4K1SA

Gly-ser-splb protease from staphylococcus aureus at 1.96 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
202
structure length
197
Chain Sequence
b'NVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVRNAYGVYFTPEIKKFIAENIDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease SplB
publication title Staphylococcal SplB Serine Protease Utilizes a Novel Molecular Mechanism of Activation.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 56
structure length 197
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k1sA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k1sA02
5H4IB 4B76A 1GHAF 1XVOA 4BTTB 4NWLA 3Q00A 3O8DA 4WXIA 3RC4A 2XW9A 2VIDA 4BAOB 1C1PA 4OS5A 1D4PB 4YLUA 2WPMS 3UY9A 2BD8A 4CRDA 2ZTYA 3V13A 4J2YB 1O35A 2HALA 4CREA 1O5BB 1HIAB 1K1OA 4E06H 5IYTA 1SQTA 2GT8A 1S0RA 5A2MH 3S9CA 1TOCB 2I6QA 4LK4A 3T27A 2QXGA 4TWYA 1O3KA 2XNIA 4FU9A 1FLEE 1DWDH 1RS0A 1NO9H 2ESTE 2PUQH 1W2KH 1DX5M 5LH8A 1BMAA 1GBAA 1A46H 1YPHC 2F91A 4MNYA 1C2KA 4JZFH 1YP9A 1MU6B 1T8LA 1IQLA 1MTSA 1GI7B 1ZSLA 2GTBA 2KAIA 1GMHG 1GBJA 1DICA 4Y8ZA 1G3CA 1DUEA 4AZ2B 3EYDA 4OS2A 1CVWH 1MTVA 1OWJA 5A0CA 1ZMLA 4AFZA 2FS8A 3FANA 2FX6A 1SR5C 1WTHD 3AASA 1HAHH 3F68H 2ZA5A 1O3CA 1ZTKA 1PPZA 4JK6A 4MQAA 1XUGA 1HUTH 1SFQB 1GDNA 5FXLA 3OU0A 1YPMH 7GCHG 3S69A 1BIOA 1LCYA 2D2DA 4CRBA 1FIZA 4INLA 5ESTE 4IMQA 1KXAA 1F0SA 1OWEA 2R0KA 1DT2A 1OWKA 2P94A 5C1XA 1SGRE 1ELCA 4FVBA 2CHAC 3RMNH 4AFUA 1GHAG 2PV9B 1EUFA 1TA6A 2PKSC 3GY2A 1C5NH 3P92A 3S0NA 2ZFTA 1TMBH 1O36A 4AB8A 2TGTA 2ZGJA 5C1YA 1AKSA 1PJPA 3A8BA 2VVUA 2WYJA 1BTZA 1O39A 2RA0A 1WV7H 1LVBA 1O2ZA 2XWAA 4CHAB 1GJ5H 2TBSA 1Y3WA 1P8VC 3RXUA 3UPEA 1HLTH 2ZGXH 3UTUH 1V2QT 1CE5A 1WU1A 3ZVCA 1GI6A 3SU0A 3V0XA 2ZCLP 1QHRB 1UK4A 3A7XA 4INHA 3BEFB 4ISLA 3GCTG 1OX1A 2BX4A 4UFEH 3M36A 1C1UH 1EZQA 2ZU1A 3R0FA 1B5GH 1ANCA 3VFEA 1HAVB 3RLWH 1YC0A 2Q6DA 3QN7A 2G5VA 1AE8H 1YPGH 3QWCH 1H9LB 4WXVA 1H8IH 2GZ9A 2J34A 4KP0A 1GGDB 5HM2A 3RXDA 1Q3XA 1LVOA 1P3CA 1OXGA 1QQUA 1LKBA 4UONA 2ZEBA 1C5UA 3QO6A 1DWEH 3BTEE 3RM0H 3SQHE 2YOLA 3RXVA 1H9IE 3M37A 1NRSH 3P8GA 4LXBH 4OS7A 5HXFA 1GHZA 2G4TA 2J92A 3ESTA 2PLXA 4MDSA 3ZV9A 3UQOA 3GCHB 1QR3E 2BQ6B 2PFEA 1ABIH 5FBIA 1C2GA 3DT0H 4A1XA 4BXWA 2B9LA 3SU3A 3ZV8A 1S83A 2VNTA 3EA7A 1HAGE 1JIMA 2R2WU 4JMYA 2P16A 4NIWA 2HRVA 4DGJA 4TYDA 4Y76A 3KHVA 2ZHQH 1DXWA 1AUTC 1C2LA 1D3QB 6ESTA 1C1SA 1GI5A 2QC2A 4JZIA 3UNRA 4CR5A 2EEKA 1P2IA 2Q6GA 4CRCA 3DA9B 2Z7FE 1IQFA 1GI1A 1V2PT 3PTNA 1MTNB 5FPYA 1NROH 1VZQH 1P9UA 4A1TA 4FUBA 1C5QA 1O3NA 4NA9H 4R8TB 4HGCA 5G4BA 3ELAH 4FUIA 1CU1A 2JH0D 3I78A 2WPIS 3U98H 1O2MA 2ZI2H 1C2DA 3LGYA 4GHQA 1BMMH 1O3OA 2YNBA 3BV9B 1ELDE 4BAQB 4E7RG 1HCGA 3UNSA 3SV7A 1GI2A 3ZVDA 2SNVA 1IOEA 2D26C 1Z8RA 