4K1OA

Crystal structure of the alphan-catenin actin-binding domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
200
structure length
200
Chain Sequence
LIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Catenin alpha-2
publication title An autoinhibited structure of alpha-catenin and its implications for vinculin recruitment to adherens junctions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 80
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2013-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4k1oA00
1ZW3A 1DOWA 1T01A 2IBFA 5L0GA 3MYIA 2X0CA 1DOVA 1TR2A 5L0HA 2L7AA 3H2UA 4K1OA 3VF0A 3TJ6A 2HSQA 2GDCA 1QKRA 3T6GB 5L0DA 1U6HA 2LQGA 4IGGA 1H6GA 4ONSA 4PR9A 3RF3A 3ZDLA 4E18A 5L0JA 5FZTA 5L0IA 1ZVZA 3S90A 1YDIA 1ZW2A 2GWWA 1XWJA 3H2VA 2B0HA 1RKEA 4W8PA 4DJ9A 1U89A 1ST6A 1RKCA 1SYQA 4P9TA 4E17A 5L0CA 4EHPA 1RKEB 5L0FA 3TJ5A 1L7CA
chains in the Genus database with same CATH superfamily
2OOCA 4JZAA 2Y3DA 3FDQA 3ASOC 4C7OB 2MWQA 1MMNA 3DM5A 4J30B 3AQCA 4GYTA 3QZCA 1Z63A 1CPQA 4YJWA 2HMZA 4G0HA 2P61A 3A9CA 1W2WA 2PFDA 3VRCA 3QW1A 1YARO 5E3AA 4KNVA 1N1CA 3L34A 4KC9A 4X0RA 2P6VA 2W4MA 2PP4A 3V5YA 4CS9A 3EG9A 1OKKA 3G4XA 2KGOA 3RVYA 5DLJA 5F5FA 2L6HA 1TKNA 2CYDA 4XEFA 1Q0GA 1ZHXA 4ULVA 2XXAA 3EG9B 3B29A 3NMIA 2VCBA 2RSEB 1E83A 5A6BD 2EIKC 2OU6A 3HNKA 4WGZA 1ZHTA 2G62A 3ZTZA 3NKEA 5JUAA 4XPXA 4JTAB 2PX3A 4I1MA 4JW1A 4JVSA 4CS7A 4A4AA 2XRHA 4AX2A 2QE9A 4NTFA 4YT5A 2ZD9A 4JJFA 3SP1A 1SF8A 5JSLA 4NY3A 4MW8A 3SXKA 2OG2A 4QI0A 2EPNA 4PACA 4E7ZA 4YL0A 2QTVA 1ZU4A 1UG7A 2M4EA 4QI2A 4ULWA 1OW7A 1T9KA 1E2XA 1NSGB 1KNYA 1QKRA 3M4BA 2QY9A 3NKDA 4IWBA 3U9JA 2LFFA 1ZVZA 1V74B 1TWAA 1ZW2A 2GWWA 1FMVA 2VCCA 5B1AC 5EHHA 1SZIA 4N06A 4OIRF 4CBEA 1RKEA 1HE1A 2R7QA 4BJ5A 4BJ1A 2IXMA 2WVNA 2XLVA 1YZCA 2YLIA 1RKEB 3ZQYA 3TJ5A 3UGPA 1M57C 4LACB 2D4UA 2AP3A 4JCHA 2I15A 3ABMC 3O39A 5JVEA 1MQVA 1WATA 4M63A 3JSEO 3SXMA 4BEMJ 1L3PA 1MMDA 2A0BA 3R2PA 4XEVA 3EZHA 4EWCA 4IB4A 1IZMA 1J8MF 2ZXOA 4C3DA 5KYUB 1YLMA 4ANJA 1CGME 2R9RB 3EQLF 3U0CA 3FMSA 2V26A 3S29A 1ZYRF 3NYLA 1T6IA 1OCZC 1XZQA 1FAPB 1H6GA 2LSEA 2WZLA 2ZXPA 3LLIA 4AK9A 1V55C 4NC3A 4O6YA 2JX0A 4N6HA 1VB5A 1FNTc 2B0HA 4BPMA 2KK1A 1LE4A 3HNJA 2OQMA 3QVZA 3ECSA 4W8PA 1HE9A 3LS1A 3OA1A 5E2QA 4MVMA 3GEEA 2L6FA 1TFKB 1NLXA 4BJ6A 3DWWA 3EGDB 3DD7A 3SZRA 1QPUA 2EINC 3VAYA 3EHNA 2C04A 2CDQA 5CI8A 2W4BA 3BEHA 3ZWIA 1EQ1A 4E0HA 2W45A 2VASA 3UNGC 4OIPF 3B0VC 2CW0F 1OKKD 3MYIA 3CSKA 4JKVA 4BG0A 1ZU5A 3O10A 5A6AA 2ETSA 3KKBA 5JRAA 2G3KA 3WHNA 3G50A 4O7GA 1ZZPA 3TQOA 5B3SC 4IAQA 2R7UA 