4K1OA

Crystal structure of the alphan-catenin actin-binding domain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
200
structure length
200
Chain Sequence
b'LIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Catenin alpha-2
publication title An autoinhibited structure of alpha-catenin and its implications for vinculin recruitment to adherens junctions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 80
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2013-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4k1oA00
5FZTA 2HSQA 1XWJA 1U89A 4P9TA 4EHPA 2IBFA 2X0CA 1RKEB 1L7CA 1RKCA 1ZW3A 3H2VA 3MYIA 3T6GB 5L0GA 2GWWA 5L0IA 3H2UA 1DOVA 5L0HA 2LQGA 3S90A 5L0FA 3TJ6A 4K1OA 4W8PA 1QKRA 4E17A 4IGGA 5L0DA 1RKEA 1U6HA 1YDIA 4DJ9A 1T01A 1SYQA 2L7AA 1ZVZA 3VF0A 2B0HA 4E18A 1DOWA 5L0JA 1H6GA 2GDCA 4ONSA 3ZDLA 3TJ5A 1ZW2A 1TR2A 4PR9A 5L0CA 1ST6A 3RF3A
chains in the Genus database with same CATH superfamily
5EHHA 2PX3A 2ZXOA 4PJJA 2PBEA 3FHDA 1WASA 4ZLDA 3L0IA 1BR1A 2HJ3A 4WGZA 5B1BC 3RH3A 4AK9A 2PX0A 3LESA 1VYIA 4YWQA 3IPMO 1HW2A 4XWJA 1NSGB 1PD1A 4YL0A 4U5BE 1XZQA 3S90A 2XM4A 1MNDA 3DAFA 2W45A 2H7OA 1WATA 4J7YA 4JURI 4JKVA 4AL0A 4XEKA 4OIOF 4GYTA 2J46A 3QVYA 5KYWA 2FGYA 4LACB 4K0DA 3ZWIA 4BJ1A 4KC9A 2NUTB 2VCAA 4C7OA 3TJ5A 2GAQA 2YLIA 3EG9B 2ASRA 2M64A 4ULVA 2KGOA 4CDYA 1UFBA 1Y6DA 2GA0A 4FAPB 1WOLA 2YL3A 2VH3A 3EFOA 1K40A 1V74B 3GEHA 4JW1A 4PK4A 5A6BA 2VASA 4EHPA 2IBFA 1FTSA 3C8GB 3K33A 3JZ0A 4DBQA 1M2OA 3EGXA 2YLGA 1MMNA 2J8WA 2YQYA 1LVKA 3TD7A 2P6VA 5HSWA 2NUPB 2XLOA 2FFHA 5DS6A 4N6HA 1RJ9A 1C02A 2WVQA 3V5ZA 1KTMA 3GM1A 3FVYA 1PD0A 3LAYA 5AGFA 2CDQA 4DVZA 1RCPA 3Q6NA 3I5QA 2HMQA 3R2PA 3DMDA 3G4XA 2J9UA 4IAOA 4BEMJ 2M4EA 3C8GD 4I1MA 4O6MA 1FNTc 2J9VA 3QMKA 3ASOC 1S05A 2JPUA 4PJMA 2Q7RA 2R7RA 2G3KA 3IEEA 3ABMC 3PDMP 1Q0KA 2I8BA 1RKCA 3S0XA 4EWCA 2XRHA 3EG9A 3RVYA 3NKEA 3DI5A 4GEHA 5L0IA 5KYUB 1T6UA 3ASNC 2OQMA 4FESA 2XLWA 2R7QA 2LIGA 2DYRC 3DJNB 2IXNA 2JX0A 4MW3A 4RBNA 1C03A 1VTMP 1IZMA 2BC5A 3NRHA 3Q6MA 3EH2A 1BDJB 1JPJA 2QUPA 2JD3A 2QLAA 2B0HA 4LDRA 4CSAA 3B0PA 2NUPA 1YVIA 2XLVA 5BQHA 3S28A 2QY9A 2R7VA 2H8AA 2DI3A 4E0IA 2A0BA 4N4WA 1LE2A 1LI7A 1HY5A 4M63A 4MVZA 2IXMA 2YEVA 3LJBA 3N2ZB 5JSLA 3WODF 3ZTMA 4BJ5C 3U0CA 2HFIA 2Y3GA 1V54C 4LERA 2ETSA 2ZPAA 3A11A 4KNWA 2HJMA 1MMAA 1JOGA 1TWAA 4P6IC 2AWCA 4NCQA 4NQFA 3NYJA 3MLGA 3KPHA 4J7TA 1T5OA 2W9YA 4PFPA 3LS0A 1OW6A 4PJLA 2XXAB 2R9RB 3PCVA 1Z7Qc 1RXQA 4Q5SF 3N24A 1E84A 3RQFA 3HTKC 3HNIA 3QW0A 2DYSC 2LP4A 4BJTA 4AX2A 1QPUA 4KBLA 1OKKA 5GPGB 5K0IA 4Z9HA 3RF3A 3FXHA 