1AO5A 1F2SE 3BTDE 2CF9H 5TCAA 4H4FA 2XCFA 1A61H 3RXOA 3F1SB 5GCHF 2F9NA 5GPIB 2Z6BD 5HYOA 3F6UH 1O38A 5EODA 3E3TA 1O2VA 1DSUA 1MKXH 1GHYH 3F9EA 1YBWA 4MPUA 1Y3UA 3MU0A 1C2IA 2GVFA 1XKAC 4O9VA 1BOQA 1ELTA 4MLFB 3A82A 2XC4A 4X1NU 1A5IA 4VGCB 1D3PB 1MMJN 1S81A 3QTVH 3MH7A 3NZIA 4DJZB 1QIXB 4AB9A 2FYRA 3ATLA 1F0UA 4ABFA 2OBQA 3URDA 1J9CH 1EQ9A 1EAIA 2BY9X 2VGCB 1B0FA 1O5DH 3MYWA 4NZLA 2FXRA 1GI8B 2ZDMA 2JH6D 3SNCA 1N8OB 1BZXE 1EAUA 1HB0B 1U6QA 1W0ZU 3PLKA 5EQSA 4BNRA 1KY9A 1GBMA 1E34B 2J95A 2A45B 1EPTA 3RXIA 4IW4E 4CH2B 2BY7X 3SV8A 3QGNB 3LDXH 1HJ8A 1G2MA 1GJ7B 1FMGA 4H6SB 1P12E 2B0FA 4PROA 3TU7H 5JBCS 2SGEE 4X8UH 4YOJA 1WUNH 4A7IB 4IS5A 3A7WA 4CRFA 2JETC 3ZYDA 1GJCB 3SHCH 4TPIZ 3UOUA 4CR9A 2G8TA 2FLBH 5FPSA 3SGBE 3F9FA 1ZSJA 1XVMA 3S9AA 4NA8A 4BAMB 5GCHG 2XRCA 5LGOA 1TA2A 3FP7E 1AMHA 4KELA 1AVWA 1NT1A 1TGSZ 2ZWLH 1E0FD 2ZPSA 1KTTB 3KGPA 2FI5E 1EASA 4BTIB 7LPRA 2ZECA 2F83A 1SBWA 1BT7A 1C2FA 1AB9B 5EQQA 2QXIA 3ZVEA 3BTHE 4FUEA 1UHBA 1W3CA 3TIUA 2FOBA 2ANWA 3TNSA 4B2AA 3RMLH 5F8XA 1EZSC 1TNKA 3GYMA 1SFIA 1CA8B 4X0WU 4NWKA 3I77A 2GCTB 1NPMA 1Y5UT 1FPCH 5A8XA 3GDUA 3UWIA 3L33A 4X2XA 3SBKA 3OSYA 1JMOH 3Q3KA 3K6YA 1EP5A 3EGKH 1TABE 2BLOA 2HNTC 4ZAEA 1HAZB 2O8MA 1O3PB 2V35A 1TAWA 1QRZA 3E16B 3PV4A 3SQEE 1K9OE 2EC9H 4GAWA 1W7XH 5A0AE 4MTBA 1SLUB 1C1RA 2QF3A 4LZ1H 3MI4A 3RXHA 1TIOA 4E05H 2GDDA 1OKXA 1MKWH 2FTLE 2H5DA 3SU6A 1SGPE 5E2OA 1W0YH 2EI7A 2A7CA 1RIWC 2BYAX 1YPKH 1J16A 2AIQA 4DY7B 1C5TA 4Y8YA 1SGEE 4B2BA 3TJVA 1O37A 3IITA 1NS3A 1GI4A 4ASHA 3M7TA 4Y6DA 1DY8A 1TNJA 3M5NA 3TPIZ 4BANB 1H8DH 2TGPZ 4F49A 1G3BA 3MNXA 3PYHA 1KXBA 8ESTE 1BTUA 3RXSA 4HI3A 3CENA 1V2MT 2ZNKH 4INKA 1O2KA 1BTXA 1NTPA 2BXUH 4K2YA 1MBQA 2VINA 1LQDB 1CA0B 2BOHB 2EA3A 4XBCA 3DFJA 4IC6A 2FI3E 4AYVB 1T31A 2V6NA 3VEQB 1GBTA 5FCRA 2F9BH 1B0EA 3UWJH 1FAXA 2ZKSA 3SN8A 4LZ4B 1TGNA 1GMDF 2PUXB 3QZRA 1NRNH 3O8RA 3DD2H 4UE7H 1C2EA 2FEQH 1KTSB 4NIYA 4ZXXH 2O9QA 1KLTA 1V3XA 1WTGH 1LHGH 3D62A 1YKTA 3LGUA 2V3OH 1YPLH 1Y3XA 1QB1A 2WPLS 4UFFH 2FYQA 3H5CB 1AI8H 1GJBB 2GP9B 1C2MA 3BTKE 2Y82A 3SU4A 1Y8TA 3BTTE 1MTWA 2AGEX 4D7FA 1S5SA 2A4QA 1HXEH 1H9HE 2QA9E 1OP0A 4FUCA 3M5LA 3I29A 3A88A 1RRKA 1O3LA 2UUYA 2P8OB 3FZZA 4AFQA 1BMLA 1DFPA 3TGKE 1NY22 4FUJA 2OC8A 2ZQ2A 1A4WH 2R3UA 3MU8A 3LJOA 5ESBA 1BQYA 1IHSH 5GDSH 1VCQA 3JZ1B 2LPRA 4D7GA 2OCVB 1OSSA 1QFKH 1YLCA 3SNBA 8LPRA 2BD2A 1Z6EA 1Q2WA 1YPJH 3BTQE 1O3AA 1EOJA 4JCNA 2CHAB 3GY3A 1KYNA 1SGQE 3CS7A 1GHVH 3MTYA 4MNVA 2UUFB 1ELVA 4ABJA 5IDKA 1N6XA 1EPTC 3LH3A 1ELFA 2ZFFH 3KL6A 1P02A 1SC8U 3GY5A 3PLPA 3R3GB 2J2UA 1C5YB 2WV5A 1BA8B 5C20A 3QDZB 3UR9A 1T32A 1SOZA 1SGYE 3SJ9A 4AX9H 5TCCA 1LO6A 1SG8B 2BD5A 2BD9A 4X6PA 3MO3A 1FY4A 2GD4B 1Y59T 3K2UA 2A0QB 1QA7A 2AEIH 4Y0YE 1FNIA 4QT8C 