0A 1IFCA 5DG4A 3S5XA 5AJBA 4CPHA 4D6BA 1U17A 1HY2A 2VFBA 3FEPA 5B11O 3T6FA 4GGRA 1O1VA 4GKCA 2WR6A 1SY1A 1GX3A 2NP1A 3U03A 3BDRA 4FBRA 4GZVA 1Y53X 2BLGA 2E4JA 3ELZA 4GGZA 4Y0RA 3VGWA 1LDQA 5B29A 2K23A 3FA9A 5HA1A 3L4RA 5H8TA 4QYPA 3TF6A 1JJXA 2KTSA 1VPRA 1JMXA 1X8QA 3QQ2A 4QYNA 1PBOA 2X4MA 3SZHA 2G79A 1G74A 1G85A 2MWHA 2OY7A 1QFVA 4ORRA 3KQ0A 1X8UA 3FR2A 3WVMA 4AZMA 3E3CA 1SXYA 2AT0X 2YG2A 2EU7X 1IFBA 4QQ1A 2RTGB 1GXAA 4MVIA 1PEEA 1OBPA 2GTLM 3NQKA 4TQ2A 2ZAIA 1AVGI 1DC9A 3GAQA 1LNMA 4MISA 4U8UN 4XMHA 4CK4A 1A57A 1AVDA 4YBPA 1P6PA 1MEPA 1N4JA 1Y52X 2RN4A 3C76X 4UU3A 5L8NA 4GNYA 3D4RA 3KFFA 3D95A 1FTPA 4IBAA 2RTCB 1QFTA 4RUUA 1RXHA 4O9SA 4MVEA 1N0SA 1GGLA 3GE2A 1LIFA 5CYBA 3HOEA 3JSQA 3NQ3A 2X8SA 4U3QA 3QKGA 4O3ZA 3WOVA 3WZNA 2OFBA 2Y3EA 3OJYC 1SWEA 3CWKA 4IAXA 2OVEA 4YGGA 5BYPA 1LCZA 3VPJE 4Z28A 3STKA 4NP1A 1B56A 2G78A 3PECA 2IZEB 1EI5A 5EEDA 3TGCA 2X8TA 4A60A 4CV7A 4I9SA 4ZHGA 4YDBA 1X8NA 2IZGB 1SWKA 3EBKA 2X8FA 1X71A 1SWPA 2LBVA 1OEKA 2CM4A 2F01A 4GGTA 1SWGA 4IB7A 3CQRA 4WFVA 4AYHA 1RSTB 2X56A 5LJKA 1SY2A 1VWKB 1MOYA 2HKDA 2QO6A 2RTHB 2QO5A 3FLLA 5AEOA 1O8VA 2G8CO 4TNNA 5HTDA 4I95A 3F6ZB 3NQ9A 1JYJA 1ALBA 3MG5A 4XMGA 1GKAB 1VWFB 1ICMA 4OS8A 3JQOA 2ANSA 1N43A 1S2PA 3MX7A 4GJVA 3FIQA 4DCBA 1SWSA 1SREA 2NNQA 3EW2A 2MF6A 4HPBA 2R74A 4U46A 1JJJA 3APVA 1JMZA 1QY1A 3SLTA 4EFGA 1YWAA 2IZBA 2BT9A 2GTLO 4UU2A 3FENA 4JO6A 4BQUA 1LDOA 1HMSA 1HQQA 4N7DA 3RDXA 3ZZVA 3FR5A 4B55A 2AL0X 4MEEA 3P6GA 1KT6A 2CBRA 1SWQA 1OEJA 2ACPX 4AZRA 1BLRA 2WEXA 4YCEA 3ZW1A 4QGVA 1QQSA 3HTYA 1MDCA 1ACDA 5EDCA 2QO4A 5IO5A 3Q6LA 1NP4A 1A3YA 2JN3A 2WQ9A 3MVFA 2AMMX 4FBVA 1KT4A 5AQ6A 3AUMO 4AZOA 4BX6B 3SLOA 2AH7X 5KHPA 3S5VA 1DF3A 3CMPA 2Q39A 4GUZA 1TW4A 1NBXA 3ZWEA 4YDAA 1EALA 4JHQA 5LJBA 1FE3A 1MX8A 4OMWA 2RTAA 4ORYA 1SRFA 5FQ6E 4Z2PA 1CRBA 5D47A 3RE6A 2RA6A 5AJCA 3VHIA 3NADA 2KT4B 4HWMA 1ERXA 2RTLA 2DJGA 5EEEA 4I3CA 1AB0A 3SZJA 1QABE 1U0XA 2OVAA 2OVDA 3P6DA 1QG5A 1CBRA 1FDQA 1R0UA 1VWDB 2WEWA 3P6FA 5D45A 1EUOA 5B5GA 5LJGA 2IZHB 2X34A 3FYFA 4QZUA 5B27A 3PPTA 2QOSC 5F6ZA 2G7BA 3WJBA 5HCDC 1VWBB 4LZUA 1TXLA 4I3BA 2FTBA 2FS6A 4OMXA 1SWNA 2AVIA 2RQ0A 3V8UA 4ALOA 3RY2A 3FA6A 2OZQA 3FEKA 3PK2A 4KC8A 4NYQA 4XMFA 1YIVA 2JMBA 3STMX 2BS5A 2JU8A 4IB9A 3BU9A 4O3WA 2L67A 1I78A 4IABA 2K62A 3SOTA 2OL7A 1STPA 3KZAA 3NR3A 1KZWA 2FRSA 4I60A 2IZKA 5HZ9A 1NQMA 2QMIA 1ZNHA 3MBTA 2IFBA 4IB8A 2CZUA 5BVQA 4BGFA 2KW1A 2BHVA 3VG5A 4ZHFA 1ZNKA 5CE4A 1A2DA 1SY0A 5IO7A 1XCAA 2W2AA 3APXA 4ZHHA 2OY5O 1YWCA 1I05A 4WBKA 4CPFA 1SXUA 3CR6A 4ON1A 4YFPA 1B4MA 2RTJA 2OY1O 1GT1A 1Y0GA 4CPIA 5HWZA 3U0DA 1QWDA 3WYQA 2HLVA 2POAA 2X45A 2M4LA 1I4UA 3ZW2A 4FQBB 2WPUA 4Y0PA 4QZTA 2L9CA 3B2JA 3ZUOA 5HAEA 1DZPA 3AEHA 4WFUA 1VWAB 3RBYA 1GT5A 2RTNB 5HTEA 4ALBA 4MVLA 3WZPA 4INNA 3EC5A 1T8VA 1YWDA 4NNTA 2A5BA 5DPQA 5BVSA 3VG2A 2OVSA 1KFFA 3VG7A 5FENA 4I3DA 4YMYA 1JBHA 2IZLB 3B2HA 4GETA 2RTKA 1NDJA 1SWTA 3B2KA 4QNIA 4TKHA 1LIEA 4WHIA 1EXSA 4CDDA 1VWCB 1VWGB 1KQXA 4LKTA 1ML7A 1N9MA 2OF9A 3G7XA 3HWFA 4O3XB 3UAQA 4EXZA 1KZXA 3OD9A 2OL8O 4BX7B 3FELA 2ZAGA 4HPCA 4BOEA 2JW1A 2Q2MA 2X32A 3X00A 4Y0QA 3NX2A 2I5VO 1UYNX 1JV4A 5FFHA 1KL3A 1S44A 1HMRA 3HWEA 3HWGA 4YH0A 5F1EA 3RWXA 3APWA 2UZ2A 2HNXA 2FLJA 4HPAA 1E00A 2ASNX 2LKKA 4YGHA 4KCAA 3VE1A 4NLIA 3WZOA 5B5FA 1JZUA 1SWCA 1PTSA 1SLFB 2OY8A 4ARHA 2LFOA 2RTFB 3RY1A 1Z24A 1FELA 1DZKA 3S26A 2R56A 4I9RA 4ZHDA 4ID2A 1LKEA 2RTPB 1LIBA 2A5CA 3VG4A 4L1NA 2Z4HA 2A8GA 4ZCBA 2CBSA 3P24A 4MIRA 1SA8A 2AT8X 3SZIA 1SY3A 5H9NA 2GC9A 1EIIA 4PSQA 1U18A 1CBIA 4M7MA 3RKGA 3WJGA 1NGLA 2A2UA 4FBOA 5HZ5A 4CDCA 2VDFA 3RDMA 3D97A 2FHLA 3AKNA 4BVMA 2AT5X 5IXGA 2AT3X 1GT3A 2PI3O 3NP1A 2MM3A 2OFMX 1GKAA 5HCCC 1BRQA 1VYGA 5LJEA 2FR2A 4AZPA 5D48A 1DV9A 1LCWA 2LBAA 3EMMA 1DFVA 2FKGA 3WBGA 2OL6O 5EDBA 1BSYA 4OS3A 2Q9SA 2DJFA 3TGAA 4EKVA 4O4SA 4OEMA 2HMBA 1D2UA 1IIUA 1LCVA 2RTMA 1LIDA 1SLDB 2AKQA 1EIOA 1TVQA 1YP6A 1SLEB 3FDCA 1N7YA 2GJ5A 3WXQA 1ERBA 4O3YA 4BBOA 4DQ3A 3IFBA 3CBSA 3UEUA 3FA8A 3PP6A 2R73A 4KH8A 1LFOA 1X8OA 1A18A 1EW3A 3RE5A 5K67A 1MVGA 2Y32A 3BLGA 2GTLN 3D96A 5D8JA 1I9HA 3P6EA 1CBQA 1NC9A 4BX6A 1SWHA 1ADLA 2ALLX 4NV8A 4U9CA 1W5RA 3UEXA 4GNWA 4QGXA 1G5WA 1Y9TA 4TKJA 2Q2PA 2Q4NA 3FW5A 1GM6A 1X89A 2W2BA 3BU1A 1KGLA 4ZH9A 2JGSA 4GE1A 1BSOA 5LJDA 3STNA 5LKEA 4NNSA 2XKLA 1HXZA 5KIDA 1EPBA 2C1QA 2AT6X 4YKMA 1ZNEA 4YGZA 1SXXA 4HFOA 1O1UA 4IB6A 1BBPA 5B3MO 2X46A 1QY0A 1VYFA 3P6HA 4ZGFA 1KXOA 2VFCA 1E5PA 2CAMA 2LA7A 4A1HA 4IMOA 1JQPA 4O4UA 1DZMA 3BS2A 4U8UM 3ZW0B 1HBQA 2CM9A 4ORXA 4XMEA 1VWLB 1BJ7A 1RBPA 1CBSA 1DF8A 5HA0A 1HQPA 1VWEB 1KL4A 3NX1A 1PBYA 4KIIA 