4DBRA 4U5EE 3K1IC 3NMIA 1K05A 2AWYA 3JT1A 3JRMO 4MTOA 4DRIB 3NG1A 4Z9JA 4BJ6C 1OCOC 1RKEB 3GM2A 1ORJA 4OINF 3RQGA 1LIHA 1O87A 3C7JA 3HNLA 1D0XA 3MBGA 4K7BA 3B9QA 2OJQA 3AG4C 4C3BA 1F1MA 1T6QA 4Z9IA 1U0BB 3S27A 2HV7A 5B3SC 3EHNA 5COGA 3RFYA 1NFOA 2VB6A 3EGDA 3ECSA 1JR8A 1U6HA 3U8VA 2R7WA 1VLSA 1H9GA 1ZHYA 1G4US 3OWTA 1J8YF 5DS4A 5CIVA 3ZDLA 3VYWA 3W8IA 5DQTA 3L8JA 4BPMA 1ST6A 1VB5A 3DXJF 1JAFA 4XTKA 1BZ4A 3E70C 5F28E 1XWJA 4U5DE 4X0RA 2Y69C 3W2WA 4CX9A 1FFTC 1WWPA 4EBKA 2HV6A 2Q9CA 4MVUA 4MW8A 2IXPA 3X1OA 1FMVA 2OG2A 3K66A 4HE8D 1A41A 4ULWA 1TFOB 3NMKA 3OEOA 3L34A 4KNVA 4U9EA 2TMVP 3NDBB 1E83A 4JVSA 2XL8A 5KYWB 3IQ6A 2UUHA 1SF8A 3FOPA 4MVMA 2WVOA 2YKZA 4C3DA 5DLJA 2YHSA 2IYLD 3UMKA 4HEAJ 1RKEA 3DE9A 4CS8C 3VF0A 1PV3A 3UGPA 3N0TA 4U9DA 3Q7LA 2XL4A 3M4BA 4OIQF 3RKOF 2QNLA 5JUAA 5L0CA 2XS8A 1TWGA 1OXBA 2BE5F 3K1HA 5L3QA 1VLTA 4O7GA 3RIPA 4CS9C 3TULA 4BEJA 3SXYA 2X0CA 1ZHXA 2KC3A 3C62A 1NFNA 3KMIA 3Q7GA 3I4UA 5L0GA 2R7TA 4D4XA 5JVEA 4G7ZF 3U9JA 1TWHA 1WN0A 2L6HA 1DOVA 1M6TA 3H2UA 4JCZA 3T6JA 5E33A 1LKXA 4JEAA 5B1AC 3NKDA 3UMHA 2R7XA 2OEVA 2NPUA 2XLHA 1GGQA 2C04A 2Y3HA 3AJMA 3O55A 1D1AA 4WGYA 5E3CA 3WAQA 2MWQA 3IQTA 2UUIA 1OR2A 3B71A 5COMA 5DVWA 3ZQVA 4CBEA 4DOZA 1ZVZA 5A6KA 3LLIA 4CIPA 3U5SA 1XZPA 2XLDA 1NG1A 4JIOA 4QI0A 3DZAA 3U8PA 3UGOA 4PR9A 1AEPA 2KQ9A 4IARA 1Z23A 4L6RA 2J9BA 3HKKA 2YZSA 1ORYA 1YA7O 5EK0A 2A0UA 1YLMA 2KSFA 2EPMX 3AG2C 2LD6A 3DM5A 2DGJA 2L81A 5KYXB 4AE4B 3K6BA 5KYYB 1R5ID 2H7VC 1G8XA 5AC5A 2NUTA 5DS5A 1Z6AA 5JS5A 3U3FA 4MS2A 1OW8A 4E18A 1S7ZA 5DQZA 5L0FA 2CW0F 2CCYA 3KKBA 1OQCA 2IOQA 4E7ZA 3GODA 4GQHA 5JRAA 3EPVA 3EH1A 4EKWA 2O9XA 1V55C 3C8GA 2CYDA 4N06A 1VOMA 1Z3IX 3BEHA 4DJ9A 4DRJB 4CJOA 3AG1C 4MVSA 1ZW2A 2R02A 2Z15A 1A7DA 1HE1A 5CI8A 1LS1A 4HFFB 3U2LA 2XLEA 1GM5A 1CPRA 1LE4A 2EINC 2P0NA 3GWNA 1T6IA 4UDVA 3EZHA 4C3EA 3C63A 1U89A 1L3PA 2FAPB 2YL0A 2ZD9A 3IQ5A 5FCLA 3W4YA 4DVYP 4JEBA 4CSAC 1M2VB 3SNHA 2YLDA 1ZW3A 2KJGA 1KU2A 3CZ6A 4NTBA 2EIJC 4YT8A 3HNKA 3M4CA 2X51A 4MTGA 2EPLX 3GEIA 1QKRA 1FFHA 4W8PA 3V7OA 4XLPF 4I3MA 4G7OF 3FOOA 2OJED 3NMJA 3JCUQ 4FWVA 4O6YA 5KYXA 2J7PA 2WZGA 2HUJA 2L7AA 3UR3C 5KYYA 3C18A 2CNWA 1V4AA 4ONSA 1NLXA 2HS5A 4J32B 4JJGA 3S9OA 3MX3A 2AVKA 1EKYA 1Q0DA 1YA9A 1OCRC 5KYUA 3JYYA 1NBBA 1UG7A 3PMRA 4B6IA 1PCXA 3RVZA 5F5HA 2R7UA 4D4NA 3KYJA 4NY3A 3IQCA 1SMYF 3JRTA 4P9TA 1GS9A 2C03A 2QTVA 2OKUA 1IW7F 1YAUO 3DM9B 3O39A 4H4KC 2G3VA 4QI2A 4Q7CA 3GANA 2OEXA 1K04A 1YJGA 3LLKA 1LS4A 3A9CA 2F22A 3US6A 4KI2A 1HW1A 4G7HF 5L0DA 1WGWA 4BJ6A 3RW0A 256BA 1FAPB 1YZCA 1ZHTA 2EPKX 2HZ8A 2J9WA 