1CQQA 1H4WA 1HIAA 1AGJA 4Y7BA 1WQVH 1RTLA 1T8OA 1O2QA 1AIXH 2G52A 4XDEA 1FUJA 1TGBA 1A3BH 1BB0B 2OC0A 1HAPH 1EOLA 3A8AA 1O2RA 1BHXB 1PQ5A 1TALA 4GUXA 2PTCE 5EW2H 2VH0A 7ESTE 3B8JA 1ZR0A 1GBFA 2BZ6H 3ZZ3A 4D76A 1A5HA 4O3UA 1W7GH 3SI4H 1PPCE 2BY6X 1C1WH 7GCHF 3HATH 1SGIB 1MAYA 3BN9A 2VH6A 3P17H 5LPRA 1SHHB 3P8FA 1GG6C 2ZU4A 4X2VA 4R0IA 1DE7H 4YT6H 4NSVA 2K1QA 1ANEA 3A80A 2ZU2A 1QCPA 4AG2A 1DLEA 2SGFE 3PO1C 2FPZA 1C1OA 2Y5HA 1MTUA 2TPIZ 3LU9B 1RGQA 3GCOA 3VXEH 1SI5H 3M61U 1NRRH 5TJXA 1GBIA 1GJ6A 1TBZH 1HGTH 2FOAA 3PLBA 1GPZA 1ETSH 1LPZB 3QK1A 4BTUB 2W7UA 1ZTJA 3AW1A 1ZGVA 1C1MA 1LHEH 1FV9A 1UTPA 1AN1E 2FOHA 2ZHWH 3M3SA 3EDXB 1IHTH 2FI4E 4MPWA 1IQJA 5EW1H 3NUMA 2ZGHA 2AS9A 3HK6B 1EAXA 4NIXA 3E0NB 1QB6A 4WH8A 1T8NA 3GCTF 1SLXB 2H9HA 1O30A 1C5VA 4K3JA 3MMGA 2BY5X 3VB3A 1ARBA 3GY8A 4HTCH 5JBBS 1K2I1 5JPMH 3CS0A 1UVPA 3U8TH 1L0ZA 2P93A 2VB0A 1Z8GA 3SV9A 4O03A 2ALPA 2HGTH 3FAOA 4CH8B 4BOHA 3LT3A 1XX9A 4AOQA 1CBWC 3MO6A 1W14U 1NM6A 2PGBB 3A7TA 1HAVA 1PPBH 1EZXC 1BJVA 1C5XB 1VCPA 2V0BA 2O8LA 3P8OA 3M5MA 2SGDE 4ZH8A 1O5GH 3W94A 9ESTA 1PPHE 3LC3A 1HJAC 1SSXA 1QJ1B 1O2NA 1FY5A 1K1JA 1HAXB 1BTHH 1P2QA 4THNH 5AFYH 1FY1A 2VWOA 2Z9LA 4B71A 5GIBA 5DP5A 2C4FH 1BDAA 2A2XH 2ZU3A 5EU8A 1O3JA 1C1NA 4YOIA 2PSXA 2VU8E 2Q6FA 1C4U2 3NXPA 1SOTA 2A31A 3SZNA 3UUZA 1QGFA 4Y71A 5E2PA 3OX7U 4WMFA 1ARCA 3RXGA 1EX3A 5E8EH 1DLKB 3UIRA 1V2UT 4X8VH 1KLIH 1T7CA 4WJG2 1V2RT 3BTWE 2CF8H 3ZYEA 1DS2E 4K5ZA 1AY6H 2RDLA 1NFXA 4Y7AA 5T3HA 1GMCF 2ILNA 3TK6A 2Y7XA 2BLQA 1YPEH 2GMTB 1MCTA 1GBHA 1K1IA 4GLYA 1MU8B 2Z9JA 1TGTA 3RLYH 4X8TH 1QL7A 2ZO3H 1LMWB 2CXVA 3Q77A 2GGVB 3ZZDA 1EB1H 1DUAA 1O33A 1C9TA 3FFGA 1Y3YA 3GYLB 1GBKA 1UO6A 3KQCA 4WWYA 1O2SA 2QXJA 1GCTC 2QGRA 1E38B 1O3BA 5T6DA 5BPEA 1UVOA 1K28D 2TGDA 3HGNA 1WAYB 2WPHS 2XBYA 3FP6E 2A5KA 2Y7ZA 4WMEA 2SGQE 4ISIH 1GI3A 1PFXC 1O5FH 4OS1A 3ZZCA 1O0DH 4TY6A 2G00A 3T28A 1D6WA 1SQAA 2ANKH 1OOKB 2PR3A 4SGBE 4YM9A 3SO3A 1WOFA 2G55A 3TITA 1KXCA 2DE8A 1P2MA 1Y3VA 1TNLA 1LKAA 1MAXA 1NU9A 1TOMH 2TRMA 1ELBA 1KDQA 5AF9H 3C27B 2C8WB 1OYQA 4GSOA 1O2OA 2F9VA 1O3FA 5JDUB 3KNXA 3TK5A 1IQHA 5DP8A 4H42U 2I6SA 2UWPA 2FOCA 3S7HB 5A8YA 4KKDA 4FU7A 1MD7A 2GKVE 1GHWH 4NG9H 2CGAA 1ZLRA 4HZHA 3GOVB 1GMCG 2PSYA 2BVSH 2Z3EA 1IQNA 2ZQ1A 1T4VH 3BG4B 5F8ZA 3SNEA 2XBVA 3HKIB 5E0JA 3QGJA 3MFJA 1S84A 1WYKA 1DPOA 3RU4D 2NU2E 1J15A 1W11U 1W8BH 2VWLA 5L30H 4BAKB 3AAVA 3UREA 3PM3A 4KTSA 3M7QA 2ZG0H 1THRH 2GV7A 1WSSH 3PMAB 1QBNA 1KXEA 2WPKS 1GBLA 3A7YA 3SUGA 3GY6A 1Y5AT 2FP7B 1V2WT 4ABGA 5E0HA 2HWLB 1AFQC 2C3SA 3TGJE 1S6HA 3LONA 3DUXH 2BLWA 1KDQB 3Q76A 2ZCHP 1L1NA 4HFPB 1ELGA 3A8CA 3B9FH 4X1SU 1XKBC 2BDCA 3RXLA 2BM2A 1GVKB 3SW2B 4ABEA 4MNXA 4J1YA 5EXMA 2WPJS 5FPTA 1F5LA 2ZIQH 2GZ8A 1ZRKA 1C5PA 2R0LA 