2UYWA 2DM5A 1RSUB 3B2IA 3CBCA 4IAWA 3DSZA 4LZVA 1SWRA 4NW4A 1I04A 1WUBA 2RTRB 3CKFA 4LQZA 5IRWA 1FJ1E 3FR4A 1S7DA 1GX9A 4GU8A 2A2GA 3S60A 4OELA 5L8IA 2NNDA 5H9AA 1G7NA 1SRIA 1MK5A 3VG6A 4Z6JA 2BSZA 3P02A 3HOLA 5HCEC 1BWYA 2QM9A 3AKMA 1SRJA 1W4TA 2QOMA 3PH5A 1VWPB 3HK1A 1EQDA 1K24A 3JS1A 1HXLA 1VWMB 5F7GA 1LICA 4FGIB 4YVBA 1OBQA 1NQNA 2FWVA 4NYRA 1SRGA 1LPJA 5EPQA 4TKBA 3ZI8A 1OSPO 1T68X 3WJCA 1HBPA 3TZSA 3WZQA 2XSTA 1SLGB 5L8OA 2F09A 3N91A 4HPDA 4ORWA 5B10O 1EPAA 2RTDB 5HZQA 2IZIA 4I6SA 2CZTA 3VHHA 3T2WA 1JYDA 2MJIA 5IRUA 4COTA 4YKOA 2A13A 4OKAA 3BX7A 4TJZA 2IZAA 4BX7A 4BX5B 5L3YA 2RTOB 4GK9A 5LJHA 2ACOA 4IMNA 2RCTA 4CPHB 4ML7B 1E2TA 3B2LA 5F6BA 1QY2A 3WYPA 5BVTA 1B0OA 2OFAA 5B2AO 3EBWA 5JD2A 2C4IA 1UZ2X 5FQ8E 2KD2A
chains in the Genus database with same CATH topology
1HMTA 5H9LA 4O49A 4RUNA 4D6AA 4U8UO 3KFHA 1KT7A 2HZRA 1LF7A 1PMPA 3I0AA 3OE3A 4M6SA 4CSBA 4QGWA 4L3RA 2WSJA 5F58A 3RSWA 1ZNLA 1BSQA 3RZYA 5HBSA 3NBXX 1KQWA 4NLJA 3BRNA 1I06A 4KT5A 1GT4A 1MUPA 1OPBA 3ZQ3A 2GTFX 2Z4IA 5FQ7E 1IW2A 1ICNA 4ZFXA 3PQSA 1E02A 4PJ2A 1BEBA 3O19A 5HZ6A 4GH7A 1XKIA 3O22A 5C0NA 2LB6A 4KC7A 1X8PA 4YFQA 4QRLA 2FS7A 5LJCA 1HN2A 2MHDA 3VE2A 4ZHFA 2FT9A 2L5PA 3BY0A 1L6MA 5D4AA 3K3LA 1YWBA 3T1DA 1NP1A 4QAEA 4YBUA 2HYSA 1IKJA 3C77X 5LKFA 1AELA 3LV4A 3TGBA 2L68A 2W2FA 4K19A 4MVKA 2WUTA 3I17A 2FR3A 2RD7C 2WQAE 3PQUA 4ZH6A 2N93A 1CJ5A 1Y9LA 2HZQA 2NNEA 2KTDA 4YFRA 2OFRX 5KICA 4XMCA 4AZQA 1SXWA 3PH6A 4TLJA 4EEJA 5H9KA 4EDEA 3UEVA 1OPAA 1UREA 3VU1A 2JOZA 1H91A 3F8AA 3UEWA 3BX8A 3DTQA 4A1YA 1GX8A 3FMZA 3O2YA 1IKEA 3EM0A 1KT3A 1PM1X 3C78X 1ZNGA 4AZNA 3ZW0A 3NPOA 2JU7A 5EZ2A 3APUA 1ZRYA 1KT5A 4O4XA 1T0VA 3CQNA 4JGLA 3HWDA 3PEDA 3FW4A 4ODDA 4Y0SA 4YGZA 3WJDA 4XMDA 4EQAC 1D3SA 1E06A 5IO6A 3IA8A 2O62A 3BSZE 1OEEA 4LKPA 3VG3A 4GDZA 5FAZA 2JU3A 1BRPA 3WJEA 1JIWI 1SMPI 1ZNDA 2F73A 3WJFA 3FA7A 2A0AA 3F9DA 3ZW1B 4A8ZA 2MO5A 4AW8A 1FENA 2A3FX 1BM5A 4ZJ0A 5HZ8A 4ZR2A 5K06A 2PY1A 1TOWA 4ZGUA 3OBLA 2RCQA 4N7CA 3LHNA 3P6CA 3EYCA 3KFGA 1AQBA 1YUPA 4O4OA 1FEMA 3ZUIA 4ORSA 4YCHA 2BS6A 3KFIA 1RLBE 5JR8A 4DQ4A 1TOUA 3H3IA 4ES7A 1YP7A 2P8GA 1KOIA 4GRJA 1B8EA 3SAOA 4ZHCA 3U9PC 4R0BA 1OBUA 2YMSA 4ORUA 3ELXA 1DZJA 1MX7A 2WWPA 4OS0A 1IFCA 5DG4A 3S5XA 5AJBA 4D6BA 1U17A 3FEPA 1O1VA 4GKCA 2WR6A 1SY1A 2NP1A 3U03A 3BDRA 4FBRA 4GZVA 2BLGA 2E4JA 3ELZA 4Y0RA 5B29A 2K23A 3FA9A 5HA1A 3L4RA 5H8TA 4QYPA 3TF6A 1JJXA 2KTSA 1VPRA 1X8QA 4QYNA 1PBOA 2G79A 1G74A 1G85A 2MWHA 1QFVA 4ORRA 3KQ0A 1X8UA 3FR2A 3WVMA 4AZMA 3E3CA 1SXYA 2AT0X 2YG2A 2EU7X 1IFBA 4QQ1A 1GXAA 4MVIA 1PEEA 1OBPA 2GTLM 3NQKA 4TQ2A 2ZAIA 1AVGI 1DC9A 3GAQA 1LNMA 4MISA 4U8UN 4XMHA 4CK4A 1A57A 4YBPA 1P6PA 3C76X 2RN4A 4UU3A 5L8NA 4GNYA 3D4RA 3KFFA 3D95A 1FTPA 4IBAA 1QFTA 4RUUA 4O9SA 4MVEA 1N0SA 1GGLA 3GE2A 1LIFA 5CYBA 3HOEA 3JSQA 3NQ3A 2X8SA 4U3QA 3QKGA 4O3ZA 3WOVA 3OJYC 4IAXA 3CWKA 4YGGA 2OVEA 5BYPA 3VPJE 3STKA 4NP1A 1B56A 2G78A 3PECA 1EI5A 5EEDA 3TGCA 2X8TA 4A60A 4CV7A 4I9SA 4ZHGA 4YDBA 1X8NA 3EBKA 2X8FA 1X71A 2LBVA 1OEKA 2CM4A 4IB7A 3CQRA 4WFVA 4AYHA 5LJKA 1SY2A 2QO6A 2QO5A 3FLLA 5AEOA 1O8VA 5HTDA 4TNNA 4I95A 3F6ZB 3NQ9A 1JYJA 1ALBA 4XMGA 1GKAB 1ICMA 4OS8A 3JQOA 2ANSA 1S2PA 3MX7A 3FIQA 1JJJA 2NNQA 4HPBA 2R74A 3APVA 1QY1A 4EFGA 1YWAA 2BT9A 2GTLO 4UU2A 3FENA 4BQUA 1HMSA 4N7DA 3ZZVA 3FR5A 2AL0X 3P6GA 1KT6A 2CBRA 2ACPX 1OEJA 4AZRA 1BLRA 2WEXA 4YCEA 3ZW1A 4QGVA 1QQSA 3HTYA 1MDCA 1ACDA 5EDCA 2QO4A 5IO5A 3Q6LA 1NP4A 1A3YA 2JN3A 2WQ9A 3MVFA 2AMMX 4FBVA 1KT4A 5AQ6A 4AZOA 5KHPA 2AH7X 3S5VA 1DF3A 3CMPA 2Q39A 1TW4A 3ZWEA 4YDAA 1EALA 5LJBA 1FE3A 1MX8A 4OMWA 4ORYA 5FQ6E 1CRBA 5D47A 2RA6A 5AJCA 3NADA 2KT4B 4HWMA 1ERXA 5EEEA 4I3CA 1AB0A 1QABE 1U0XA 2OVAA 2OVDA 3P6DA 1QG5A 1CBRA 1FDQA 1R0UA 2WEWA 3P6FA 5D45A 5LJGA 1EUOA 5HCDC 3FYFA 4QZUA 5B27A 3PPTA 2QOSC 5F6ZA 2G7BA 3WJBA 4LZUA 1TXLA 4I3BA 2FTBA 2FS6A 4OMXA 3V8UA 2RQ0A 4ALOA 3FA6A 2OZQA 3FEKA 4KC8A 4NYQA 4XMFA 1YIVA 2JMBA 3STMX 2BS5A 2JU8A 4IB9A 3BU9A 4O3WA 2L67A 4IABA 2K62A 3SOTA 3KZAA 3NR3A 1KZWA 2FRSA 5HZ9A 2QMIA 1ZNHA 3MBTA 2IFBA 4IB8A 2CZUA 5BVQA 2KW1A 2BHVA 3VG5A 5CE4A 1ZNKA 5IO7A 1A2DA 1SY0A 1XCAA 2W2AA 3APXA 4ZHHA 1YWCA 1I05A 4WBKA 1SXUA 3CR6A 4ON1A 4YFPA 1B4MA 1GT1A 3U0DA 5HWZA 1QWDA 2HLVA 2POAA 2X45A 2M4LA 1I4UA 3ZW2A 4FQBB 4Y0PA 3ZUOA 4QZTA 2L9CA 3B2JA 5HAEA 1DZPA 4WFUA 3RBYA 1GT5A 5HTEA 4ALBA 4MVLA 4INNA 4NNTA 1T8VA 1YWDA 5DPQA 3VG7A 5BVSA 3VG2A 5FENA 2OVSA 4I3DA 4YMYA 1JBHA 3B2HA 4GETA 4TKHA 4QNIA 4WHIA 3B2KA 1LIEA 1EXSA 1KQXA 4LKTA 1ML7A 4O3XB 3HWFA 3G7XA 3UAQA 4EXZA 1KZXA 3OD9A 3FELA 2ZAGA 4HPCA 4BOEA 2JW1A 2Q2MA 4Y0QA 3NX2A 1JV4A 5FFHA 1S44A 4YH0A 