4JTCB 3F47A 1TKNA 1ZYRF 4P9FA 1J8MF 2EPOA 2KW3C 5L0JA 1NZEA 3DJUB 4XEVA 2D5RB 3OA1A 4A2NB 2H7BA 1ZU4A 3PHF2 3WG7C 4JTAB 2HSBA 2OOCA 3X2QC 1YARO 4MTFA 3U9MA 4U5HA 4OIPF 1HMOA 2R25A 2HSQA 3DKAA 4I1OB 3SEOA 1JPNA 1H7IA 2PFDA 3QZCA 2R7SA 3W2VA 3ITFA 5BUOA 3VAYA 2A69F 4OD5A 3ZIBA 1E86A 1HE9A 2KNHA 2OU6A 2ICWG 2W4BA 4C7OB 4LLEA 4K1OA 3EFOB 4IJJA 1B68A 3V5XA 5AC4A 3JTLO 5HV9A 2V26A 3ZC4A 3GM3A 2Q4FA 2XL6A 3HNJA 1HMDA 2G62A 1JMWA 3SP1A 1EQ1A 4JC7A 2IXOA 3B0VC 3CAXA 3JSEO 3T6BA 1QLEC 2BL2A 1A0BA 3O10A 1OR3A 1OCCC 2VCCA 3ZTZA 3TQOA 1RJ9B 5JP7A 3POVA 1W2WA 3NYMA 5KYNA 1APCA 4HFKB 4OIRF 3FDQA 3G50A 5JT4A 1RMVA 4IWBA 3SXZA 2HMZA 3UMIA 2D4UA 4H54A 1CPQA 1Z5ZA 2AU5A 2ZXRA 3AOUA 4ER9A 4AL1A 4CS8A 1GQAA 2XXAA 2P61A 4JJFA 4JE9A 1I4YA 2GWWA 3UNGC 2L9JA 5A6BD 1LI5A 2AP3A 2QE9A 2XLMA 3IHUA 4RDAA 3O6XA 4JZAA 1D0YA 4FX5A 1BR4A 2A6EF 2Y3DA 3DWWA 1MQVA 5T3WA 4CDVA 2WVNA 3BRJA 2MYSA 5A6JA 4CS9A 5A6AA 2EIKC 1G4WR 4F4BA 5CI9A 1YYJA 1ZHZA 3AQBA 3VRCA 4CS7A 3L1MA 4Q4ZF 4JTDB 2OCCC 3RYLA 3KH2A 4N6CA 2B0JA 5EGYA 3ZVRA 1VK5A 4RD9A 1Q0FA 2EILC 2CGEA 2Y39A 2A68F 2ZXWC 2A6HF 1VMAA 3LEVA 4MVOA 3JSZA 2R05A 1R4TA 2YVKA 3H65A 4XPXA 1WTYA 5BQGA 1D1CA 3TK0A 3M15A 4EBJA 4YT4A 3L8IA 3EHMA 4CIHA 3MFNA 1C17M 2WB7A 1QSPA 2R7OA 2NG1A 2P1AA 3FAPB 4E7SA 2KK1A 3T6GB 4XPYA 4XLNF 2XM0A 4JRZA 5E2QA 3VM6A 2IM8A 2MHRA 1I5NA 2Q9BA 4G0HA 4YJWA 3B0UX 4YT5A 3J06A 1BR2A 4G78A 3T9OA 1JRAA 2VCBA 1D1BA 2HKVA 4U5GA 1TWCA 4XEFA 1SYQA 1DOWA 1NU9C 5BQIA 2J0WA 3AGTA 3EJNA 5D92A 1EI7A 3LNMB 1M56C 3RQEA 4YN0B 2WL8A 3DE8A 3GEEA 1FR0A 4LDQA 4A4AA 2XSEA 1BBHA 1NU7D 1G5ZA 3GWLA 4WABA 1AVOB 2RD9A 3LS1A 4CDAA 2PNOA 2WZFA 3ZG1A 4NTAA 4DRHB 1SZIA 1TFKB 1CGME 5T1DB 1N1CA 2LFDA 2ZXPA 4O79A 5L0HA 2LQGA 2LFFA 3FAJA 2LSEA 3C8ZA 1T9KA 3QW1A 3CSKA 2I15A 3QTHA 3W8HA 2Q00A 3WHNA 4OD4A 2R03A 3ZQYA 4BJ5A 1A7VA 2KYHA 2LCHA 2PF4E 4MQ9F 3AGUA 3R7CA 3T4RA 4BG0A 4E0HA 3HLZA 4AE4A 1H6GA 1E85A 1YYXA 2GDCA 3TOMA 1EA8A 2J45A 1ZHWA 2J7PD 1LPEA 4NC3A 4EUKB 2E87A 3V5YA 2CNWD 2Y3BA 5FZTA 2LK4A 3AG3C 4CJGA 1QVXA 3EGDB 4U5CE 1VYKA 4XQ1A 1CGNA 3SYNA 1M57C 1OKKD 2NSGA 1O3UA 4J30B 4YL3A 4EIYA 4YT2A 1OXKA 2A1DD 3TOLA 1H9TA 1L7CA 2EIMC 1A7EA 3M1CB 2NSFA 3H2VA 1Q0MA 5COFA 1Z63A 2XS1A 3ATPA 4PFOA 3LEOA 3CQZA 1I4ZA 2PP4A 2VC9A 2YWAA 3K7DA 3TJ6A 1LM3B 3SXKA 2RSEB 2L6GA 1KNYA 1MMDA 2DB4A 3LNRA 1SR2A 3NYLA 5E3AA 1CGOA 3I5PA 3K1IA 1Y4CA 4XPWA 4I44A 1YDIA 3U3BA 1T01A 2YL1A 3SXMA 3U2MA 5A69A 3G4ZA 1M2VA 4YK5A 4MVRA 1AUEA 4MNDA 1OW7A 2W4MA 4MVQA 2V3CC 1TQGA 5L3VA 1ZU5A 3EQLF 4O6NA 2Q9AA 1D0ZA 2YL7A 3CEXA 3ABLC 3FMSA 2YRFA 3JYHA 4LDKA 