3FVFB 4JYUH 5F03A 2P59A 3P70B 1G30B 4BXSA 1V2NT 2JKHA 4NIVA 5HMAA 1G37A 4K1TA 4UFGH 1MH0A 1AUJA 1MKXK 2Z94A 4K8YA 2B8OH 4YT7H 1GL0E 5EPYA 1TYNA 1E36B 2FDAA 4Q7ZA 3L3TA 5B6OA 1E37B 2XC5A 1B7XB 1C5RA 1SMFE 2A4RA 2XC0A 1GGDC 1PPGE 4O3TA 2G51A 2M5TA 1LPKB 1FY3A 4B75A 3QZQA 1GVZA 4DOQA 4Z0KA 4AYYB 1NC6A 1K22H 1J14A 1NRPH 4X6OA 3TJUA 1GBDA 2BX3A 2STBE 2W3KA 4I32A 1JRTA 2Y6TA 4MPXA 1FXYA 1RD3B 1RTFB 1P11E 2Y80A 3IG6B 2Y5GA 1HAIH 3TJOA 2BVXH 1FDPA 3V12A 3MH4A 1NRQH 4CBNA 3PMJA 3TH2H 3PMBB 1CGHA 1XXDA 4E7NA 4CRAA 3E8LA 4JYTA 1WBGB 5L2YH 3A87A 3SJOA 1BBRH 2P3TB 1K21H 2A2QH 2BVRH 1CHOG 2H2ZA 2ZPQA 3SI3H 2BQWB 1YM0A 1TGCA 3UNQA 2IN2A 4MNWA 4ISHH 1VGCB 2PTNA 3RM2H 1CGIE 1O32A 2STAE 2PKAB 3GISB 4K8BA 5E0GA 2HOBA 1MTNC 3V7TA 1SLVB 3A7ZA 2G4UA 1K1LA 1L4ZA 3LOXA 3NCLA 1KLJH 1DWCH 1HBTH 1HNEE 2D8WA 3T5FH 1IQEA 2BHGA 4UDWH 4FUHA 4BAHB 1OP2A 1PPEE 1UK3A 1S82A 2VIPA 2C8YB 4B2CA 1JOUB 3D23A 4JZEH 3U8RH 1PYTC 3UOPA 5C5NA 3SJIA 1OP8A 3QTOH 3VGCB 1ESBA 2ZF0H 2R2MB 1H1BA 4ZMAH 1CT2E 3BSQA 1ABJH 1L1JA 1LDTT 1RJXB 2C90B 5SGAE 4DIIH 1XM1A 1BBRK 2ODPA 1O2LA 5CHAC 1MUEB 2GDEH 1TPOA 2FOGA 3MH6A 4NSYA 1ESAA 1GJDB 1MZDA 2BB4A 1UCYH 2BDYA 1ZPCA 1JWTA 1O3MA 1C4V2 1PQAA 1HJ9A 3HPTB 1Z6JH 4MPVA 2SGAA 1ANBA 1D3DB 1FN6A 3LH1A 2D1JA 3M5OA 4SGAE 4TWWA 3BTGE 3VXFH 1AQ7A 1MKWK 4Y79A 1P0SH 5HGGA 1NZQH 4ZKNU 1C5ZB 1ZOMA 3LGWA 1DWBH 1G2LA 4I33A 4YOGA 1N6YA 5EXLA 2GT7A 2BMGB 1N8OC 3LC5A 1BTPA 2AMDA 2ZDNA 2HPPH 2OD3B 3RU4E 4FUGA 4XFQA 3LKWA 5DP9A 1YPHE 4X6MA 5AVDA 4K69A 3H7TA 1OWIA 2ZHFH 4IN2A 4IGDA 1O2GH 3M3TA 3RXMA 2XBXA 2Z9GA 2A7JA 1QL8A 1V2OT 3K6ZA 2ZGCA 3LJJA 1Y5BT 1ZHRA 1UCYK 3SUDA 3RXTA 1HFDA 1ACBE 5DK1A 3WY8A 2XWBI 3ZZ6A 2A4OA 1DOJA 4AGJA 3T26A 1JXPA 3SU2A 2RCEA 1F92A 4B73A 2BTCE 2UWLA 4TPYA 4UD9H 2ZP0H 3STIA 1J17T 1QB9A 4NZQA 1NFWA 4YZUA 5JB8S 1ORFA 1CO7E 1O2JA 4OGYA 5I25A 2ZFQH 2C8ZB 1A1RA 1J8AA 1FQ3A 4CRGA 4AGKA 1QA0A 4RKJB 1CBWB 3MU1A 4JYVH 3MH5A 3SV6A 3BEUA 2ZTZA 2CJIA 3ZZ5A 5EPNA 2IPHA 1HAOH 3RXKA 2NU4E 4GCHF 2FOEA 1DY9A 4XE4A 1TBRH 1SPJA 3KQEA 5FX5A 3RXPA 1XUJA 2PHBA 2OC7A 3ODDA 1HJAB 1A5GH 2PKSB 4JZDH 7KMEH 5DP7A 2QV1A 2V3HH 3RDZA 1C5WB 1V2KT 1TMTH 2YNAA 4I8KA 3E90B 3UR6A 3LIWA 2ZZUH 5CMXH 2OQUA 3PB1E 1O2HA 1P2OA 3ATMA 4Q2KA 1FN8A 2UUJB 5C2ZA 2BLVA 2WUBA 1WCZA 2BOKA 2GZ7A 2FWWA 3A89A 2BDHA 1IAUA 3OTJE 5HM9A 3UQVA 4I7YH 2BY8X 1BBRE 2BDBA 1O2YA 3ODFA 4I31A 2O8WA 1FPHH 4UFDH 2ZPRA 2ANMH 1JIRA 3M35A 4Y8XA 3E91A 1PQ8A 2TIOA 1EJAA 1ESTA 3LGIA 2DE9A 1GJAB 1SHYA 1C1TA 4YO9A 3ATIA 1UJ1A 2QF0A 4NFEA 4WMDA 3D65E 4A5TS 1DM4B 1GBEA 2Y5FA 3MO9A 2A7HA 4A6LA 1FONA 3TJNA 2JH5D 1GJ8B 2TGAA 3T62A 3RUOA 1TE0A 2A4GA 1UK2A 1X7AC 2HVXA 4RKOB 1A0LA 1O2IA 2XTTB 2RA3A 3T25A 2ZHEH 5A8ZA 3MHWU 1P2JA 3TVJB 1TNHA 2AYWA 4GCHG 