3DZAA 2KQ9A 1OR3A 4DRHB 3K66A 2LP4A 3EJNA 4CIHA 3E9VA 4O6NA 3N0TA 3ZDLA 1NU7D 4PR9A 4UDVA 1VYKA 1T5OA 3DI5A 3TOLA 4EUKB 3NRHA 3DMDA 3LJBA 1NU9C 2HZ8A 1Q0KA 1H7IA 3JSZA 4I1OB 1U89A 4K0DA 1NFNA 3W2WA 2IM8A 3WODF 2DI3A 3IQCA 4P9TA 3FOOA 1PV3A 4U5BE 5L3VA 2AU5A 5CIVA 2GA0A 3K6BA 1TWHA 3R7CA 5KYWA 2YEVA 4I3MA 1NG1A 4DRIB 2DGJA 2ZXRA 3RF3A 4AL1A 3NYMA 5GPGB 5KYWB 1Z5ZA 2EILC 2R7OA 4DRJB 3AG4C 3LEOA 4IARA 3M1CB 3DM9B 4U9EA 1GS9A 2YZSA 3C62A 3M79A 1KTMA 1D1AA 2WVQA 1O3UA 2LQGA 3UMIA 3EH1A 1Y6DA 1XZPA 3VYWA 4G7HF 5E3CA 3S90A 4WABA 4G7ZF 3V5ZA 2Y3BA 1HY5A 3GWLA 4NTBA 4RD9A 4Q5SF 3E70C 1AUEA 2XLMA 2UUHA 4GEHA 1Z23A 1JPJA 1M56C 1WOLA 2YL7A 5BQGA 3C63A 3LNMB 1JRAA 1JR8A 2L81A 1UFBA 4U5GA 1RJ9B 1U0BB 1Q0DA 2KW3C 1HMDA 3MX3A 3ATPA 4MVQA 3T6BA 1LKXA 3JTLO 3PMRA 5A6KA 4XTKA 1A7EA 3PCVA 3S0XA 5A69A 1WTYA 2HUJA 5L0HA 2EPMX 2L7AA 2NSGA 1H9GA 4K1OA 1VYIA 4N4WA 2GDCA 3RKOF 3V7OA 1O87A 1R4TA 3RH3A 1VOMA 4P6IC 4C7OA 1LE2A 1K05A 3H2VA 3C7JA 4OD5A 4LLCA 1T6UA 2HV6A 2J8WA 2XLHA 3FVYA 2VC9A 2HMQA 1YZAA 2W9YA 3HJCA 1ZHYA 4FESA 3RIPA 5A6JA 2WB7A 4E7SA 2YHSA 5HV9A 4JE9A 4N6CA 2Y39A 5L0FA 2TMVP 2HS5A 3SXZA 2XXAB 5BUOA 5FCLA 3GM1A 3K7DA 2EPLX 3HLZA 3LESA 4Z9HA 4U5EE 1EI7A 1V4AA 1A0BA 4A2NB 3IHUA 4C3BA 1K04A 1F1MA 1WASA 1TWCA 3IQ5A 3N2ZB 2H7VC 4YL1A 2X51A 1TWGA 5DVWA 2R7SA 1VK5A 5L0DA 3FAPB 3KYIA 1D0XA 1H9TA 2IOQA 2P1AA 3DE8A 1VLTA 5FZTA 2AVKA 1CGOA 3RW0A 3T4RA 2PF4E 1S7ZA 4U5DE 2HV7A 3GANA 3C8GD 5DS4A 4DJ9A 2FAPB 3DJUB 3U3FA 4DBRA 3Q7GA 4PFOA 3PHF2 1Y4CA 2CGEA 3I5QA 4LERA 4O6MA 4PJJA 3EPVA 3IPMO 1A7VA 3DAFA 2OKUA 4B6IA 3S28A 1JMWA 2XL6A 1LS4A 4YT2A 2E87A 3TK0A 1LI5A 3G4ZA 1LVKA 3K1IC 5DQZA 1V54C 4CJGA 3UGOA 3AGTA 1CGNA 2KSFA 1PD0A 1U6HA 1TFOB 2B0JA 3KPHA 3KYJA 5D91A 3S9OA 4NQFA 4J7YA 4KI2A 2OJED 4YT4A 3HTKC 2DYSC 2IXNA 4CIPA 4CSAC 1OCOC 4CS8A 3UR3C 3AJMA 2EPOA 4ER9A 1OXKA 4MTGA 4H54A 2KYHA 5JP7A 3U8VA 3NDBB 1D0ZA 4XLNF 4ZLCA 4G7OF 2GFHA 1KU2A 1FFTC 5T1DB 1OW8A 1YYXA 4JEBA 4NTAA 2YLDA 2H7OA 4CDYA 4CS9C 2J9BA 2J45A 1LPEA 2XLWA 4KBLA 1G8XA 3QVYA 3DKAA 4XWJA 3NG1A 2A1DD 1M6TA 4LLEA 5AC4A 1QLEC 1VLSA 2LD6A 4OD4A 1CPRA 2BL2A 4PFPA 2KC3A 4EBKA 4RDAA 3AG3C 4XLPF 1MMGA 1OQCA 3AQBA 3H2UA 4LDKA 1C17M 2IXPA 3NMJA 4IGGA 4PJLA 2DB4A 2NUPA 3B0PA 4JCZA 3FXHA 2YVKA 1HMOA 1LM3B 2EPKX 1M2VA 3U8PA 5K0IA 2NUPB 1BR4A 4GQHA 4YT8A 1LIHA 2XS8A 5D92A 2XL4A 4L6RA 4E17A 2VCAA 5L0CA 1M2VB 3GODA 4C3EA 3IEEA 4XQ1A 2Z15A 4XPYA 1L7CA 3JYYA 3HKKA 3LEVA 2OEVA 4MVOA 4Q7CA 2KJGA 3B0UX 1SR2A 4D4NA 3W2VA 2J7PA 4KNWA 4PJMA 1HW2A 3U3BA 3S27A 2YRFA 3WG7C 3EHMA 4BJ5C 1LS1A 2EIMC 4EIYA 2A6EF 