4QDLA 3ZSUA 5JLIA 5B3IA 2P7VA 1QZXA 1OCZC 3HJCA 3QVZA 3KL4A 4JCHA 1E2XA 5IY5C 3AQCA 3MYIA 4IAQA 2WZLA 4IRUA 4PACA 3S84A 3E9VA 5F5FA 3GORA 3ABKC 3MYFA 1FMWA 2L6FA 5D91A 3S29A 4ANJA 2Q3TA 1YZAA 3DAGA 1O5HA 5T3TA 3LUTB 4YL1A 4E17A 4PJNA 4ZLCA 1MNEA 2EPNA 3EZIA 4IGGA 4R32A 4U5FE 3SZRA 4W8KA 3B29A 4NTFA 4WJ0A 1Q0GA 1ORSC 3EGXB 4EBBA 1ZZPA 4IB4A 3DD7A 3F46A 1MMGA 1QQ3A 1TR2A 2GFHA 4LLCA 3KYIA 5TJ5E 4DXWA 2J0XA 3M79A
chains in the Genus database with same CATH topology
5FZTA 2HSQA 1XWJA 1U89A 4P9TA 4EHPA 2IBFA 2X0CA 1RKEB 1L7CA 1RKCA 1ZW3A 3H2VA 3MYIA 3T6GB 5L0GA 2GWWA 5L0IA 3H2UA 1DOVA 5L0HA 2LQGA 3S90A 5L0FA 3TJ6A 4K1OA 4W8PA 1QKRA 4E17A 4IGGA 5L0DA 1RKEA 1U6HA 1YDIA 4DJ9A 1T01A 1SYQA 2L7AA 1ZVZA 3VF0A 2B0HA 4E18A 1DOWA 5L0JA 1H6GA 2GDCA 4ONSA 3ZDLA 3TJ5A 1ZW2A 1TR2A 4PR9A 5L0CA 1ST6A 3RF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZT A;  2HSQ A;  1XWJ A;  1U89 A;  4P9T A;  4EHP A;  2IBF A;  2X0C A;  1RKE B;  1L7C A;  1RKC A;  1ZW3 A;  3H2V A;  3MYI A;  3T6G B;  5L0G A;  2GWW A;  5L0I A;  3H2U A;  1DOV A;  5L0H A;  2LQG A;  3S90 A;  5L0F A;  3TJ6 A;  4K1O A;  4W8P A;  1QKR A;  4E17 A;  4IGG A;  5L0D A;  1RKE A;  1U6H A;  1YDI A;  4DJ9 A;  1T01 A;  1SYQ A;  2L7A A;  1ZVZ A;  3VF0 A;  2B0H A;  4E18 A;  1DOW A;  5L0J A;  1H6G A;  2GDC A;  4ONS A;  3ZDL A;  3TJ5 A;  1ZW2 A;  1TR2 A;  4PR9 A;  5L0C A;  1ST6 A;  3RF3 A; 
#chains in the Genus database with same CATH topology
 5EHH A;  2PX3 A;  2ZXO A;  4PJJ A;  2PBE A;  3FHD A;  1WAS A;  4ZLD A;  3L0I A;  1BR1 A;  2HJ3 A;  4WGZ A;  5B1B C;  3RH3 A;  4AK9 A;  2PX0 A;  3LES A;  1VYI A;  4YWQ A;  3IPM O;  1HW2 A;  4XWJ A;  1NSG B;  1PD1 A;  4YL0 A;  4U5B E;  1XZQ A;  3S90 A;  2XM4 A;  1MND A;  3DAF A;  2W45 A;  2H7O A;  1WAT A;  4J7Y A;  4JUR I;  4JKV A;  4AL0 A;  4XEK A;  4OIO F;  4GYT A;  2J46 A;  3QVY A;  5KYW A;  2FGY A;  4LAC B;  4K0D A;  3ZWI A;  4BJ1 A;  4KC9 A;  2NUT B;  2VCA A;  4C7O A;  3TJ5 A;  2GAQ A;  2YLI A;  3EG9 B;  2ASR A;  2M64 A;  4ULV A;  2KGO A;  4CDY A;  1UFB A;  1Y6D A;  2GA0 A;  4FAP B;  1WOL A;  2YL3 A;  2VH3 A;  3EFO A;  1K40 A;  1V74 B;  3GEH A;  4JW1 A;  4PK4 A;  5A6B A;  2VAS A;  4EHP A;  2IBF A;  1FTS A;  3C8G B;  3K33 A;  3JZ0 A;  4DBQ A;  1M2O A;  3EGX A;  2YLG A;  1MMN A;  2J8W A;  2YQY A;  1LVK A;  3TD7 A;  2P6V A;  5HSW A;  2NUP B;  2XLO A;  2FFH A;  5DS6 A;  4N6H A;  1RJ9 A;  1C02 A;  2WVQ A;  3V5Z A;  1KTM A;  3GM1 A;  3FVY A;  1PD0 A;  3LAY A;  5AGF A;  2CDQ A;  4DVZ A;  1RCP A;  3Q6N A;  3I5Q A;  2HMQ A;  3R2P A;  3DMD A;  3G4X A;  