4O97A 4X2WA 4WH6A 3VB4A 5LPFA 1P03A 5T6FA 1C9PA 4Q7YA 1YYY1 3CP7A 4H6TA 6LPRA 1EKBB 1MQ5A 2AMPA 3ZVGA 2OP9A 2H6MA 4WF8A 1BMNH 3BEIB 5GJ4B 3MU4A 3KQDA 4FXGH 3A81A 2B5TB 1CA0C 3K65B 1MZAA 1TLDA 1THSH 4YTAA 1UCYE 2QYIA 1SGDE 4ZKOU 1OWHA 1P3EA 5DJ7A 3SGAE 2H9TH 4K1SA 3EE0B 4IC5A 1XUKA 3SU1A 4XSKU 2WINI 1ZYOA 3E0PB 5EGMA 4DVAU 1ZMNA 2H5CA 3RXRA 3VB5A 2HPQH 1AFEH 2QCYA 1YGCH 1NU7B 3QUMP 1VITH 1O5CB 3KF2A 1DVAH 2Y81A 3RXAA 1G3DA 2FODA 2ULLA 4OS4A 2VWMA 6GCHG 2ZDAH 3RC5A 1BRAA 2ZGBH 1UVTH 1OYTH 3F9HA 4NA7A 1ZHPA 1MCVA 3GY4A 1QBOA 3QLPH 2XYAA 3P8NA 3GICB 2P8OC 2H1UA 2ZDLA 2FS9A 1XUFA 2QIQA 5DG6A 3LPRA 3KEEA 1TQ7B 4ZKRU 3TH3H 3ZZAA 1O5EH 3O8CA 4AFSA 2BDAA 5DP3A 1HRTH 4U30A 1BRBE 1QJ6B 1QNJA 1MD8A 1BHXF 1A0JA 1Z7KA 2OUAA 1OPHB 1TRYA 1VR1H 1AFQB 3RP2A 1GBCA 4M7GA 3A84A 2BQ7B 1Z8JB 5ABWA 2WV4A 3ZVAA 2J9NA 2W3IA 1CSOE 3U9AH 3T2NA 1VJ9U 1UTJA 2A5IA 1F0RA 4XBBA 1A3EH 5DGJA 1V2ST 4NCYA 4X6NA 4JK5A 1EJNA 1O3IA 1TONA 2Z9KA 1UTKA 1ELAA 2O8TA 3LGTA 3T29A 3M3VA 2BXTH 1S6FA 2A5AA 3NK8A 4UEHH 1AE5A 3KN2A 5DO4H 1GJ9B 2KAIB 5DKMA 1C4Y2 2FO9A 1EJMA 1ZRBA 1Z1IA 1TPPA 3SUEA 2UUKB 1G9IE 3UFAA 1P04A 3A85A 3JZ2B 3SU5A 9LPRA 2JETB 2OQ5A 4AG1A 1W12U 1EATA 2ALVA 2W26A 2ZDKA 4GHTA 3Q3XA 2GCHF 1GDQA 3W95A 2XCNA 5F8TA 4D9RA 1GVLA 6CHAC 4ABBA 4ZHMU 1SB1H 1XXFA 2BDIA 2VIQA 4D8NA 2ANYA 1CT0E 2BZAA 1P9SA 1D3TB 4ABIA 1YCPH 2J4IA 5ETXA 3N7OA 1LVMA 2IOTA 1O2PA 2PWXA 3NKKA 1C2JA 1TWXB 1HDTH 2NU1E 1FJSA 4DT7B 3EA8A 3SV2H 2F9PA 1AKSB 3K9XB 2NU3E 5A09A 1AZ8A 1ETRH 3TNTA 1GHXH 1GI0A 5AHGH 1LHFH 3RXEA 1ZJKA 1QRXA 1P05A 1NN6A 1IQGA 1RTKA 1Z71A 2DUCA 1SGCA 2HNTE 2BD3A 3SHAH 1INCA 4D9QA 1AD8H 2SNWA 5FCKA 2SGPE 1NFYA 1TRMA 3RC6A 3FP8E 3OYPA 2O8UA 3O8BA 2AIPA 1O2TA 1SGNE 2BDGA 2FLRH 4ZXYH 2SFAA 3E1XB 3EAJA 4DCDA 4WVPE 3D49H 1YCPK 3L6PA 3IWMA 4A1VA 2BD4A 4Y11E 3NWUA 4I8GA 1O31A 1P2KA 1O34A 2Z3DA 1RXPA 1PPFE 5JB9S 2FOMB 2ASUB 2VWNA 1GWAA 4U2WA 1ID5H 1JBUH 3RMOH 5JYIA 2GCHG 1HV7A 3SORA 1BUIA 1EAWA 4U01A 2OTVA 4U32A 4Y10E 1SLWB 3BG8A 4MVNA 1RIWB 3U1IB 1ZPZA 5C67A 1BRUP 1F7ZA 1T4UH 1TMUH 3MOCA 5FAHA 1AWHB 1TPSA 1C5LH 3MWIU 3U69H 1CT4E 2OXSA 2VIWA 2Q1JA 1QBVH 1LVYA 1TX6A 5CHAB 1O3DA 2EI8A 3G01A 4LOYH 5FX6A 1V2VT 2FM2A 5J4SA 1FY8E 1QURH 3PMHB 1BJUA 1EB2A 1LHDH 1KXFA 3B23B 1ZJDA 1QTFA 1O2UA 4CBOA 1C5MD 2OINA 4IMZA 4DURA 1UTOA 1UMAH 4X2YA 3PWBA 2QXHA 1SGFA 2R9PA 3ZZ9A 1MBMA 3A86A 4CHAC 4X1PU 1CHOF 1KIGH 1P06A 4IBLH 2Z9IA 8GCHF 1IQKA 2FIRH 4JZ1A 4WY3A 1ZSKA 2ODYB 5EG4A 1UVSH 1ZPBA 3KIDU 4YESB 1HXFH 4Q80A 3URCA 1AU8A 2OLGA 3LGVA 4NFFA 3TGIE 4ZHLU 2Z3CA 1P10A 1UTQA 1A0HB 2F3CE 3A7VA 1TX7A 3M7UA 1UTNA 2CV3A 3SJKA 4ABDA 3U1JB 3F9GA 1UVUH 4MG3A 2GMTC 4YLQH 1W13U 2PKAA 5I46H 5F6MA 4DG4A 2B7DH 2ODQA 1GI9B 1C1VH 2ZHDA 3PROA 4XOJA 