1HMRA 3HWEA 3HWGA 5F1EA 3RWXA 3APWA 4HPAA 2HNXA 2FLJA 4YGHA 1E00A 2ASNX 2LKKA 3VE1A 4KCAA 4NLIA 1JZUA 4ARHA 2LFOA 1Z24A 1FELA 1DZKA 3S26A 2R56A 4I9RA 4ZHDA 4ID2A 1LKEA 1LIBA 3VG4A 4L1NA 2Z4HA 4ZCBA 2CBSA 3P24A 4MIRA 1SA8A 2AT8X 1SY3A 5H9NA 2GC9A 1EIIA 4PSQA 1U18A 1CBIA 4M7MA 3RKGA 3WJGA 1NGLA 2A2UA 4FBOA 5HZ5A 3D97A 3AKNA 4BVMA 2AT5X 2AT3X 1GT3A 3NP1A 2MM3A 2OFMX 1GKAA 5HCCC 1BRQA 1VYGA 5LJEA 2FR2A 4AZPA 5D48A 1DV9A 2LBAA 3EMMA 1DFVA 3WBGA 5EDBA 1BSYA 4OS3A 2Q9SA 3TGAA 4O4SA 2HMBA 1D2UA 1IIUA 1LIDA 1EIOA 2AKQA 1TVQA 1YP6A 3WXQA 2GJ5A 1ERBA 4O3YA 4DQ3A 3IFBA 3CBSA 3UEUA 3FA8A 3PP6A 2R73A 4KH8A 1LFOA 1X8OA 1A18A 1EW3A 1MVGA 3BLGA 3D96A 2GTLN 5D8JA 3P6EA 1CBQA 1ADLA 2ALLX 4U9CA 3UEXA 1G5WA 4GNWA 4QGXA 1Y9TA 4TKJA 2Q2PA 2Q4NA 3FW5A 1GM6A 1X89A 2W2BA 3BU1A 1KGLA 4ZH9A 4GE1A 1BSOA 5LJDA 3STNA 5LKEA 4NNSA 2XKLA 5KIDA 1EPBA 2AT6X 4YKMA 1ZNEA 1SXXA 4HFOA 1O1UA 4IB6A 1BBPA 2X46A 1QY0A 1VYFA 3P6HA 4ZGFA 1KXOA 1E5PA 2LA7A 4A1HA 4IMOA 4O4UA 4U8UM 1DZMA 3BS2A 3ZW0B 1HBQA 2CM9A 4ORXA 4XMEA 1BJ7A 1RBPA 1CBSA 5HA0A 1HQPA 3NX1A 4KIIA 2DM5A 4LZVA 3B2IA 3CBCA 4IAWA 3DSZA 4NW4A 1I04A 4LQZA 3FR4A 1S7DA 1GX9A 4GU8A 2A2GA 3S60A 5L8IA 2NNDA 5H9AA 1G7NA 3VG6A 3P02A 3HOLA 5HCEC 1BWYA 2QM9A 3AKMA 3PH5A 3HK1A 1EQDA 3JS1A 5F7GA 1LICA 4FGIB 1OBQA 2FWVA 4NYRA 1LPJA 5EPQA 4TKBA 3ZI8A 1T68X 3WJCA 1HBPA 3TZSA 2XSTA 5L8OA 2F09A 3N91A 4HPDA 4ORWA 1EPAA 5HZQA 4I6SA 2CZTA 4COTA 1JYDA 2MJIA 4YKOA 2A13A 4TJZA 3BX7A 4GK9A 5LJHA 2ACOA 4IMNA 2RCTA 4ML7B 3B2LA 5F6BA 1QY2A 5BVTA 1B0OA 3EBWA 1UZ2X 5FQ8E 2KD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMT A;  5H9L A;  4RUN A;  4D6A A;  3KFH A;  1KT7 A;  2HZR A;  1LF7 A;  1PMP A;  3I0A A;  4M6S A;  4QGW A;  2WSJ A;  5F58 A;  3RSW A;  1ZNL A;  1BSQ A;  3RZY A;  5HBS A;  1KQW A;  4NLJ A;  3BRN A;  1I06 A;  1GT4 A;  1MUP A;  1OPB A;  3ZQ3 A;  2GTF X;  1IW2 A;  1ICN A;  4ZFX A;  1E02 A;  1BEB A;  3O19 A;  5HZ6 A;  4GH7 A;  1XKI A;  3O22 A;  5C0N A;  2LB6 A;  1X8P A;  4YFQ A;  5LJC A;  2FS7 A;  1HN2 A;  4ZHF A;  2FT9 A;  2L5P A;  3BY0 A;  1L6M A;  5D4A A;  3K3L A;  1YWB A;  3T1D A;  1NP1 A;  4QAE A;  4YBU A;  2HYS A;  1IKJ A;  3C77 X;  5LKF A;  1AEL A;  3TGB A;  2L68 A;  2W2F A;  4K19 A;  4MVK A;  2WUT A;  3I17 A;  2FR3 A;  2RD7 C;  2WQA E;  4ZH6 A;  1CJ5 A;  2N93 A;  2HZQ A;  2NNE A;  2KTD A;  4YFR A;  2OFR X;  4XMC A;  4AZQ A;  1SXW A;  3PH6 A;  4TLJ A;  4EEJ A;  5H9K A;  4EDE A;  3UEV A;  1OPA A;  1URE A;  2JOZ A;  1H91 A;  3F8A A;  3UEW A;  3BX8 A;  3DTQ A;  4A1Y A;  1GX8 A;  3FMZ A;  3O2Y A;  1IKE A;  3EM0 A;  1KT3 A;  1PM1 X;  3C78 X;  1ZNG A;  4AZN A;  3NPO A;  2JU7 A;  5EZ2 A;  3APU A;  1ZRY A;  1KT5 A;  5KIC A;  1T0V A;  3CQN A;  4YGZ A;  3HWD A;  3PED A;  3FW4 A;  4ODD A;  4Y0S A;  3WJD A;  4XMD A;  1D3S A;  1E06 A;  5IO6 A;  3IA8 A;  2O62 A;  3BSZ E;  1OEE A;  4LKP A;  3VG3 A;  5FAZ A;  2JU3 A;  1BRP A;  3WJE A;  1ZND A;  2F73 A;  3WJF A;  3FA7 A;  2A0A A;  3F9D A;  4A8Z A;  4AW8 A;  2MO5 A;  1FEN A;  2A3F X;  1BM5 A;  4ZJ0 A;  5HZ8 A;  4ZR2 A;  5K06 A;  2PY1 A;  1TOW A;  4ZGU A;  2RCQ A;  4N7C A;  3P6C A;  3EYC A;  3KFG A;  1AQB A;  1YUP A;  1FEM A;  3ZUI A;  4ORS A;  4YCH A;  3KFI A;  1RLB E;  5JR8 A;  4DQ4 A;  1TOU A;  4ES7 A;  1YP7 A;  2P8G A;  1KOI A;  4GRJ A;  1B8E A;  3SAO A;  4ZHC A;  3U9P C;  4R0B A;  1OBU A;  4ORU A;  3ELX A;  1DZJ A;  1MX7 A;  2WWP A;  4OS0 A;  1IFC A;  5DG4 A;  4D6B A;  1U17 A;  3FEP A;  1O1V A;  4GKC A;  2WR6 A;  1SY1 A;  2NP1 A;  3U03 A;  3BDR A;  2BLG A;  2E4J A;  3ELZ A;  4Y0R A;  5B29 A;  2K23 A;  3FA9 A;  5HA1 A;  3L4R A;  5H8T A;  4QYP A;  3TF6 A;  1JJX A;  1VPR A;  1X8Q A;  4QYN A;  1PBO A;  2G79 A;  1G74 A;  1G85 A;  1QFV A;  4ORR A;  3KQ0 A;  1X8U A;  3FR2 A;  3WVM A;  4AZM A;  1SXY A;  2AT0 X;  2YG2 A;  2EU7 X;  1IFB A;  1GXA A;  4MVI A;  1PEE A;  1OBP A;  4TQ2 A;  3GAQ A;  1AVG I;  1DC9 A;  4XMH A;  1LNM A;  4CK4 A;  1A57 A;  4YBP A;  1P6P A;  3C76 X;  4UU3 A;  5L8N A;  4GNY A;  3KFF A;  3D95 A;  1FTP A;  4IBA A;  1QFT A;  4RUU A;  4O9S A;  1N0S A;  1GGL A;  1LIF A;  3JSQ A;  3NQ3 A;  3QKG A;  3OJY C;  4IAX A;  3CWK A;  4YGG A;  2OVE A;  3STK A;  4NP1 A;  1B56 A;  2G78 A;  3PEC A;  5EED A;  3TGC A;  4A60 A;  4I9S A;  4ZHG A;  4YDB A;  1X8N A;  3EBK A;  1X71 A;  2LBV A;  1OEK A;  2CM4 A;  4IB7 A;  3CQR A;  4WFV A;  4AYH A;  5LJK A;  1SY2 A;  2QO6 A;  2QO5 A;  3FLL A;  1O8V A;  5HTD A;  4TNN A;  3NQ9 A;  1JYJ A;  1ALB A;  4XMG A;  1GKA B;  1ICM A;  4OS8 A;  2ANS A;  1S2P A;  3FIQ A;  1JJJ A;  2NNQ A;  4HPB A;  2R74 A;  3APV A;  1QY1 