3QMKA 3I5PA 3ZTMA 3CAXA 1TR2A 3QW0A 3DAGA 4U5HA 4JEAA 1O5HA 3C8GA 3RYLA 2D5RB 1FMWA 3L8JA 5AGFA 3UMHA 2OCCC 3K1HA 4EKWA 1ORYA 1Q0FA 1IW7F 1WN0A 3C8GB 3OWTA 4K7BA 2XM0A 1ORSC 1FR0A 3L0IA 1GM5A 4IJJA 2F22A 2R05A 2YQYA 3GEHA 1I4YA 5BQHA 3LS0A 1OXBA 4WJ0A 2FGYA 3OEOA 4EBJA 3JYHA 2J0XA 3NYJA 4P9FA 3US6A 3PDMP 4MNDA 2M64A 2PNOA 5F28E 1E86A 4FX5A 2RD9A 3U2LA 1K40A 4RBNA 2OJQA 2ZPAA 1DOVA 2A0UA 4XPWA 3A11A 3SXYA 2L6GA 4BJ6C 3TULA 2LK4A 4OINF 4MW3A 4CX9A 3GM3A 3IQTA 4CDAA 3EFOA 1A7DA 4NCQA 2XSEA 2IXOA 1YAUO 1MNDA 2A6HF 4E18A 3EH2A 3EFOB 5JS5A 2YL3A 4CDVA 1FFHA 1RMVA 3UMKA 4JC7A 3FOPA 5KYYA 2YL0A 1BDJB 1D0YA 3CZ6A 5L3QA 2HJMA 1RXQA 3Q6NA 5KYYB 3FHDA 1E85A 1VMAA 2HSBA 3HNIA 4DVYP 1QZXA 3F47A 1YA9A 2XM4A 1OCRC 1PCXA 3H65A 1R5ID 3C18A 1ORJA 3LAYA 2J9WA 3LLKA 2XLEA 4YWQA 1LI7A 2MYSA 3QTHA 2Q7RA 1Z3IX 3X2QC 5E33A 3GEIA 3S84A 4FWVA 3EGXA 3JCUQ 4DBQA 4Q4ZF 1BZ4A 3ABLC 3CEXA 3DXJF 4WGYA 1NZEA 5DS6A 5AC5A 3EGXB 1JAFA 2YKZA 4ONSA 1YYJA 2J7PD 2JD3A 2LCHA 1XWJA 256BA 1D1CA 2Y69C 3B9QA 4BEJA 1GGQA 1AEPA 1S05A 4YL3A 2CCYA 2GAQA 4JJGA 4AE4A 1C02A 2DYRC 1SYQA 2A69F 2HJ3A 4EHPA 2Q3TA 4IAOA 1A41A 2Y3HA 3SYNA 4AL0A 2R7RA 2VB6A 3L1MA 4AE4B 2XS1A 4ZLDA 1T6QA 2G3VA 2Y3GA 3AOUA 5EK0A 1JOGA 5JT4A 3RQGA 5L0GA 3V5XA 1TQGA 1OCCC 3L8IA 5COMA 3WAQA 1NFOA 4JURI 2NUTA 3X1OA 3LUTB 2I8BA 4DOZA 2XLDA 2R03A 4R32A 3ZSUA 5JLIA 5HSWA 1YA7O 3U5SA 2UUIA 2HSQA 2NUTB 3ZG1A 3HNLA 2ASRA 2HFIA 3M4CA 1M2OA 1MNEA 3BRJA 2NG1A 2LIGA 4YN0B 5B1BC 2WVOA 1BR2A 1YDIA 3JRTA 3W8IA 2J0WA 3TOMA 3AGUA 2Q00A 5COGA 3EZIA 3VM6A 3M15A 2FFHA 2WZGA 1ST6A 2O9XA 1RKCA 2Q9BA 2Q9CA 4U5CE 3MFNA 4OIOF 4MQ9F 3NMKA 3ABKC 2R25A 5KYUA 4F4BA 2R7VA 4J7TA 2CNWD 4MVZA 5EGYA 5B3IA 2BE5F 3JRMO 4MS2A 4W8KA 5KYXA 2XL8A 2OEXA 1YJGA 2J9VA 4LDQA 3RQEA 3T9OA 5IY5C 1OW6A 1VTMP 1B68A 4D4XA 1Q0MA 5KYXB 3VF0A 4G78A 1OR2A 3T6GB 3U2MA 5COFA 4E0IA 1ZHZA 5T3TA 5L0JA 2AWCA 2VH3A 3KH2A 4OIQF 1I4ZA 1QVXA 1G4US 3B71A 3EGDA 4O79A 1FTSA 4EBBA 3POVA 2LFDA 3FAJA 2BC5A 2IYLD 4HEAJ 3W4YA 2P7VA 1Z6AA 4JTDB 1PD1A 3KMIA 4H4KC 4CJOA 1E84A 5BQIA 1ZW3A 5T3WA 1QSPA 1EA8A 5CI9A 4U9DA 3O55A 3RQFA 1G4WR 1T01A 1QQ3A 1WGWA 2IBFA 2QNLA 3Q7LA 2R7TA 1D1BA 4HFFB 1C03A 4XEKA 2X0CA 3JT1A 3N24A 3ZQVA 4JRZA 3ZC4A 3TD7A 2R7XA 2H7BA 4JTCB 4BJTA 3O6XA 4CSAA 1GQAA 1J8YF 2H8AA 2QUPA 3DE9A 3DJNB 4HE8D 3TJ6A 5A6BA 2YL1A 1APCA 2ZXWC 4MVRA 4DVZA 4Z9IA 3ZIBA 3T6JA 4LDRA 3ITFA 4Z9JA 2V3CC 1NBBA 2C03A 2J9UA 2J46A 1G5ZA 2PX0A 2WZFA 3AG2C 3LNRA 4U5FE 4FAPB 5KYNA 3Q6MA 4HFKB 1MMAA 1HW1A 2R7WA 4I44A 1BR1A 2ICWG 2KNHA 3U9MA 4MTFA 2NPUA 5DS5A 2JPUA 3RFYA 2P0NA 1DOWA 