1Z8IB 2EI6A 4F4OC 3VB6A 1FI8A 1TNGA 2HNTF 3KQBA 1E35B 5JBTA 2FZZA 4XBDA 2C8XB 2P95A 3ATWA 3OY5U 3RU4T 1W10U 3GCHC 4KTUA 1QJ7B 2FTMA 3SUFA 1EXFA 1YLDA 1IQIA 1F0TA 1C2HA 3BTFE 2P3FH 3SOSA 1VJAU 4FUDA 4ZROA 3OY6U 1FIWA 5L6NH 4A92A 1LPGB 1G3EA 4K60A 1Z1JA 1BTYA 3HK3B 2IJOB 1C1QA 2F9UA 5JBAS 8GCHG 2HLCA 3KCGH 1AZZA 1EPTB 3HKJB 5EOKA 5FHTA 3MNBA 2QN5T 5L2ZH 1VITF 5DPAA 1F5KU 3ZVBA 1F5RA 1AVXA 2W5EA 3Q3YA 4FVDA 1BCUH 2AFQB 1KXDA 3SNDA 2FESH 2ZU5A 3A8DA 3RXCA 1AWFH 3PTBA 2H9EH 3S9BA 3BG4C 4I8HA 1TRNA 3E6PH 4ZKSU 2OBOA 1TPAE 1ELEE 3TK9A 1SL3A 3ENSB 2ZFPH 3H7OA 3U8OH 1ZGIA 2C93B 2CMYA 1D9IA 1LQEA 2AERH 2RG3A 1L2EA 4B1TA 4ESTE 1AHTH 4ABAA 2QY0B 5J4QA 1ZZZA 1UHBB 1HAYB 1SGTA 2R3YA 2W7SA 5GXPA 1A7SA 2FOFA 3ZZ8A 1K1MA 1QQ4A 1BRCE 1P2NA 2AGIX 1P09A 3ATKA 1XMNB 1GG6B 1YF4A 2ZFSA 1C5SA 1QY6A 1CHGA 4OGXA 4VGCC 2AGGX 1BITA 4OS6A 3PO1B 3BF6H 2XXLA 2GX4A 1DITH 1G36A 1L1GA 2VJ1A 4FUFA 2VGCC 4Z6AH 2J38A 4NGAH 2GV6A 5EQRA 5BRRE 1S0QA 1YCPM 3RXBA 1WQSA 3P6ZB 2QAAA 1O5AB 3ZZBA 5DP6A 3EQ0H 3P95A 1OWDA 1BTWA 3NPSA 3V3MA 3GDSA 1ETTH 1SQOA 1T8MA 1VITG 1V2JT 3SGQE 3AW0A 1FAKH 1GL1A 1P01A 1M9UA 3PWCA 3HGPA 2ZDVH 1LHCH 2CN0H 1XUIA 3BIVH 4X1QU 3SNAA 1V2LT 1FZZA 2AMQA 2BD7A 1V6DA 3MNSA 1O3HA 1GDUA 3S7KB 4ZUHA 3RMMH 1C5OH 1V2TT 2FX4A 1TB6H 1ZHMA 1K1NA 2VIVA 3DFLA 3TH4H 2P3UB 1PQ7A 1QL9A 2G5NA 3ZVFA 5LPEA 3BIUH 2NWNA 4KTCA 1OS8A 3A83A 1GJ4H 3GDVA 1DSTA 4FU8A 1ZTLA 4Y0ZE 3STJA 1GBBA 1HYLA 4AORA 4RSPA 1AB9C 2VVCA 1TBQH 3C1KA 1VCWA 1GHBF 2J94A 3EA9A 3VB7A 5GWZA 5K0HA 1QRWA 4DW2U 5C5OA 5C1UA 4X8SH 4Q7XA 3AVZA 1TFXA 5DP4A 3ZZ4A 2AH4X 1TNIA 1SGFG 2GCTC 2XBWA 1IQMA 3SJ8A 2LNCA 2VVVA 4IN1A 1DXPA 1UTLM 4GPGA 5FBEA 5C3NA 5A0BA 4K1EA 5K7RA 1MQ6A 1TQ0B 3GY7A 2ZC9H 4ISOA 1G32B 1S85A 3RXQA 1N1LA 1ZMJA 1VGCC 2A32A 5EXNA 3QX5H 1RFNA 2PGQB 2PW8H 1GMDG 4X1RU 4AN7A 3MNCA 1CGJE 3MU5A 1P57B 2G81E 1EP6A 1O2XA 1K1PA 1UTMA 2NU0E 3TLOA 1Q31A 2UWOA 3DHKH 2VIOA 5CE1A 4ZHAA 1NESE 2ZTXA 4DIHH 1XUHA 6GCHF 2F9OA 4ISNA 3RXJA 1GCDA 8KME2 3RXFA 1THPB 1O3GA 4KGAA 2THFB 5T6GA 2WUCA 3BTME 3VGCC 1GMHF 1HPGA 1O3EA 1AVGH 1DANH 5AFZH 2ZCKP 2ZFRH 1JRSA 1PYTD 6CHAB 3ZZ7A 1GCTB 3ITIA 2A1DB 1KSNA 1A2CH 3VPKA 3FZDA 2FMJA 1LTOA 4I8JA 1D6RA 4B74A 1EZUC 1GHBG 1SVPA 1TX8A 2WYGA 2OC1A 1NFUA 4RN6A 4ABHA 1L4DA 1DDJA 3GCNA 1ANDA 4TY7A 1O2WA 3AAUA 4GVUA 5PTPA 4I8LA
chains in the Genus database with same CATH superfamily