A;  4EFG A;  1YWA A;  4UU2 A;  3FEN A;  4BQU A;  1HMS A;  4N7D A;  3FR5 A;  2AL0 X;  3P6G A;  1KT6 A;  2CBR A;  2ACP X;  1OEJ A;  4AZR A;  1BLR A;  2WEX A;  4YCE A;  4QGV A;  1QQS A;  1MDC A;  1ACD A;  5EDC A;  2QO4 A;  5IO5 A;  3Q6L A;  1NP4 A;  1A3Y A;  2JN3 A;  2WQ9 A;  3MVF A;  2AMM X;  5AQ6 A;  1KT4 A;  4AZO A;  5KHP A;  2AH7 X;  1DF3 A;  3CMP A;  2Q39 A;  1TW4 A;  4YDA A;  1EAL A;  5LJB A;  1FE3 A;  1MX8 A;  4OMW A;  4ORY A;  1CRB A;  5D47 A;  2RA6 A;  3NAD A;  2KT4 B;  1ERX A;  5EEE A;  4I3C A;  1AB0 A;  1QAB E;  1U0X A;  2OVA A;  2OVD A;  3P6D A;  1QG5 A;  1CBR A;  1FDQ A;  1R0U A;  2WEW A;  3P6F A;  5D45 A;  5LJG A;  1EUO A;  5HCD C;  4QZU A;  5B27 A;  3PPT A;  2QOS C;  5F6Z A;  2G7B A;  3WJB A;  4LZU A;  1TXL A;  4I3B A;  2FTB A;  2FS6 A;  4OMX A;  4ALO A;  2RQ0 A;  3FA6 A;  2OZQ A;  3FEK A;  4NYQ A;  4XMF A;  1YIV A;  3STM X;  2JU8 A;  4IB9 A;  3BU9 A;  2L67 A;  2K62 A;  3KZA A;  3NR3 A;  1KZW A;  2FRS A;  5HZ9 A;  1ZNH A;  3MBT A;  2IFB A;  4IB8 A;  2CZU A;  5BVQ A;  3VG5 A;  5CE4 A;  1ZNK A;  5IO7 A;  1A2D A;  1SY0 A;  1XCA A;  2W2A A;  3APX A;  4ZHH A;  1YWC A;  1I05 A;  4WBK A;  1SXU A;  3CR6 A;  4YFP A;  1B4M A;  1GT1 A;  3U0D A;  5HWZ A;  1QWD A;  2HLV A;  2POA A;  2X45 A;  1I4U A;  4Y0P A;  3ZUO A;  4QZT A;  2L9C A;  3B2J A;  5HAE A;  1DZP A;  4WFU A;  1GT5 A;  5HTE A;  4ALB A;  4MVL A;  4NNT A;  1T8V A;  1YWD A;  5DPQ A;  3VG7 A;  5BVS A;  3VG2 A;  5FEN A;  4I3D A;  4YMY A;  1JBH A;  3B2H A;  4GET A;  4TKH A;  3B2K A;  1LIE A;  1EXS A;  1KQX A;  4LKT A;  1ML7 A;  3HWF A;  3G7X A;  4EXZ A;  1KZX A;  3FEL A;  4HPC A;  4BOE A;  2Q2M A;  4Y0Q A;  3NX2 A;  1JV4 A;  5FFH A;  1S44 A;  4YH0 A;  1HMR A;  3HWE A;  3HWG A;  5F1E A;  3APW A;  4HPA A;  2HNX A;  2FLJ A;  4YGH A;  1E00 A;  2ASN X;  2LKK A;  4NLI A;  1JZU A;  4ARH A;  2LFO A;  1Z24 A;  1FEL A;  1DZK A;  3S26 A;  2R56 A;  4I9R A;  4ZHD A;  1LKE A;  1LIB A;  3VG4 A;  4ZCB A;  2CBS A;  1SA8 A;  2AT8 X;  1SY3 A;  5H9N A;  2GC9 A;  1EII A;  4PSQ A;  1U18 A;  1CBI A;  4M7M A;  3WJG A;  1NGL A;  2A2U A;  5HZ5 A;  3D97 A;  3AKN A;  4BVM A;  2AT5 X;  2AT3 X;  1GT3 A;  3NP1 A;  2MM3 A;  2OFM X;  1GKA A;  5HCC C;  1BRQ A;  1VYG A;  5LJE A;  2FR2 A;  4AZP A;  5D48 A;  1DV9 A;  2LBA A;  3EMM A;  1DFV A;  3WBG A;  5EDB A;  1BSY A;  4OS3 A;  2Q9S A;  3TGA A;  2HMB A;  1D2U A;  1IIU A;  1LID A;  1EIO A;  2AKQ A;  1TVQ A;  1YP6 A;  3WXQ A;  2GJ5 A;  1ERB A;  4DQ3 A;  3IFB A;  3CBS A;  3UEU A;  3FA8 A;  3PP6 A;  2R73 A;  1LFO A;  1X8O A;  1A18 A;  1EW3 A;  1MVG A;  3BLG A;  3D96 A;  5D8J A;  3P6E A;  1CBQ A;  1ADL A;  2ALL X;  3UEX A;  1G5W A;  4GNW A;  4QGX A;  4TKJ A;  2Q2P A;  2Q4N A;  3FW5 A;  1GM6 A;  1X89 A;  2W2B A;  3BU1 A;  1KGL A;  4ZH9 A;  4GE1 A;  1BSO A;  5LJD A;  3STN A;  5LKE A;  4NNS A;  2XKL A;  5KID A;  1EPB A;  2AT6 X;  4YKM A;  1ZNE A;  1SXX A;  4HFO A;  1O1U A;  4IB6 A;  1BBP A;  2X46 A;  1QY0 A;  1VYF A;  3P6H A;  1KXO A;  1E5P A;  4A1H A;  4IMO A;  1DZM A;  3BS2 A;  1HBQ A;  2CM9 A;  4ORX A;  4XME A;  1BJ7 A;  1RBP A;  1CBS A;  5HA0 A;  1HQP A;  3NX1 A;  4KII A;  2DM5 A;  4LZV A;  3B2I A;  3CBC A;  4IAW A;  3DSZ A;  1I04 A;  3FR4 A;  1S7D A;  1GX9 A;  2A2G A;  5L8I A;  2NND A;  5H9A A;  1G7N A;  3VG6 A;  5HCE C;  1BWY A;  2QM9 A;  3AKM A;  3PH5 A;  3HK1 A;  1EQD A;  3JS1 A;  5F7G A;  1LIC A;  1OBQ A;  2FWV A;  4NYR A;  1LPJ A;  5EPQ A;  4TKB A;  1T68 X;  3WJC A;  1HBP A;  3TZS A;  2XST A;  5L8O A;  4ORW A;  4HPD A;  1EPA A;  5HZQ A;  2CZT A;  1JYD A;  2MJI A;  4YKO A;  2A13 A;  4TJZ A;  3BX7 A;  5LJH A;  2ACO A;  4IMN A;  2RCT A;  3B2L A;  5F6B A;  1QY2 A;  5BVT A;  1B0O A;  3EBW A;  1UZ2 X; 
#chains in the Genus database with same CATH topology
 1JJU A;  1HMT A;  1VWO B;  1SWJ A;  3RDO A;  5H9L A;  4O49 A;  1N9Y A;  4RUN A;  4D6A A;  2I5Z O;  1SWU A;  2X55 A;  3KFH A;  4U8U O;  2RTI B;  1KT7 A;  1SWF A;  1LF7 A;  2HZR A;  1PMP A;  4GDA A;  1SWD A;  3I0A A;  3OE3 A;  4GD9 A;  4M6S A;  4CSB A;  2IZC B;  4QGW A;  4L3R A;  3RDU A;  2WSJ A;  5F58 A;  3VHM A;  3RSW A;  1ZNL A;  1BSQ A;  4JNJ A;  5HBS A;  3NBX X;  1KQW A;  4NLJ A;  3BRN A;  3RZY A;  1I06 A;  4KT5 A;  1GT4 A;  1MUP A;  1OPB A;  3ZQ3 A;  3FID A;  2GTF X;  2Z4I A;  1VWJ B;  5FQ7 E;  1IW2 A;  2AF5 A;  1ICN A;  4C5P A;  4ZFX A;  1STR B;  3PQS A;  1E02 A;  4PJ2 A;  1BEB A;  3O19 A;  5HZ6 A;  1IJ8 A;  4GH7 A;  1XKI A;  3O22 A;  5C0N A;  2LB6 A;  4KC7 A;  1X8P A;  4YFQ A;  4QRL A;  2FS7 A;  3MM0 A;  5LJC A;  1RXJ A;  2RTQ B;  1HN2 A;  1K3B A;  1VWH B;  1LEL