4IRUA 4PK4A 4CS8C 1YVIA 1AVOB 1BBHA 3K33A 3MBGA 3IQ6A 4JIOA 3GWNA 2YLGA 2A68F 4MTOA 2WL8A 2NSFA 3SNHA 3GM2A 4PJNA 5F5HA 1WWPA 3ZVRA 1JPNA 1RCPA 4J32B 4MVUA 2XLOA 4QDLA 3SEOA 4MVSA 2YWAA 5L0IA 4YK5A 2Q4FA 3ASNC 2QLAA 1SMYF 3RVZA 2MHRA 3W8HA 1EKYA 3C8ZA 3JZ0A 3MLGA 3MYFA 2CNWA 2HKVA 3I4UA 1I5NA 1Z7Qc 2EIJC 5TJ5E 2L9JA 1RJ9A 2R02A 2Q9AA 5DQTA 2PBEA 2AWYA 3AG1C 3GORA 3KL4A 4DXWA 3J06A 3K1IA 3CQZA 1ZHWA 3F46A
chains in the Genus database with same CATH topology
1ZW3A 1DOWA 1T01A 2IBFA 5L0GA 3MYIA 2X0CA 1DOVA 1TR2A 5L0HA 2L7AA 3H2UA 4K1OA 3VF0A 3TJ6A 2HSQA 2GDCA 1QKRA 3T6GB 5L0DA 1U6HA 2LQGA 4IGGA 1H6GA 4ONSA 4PR9A 3RF3A 3ZDLA 4E18A 5L0JA 5FZTA 5L0IA 1ZVZA 3S90A 1YDIA 1ZW2A 2GWWA 1XWJA 3H2VA 2B0HA 1RKEA 4W8PA 4DJ9A 1U89A 1ST6A 1RKCA 1SYQA 4P9TA 4E17A 5L0CA 4EHPA 1RKEB 5L0FA 3TJ5A 1L7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZW3 A;  1DOW A;  1T01 A;  2IBF A;  5L0G A;  3MYI A;  2X0C A;  1DOV A;  1TR2 A;  5L0H A;  2L7A A;  3H2U A;  4K1O A;  3VF0 A;  3TJ6 A;  2HSQ A;  2GDC A;  1QKR A;  3T6G B;  5L0D A;  1U6H A;  2LQG A;  4IGG A;  1H6G A;  4ONS A;  4PR9 A;  3RF3 A;  3ZDL A;  4E18 A;  5L0J A;  5FZT A;  5L0I A;  1ZVZ A;  3S90 A;  1YDI A;  1ZW2 A;  2GWW A;  1XWJ A;  3H2V A;  2B0H A;  1RKE A;  4W8P A;  4DJ9 A;  1U89 A;  1ST6 A;  1RKC A;  1SYQ A;  4P9T A;  4E17 A;  5L0C A;  4EHP A;  1RKE B;  5L0F A;  3TJ5 A;  1L7C A; 
#chains in the Genus database with same CATH topology
 2OOC A;  4JZA A;  2Y3D A;  3FDQ A;  3ASO C;  4C7O B;  2MWQ A;  1MMN A;  3DM5 A;  4J30 B;  3AQC A;  4GYT A;  3QZC A;  1Z63 A;  1CPQ A;  4YJW A;  2HMZ A;  4G0H A;  2P61 A;  3A9C A;  1W2W A;  2PFD A;  3VRC A;  3QW1 A;  1YAR O;  5E3A A;  4KNV A;  1N1C A;  3L34 A;  4KC9 A;  4X0R A;  2P6V A;  2W4M A;  2PP4 A;  3V5Y A;  4CS9 A;  3EG9 A;  1OKK A;  3G4X A;  2KGO A;  3RVY A;  5DLJ A;  5F5F A;  2L6H A;  1TKN A;  2CYD A;  4XEF A;  1Q0G A;  1ZHX A;  4ULV A;  2XXA A;  3EG9 B;  3B29 A;  3NMI A;  2VCB A;  2RSE B;  1E83 A;  5A6B D;  2EIK C;  2OU6 A;  3HNK A;  4WGZ A;  1ZHT A;  2G62 A;  3ZTZ A;  3NKE A;  5JUA A;  4XPX A;  4JTA B;  2PX3 A;  4I1M A;  4JW1 A;  4JVS A;  4CS7 A;  4A4A A;  2XRH A;  4AX2 A;  2QE9 A;  4NTF A;  4YT5 A;  2ZD9 A;  4JJF A;  3SP1 A;  1SF8 A;  5JSL A;  4NY3 A;  4MW8 A;  3SXK A;  2OG2 A;  4QI0 A;  2EPN A;  4PAC A;  4E7Z A;  4YL0 A;  2QTV A;  1ZU4 A;  1UG7 A;  2M4E A;  4QI2 A;  4ULW A;  1OW7 A;  1T9K A;  1E2X A;  1NSG B;  1KNY A;  1QKR A;  3M4B A;  2QY9 A;  3NKD A;  4IWB A;  3U9J A;  2LFF A;  1ZVZ A;  1V74 B;  1TWA A;  1ZW2 A;  2GWW A;  1FMV A;  2VCC