2J9U A;  4IAO A;  4BEM J;  2M4E A;  3C8G D;  4I1M A;  4O6M A;  1FNT c;  2J9V A;  3QMK A;  3ASO C;  1S05 A;  2JPU A;  4PJM A;  2Q7R A;  2R7R A;  2G3K A;  3IEE A;  3ABM C;  3PDM P;  1Q0K A;  2I8B A;  1RKC A;  3S0X A;  4EWC A;  2XRH A;  3EG9 A;  3RVY A;  3NKE A;  3DI5 A;  4GEH A;  5L0I A;  5KYU B;  1T6U A;  3ASN C;  2OQM A;  4FES A;  2XLW A;  2R7Q A;  2LIG A;  2DYR C;  3DJN B;  2IXN A;  2JX0 A;  4MW3 A;  4RBN A;  1C03 A;  1VTM P;  1IZM A;  2BC5 A;  3NRH A;  3Q6M A;  3EH2 A;  1BDJ B;  1JPJ A;  2QUP A;  2JD3 A;  2QLA A;  2B0H A;  4LDR A;  4CSA A;  3B0P A;  2NUP A;  1YVI A;  2XLV A;  5BQH A;  3S28 A;  2QY9 A;  2R7V A;  2H8A A;  2DI3 A;  4E0I A;  2A0B A;  4N4W A;  1LE2 A;  1LI7 A;  1HY5 A;  4M63 A;  4MVZ A;  2IXM A;  2YEV A;  3LJB A;  3N2Z B;  5JSL A;  3WOD F;  3ZTM A;  4BJ5 C;  3U0C A;  2HFI A;  2Y3G A;  1V54 C;  4LER A;  2ETS A;  2ZPA A;  3A11 A;  4KNW A;  2HJM A;  1MMA A;  1JOG A;  1TWA A;  4P6I C;  2AWC A;  4NCQ A;  4NQF A;  3NYJ A;  3MLG A;  3KPH A;  4J7T A;  1T5O A;  2W9Y A;  4PFP A;  3LS0 A;  1OW6 A;  4PJL A;  2XXA B;  2R9R B;  3PCV A;  1Z7Q c;  1RXQ A;  4Q5S F;  3N24 A;  1E84 A;  3RQF A;  3HTK C;  3HNI A;  3QW0 A;  2DYS C;  2LP4 A;  4BJT A;  4AX2 A;  1QPU A;  4KBL A;  1OKK A;  5GPG B;  5K0I A;  4Z9H A;  3RF3 A;  3FXH A;  4DBR A;  4U5E E;  3K1I C;  3NMI A;  1K05 A;  2AWY A;  3JT1 A;  3JRM O;  4MTO A;  4DRI B;  3NG1 A;  4Z9J A;  4BJ6 C;  1OCO C;  1RKE B;  3GM2 A;  1ORJ A;  4OIN F;  3RQG A;  1LIH A;  1O87 A;  3C7J A;  3HNL A;  1D0X A;  3MBG A;  4K7B A;  3B9Q A;  2OJQ A;  3AG4 C;  4C3B A;  1F1M A;  1T6Q A;  4Z9I A;  1U0B B;  3S27 A;  2HV7 A;  5B3S C;  3EHN A;  5COG A;  3RFY A;  1NFO A;  2VB6 A;  3EGD A;  3ECS A;  1JR8 A;  1U6H A;  3U8V A;  2R7W A;  1VLS A;  1H9G A;  1ZHY A;  1G4U S;  3OWT A;  1J8Y F;  5DS4 A;  5CIV A;  3ZDL A;  3VYW A;  3W8I A;  5DQT A;  3L8J A;  4BPM A;  1ST6 A;  1VB5 A;  3DXJ F;  1JAF A;  4XTK A;  1BZ4 A;  3E70 C;  5F28 E;  1XWJ A;  4U5D E;  4X0R A;  2Y69 C;  3W2W A;  4CX9 A;  1FFT C;  1WWP A;  4EBK A;  2HV6 A;  2Q9C A;  4MVU A;  4MW8 A;  2IXP A;  3X1O A;  1FMV A;  2OG2 A;  3K66 A;  4HE8 D;  1A41 A;  4ULW A;  1TFO B;  3NMK A;  3OEO A;  3L34 A;  4KNV A;  4U9E A;  2TMV P;  3NDB B;  1E83 A;  4JVS A;  2XL8 A;  5KYW B;  3IQ6 A;  2UUH A;  1SF8 A;  3FOP A;  4MVM A;  2WVO A;  2YKZ A;  4C3D A;  5DLJ A;  2YHS A;  2IYL D;  3UMK A;  4HEA J;  1RKE A;  3DE9 A;  4CS8 C;  3VF0 A;  1PV3 A;  3UGP A;  3N0T A;  4U9D A;  3Q7L A;  2XL4 A;  3M4B A;  4OIQ F;  3RKO F;  2QNL A;  5JUA A;  5L0C A;  2XS8 A;  1TWG A;  1OXB A;  