A;  2MHD A;  3T6L A;  2FT9 A;  2L5P A;  3BY0 A;  1KL5 A;  1L6M A;  1VWN B;  3K3L A;  1STS B;  1YWB A;  5D4A A;  3T1D A;  1NP1 A;  4QAE A;  4YBU A;  2HYS A;  4IRW A;  2IZF B;  1IKJ A;  4Y59 A;  1SRH A;  1VWR B;  3C77 X;  2OYB O;  5LKF A;  1AEL A;  2BC3 A;  3LV4 A;  3TGB A;  4Z2V A;  3VE2 A;  2L68 A;  1RXK A;  2W2F A;  4K19 A;  2WUT A;  4MVK A;  4CDE A;  3I17 A;  3WJD A;  1SWA A;  2FR3 A;  2IZJ A;  2RD7 C;  2WQA E;  2N93 A;  3PQU A;  4ZH6 A;  1CJ5 A;  4BJ8 A;  2FGS A;  1Y9L A;  2HZQ A;  2NNE A;  3Q34 A;  2KTD A;  5CSE A;  4YFR A;  2OFR X;  5KIC A;  4XMC A;  4AZQ A;  1VWI B;  1SXW A;  3PH6 A;  4TLJ A;  1VWQ B;  3KVN A;  4EEJ A;  5H9K A;  2RTE B;  4EDE A;  3UEV A;  2Y3F A;  2ZSC A;  1OPA A;  1URE A;  3VU1 A;  1SWO A;  2GH7 A;  1H91 A;  2JOZ A;  3F8A A;  3UEW A;  3BX8 A;  1SWB A;  3DTQ A;  3LTW A;  4A1Y A;  1GX8 A;  3EW1 A;  3FMZ A;  4DNE A;  3O2Y A;  1IKE A;  2G5L A;  3EM0 A;  1KT3 A;  3HPE A;  3RDS A;  1PM1 X;  3C78 X;  1RAV A;  1ZNG A;  1AVE A;  4AZN A;  3ZW0 A;  3NPO A;  4Y5D A;  2JU7 A;  5EZ2 A;  3APU A;  1ZRY A;  1KT5 A;  1MM9 A;  1T0V A;  3CQN A;  4JGL A;  3HWD A;  3PED A;  3FW4 A;  4O4X A;  2RTB B;  4ODD A;  4Y0S A;  4XMD A;  5F2B A;  1D3S A;  1E06 A;  2OF8 A;  5IO6 A;  3IA8 A;  4CDF A;  2O62 A;  3BSZ E;  2QCB A;  3RDQ A;  1OEE A;  4LKP A;  3VG3 A;  3D9W A;  4GDZ A;  5FAZ A;  2JU3 A;  1BRP A;  3WJE A;  1JIW I;  1SMP I;  1ZND A;  5IRA A;  2F73 A;  3WJF A;  3FA7 A;  2A0A A;  3F9D A;  3ZW1 B;  4A8Z A;  2MO5 A;  4AW8 A;  1FEN A;  2A3F X;  1BM5 A;  4ZJ0 A;  5HZ8 A;  2C1S A;  2FHN X;  4ZR2 A;  5K06 A;  2PY1 A;  1TOW A;  4ZGU A;  3OBL A;  2RCQ A;  4NV7 A;  4Z27 A;  4N7C A;  5CHK A;  3LHN A;  3P6C A;  5K68 A;  4Z2O A;  3EYC A;  2IZD B;  4EQA C;  3KFG A;  1AQB A;  1YUP A;  4O4O A;  3PDF A;  1LUQ A;  3SLJ A;  2FKJ A;  1FEM A;  3ZUI A;  4ORS A;  1Y55 X;  4YCH A;  3T2X A;  2BS6 A;  3KFI A;  1RLB E;  1WBI A;  5JR8 A;  4DQ4 A;  1TOU A;  3H3I A;  1W6F A;  4ES7 A;  4BCS A;  1YP7 A;  2P8G A;  1KOI A;  4GRJ A;  1B8E A;  3SAO A;  4ZHC A;  3CKG A;  1VYO A;  3U9P C;  4CPE A;  1UYO X;  1OBU A;  2YMS A;  4R0B A;  4ORU A;  4BX5 A;  1SWL A;  3ELX A;  4GJS A;  1DZJ A;  1MX7 A;  2WWP A;  4OS0 A;  1IFC A;  5DG4 A;  3S5X A;  5AJB A;  4CPH A;  4D6B A;  1U17 A;  1HY2 A;  2VFB A;  3FEP A;  5B11 O;  3T6F A;  4GGR A;  1O1V A;  4GKC A;  2WR6 A;  1SY1 A;  1GX3 A;  2NP1 A;  3U03 A;  3BDR A;  4FBR A;  4GZV A;  1Y53 X;  2BLG A;  2E4J A;  3ELZ A;  4GGZ A;  4Y0R A;  3VGW A;  1LDQ A;  5B29 A;  2K23 A;  3FA9 A;  5HA1 A;  3L4R A;  5H8T A;  4QYP A;  3TF6 A;  1JJX A;  2KTS A;  1VPR A;  1JMX A;  1X8Q A;  3QQ2 A;  4QYN A;  1PBO A;  2X4M A;  3SZH A;  2G79 A;  1G74 A;  1G85 A;  2MWH A;  2OY7 A;  1QFV A;  4ORR A;  3KQ0 A;  1X8U A;  3FR2 A;  3WVM A;  4AZM A;  3E3C A;  1SXY A;  2AT0 X;  2YG2 A;  2EU7 X;  1IFB A;  4QQ1 A;  2RTG B;  1GXA A;  4MVI A;  1PEE A;  1OBP A;  2GTL M;  3NQK A;  4TQ2 A;  2ZAI A;  1AVG I;  1DC9 A;  3GAQ A;  1LNM A;  4MIS A;  4U8U N;  4XMH A;  4CK4 A;  1A57 A;  1AVD A;  4YBP A;  1P6P A;  1MEP A;  1N4J A;  1Y52 X;  2RN4 A;  3C76 X;  4UU3 A;  5L8N A;  4GNY A;  3D4R A;  3KFF A;  3D95 A;  1FTP A;  4IBA A;  2RTC B;  1QFT A;  4RUU A;  1RXH A;  4O9S A;  4MVE A;  1N0S A;  1GGL A;  3GE2 A;  1LIF A;  5CYB A;  3HOE A;  3JSQ A;  3NQ3 A;  2X8S A;  4U3Q A;  3QKG A;  4O3Z A;  3WOV A;  3WZN A;  2OFB A;  2Y3E A;  3OJY C;  1SWE A;  3CWK A;  4IAX A;  2OVE A;  4YGG A;  5BYP A;  1LCZ A;  3VPJ E;  4Z28 A;  3STK A;  4NP1 A;  1B56 A;  2G78 A;  3PEC A;  2IZE B;  1EI5 A;  5EED A;  3TGC A;  2X8T A;  4A60 A;  4CV7 A;  4I9S A;  4ZHG A;  4YDB A;  1X8N A;  2IZG B;  1SWK A;  3EBK A;  2X8F A;  1X71 A;  1SWP A;  2LBV A;  1OEK A;  2CM4 A;  2F01 A;  4GGT A;  1SWG A;  4IB7 A;  3CQR A;  4WFV A;  4AYH A;  1RST B;  2X56 A;  5LJK A;  1SY2 A;  1VWK B;  1MOY A;  2HKD A;  2QO6 A;  2RTH B;  2QO5 A;  3FLL A;  5AEO A;  1O8V A;  2G8C O;  4TNN A;  5HTD A;  4I95 A;  3F6Z B;  3NQ9 A;  1JYJ A;  1ALB A;  3MG5 A;  4XMG A;  1GKA B;  1VWF B;  1ICM A;  4OS8 A;  3JQO A;  2ANS A;  1N43 A;  1S2P A;  3MX7 A;  4GJV A;  3FIQ A;  4DCB A;  1SWS A;  1SRE A;  2NNQ A;  3EW2 A;  2MF6 A;  4HPB A;  2R74 A;  4U46 A;  1JJJ A;  3APV A;  1JMZ A;  1QY1 A;  3SLT A;  4EFG A;  1YWA A;  2IZB A;  2BT9 A;  2GTL O;  4UU2 A;  3FEN A;  4JO6 A;  4BQU A;  1LDO A;  1HMS A;  1HQQ A;  4N7D A;  3RDX A;  3ZZV A;  3FR5 A;  4B55 A;  2AL0 X;  4MEE A;  3P6G A;  1KT6 A;  2CBR A;  1SWQ A;  1OEJ A;  2ACP X;  4AZR A;  1BLR A;  2WEX A;  4YCE A;  3ZW1 A;  4QGV A;  1QQS A;  3HTY A;  1MDC A;  1ACD A;  5EDC A;  2QO4 A;  