A;  5B1A C;  5EHH A;  1SZI A;  4N06 A;  4OIR F;  4CBE A;  1RKE A;  1HE1 A;  2R7Q A;  4BJ5 A;  4BJ1 A;  2IXM A;  2WVN A;  2XLV A;  1YZC A;  2YLI A;  1RKE B;  3ZQY A;  3TJ5 A;  3UGP A;  1M57 C;  4LAC B;  2D4U A;  2AP3 A;  4JCH A;  2I15 A;  3ABM C;  3O39 A;  5JVE A;  1MQV A;  1WAT A;  4M63 A;  3JSE O;  3SXM A;  4BEM J;  1L3P A;  1MMD A;  2A0B A;  3R2P A;  4XEV A;  3EZH A;  4EWC A;  4IB4 A;  1IZM A;  1J8M F;  2ZXO A;  4C3D A;  5KYU B;  1YLM A;  4ANJ A;  1CGM E;  2R9R B;  3EQL F;  3U0C A;  3FMS A;  2V26 A;  3S29 A;  1ZYR F;  3NYL A;  1T6I A;  1OCZ C;  1XZQ A;  1FAP B;  1H6G A;  2LSE A;  2WZL A;  2ZXP A;  3LLI A;  4AK9 A;  1V55 C;  4NC3 A;  4O6Y A;  2JX0 A;  4N6H A;  1VB5 A;  1FNT c;  2B0H A;  4BPM A;  2KK1 A;  1LE4 A;  3HNJ A;  2OQM A;  3QVZ A;  3ECS A;  4W8P A;  1HE9 A;  3LS1 A;  3OA1 A;  5E2Q A;  4MVM A;  3GEE A;  2L6F A;  1TFK B;  1NLX A;  4BJ6 A;  3DWW A;  3EGD B;  3DD7 A;  3SZR A;  1QPU A;  2EIN C;  3VAY A;  3EHN A;  2C04 A;  2CDQ A;  5CI8 A;  2W4B A;  3BEH A;  3ZWI A;  1EQ1 A;  4E0H A;  2W45 A;  2VAS A;  3UNG C;  4OIP F;  3B0V C;  2CW0 F;  1OKK D;  3MYI A;  3CSK A;  4JKV A;  4BG0 A;  1ZU5 A;  3O10 A;  5A6A A;  2ETS A;  3KKB A;  5JRA A;  2G3K A;  3WHN A;  3G50 A;  4O7G A;  1ZZP A;  3TQO A;  5B3S C;  4IAQ A;  2R7U A;  3DZA A;  2KQ9 A;  1OR3 A;  4DRH B;  3K66 A;  2LP4 A;  3EJN A;  4CIH A;  3E9V A;  4O6N A;  3N0T A;  3ZDL A;  1NU7 D;  4PR9 A;  4UDV A;  1VYK A;  1T5O A;  3DI5 A;  3TOL A;  4EUK B;  3NRH A;  3DMD A;  3LJB A;  1NU9 C;  2HZ8 A;  1Q0K A;  1H7I A;  3JSZ A;  4I1O B;  1U89 A;  4K0D A;  1NFN A;  3W2W A;  2IM8 A;  3WOD F;  2DI3 A;  3IQC A;  4P9T A;  3FOO A;  1PV3 A;  4U5B E;  5L3V A;  2AU5 A;  5CIV A;  2GA0 A;  3K6B A;  1TWH A;  3R7C A;  5KYW A;  2YEV A;  4I3M A;  1NG1 A;  4DRI B;  2DGJ A;  2ZXR A;  3RF3 A;  4AL1 A;  3NYM A;  5GPG B;  5KYW B;  1Z5Z A;  2EIL C;  2R7O A;  4DRJ B;  3AG4 C;  3LEO A;  4IAR A;  3M1C B;  3DM9 B;  4U9E A;  1GS9 A;  2YZS A;  3C62 A;  3M79 A;  1KTM A;  1D1A A;  2WVQ A;  1O3U A;  2LQG A;  3UMI A;  3EH1 A;  1Y6D A;  1XZP A;  3VYW A;  4G7H F;  5E3C A;  3S90 A;  4WAB A;  4G7Z F;  3V5Z A;  2Y3B A;  1HY5 A;  3GWL A;  4NTB A;  4RD9 A;  4Q5S F;  3E70 C;  1AUE A;  2XLM A;  2UUH A;  4GEH A;  1Z23 A;  1JPJ A;  1M56 C;  1WOL A;  2YL7 A;  5BQG A;  3C63 A;  3LNM B;  1JRA A;  1JR8 A;  2L81 A;  1UFB A;  4U5G A;  1RJ9 B;  1U0B B;  1Q0D A;  2KW3 C;  1HMD A;  3MX3 A;  3ATP A;  4MVQ A;  3T6B A;  1LKX A;  3JTL O;  3PMR A;  5A6K A;  4XTK A;  1A7E A;  3PCV A;  3S0X A;  5A69 A;  1WTY A;  2HUJ A;  5L0H A;  2EPM