5H4IB 4B76A 1GHAF 1XVOA 4BTTB 4NWLA 3Q00A 3O8DA 4WXIA 3RC4A 2XW9A 2VIDA 4BAOB 1C1PA 4OS5A 1D4PB 4YLUA 2WPMS 3UY9A 2BD8A 4CRDA 2ZTYA 3V13A 4J2YB 1O35A 2HALA 4CREA 1O5BB 1HIAB 1K1OA 4E06H 5IYTA 1SQTA 2GT8A 1S0RA 5A2MH 3S9CA 1TOCB 2I6QA 3DCLA 4LK4A 3T27A 2QXGA 4TWYA 1O3KA 2XNIA 4FU9A 1FLEE 1DWDH 1RS0A 1NO9H 2ESTE 2PUQH 1W2KH 1DX5M 5LH8A 1BMAA 1GBAA 1A46H 1YPHC 2F91A 4MNYA 1C2KA 4JZFH 1YP9A 1MU6B 1T8LA 1IQLA 1MTSA 1GI7B 1ZSLA 2GTBA 2KAIA 1GMHG 3KYFA 1GBJA 2LELA 1DICA 4Y8ZA 1G3CA 1DUEA 4AZ2B 3EYDA 4OS2A 1CVWH 1MTVA 1OWJA 5A0CA 1ZMLA 4AFZA 2FS8A 3FANA 3UB0A 2FX6A 1SR5C 1WTHD 3AASA 1HAHH 3F68H 4P02A 2ZA5A 1O3CA 1ZTKA 1PPZA 4JK6A 4MQAA 2HVYB 1XUGA 5CDFE 1HUTH 1SFQB 1GDNA 5FXLA 3OU0A 1YPMH 7GCHG 3S69A 1BIOA 1LCYA 2D2DA 4DT4A 2WV9A 4CRBA 1FIZA 4INLA 5ESTE 4IMQA 1KXAA 1F0SA 1OWEA 2R0KA 1DT2A 1OWKA 2P94A 5C1XA 1SGRE 1ELCA 4FVBA 1K0HA 2CHAC 3RMNH 4AFUA 1GHAG 5KECA 2PV9B 1EUFA 1TA6A 2PKSC 3GY2A 1C5NH 3P92A 3S0NA 2ZFTA 1TMBH 1O36A 4AB8A 2TGTA 1KMHB 2ZGJA 5C1YA 1AKSA 1PJPA 3A8BA 2VVUA 5FL7D 2WYJA 1BTZA 1O39A 2RA0A 1WV7H 1LVBA 1O2ZA 2XWAA 4CHAB 1GJ5H 2TBSA 1Y3WA 1P8VC 1SQRA 3RXUA 3UPEA 1HLTH 2ZGXH 3UTUH 1V2QT 3F0PA 1CE5A 1WU1A 3ZVCA 3FN8A 1GI6A 3SU0A 3V0XA 2ZCLP 1QHRB 1UK4A 2KX4A 3A7XA 4INHA 3BEFB 4ISLA 3GCTG 1OX1A 2BX4A 4UFEH 1H8HD 3M36A 1C1UH 1EZQA 2ZU1A 3R0FA 1B5GH 1ANCA 3VFEA 1HAVB 3RLWH 1YC0A 2Q6DA 3QN7A 2G5VA 1AE8H 1YPGH 3QWCH 1H9LB 4WXVA 1H8IH 4YXWD 2GZ9A 2J34A 4KP0A 1GGDB 5HM2A 3RXDA 1Q3XA 1LVOA 1P3CA 1OXGA 1QQUA 1LKBA 3NRLA 2ZEBA 4UONA 1C5UA 2QE7D 3QO6A 1DWEH 3BTEE 3RM0H 3SQHE 2YOLA 3RXVA 1H9IE 3M37A 1NRSH 5C17A 3P8GA 4LXBH 4OS7A 5HXFA 1GHZA 2G4TA 2J92A 3ESTA 2PLXA 4MDSA 3ZV9A 3UQOA 3GCHB 1QR3E 2BQ6B 2PFEA 1ABIH 5FBIA 2L6OA 3OAAD 1C2GA 3DT0H 4A1XA 4BXWA 2B9LA 3SU3A 2YMSD 3ZV8A 1S83A 2VNTA 3EA7A 1HAGE 1JIMA 2R2WU 4JMYA 2P16A 4NIWA 2HRVA 4DGJA 4TYDA 1VKYA 4Y76A 3KHVA 2ZHQH 1DXWA 1AUTC 1C2LA 1D3QB 6ESTA 1C1SA 1GI5A 2QC2A 4JZIA 3OEHD 3UNRA 4CR5A 2EEKA 1P2IA 2Q6GA 1YLNA 1MABB 4CRCA 3DA9B 2Z7FE 1IQFA 1GI1A 1V2PT 3PTNA 1MTNB 5FPYA 3VG8A 1NROH 1VZQH 1P9UA 4A1TA 4FUBA 4TSFD 1C5QA 1O3NA 4NA9H 4R8TB 4HGCA 5G4BA 3ELAH 4FUIA 1CU1A 2JH0D 3I78A 2WPIS 3U98H 1O2MA 2ZI2H 1C2DA 3LGYA 4GHQA 1BMMH 1O3OA 2YNBA 3BV9B 1ELDE 4BAQB 4E7RG 1HCGA 3UNSA 3SV7A 1GI2A 3ZVDA 2SNVA 1IOEA 2D26C 1Z8RA 1AO5A 1F2SE 3F3BA 3BTDE 2CF9H 5TCAA 4H4FA 2XCFA 1A61H 3DSPA 3RXOA 3F1SB 5GCHF 2F9NA 5GPIB 2Z6BD 5HYOA 3F6UH 1O38A 5EODA 3E3TA 1O2VA 1DSUA 1MKXH 1GHYH 3F9EA 1YBWA 4MPUA 1Y3UA 3MU0A 1C2IA 2GVFA 1XKAC 4O9VA 1BOQA 1ELTA 4MLFB 3A82A 2XC4A 4X1NU 1A5IA 4VGCB 1D3PB 1MMJN 1S81A 3QTVH 3MH7A 3NZIA 4DJZB 1QIXB 4AB9A 2FYRA 3ATLA 1F0UA 1E1RD 4ABFA 2OBQA 3URDA 1J9CH 1EQ9A 4RT1A 1EAIA 2BY9X 2VGCB 1B0FA 1O5DH 3MYWA 4NZLA 2FXRA 1GI8B 2ZDMA 2JH6D 3SNCA 1N8OB 5EJ1A 1BZXE 1EAUA 1HB0B 1U6QA 1W0ZU 3PLKA 5EQSA 4BNRA 1KY9A 1GBMA 1E34B 2J95A 2A45B 1EPTA 3RXIA 4IW4E 4CH2B 2BY7X 3SV8A 3QGNB 3LDXH 1HJ8A 4Q63A 1G2MA 1GJ7B 1FMGA 4H6SB 1P12E 2B0FA 4PROA 3TU7H 5JBCS 2SGEE 4X8UH 1E79D 4YOJA 1WUNH 4A7IB 4IS5A 3A7WA 4CRFA 2JETC 3ZYDA 1OHHD 1GJCB 3SHCH 4TPIZ 3UOUA 4CR9A 2G8TA 2FLBH 