5IO5 A;  3Q6L A;  1NP4 A;  1A3Y A;  2JN3 A;  2WQ9 A;  3MVF A;  2AMM X;  4FBV A;  1KT4 A;  5AQ6 A;  3AUM O;  4AZO A;  4BX6 B;  3SLO A;  2AH7 X;  5KHP A;  3S5V A;  1DF3 A;  3CMP A;  2Q39 A;  4GUZ A;  1TW4 A;  1NBX A;  3ZWE A;  4YDA A;  1EAL A;  4JHQ A;  5LJB A;  1FE3 A;  1MX8 A;  4OMW A;  2RTA A;  4ORY A;  1SRF A;  5FQ6 E;  4Z2P A;  1CRB A;  5D47 A;  3RE6 A;  2RA6 A;  5AJC A;  3VHI A;  3NAD A;  2KT4 B;  4HWM A;  1ERX A;  2RTL A;  2DJG A;  5EEE A;  4I3C A;  1AB0 A;  3SZJ A;  1QAB E;  1U0X A;  2OVA A;  2OVD A;  3P6D A;  1QG5 A;  1CBR A;  1FDQ A;  1R0U A;  1VWD B;  2WEW A;  3P6F A;  5D45 A;  1EUO A;  5B5G A;  5LJG A;  2IZH B;  2X34 A;  3FYF A;  4QZU A;  5B27 A;  3PPT A;  2QOS C;  5F6Z A;  2G7B A;  3WJB A;  5HCD C;  1VWB B;  4LZU A;  1TXL A;  4I3B A;  2FTB A;  2FS6 A;  4OMX A;  1SWN A;  2AVI A;  2RQ0 A;  3V8U A;  4ALO A;  3RY2 A;  3FA6 A;  2OZQ A;  3FEK A;  3PK2 A;  4KC8 A;  4NYQ A;  4XMF A;  1YIV A;  2JMB A;  3STM X;  2BS5 A;  2JU8 A;  4IB9 A;  3BU9 A;  4O3W A;  2L67 A;  1I78 A;  4IAB A;  2K62 A;  3SOT A;  2OL7 A;  1STP A;  3KZA A;  3NR3 A;  1KZW A;  2FRS A;  4I60 A;  2IZK A;  5HZ9 A;  1NQM A;  2QMI A;  1ZNH A;  3MBT A;  2IFB A;  4IB8 A;  2CZU A;  5BVQ A;  4BGF A;  2KW1 A;  2BHV A;  3VG5 A;  4ZHF A;  1ZNK A;  5CE4 A;  1A2D A;  1SY0 A;  5IO7 A;  1XCA A;  2W2A A;  3APX A;  4ZHH A;  2OY5 O;  1YWC A;  1I05 A;  4WBK A;  4CPF A;  1SXU A;  3CR6 A;  4ON1 A;  4YFP A;  1B4M A;  2RTJ A;  2OY1 O;  1GT1 A;  1Y0G A;  4CPI A;  5HWZ A;  3U0D A;  1QWD A;  3WYQ A;  2HLV A;  2POA A;  2X45 A;  2M4L A;  1I4U A;  3ZW2 A;  4FQB B;  2WPU A;  4Y0P A;  4QZT A;  2L9C A;  3B2J A;  3ZUO A;  5HAE A;  1DZP A;  3AEH A;  4WFU A;  1VWA B;  3RBY A;  1GT5 A;  2RTN B;  5HTE A;  4ALB A;  4MVL A;  3WZP A;  4INN A;  3EC5 A;  1T8V A;  1YWD A;  4NNT A;  2A5B A;  5DPQ A;  5BVS A;  3VG2 A;  2OVS A;  1KFF A;  3VG7 A;  5FEN A;  4I3D A;  4YMY A;  1JBH A;  2IZL B;  3B2H A;  4GET A;  2RTK A;  1NDJ A;  1SWT A;  3B2K A;  4QNI A;  4TKH A;  1LIE A;  4WHI A;  1EXS A;  4CDD A;  1VWC B;  1VWG B;  1KQX A;  4LKT A;  1ML7 A;  1N9M A;  2OF9 A;  3G7X A;  3HWF A;  4O3X B;  3UAQ A;  4EXZ A;  1KZX A;  3OD9 A;  2OL8 O;  4BX7 B;  3FEL A;  2ZAG A;  4HPC A;  4BOE A;  2JW1 A;  2Q2M A;  2X32 A;  3X00 A;  4Y0Q A;  3NX2 A;  2I5V O;  1UYN X;  1JV4 A;  5FFH A;  1KL3 A;  1S44 A;  1HMR A;  3HWE A;  3HWG A;  4YH0 A;  5F1E A;  3RWX A;  3APW A;  2UZ2 A;  2HNX A;  2FLJ A;  4HPA A;  1E00 A;  2ASN X;  2LKK A;  4YGH A;  4KCA A;  3VE1 A;  4NLI A;  3WZO A;  5B5F A;  1JZU A;  1SWC A;  1PTS A;  1SLF B;  2OY8 A;  4ARH A;  2LFO A;  2RTF B;  3RY1 A;  1Z24 A;  1FEL A;  1DZK A;  3S26 A;  2R56 A;  4I9R A;  4ZHD A;  4ID2 A;  1LKE A;  2RTP B;  1LIB A;  2A5C A;  3VG4 A;  4L1N A;  2Z4H A;  2A8G A;  4ZCB A;  2CBS A;  3P24 A;  4MIR A;  1SA8 A;  2AT8 X;  3SZI A;  1SY3 A;  5H9N A;  2GC9 A;  1EII A;  4PSQ A;  1U18 A;  1CBI A;  4M7M A;  3RKG A;  3WJG A;  1NGL A;  2A2U A;  4FBO A;  5HZ5 A;  4CDC A;  2VDF A;  3RDM A;  3D97 A;  2FHL A;  3AKN A;  4BVM A;  2AT5 X;  5IXG A;  2AT3 X;  1GT3 A;  2PI3 O;  3NP1 A;  2MM3 A;  2OFM X;  1GKA A;  5HCC C;  1BRQ A;  1VYG A;  5LJE A;  2FR2 A;  4AZP A;  5D48 A;  1DV9 A;  1LCW A;  2LBA A;  3EMM A;  1DFV A;  2FKG A;  3WBG A;  2OL6 O;  5EDB A;  1BSY A;  4OS3 A;  2Q9S A;  2DJF A;  3TGA A;  4EKV A;  4O4S A;  4OEM A;  2HMB A;  1D2U A;  1IIU A;  1LCV A;  2RTM A;  1LID A;  1SLD B;  2AKQ A;  1EIO A;  1TVQ A;  1YP6 A;  1SLE B;  3FDC A;  1N7Y A;  2GJ5 A;  3WXQ A;  1ERB A;  4O3Y A;  4BBO A;  4DQ3 A;  3IFB A;  3CBS A;  3UEU A;  3FA8 A;  3PP6 A;  2R73 A;  4KH8 A;  1LFO A;  1X8O A;  1A18 A;  1EW3 A;  3RE5 A;  5K67 A;  1MVG A;  2Y32 A;  3BLG A;  2GTL N;  3D96 A;  5D8J A;  1I9H A;  3P6E A;  1CBQ A;  1NC9 A;  4BX6 A;  1SWH A;  1ADL A;  2ALL X;  4NV8 A;  4U9C A;  1W5R A;  3UEX A;  4GNW A;  4QGX A;  1G5W A;  1Y9T A;  4TKJ A;  2Q2P A;  2Q4N A;  3FW5 A;  1GM6 A;  1X89 A;  2W2B A;  3BU1 A;  1KGL A;  4ZH9 A;  2JGS A;  4GE1 A;  1BSO A;  5LJD A;  3STN A;  5LKE A;  4NNS A;  2XKL A;  1HXZ A;  5KID A;  1EPB A;  2C1Q A;  2AT6 X;  4YKM A;  1ZNE A;  4YGZ A;  1SXX A;  4HFO A;  1O1U A;  4IB6 A;  1BBP A;  5B3M O;  2X46 A;  1QY0 A;  1VYF A;  3P6H A;  4ZGF A;  1KXO A;  2VFC A;  1E5P A;  2CAM A;  2LA7 A;  4A1H A;  4IMO A;  1JQP A;  4O4U A;  1DZM A;  3BS2 A;  4U8U M;  3ZW0 B;  1HBQ A;  2CM9 A;  4ORX A;  4XME A;  1VWL B;  1BJ7 A;  1RBP A;  1CBS A;  1DF8 A;  5HA0 A;  1HQP A;  1VWE B;  1KL4 A;  3NX1 A;  1PBY A;  4KII A;  2UYW A;  2DM5 A;  1RSU B;  3B2I A;  3CBC A;  4IAW A;  3DSZ A;  4LZV A;  1SWR A;  