X;  2L7A A;  2NSG A;  1H9G A;  4K1O A;  1VYI A;  4N4W A;  2GDC A;  3RKO F;  3V7O A;  1O87 A;  1R4T A;  3RH3 A;  1VOM A;  4P6I C;  4C7O A;  1LE2 A;  1K05 A;  3H2V A;  3C7J A;  4OD5 A;  4LLC A;  1T6U A;  2HV6 A;  2J8W A;  2XLH A;  3FVY A;  2VC9 A;  2HMQ A;  1YZA A;  2W9Y A;  3HJC A;  1ZHY A;  4FES A;  3RIP A;  5A6J A;  2WB7 A;  4E7S A;  2YHS A;  5HV9 A;  4JE9 A;  4N6C A;  2Y39 A;  5L0F A;  2TMV P;  2HS5 A;  3SXZ A;  2XXA B;  5BUO A;  5FCL A;  3GM1 A;  3K7D A;  2EPL X;  3HLZ A;  3LES A;  4Z9H A;  4U5E E;  1EI7 A;  1V4A A;  1A0B A;  4A2N B;  3IHU A;  4C3B A;  1K04 A;  1F1M A;  1WAS A;  1TWC A;  3IQ5 A;  3N2Z B;  2H7V C;  4YL1 A;  2X51 A;  1TWG A;  5DVW A;  2R7S A;  1VK5 A;  5L0D A;  3FAP B;  3KYI A;  1D0X A;  1H9T A;  2IOQ A;  2P1A A;  3DE8 A;  1VLT A;  5FZT A;  2AVK A;  1CGO A;  3RW0 A;  3T4R A;  2PF4 E;  1S7Z A;  4U5D E;  2HV7 A;  3GAN A;  3C8G D;  5DS4 A;  4DJ9 A;  2FAP B;  3DJU B;  3U3F A;  4DBR A;  3Q7G A;  4PFO A;  3PHF 2;  1Y4C A;  2CGE A;  3I5Q A;  4LER A;  4O6M A;  4PJJ A;  3EPV A;  3IPM O;  1A7V A;  3DAF A;  2OKU A;  4B6I A;  3S28 A;  1JMW A;  2XL6 A;  1LS4 A;  4YT2 A;  2E87 A;  3TK0 A;  1LI5 A;  3G4Z A;  1LVK A;  3K1I C;  5DQZ A;  1V54 C;  4CJG A;  3UGO A;  3AGT A;  1CGN A;  2KSF A;  1PD0 A;  1U6H A;  1TFO B;  2B0J A;  3KPH A;  3KYJ A;  5D91 A;  3S9O A;  4NQF A;  4J7Y A;  4KI2 A;  2OJE D;  4YT4 A;  3HTK C;  2DYS C;  2IXN A;  4CIP A;  4CSA C;  1OCO C;  4CS8 A;  3UR3 C;  3AJM A;  2EPO A;  4ER9 A;  1OXK A;  4MTG A;  4H54 A;  2KYH A;  5JP7 A;  3U8V A;  3NDB B;  1D0Z A;  4XLN F;  4ZLC A;  4G7O F;  2GFH A;  1KU2 A;  1FFT C;  5T1D B;  1OW8 A;  1YYX A;  4JEB A;  4NTA A;  2YLD A;  2H7O A;  4CDY A;  4CS9 C;  2J9B A;  2J45 A;  1LPE A;  2XLW A;  4KBL A;  1G8X A;  3QVY A;  3DKA A;  4XWJ A;  3NG1 A;  2A1D D;  1M6T A;  4LLE A;  5AC4 A;  1QLE C;  1VLS A;  2LD6 A;  4OD4 A;  1CPR A;  2BL2 A;  4PFP A;  2KC3 A;  4EBK A;  4RDA A;  3AG3 C;  4XLP F;  1MMG A;  1OQC A;  3AQB A;  3H2U A;  4LDK A;  1C17 M;  2IXP A;  3NMJ A;  4IGG A;  4PJL A;  2DB4 A;  2NUP A;  3B0P A;  4JCZ A;  3FXH A;  2YVK A;  1HMO A;  1LM3 B;  2EPK X;  1M2V A;  3U8P A;  5K0I A;  2NUP B;  1BR4 A;  4GQH A;  4YT8 A;  1LIH A;  2XS8 A;  5D92 A;  2XL4 A;  4L6R A;  4E17 A;  2VCA A;  5L0C A;  1M2V B;  3GOD A;  4C3E A;  3IEE A;  4XQ1 A;  2Z15 A;  4XPY A;  1L7C A;  3JYY A;  3HKK A;  3LEV A;  2OEV A;  4MVO A;  4Q7C A;  2KJG A;  3B0U X;  1SR2 A;  4D4N A;  3W2V A;  2J7P A;  4KNW A;  4PJM A;  1HW2 A;  3U3B A;  3S27 A;  2YRF A;  3WG7 C;  3EHM A;  4BJ5 C;  1LS1 A;  2EIM C;  4EIY