2BE5 F;  3K1H A;  5L3Q A;  1VLT A;  4O7G A;  3RIP A;  4CS9 C;  3TUL A;  4BEJ A;  3SXY A;  2X0C A;  1ZHX A;  2KC3 A;  3C62 A;  1NFN A;  3KMI A;  3Q7G A;  3I4U A;  5L0G A;  2R7T A;  4D4X A;  5JVE A;  4G7Z F;  3U9J A;  1TWH A;  1WN0 A;  2L6H A;  1DOV A;  1M6T A;  3H2U A;  4JCZ A;  3T6J A;  5E33 A;  1LKX A;  4JEA A;  5B1A C;  3NKD A;  3UMH A;  2R7X A;  2OEV A;  2NPU A;  2XLH A;  1GGQ A;  2C04 A;  2Y3H A;  3AJM A;  3O55 A;  1D1A A;  4WGY A;  5E3C A;  3WAQ A;  2MWQ A;  3IQT A;  2UUI A;  1OR2 A;  3B71 A;  5COM A;  5DVW A;  3ZQV A;  4CBE A;  4DOZ A;  1ZVZ A;  5A6K A;  3LLI A;  4CIP A;  3U5S A;  1XZP A;  2XLD A;  1NG1 A;  4JIO A;  4QI0 A;  3DZA A;  3U8P A;  3UGO A;  4PR9 A;  1AEP A;  2KQ9 A;  4IAR A;  1Z23 A;  4L6R A;  2J9B A;  3HKK A;  2YZS A;  1ORY A;  1YA7 O;  5EK0 A;  2A0U A;  1YLM A;  2KSF A;  2EPM X;  3AG2 C;  2LD6 A;  3DM5 A;  2DGJ A;  2L81 A;  5KYX B;  4AE4 B;  3K6B A;  5KYY B;  1R5I D;  2H7V C;  1G8X A;  5AC5 A;  2NUT A;  5DS5 A;  1Z6A A;  5JS5 A;  3U3F A;  4MS2 A;  1OW8 A;  4E18 A;  1S7Z A;  5DQZ A;  5L0F A;  2CW0 F;  2CCY A;  3KKB A;  1OQC A;  2IOQ A;  4E7Z A;  3GOD A;  4GQH A;  5JRA A;  3EPV A;  3EH1 A;  4EKW A;  2O9X A;  1V55 C;  3C8G A;  2CYD A;  4N06 A;  1VOM A;  1Z3I X;  3BEH A;  4DJ9 A;  4DRJ B;  4CJO A;  3AG1 C;  4MVS A;  1ZW2 A;  2R02 A;  2Z15 A;  1A7D A;  1HE1 A;  5CI8 A;  1LS1 A;  4HFF B;  3U2L A;  2XLE A;  1GM5 A;  1CPR A;  1LE4 A;  2EIN C;  2P0N A;  3GWN A;  1T6I A;  4UDV A;  3EZH A;  4C3E A;  3C63 A;  1U89 A;  1L3P A;  2FAP B;  2YL0 A;  2ZD9 A;  3IQ5 A;  5FCL A;  3W4Y A;  4DVY P;  4JEB A;  4CSA C;  1M2V B;  3SNH A;  2YLD A;  1ZW3 A;  2KJG A;  1KU2 A;  3CZ6 A;  4NTB A;  2EIJ C;  4YT8 A;  3HNK A;  3M4C A;  2X51 A;  4MTG A;  2EPL X;  3GEI A;  1QKR A;  1FFH A;  4W8P A;  3V7O A;  4XLP F;  4I3M A;  4G7O F;  3FOO A;  2OJE D;  3NMJ A;  3JCU Q;  4FWV A;  4O6Y A;  5KYX A;  2J7P A;  2WZG A;  2HUJ A;  2L7A A;  3UR3 C;  5KYY A;  3C18 A;  2CNW A;  1V4A A;  4ONS A;  1NLX A;  2HS5 A;  4J32 B;  4JJG A;  3S9O A;  3MX3 A;  2AVK A;  1EKY A;  1Q0D A;  1YA9 A;  1OCR C;  5KYU A;  3JYY A;  1NBB A;  1UG7 A;  3PMR A;  4B6I A;  1PCX A;  3RVZ A;  5F5H A;  2R7U A;  4D4N A;  3KYJ A;  4NY3 A;  3IQC A;  1SMY F;  3JRT A;  4P9T A;  1GS9 A;  2C03 A;  2QTV A;  2OKU A;  1IW7 F;  1YAU O;  3DM9 B;  3O39 A;  4H4K C;  2G3V A;  4QI2 A;  4Q7C A;  3GAN A;  2OEX A;  1K04 A;  1YJG A;  3LLK A;  1LS4 A;  3A9C A;  2F22 A;  3US6 A;  4KI2 A;  1HW1 A;  4G7H F;  5L0D A;  1WGW A;  4BJ6 A;  3RW0 A;  256B A;  1FAP B;  1YZC A;  1ZHT A;  2EPK X;  2HZ8 A;  2J9W