4NW4 A;  1I04 A;  1WUB A;  2RTR B;  3CKF A;  4LQZ A;  5IRW A;  1FJ1 E;  3FR4 A;  1S7D A;  1GX9 A;  4GU8 A;  2A2G A;  3S60 A;  4OEL A;  5L8I A;  2NND A;  5H9A A;  1G7N A;  1SRI A;  1MK5 A;  3VG6 A;  4Z6J A;  2BSZ A;  3P02 A;  3HOL A;  5HCE C;  1BWY A;  2QM9 A;  3AKM A;  1SRJ A;  1W4T A;  2QOM A;  3PH5 A;  1VWP B;  3HK1 A;  1EQD A;  1K24 A;  3JS1 A;  1HXL A;  1VWM B;  5F7G A;  1LIC A;  4FGI B;  4YVB A;  1OBQ A;  1NQN A;  2FWV A;  4NYR A;  1SRG A;  1LPJ A;  5EPQ A;  4TKB A;  3ZI8 A;  1OSP O;  1T68 X;  3WJC A;  1HBP A;  3TZS A;  3WZQ A;  2XST A;  1SLG B;  5L8O A;  2F09 A;  3N91 A;  4HPD A;  4ORW A;  5B10 O;  1EPA A;  2RTD B;  5HZQ A;  2IZI A;  4I6S A;  2CZT A;  3VHH A;  3T2W A;  1JYD A;  2MJI A;  5IRU A;  4COT A;  4YKO A;  2A13 A;  4OKA A;  3BX7 A;  4TJZ A;  2IZA A;  4BX7 A;  4BX5 B;  5L3Y A;  2RTO B;  4GK9 A;  5LJH A;  2ACO A;  4IMN A;  2RCT A;  4CPH B;  4ML7 B;  1E2T A;  3B2L A;  5F6B A;  1QY2 A;  3WYP A;  5BVT A;  1B0O A;  2OFA A;  5B2A O;  3EBW A;  5JD2 A;  2C4I A;  1UZ2 X;  5FQ8 E;  2KD2 A; 
#chains in the Genus database with same CATH homology
 1HMT A;  5H9L A;  4O49 A;  4RUN A;  4D6A A;  4U8U O;  3KFH A;  1KT7 A;  2HZR A;  1LF7 A;  1PMP A;  3I0A A;  3OE3 A;  4M6S A;  4CSB A;  4QGW A;  4L3R A;  2WSJ A;  5F58 A;  3RSW A;  1ZNL A;  1BSQ A;  3RZY A;  5HBS A;  3NBX X;  1KQW A;  4NLJ A;  3BRN A;  1I06 A;  4KT5 A;  1GT4 A;  1MUP A;  1OPB A;  3ZQ3 A;  2GTF X;  2Z4I A;  5FQ7 E;  1IW2 A;  1ICN A;  4ZFX A;  3PQS A;  1E02 A;  4PJ2 A;  1BEB A;  3O19 A;  5HZ6 A;  4GH7 A;  1XKI A;  3O22 A;  5C0N A;  2LB6 A;  4KC7 A;  1X8P A;  4YFQ A;  4QRL A;  2FS7 A;  5LJC A;  1HN2 A;  2MHD A;  3VE2 A;  4ZHF A;  2FT9 A;  2L5P A;  3BY0 A;  1L6M A;  5D4A A;  3K3L A;  1YWB A;  3T1D A;  1NP1 A;  4QAE A;  4YBU A;  2HYS A;  1IKJ A;  3C77 X;  5LKF A;  1AEL A;  3LV4 A;  3TGB A;  2L68 A;  2W2F A;  4K19 A;  4MVK A;  2WUT A;  3I17 A;  2FR3 A;  2RD7 C;  2WQA E;  3PQU A;  4ZH6 A;  2N93 A;  1CJ5 A;  1Y9L A;  2HZQ A;  2NNE A;  2KTD A;  4YFR A;  2OFR X;  5KIC A;  4XMC A;  4AZQ A;  1SXW A;  3PH6 A;  4TLJ A;  4EEJ A;  5H9K A;  4EDE A;  3UEV A;  1OPA A;  1URE A;  3VU1 A;  2JOZ A;  1H91 A;  3F8A A;  3UEW A;  3BX8 A;  3DTQ A;  4A1Y A;  1GX8 A;  3FMZ A;  3O2Y A;  1IKE A;  3EM0 A;  1KT3 A;  1PM1 X;  3C78 X;  1ZNG A;  4AZN A;  3ZW0 A;  3NPO A;  2JU7 A;  5EZ2 A;  3APU A;  1ZRY A;  1KT5 A;  4O4X A;  1T0V A;  3CQN A;  4JGL A;  3HWD A;  3PED A;  3FW4 A;  4ODD A;  4Y0S A;  4YGZ A;  3WJD A;  4XMD A;  4EQA C;  1D3S A;  1E06 A;  5IO6 A;  3IA8 A;  2O62 A;  3BSZ E;  1OEE A;  4LKP A;  3VG3 A;  4GDZ A;  5FAZ A;  2JU3 A;  1BRP A;  3WJE A;  1JIW I;  1SMP I;  1ZND A;  2F73 A;  3WJF A;  3FA7 A;  2A0A A;  3F9D A;  3ZW1 B;  4A8Z A;  2MO5 A;  4AW8 A;  1FEN A;  2A3F X;  1BM5 A;  4ZJ0 A;  5HZ8 A;  4ZR2 A;  5K06 A;  2PY1 A;  1TOW A;  4ZGU A;  3OBL A;  2RCQ A;  4N7C A;  3LHN A;  3P6C A;  3EYC A;  3KFG A;  1AQB A;  1YUP A;  4O4O A;  1FEM A;  3ZUI A;  4ORS A;  4YCH A;  2BS6 A;  3KFI A;  1RLB E;  5JR8 A;  4DQ4 A;  1TOU A;  3H3I A;  4ES7 A;  1YP7 A;  2P8G A;  1KOI A;  4GRJ A;  1B8E A;  3SAO A;  4ZHC A;  3U9P C;  4R0B A;  1OBU A;  2YMS A;  4ORU A;  3ELX A;  1DZJ A;  1MX7 A;  2WWP A;  4OS0 A;  1IFC A;  5DG4 A;  3S5X A;  5AJB A;  4D6B A;  1U17 A;  3FEP A;  1O1V A;  4GKC A;  2WR6 A;  1SY1 A;  2NP1 A;  3U03 A;  3BDR A;  4FBR A;  4GZV A;  2BLG A;  2E4J A;  3ELZ A;  4Y0R A;  5B29 A;  2K23 A;  3FA9 A;  5HA1 A;  3L4R A;  5H8T A;  4QYP A;  3TF6 A;  1JJX A;  2KTS A;  1VPR A;  1X8Q A;  4QYN A;  1PBO A;  2G79 A;  1G74 A;  1G85 A;  2MWH A;  1QFV A;  4ORR A;  3KQ0 A;  1X8U A;  3FR2 A;  3WVM A;  4AZM A;  3E3C A;  1SXY A;  2AT0 X;  2YG2 A;  2EU7 X;  1IFB A;  4QQ1 A;  1GXA A;  4MVI A;  1PEE A;  1OBP A;  2GTL M;  3NQK A;  4TQ2 A;  2ZAI A;  1AVG I;  1DC9 A;  3GAQ A;  1LNM A;  4MIS A;  4U8U N;  4XMH A;  4CK4 A;  1A57 A;  4YBP A;  1P6P A;  3C76 X;  2RN4 A;  4UU3 A;  5L8N A;  4GNY A;  3D4R A;  3KFF A;  3D95 A;  1FTP A;  4IBA A;  1QFT A;  4RUU A;  4O9S A;  4MVE A;  1N0S A;  1GGL A;  3GE2 A;  1LIF A;  5CYB A;  3HOE A;  3JSQ A;  3NQ3 A;  2X8S A;  4U3Q A;  3QKG A;  4O3Z A;  3WOV A;  3OJY C;  4IAX A;  3CWK A;  4YGG A;  2OVE A;  5BYP A;  3VPJ E;  3STK A;  4NP1 A;  1B56 A;  2G78 A;  3PEC A;  1EI5 A;  5EED A;  3TGC A;  2X8T A;  4A60 A;  4CV7 A;  4I9S A;  4ZHG A;  4YDB A;  1X8N A;  3EBK A;  2X8F A;  1X71 A;  2LBV A;  1OEK A;  2CM4 A;  4IB7 A;  3CQR A;  4WFV A;  4AYH A;  5LJK A;  1SY2 A;  2QO6 A;  2QO5 A;  3FLL A;  5AEO A;  1O8V A;  5HTD A;  4TNN A;  4I95 A;  3F6Z B;  3NQ9 A;  1JYJ A;  1ALB A;  