A;  2A6E F;  3QMK A;  3I5P A;  3ZTM A;  3CAX A;  1TR2 A;  3QW0 A;  3DAG A;  4U5H A;  4JEA A;  1O5H A;  3C8G A;  3RYL A;  2D5R B;  1FMW A;  3L8J A;  5AGF A;  3UMH A;  2OCC C;  3K1H A;  4EKW A;  1ORY A;  1Q0F A;  1IW7 F;  1WN0 A;  3C8G B;  3OWT A;  4K7B A;  2XM0 A;  1ORS C;  1FR0 A;  3L0I A;  1GM5 A;  4IJJ A;  2F22 A;  2R05 A;  2YQY A;  3GEH A;  1I4Y A;  5BQH A;  3LS0 A;  1OXB A;  4WJ0 A;  2FGY A;  3OEO A;  4EBJ A;  3JYH A;  2J0X A;  3NYJ A;  4P9F A;  3US6 A;  3PDM P;  4MND A;  2M64 A;  2PNO A;  5F28 E;  1E86 A;  4FX5 A;  2RD9 A;  3U2L A;  1K40 A;  4RBN A;  2OJQ A;  2ZPA A;  1DOV A;  2A0U A;  4XPW A;  3A11 A;  3SXY A;  2L6G A;  4BJ6 C;  3TUL A;  2LK4 A;  4OIN F;  4MW3 A;  4CX9 A;  3GM3 A;  3IQT A;  4CDA A;  3EFO A;  1A7D A;  4NCQ A;  2XSE A;  2IXO A;  1YAU O;  1MND A;  2A6H F;  4E18 A;  3EH2 A;  3EFO B;  5JS5 A;  2YL3 A;  4CDV A;  1FFH A;  1RMV A;  3UMK A;  4JC7 A;  3FOP A;  5KYY A;  2YL0 A;  1BDJ B;  1D0Y A;  3CZ6 A;  5L3Q A;  2HJM A;  1RXQ A;  3Q6N A;  5KYY B;  3FHD A;  1E85 A;  1VMA A;  2HSB A;  3HNI A;  4DVY P;  1QZX A;  3F47 A;  1YA9 A;  2XM4 A;  1OCR C;  1PCX A;  3H65 A;  1R5I D;  3C18 A;  1ORJ A;  3LAY A;  2J9W A;  3LLK A;  2XLE A;  4YWQ A;  1LI7 A;  2MYS A;  3QTH A;  2Q7R A;  1Z3I X;  3X2Q C;  5E33 A;  3GEI A;  3S84 A;  4FWV A;  3EGX A;  3JCU Q;  4DBQ A;  4Q4Z F;  1BZ4 A;  3ABL C;  3CEX A;  3DXJ F;  4WGY A;  1NZE A;  5DS6 A;  5AC5 A;  3EGX B;  1JAF A;  2YKZ A;  4ONS A;  1YYJ A;  2J7P D;  2JD3 A;  2LCH A;  1XWJ A;  256B A;  1D1C A;  2Y69 C;  3B9Q A;  4BEJ A;  1GGQ A;  1AEP A;  1S05 A;  4YL3 A;  2CCY A;  2GAQ A;  4JJG A;  4AE4 A;  1C02 A;  2DYR C;  1SYQ A;  2A69 F;  2HJ3 A;  4EHP A;  2Q3T A;  4IAO A;  1A41 A;  2Y3H A;  3SYN A;  4AL0 A;  2R7R A;  2VB6 A;  3L1M A;  4AE4 B;  2XS1 A;  4ZLD A;  1T6Q A;  2G3V A;  2Y3G A;  3AOU A;  5EK0 A;  1JOG A;  5JT4 A;  3RQG A;  5L0G A;  3V5X A;  1TQG A;  1OCC C;  3L8I A;  5COM A;  3WAQ A;  1NFO A;  4JUR I;  2NUT A;  3X1O A;  3LUT B;  2I8B A;  4DOZ A;  2XLD A;  2R03 A;  4R32 A;  3ZSU A;  5JLI A;  5HSW A;  1YA7 O;  3U5S A;  2UUI A;  2HSQ A;  2NUT B;  3ZG1 A;  3HNL A;  2ASR A;  2HFI A;  3M4C A;  1M2O A;  1MNE A;  3BRJ A;  2NG1 A;  2LIG A;  4YN0 B;  5B1B C;  2WVO A;  1BR2 A;  1YDI A;  3JRT A;  3W8I A;  2J0W A;  3TOM A;  3AGU A;  2Q00 A;  5COG A;  3EZI A;  3VM6 A;  3M15 A;  2FFH A;  2WZG A;  1ST6 A;  2O9X A;  1RKC A;  2Q9B A;  2Q9C A;  4U5C E;  3MFN A;  4OIO F;  4MQ9 F;  3NMK A;  3ABK C;  2R25 A;  5KYU A;  4F4B A;  2R7V A;  4J7T A;  2CNW D;  4MVZ A;  5EGY A;  5B3I A;  2BE5 F;  3JRM