A;  4JTC B;  3F47 A;  1TKN A;  1ZYR F;  4P9F A;  1J8M F;  2EPO A;  2KW3 C;  5L0J A;  1NZE A;  3DJU B;  4XEV A;  2D5R B;  3OA1 A;  4A2N B;  2H7B A;  1ZU4 A;  3PHF 2;  3WG7 C;  4JTA B;  2HSB A;  2OOC A;  3X2Q C;  1YAR O;  4MTF A;  3U9M A;  4U5H A;  4OIP F;  1HMO A;  2R25 A;  2HSQ A;  3DKA A;  4I1O B;  3SEO A;  1JPN A;  1H7I A;  2PFD A;  3QZC A;  2R7S A;  3W2V A;  3ITF A;  5BUO A;  3VAY A;  2A69 F;  4OD5 A;  3ZIB A;  1E86 A;  1HE9 A;  2KNH A;  2OU6 A;  2ICW G;  2W4B A;  4C7O B;  4LLE A;  4K1O A;  3EFO B;  4IJJ A;  1B68 A;  3V5X A;  5AC4 A;  3JTL O;  5HV9 A;  2V26 A;  3ZC4 A;  3GM3 A;  2Q4F A;  2XL6 A;  3HNJ A;  1HMD A;  2G62 A;  1JMW A;  3SP1 A;  1EQ1 A;  4JC7 A;  2IXO A;  3B0V C;  3CAX A;  3JSE O;  3T6B A;  1QLE C;  2BL2 A;  1A0B A;  3O10 A;  1OR3 A;  1OCC C;  2VCC A;  3ZTZ A;  3TQO A;  1RJ9 B;  5JP7 A;  3POV A;  1W2W A;  3NYM A;  5KYN A;  1APC A;  4HFK B;  4OIR F;  3FDQ A;  3G50 A;  5JT4 A;  1RMV A;  4IWB A;  3SXZ A;  2HMZ A;  3UMI A;  2D4U A;  4H54 A;  1CPQ A;  1Z5Z A;  2AU5 A;  2ZXR A;  3AOU A;  4ER9 A;  4AL1 A;  4CS8 A;  1GQA A;  2XXA A;  2P61 A;  4JJF A;  4JE9 A;  1I4Y A;  2GWW A;  3UNG C;  2L9J A;  5A6B D;  1LI5 A;  2AP3 A;  2QE9 A;  2XLM A;  3IHU A;  4RDA A;  3O6X A;  4JZA A;  1D0Y A;  4FX5 A;  1BR4 A;  2A6E F;  2Y3D A;  3DWW A;  1MQV A;  5T3W A;  4CDV A;  2WVN A;  3BRJ A;  2MYS A;  5A6J A;  4CS9 A;  5A6A A;  2EIK C;  1G4W R;  4F4B A;  5CI9 A;  1YYJ A;  1ZHZ A;  3AQB A;  3VRC A;  4CS7 A;  3L1M A;  4Q4Z F;  4JTD B;  2OCC C;  3RYL A;  3KH2 A;  4N6C A;  2B0J A;  5EGY A;  3ZVR A;  1VK5 A;  4RD9 A;  1Q0F A;  2EIL C;  2CGE A;  2Y39 A;  2A68 F;  2ZXW C;  2A6H F;  1VMA A;  3LEV A;  4MVO A;  3JSZ A;  2R05 A;  1R4T A;  2YVK A;  3H65 A;  4XPX A;  1WTY A;  5BQG A;  1D1C A;  3TK0 A;  3M15 A;  4EBJ A;  4YT4 A;  3L8I A;  3EHM A;  4CIH A;  3MFN A;  1C17 M;  2WB7 A;  1QSP A;  2R7O A;  2NG1 A;  2P1A A;  3FAP B;  4E7S A;  2KK1 A;  3T6G B;  4XPY A;  4XLN F;  2XM0 A;  4JRZ A;  5E2Q A;  3VM6 A;  2IM8 A;  2MHR A;  1I5N A;  2Q9B A;  4G0H A;  4YJW A;  3B0U X;  4YT5 A;  3J06 A;  1BR2 A;  4G78 A;  3T9O A;  1JRA A;  2VCB A;  1D1B A;  2HKV A;  4U5G A;  1TWC A;  4XEF A;  1SYQ A;  1DOW A;  1NU9 C;  5BQI A;  2J0W A;  3AGT A;  3EJN A;  5D92 A;  1EI7 A;  3LNM B;  1M56 C;  3RQE A;  4YN0 B;  2WL8 A;  3DE8 A;  3GEE A;  1FR0 A;  4LDQ A;  4A4A A;  2XSE A;  1BBH A;  1NU7 D;  1G5Z A;  3GWL A;  4WAB A;  1AVO B;  2RD9 A;  3LS1 A;  4CDA A;  2PNO A;  2WZF A;  3ZG1 A;  4NTA A;  4DRH B;  1SZI A;  1TFK B;  1CGM E;  5T1D B;  1N1C A;  2LFD A;  2ZXP A;  4O79 