4XMG A;  1GKA B;  1ICM A;  4OS8 A;  3JQO A;  2ANS A;  1S2P A;  3MX7 A;  3FIQ A;  1JJJ A;  2NNQ A;  4HPB A;  2R74 A;  3APV A;  1QY1 A;  4EFG A;  1YWA A;  2BT9 A;  2GTL O;  4UU2 A;  3FEN A;  4BQU A;  1HMS A;  4N7D A;  3ZZV A;  3FR5 A;  2AL0 X;  3P6G A;  1KT6 A;  2CBR A;  2ACP X;  1OEJ A;  4AZR A;  1BLR A;  2WEX A;  4YCE A;  3ZW1 A;  4QGV A;  1QQS A;  3HTY A;  1MDC A;  1ACD A;  5EDC A;  2QO4 A;  5IO5 A;  3Q6L A;  1NP4 A;  1A3Y A;  2JN3 A;  2WQ9 A;  3MVF A;  2AMM X;  4FBV A;  1KT4 A;  5AQ6 A;  4AZO A;  5KHP A;  2AH7 X;  3S5V A;  1DF3 A;  3CMP A;  2Q39 A;  1TW4 A;  3ZWE A;  4YDA A;  1EAL A;  5LJB A;  1FE3 A;  1MX8 A;  4OMW A;  4ORY A;  5FQ6 E;  1CRB A;  5D47 A;  2RA6 A;  5AJC A;  3NAD A;  2KT4 B;  4HWM A;  1ERX A;  5EEE A;  4I3C A;  1AB0 A;  1QAB E;  1U0X A;  2OVA A;  2OVD A;  3P6D A;  1QG5 A;  1CBR A;  1FDQ A;  1R0U A;  2WEW A;  3P6F A;  5D45 A;  5LJG A;  1EUO A;  5HCD C;  3FYF A;  4QZU A;  5B27 A;  3PPT A;  2QOS C;  5F6Z A;  2G7B A;  3WJB A;  4LZU A;  1TXL A;  4I3B A;  2FTB A;  2FS6 A;  4OMX A;  3V8U A;  2RQ0 A;  4ALO A;  3FA6 A;  2OZQ A;  3FEK A;  4KC8 A;  4NYQ A;  4XMF A;  1YIV A;  2JMB A;  3STM X;  2BS5 A;  2JU8 A;  4IB9 A;  3BU9 A;  4O3W A;  2L67 A;  4IAB A;  2K62 A;  3SOT A;  3KZA A;  3NR3 A;  1KZW A;  2FRS A;  5HZ9 A;  2QMI A;  1ZNH A;  3MBT A;  2IFB A;  4IB8 A;  2CZU A;  5BVQ A;  2KW1 A;  2BHV A;  3VG5 A;  5CE4 A;  1ZNK A;  5IO7 A;  1A2D A;  1SY0 A;  1XCA A;  2W2A A;  3APX A;  4ZHH A;  1YWC A;  1I05 A;  4WBK A;  1SXU A;  3CR6 A;  4ON1 A;  4YFP A;  1B4M A;  1GT1 A;  3U0D A;  5HWZ A;  1QWD A;  2HLV A;  2POA A;  2X45 A;  2M4L A;  1I4U A;  3ZW2 A;  4FQB B;  4Y0P A;  3ZUO A;  4QZT A;  2L9C A;  3B2J A;  5HAE A;  1DZP A;  4WFU A;  3RBY A;  1GT5 A;  5HTE A;  4ALB A;  4MVL A;  4INN A;  4NNT A;  1T8V A;  1YWD A;  5DPQ A;  3VG7 A;  5BVS A;  3VG2 A;  5FEN A;  2OVS A;  4I3D A;  4YMY A;  1JBH A;  3B2H A;  4GET A;  4TKH A;  4QNI A;  4WHI A;  3B2K A;  1LIE A;  1EXS A;  1KQX A;  4LKT A;  1ML7 A;  4O3X B;  3HWF A;  3G7X A;  3UAQ A;  4EXZ A;  1KZX A;  3OD9 A;  3FEL A;  2ZAG A;  4HPC A;  4BOE A;  2JW1 A;  2Q2M A;  4Y0Q A;  3NX2 A;  1JV4 A;  5FFH A;  1S44 A;  4YH0 A;  1HMR A;  3HWE A;  3HWG A;  5F1E A;  3RWX A;  3APW A;  4HPA A;  2HNX A;  2FLJ A;  4YGH A;  1E00 A;  2ASN X;  2LKK A;  3VE1 A;  4KCA A;  4NLI A;  1JZU A;  4ARH A;  2LFO A;  1Z24 A;  1FEL A;  1DZK A;  3S26 A;  2R56 A;  4I9R A;  4ZHD A;  4ID2 A;  1LKE A;  1LIB A;  3VG4 A;  4L1N A;  2Z4H A;  4ZCB A;  2CBS A;  3P24 A;  4MIR A;  1SA8 A;  2AT8 X;  1SY3 A;  5H9N A;  2GC9 A;  1EII A;  4PSQ A;  1U18 A;  1CBI A;  4M7M A;  3RKG A;  3WJG A;  1NGL A;  2A2U A;  4FBO A;  5HZ5 A;  3D97 A;  3AKN A;  4BVM A;  2AT5 X;  2AT3 X;  1GT3 A;  3NP1 A;  2MM3 A;  2OFM X;  1GKA A;  5HCC C;  1BRQ A;  1VYG A;  5LJE A;  2FR2 A;  4AZP A;  5D48 A;  1DV9 A;  2LBA A;  3EMM A;  1DFV A;  3WBG A;  5EDB A;  1BSY A;  4OS3 A;  2Q9S A;  3TGA A;  4O4S A;  2HMB A;  1D2U A;  1IIU A;  1LID A;  1EIO A;  2AKQ A;  1TVQ A;  1YP6 A;  3WXQ A;  2GJ5 A;  1ERB A;  4O3Y A;  4DQ3 A;  3IFB A;  3CBS A;  3UEU A;  3FA8 A;  3PP6 A;  2R73 A;  4KH8 A;  1LFO A;  1X8O A;  1A18 A;  1EW3 A;  1MVG A;  3BLG A;  3D96 A;  2GTL N;  5D8J A;  3P6E A;  1CBQ A;  1ADL A;  2ALL X;  4U9C A;  3UEX A;  1G5W A;  4GNW A;  4QGX A;  1Y9T A;  4TKJ A;  2Q2P A;  2Q4N A;  3FW5 A;  1GM6 A;  1X89 A;  2W2B A;  3BU1 A;  1KGL A;  4ZH9 A;  4GE1 A;  1BSO A;  5LJD A;  3STN A;  5LKE A;  4NNS A;  2XKL A;  5KID A;  1EPB A;  2AT6 X;  4YKM A;  1ZNE A;  1SXX A;  4HFO A;  1O1U A;  4IB6 A;  1BBP A;  2X46 A;  1QY0 A;  1VYF A;  3P6H A;  4ZGF A;  1KXO A;  1E5P A;  2LA7 A;  4A1H A;  4IMO A;  4O4U A;  4U8U M;  1DZM A;  3BS2 A;  3ZW0 B;  1HBQ A;  2CM9 A;  4ORX A;  4XME A;  1BJ7 A;  1RBP A;  1CBS A;  5HA0 A;  1HQP A;  3NX1 A;  4KII A;  2DM5 A;  4LZV A;  3B2I A;  3CBC A;  4IAW A;  3DSZ A;  4NW4 A;  1I04 A;  4LQZ A;  3FR4 A;  1S7D A;  1GX9 A;  4GU8 A;  2A2G A;  3S60 A;  5L8I A;  2NND A;  5H9A A;  1G7N A;  3VG6 A;  3P02 A;  3HOL A;  5HCE C;  1BWY A;  2QM9 A;  3AKM A;  3PH5 A;  3HK1 A;  1EQD A;  3JS1 A;  5F7G A;  1LIC A;  4FGI B;  1OBQ A;  2FWV A;  4NYR A;  1LPJ A;  5EPQ A;  4TKB A;  3ZI8 A;  1T68 X;  3WJC A;  1HBP A;  3TZS A;  2XST A;  5L8O A;  2F09 A;  3N91 A;  4HPD A;  4ORW A;  1EPA A;  5HZQ A;  4I6S A;  2CZT A;  4COT A;  1JYD A;  2MJI A;  4YKO A;  2A13 A;  4TJZ A;  3BX7 A;  4GK9 A;  5LJH A;  2ACO A;  4IMN A;  2RCT A;  4ML7 B;  3B2L A;  5F6B A;  1QY2 A;  5BVT A;  1B0O A;  3EBW A;  1UZ2 X;  5FQ8 E;  2KD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...