O;  4MS2 A;  4W8K A;  5KYX A;  2XL8 A;  2OEX A;  1YJG A;  2J9V A;  4LDQ A;  3RQE A;  3T9O A;  5IY5 C;  1OW6 A;  1VTM P;  1B68 A;  4D4X A;  1Q0M A;  5KYX B;  3VF0 A;  4G78 A;  1OR2 A;  3T6G B;  3U2M A;  5COF A;  4E0I A;  1ZHZ A;  5T3T A;  5L0J A;  2AWC A;  2VH3 A;  3KH2 A;  4OIQ F;  1I4Z A;  1QVX A;  1G4U S;  3B71 A;  3EGD A;  4O79 A;  1FTS A;  4EBB A;  3POV A;  2LFD A;  3FAJ A;  2BC5 A;  2IYL D;  4HEA J;  3W4Y A;  2P7V A;  1Z6A A;  4JTD B;  1PD1 A;  3KMI A;  4H4K C;  4CJO A;  1E84 A;  5BQI A;  1ZW3 A;  5T3W A;  1QSP A;  1EA8 A;  5CI9 A;  4U9D A;  3O55 A;  3RQF A;  1G4W R;  1T01 A;  1QQ3 A;  1WGW A;  2IBF A;  2QNL A;  3Q7L A;  2R7T A;  1D1B A;  4HFF B;  1C03 A;  4XEK A;  2X0C A;  3JT1 A;  3N24 A;  3ZQV A;  4JRZ A;  3ZC4 A;  3TD7 A;  2R7X A;  2H7B A;  4JTC B;  4BJT A;  3O6X A;  4CSA A;  1GQA A;  1J8Y F;  2H8A A;  2QUP A;  3DE9 A;  3DJN B;  4HE8 D;  3TJ6 A;  5A6B A;  2YL1 A;  1APC A;  2ZXW C;  4MVR A;  4DVZ A;  4Z9I A;  3ZIB A;  3T6J A;  4LDR A;  3ITF A;  4Z9J A;  2V3C C;  1NBB A;  2C03 A;  2J9U A;  2J46 A;  1G5Z A;  2PX0 A;  2WZF A;  3AG2 C;  3LNR A;  4U5F E;  4FAP B;  5KYN A;  3Q6M A;  4HFK B;  1MMA A;  1HW1 A;  2R7W A;  4I44 A;  1BR1 A;  2ICW G;  2KNH A;  3U9M A;  4MTF A;  2NPU A;  5DS5 A;  2JPU A;  3RFY A;  2P0N A;  1DOW A;  4IRU A;  4PK4 A;  4CS8 C;  1YVI A;  1AVO B;  1BBH A;  3K33 A;  3MBG A;  3IQ6 A;  4JIO A;  3GWN A;  2YLG A;  2A68 F;  4MTO A;  2WL8 A;  2NSF A;  3SNH A;  3GM2 A;  4PJN A;  5F5H A;  1WWP A;  3ZVR A;  1JPN A;  1RCP A;  4J32 B;  4MVU A;  2XLO A;  4QDL A;  3SEO A;  4MVS A;  2YWA A;  5L0I A;  4YK5 A;  2Q4F A;  3ASN C;  2QLA A;  1SMY F;  3RVZ A;  2MHR A;  3W8H A;  1EKY A;  3C8Z A;  3JZ0 A;  3MLG A;  3MYF A;  2CNW A;  2HKV A;  3I4U A;  1I5N A;  1Z7Q c;  2EIJ C;  5TJ5 E;  2L9J A;  1RJ9 A;  2R02 A;  2Q9A A;  5DQT A;  2PBE A;  2AWY A;  3AG1 C;  3GOR A;  3KL4 A;  4DXW A;  3J06 A;  3K1I A;  3CQZ A;  1ZHW A;  3F46 A; 
#chains in the Genus database with same CATH homology
 1ZW3 A;  1DOW A;  1T01 A;  2IBF A;  5L0G A;  3MYI A;  2X0C A;  1DOV A;  1TR2 A;  5L0H A;  2L7A A;  3H2U A;  4K1O A;  3VF0 A;  3TJ6 A;  2HSQ A;  2GDC A;  1QKR A;  3T6G B;  5L0D A;  1U6H A;  2LQG A;  4IGG A;  1H6G A;  4ONS A;  4PR9 A;  3RF3 A;  3ZDL A;  4E18 A;  5L0J A;  5FZT A;  5L0I A;  1ZVZ A;  3S90 A;  1YDI A;  1ZW2 A;  2GWW A;  1XWJ A;  3H2V A;  2B0H A;  1RKE A;  4W8P A;  4DJ9 A;  1U89 A;  1ST6 A;  1RKC A;  1SYQ A;  4P9T A;  4E17 A;  5L0C A;  4EHP A;  1RKE B;  5L0F A;  3TJ5 A;  1L7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...