A;  5L0H A;  2LQG A;  2LFF A;  3FAJ A;  2LSE A;  3C8Z A;  1T9K A;  3QW1 A;  3CSK A;  2I15 A;  3QTH A;  3W8H A;  2Q00 A;  3WHN A;  4OD4 A;  2R03 A;  3ZQY A;  4BJ5 A;  1A7V A;  2KYH A;  2LCH A;  2PF4 E;  4MQ9 F;  3AGU A;  3R7C A;  3T4R A;  4BG0 A;  4E0H A;  3HLZ A;  4AE4 A;  1H6G A;  1E85 A;  1YYX A;  2GDC A;  3TOM A;  1EA8 A;  2J45 A;  1ZHW A;  2J7P D;  1LPE A;  4NC3 A;  4EUK B;  2E87 A;  3V5Y A;  2CNW D;  2Y3B A;  5FZT A;  2LK4 A;  3AG3 C;  4CJG A;  1QVX A;  3EGD B;  4U5C E;  1VYK A;  4XQ1 A;  1CGN A;  3SYN A;  1M57 C;  1OKK D;  2NSG A;  1O3U A;  4J30 B;  4YL3 A;  4EIY A;  4YT2 A;  1OXK A;  2A1D D;  3TOL A;  1H9T A;  1L7C A;  2EIM C;  1A7E A;  3M1C B;  2NSF A;  3H2V A;  1Q0M A;  5COF A;  1Z63 A;  2XS1 A;  3ATP A;  4PFO A;  3LEO A;  3CQZ A;  1I4Z A;  2PP4 A;  2VC9 A;  2YWA A;  3K7D A;  3TJ6 A;  1LM3 B;  3SXK A;  2RSE B;  2L6G A;  1KNY A;  1MMD A;  2DB4 A;  3LNR A;  1SR2 A;  3NYL A;  5E3A A;  1CGO A;  3I5P A;  3K1I A;  1Y4C A;  4XPW A;  4I44 A;  1YDI A;  3U3B A;  1T01 A;  2YL1 A;  3SXM A;  3U2M A;  5A69 A;  3G4Z A;  1M2V A;  4YK5 A;  4MVR A;  1AUE A;  4MND A;  1OW7 A;  2W4M A;  4MVQ A;  2V3C C;  1TQG A;  5L3V A;  1ZU5 A;  3EQL F;  4O6N A;  2Q9A A;  1D0Z A;  2YL7 A;  3CEX A;  3ABL C;  3FMS A;  2YRF A;  3JYH A;  4LDK A;  4QDL A;  3ZSU A;  5JLI A;  5B3I A;  2P7V A;  1QZX A;  1OCZ C;  3HJC A;  3QVZ A;  3KL4 A;  4JCH A;  1E2X A;  5IY5 C;  3AQC A;  3MYI A;  4IAQ A;  2WZL A;  4IRU A;  4PAC A;  3S84 A;  3E9V A;  5F5F A;  3GOR A;  3ABK C;  3MYF A;  1FMW A;  2L6F A;  5D91 A;  3S29 A;  4ANJ A;  2Q3T A;  1YZA A;  3DAG A;  1O5H A;  5T3T A;  3LUT B;  4YL1 A;  4E17 A;  4PJN A;  4ZLC A;  1MNE A;  2EPN A;  3EZI A;  4IGG A;  4R32 A;  4U5F E;  3SZR A;  4W8K A;  3B29 A;  4NTF A;  4WJ0 A;  1Q0G A;  1ORS C;  3EGX B;  4EBB A;  1ZZP A;  4IB4 A;  3DD7 A;  3F46 A;  1MMG A;  1QQ3 A;  1TR2 A;  2GFH A;  4LLC A;  3KYI A;  5TJ5 E;  4DXW A;  2J0X A;  3M79 A; 
#chains in the Genus database with same CATH homology
 5FZT A;  2HSQ A;  1XWJ A;  1U89 A;  4P9T A;  4EHP A;  2IBF A;  2X0C A;  1RKE B;  1L7C A;  1RKC A;  1ZW3 A;  3H2V A;  3MYI A;  3T6G B;  5L0G A;  2GWW A;  5L0I A;  3H2U A;  1DOV A;  5L0H A;  2LQG A;  3S90 A;  5L0F A;  3TJ6 A;  4K1O A;  4W8P A;  1QKR A;  4E17 A;  4IGG A;  5L0D A;  1RKE A;  1U6H A;  1YDI A;  4DJ9 A;  1T01 A;  1SYQ A;  2L7A A;  1ZVZ A;  3VF0 A;  2B0H A;  4E18 A;  1DOW A;  5L0J A;  1H6G A;  2GDC A;  4ONS A;  3ZDL A;  3TJ5 A;  1ZW2 A;  1TR2 A;  4PR9 A;  5L0C A;  1ST6 A;  3RF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...