4B6FA 5FPSA 3H09A 3SGBE 3F9FA 1ZSJA 1XVMA 3S9AA 4NA8A 4BAMB 5GCHG 2XRCA 5LGOA 1TA2A 3FP7E 1AMHA 4KELA 1AVWA 1NT1A 1TGSZ 2ZWLH 1E0FD 2ZPSA 1KTTB 1W0KD 4F55A 3KGPA 2FI5E 1EASA 4BTIB 7LPRA 2ZECA 2F83A 1SBWA 1BT7A 1C2FA 1AB9B 5EQQA 2QXIA 3ZVEA 3BTHE 2F4LA 4FUEA 1UHBA 1W3CA 3TIUA 2FOBA 3GS9A 2ANWA 3TNSA 4B2AA 3RMLH 5F8XA 1EZSC 1TNKA 3GYMA 1SFIA 1CA8B 4X0WU 4NWKA 3I77A 2GCTB 1NPMA 1Y5UT 1FPCH 5A8XA 3GDUA 3UWIA 2L74A 3L33A 4X2XA 3SBKA 3OSYA 2J98A 1JMOH 3Q3KA 3K6YA 1EP5A 3EGKH 1TABE 2BLOA 2HNTC 4ZAEA 1HAZB 2O8MA 1O3PB 2V35A 1TAWA 1QRZA 3E16B 3PV4A 3SQEE 1K9OE 2EC9H 4GAWA 1W7XH 5A0AE 4MTBA 1SLUB 1C1RA 2QF3A 4LZ1H 3MI4A 3RXHA 1TIOA 4E05H 2GDDA 1OKXA 1MKWH 2FTLE 2H5DA 3SU6A 1SGPE 5E2OA 1W0YH 2EI7A 2A7CA 1RIWC 2BYAX 1YPKH 1J16A 2AIQA 4DY7B 1C5TA 4Y8YA 2EQNA 1SGEE 4ACAA 4B2BA 3TJVA 1O37A 3IITA 1NS3A 1GI4A 4ASHA 3M7TA 4Y6DA 1DY8A 1TNJA 4M9FA 3M5NA 3TPIZ 4BANB 1H8DH 2TGPZ 4F49A 1G3BA 3MNXA 3PYHA 1KXBA 8ESTE 1BTUA 1E1QD 3RXSA 3OFND 4HI3A 3CENA 1V2MT 2ZNKH 3PV5A 4INKA 1O2KA 1BTXA 1NTPA 2BXUH 4K2YA 1MBQA 2VINA 1LQDB 1CA0B 2BOHB 2EA3A 4XBCA 3DFJA 4IC6A 2FI3E 4AYVB 1T31A 2V6NA 3VEQB 2CK3D 1GBTA 5FCRA 2JJ2D 2F9BH 1B0EA 3UWJH 1FAXA 2ZKSA 3DSOA 3SN8A 1TGNA 4LZ4B 1GMDF 2PUXB 3QZRA 1NRNH 3O8RA 3DD2H 4UE7H 1C2EA 2FEQH 1KTSB 4NIYA 4ZXXH 5HIZA 1WXRA 2O9QA 1KLTA 1V3XA 1WTGH 1LHGH 3D62A 1YKTA 3LGUA 2V3OH 1YPLH 1Y3XA 1QB1A 2WPLS 4UFFH 2FYQA 3H5CB 1AI8H 1GJBB 2GP9B 1C2MA 3BTKE 2Y82A 3SU4A 1Y8TA 3BTTE 1MTWA 2AGEX 4D7FA 1WDIA 3W1EA 1S5SA 2A4QA 1HXEH 1COWD 1H9HE 2QA9E 3ZIAD 1OP0A 4FUCA 3M5LA 3I29A 3A88A 1W0JD 1RRKA 1O3LA 2UUYA 2P8OB 3FZZA 4AFQA 1BMLA 1DFPA 3FKSD 5C94A 3TGKE 1NY22 4FUJA 2OC8A 2ZQ2A 1A4WH 2R3UA 3MU8A 3LJOA 5ESBA 1BQYA 1IHSH 5GDSH 1VCQA 3JZ1B 2LPRA 4D7GA 2OCVB 1OSSA 1QFKH 1YLCA 3SNBA 8LPRA 2BD2A 1Z6EA 1Q2WA 1YPJH 3BTQE 3FO8D 1O3AA 1EOJA 4JCNA 2CHAB 3GY3A 1KYNA 1SGQE 3CS7A 1GHVH 3MTYA 4MNVA 2UUFB 1EFRD 1ELVA 4ABJA 5IDKA 1N6XA 1EPTC 3LH3A 1ELFA 2ZFFH 3KL6A 1P02A 1SC8U 3GY5A 3PLPA 3R3GB 2J2UA 1C5YB 2WV5A 1BA8B 5C20A 3QDZB 3UR9A 1T32A 1SOZA 1SGYE 4XD7D 3SJ9A 4AX9H 5TCCA 1LO6A 1SG8B 2BD5A 2BD9A 4X6PA 3MO3A 1FY4A 2GD4B 1Y59T 3K2UA 2A0QB 1QA7A 3OE7D 2AEIH 4Y0YE 1FNIA 4QT8C 1CQQA 1H4WA 1HIAA 1AGJA 4Y7BA 1WQVH 1RTLA 1T8OA 1O2QA 1AIXH 2G52A 4XDEA 1FUJA 1TGBA 1A3BH 1BB0B 2OC0A 1HAPH 1EOLA 3A8AA 1O2RA 1BHXB 1PQ5A 1TALA 4GUXA 2PTCE 5EW2H 2VH0A 7ESTE 3B8JA 1ZR0A 1GBFA 2BZ6H 3ZZ3A 4D76A 1A5HA 4O3UA 1W7GH 3SI4H 1PPCE 2BY6X 1C1WH 7GCHF 3HATH 1SGIB 1MAYA 3BN9A 2VH6A 3P17H 5LPRA 1SHHB 3P8FA 1GG6C 2ZU4A 4X2VA 4R0IA 1DE7H 4YT6H 4NSVA 2K1QA 1ANEA 3A80A 2EY4C 2ZU2A 1QCPA 4AG2A 1DLEA 2SGFE 3PO1C 2FPZA 2W6JD 1C1OA 2Y5HA 1MTUA 2TPIZ 3LU9B 1RGQA 3GCOA 3VXEH 1SI5H 3M61U 1NRRH 5TJXA 1GBIA 1GJ6A 1TBZH 1HGTH 2FOAA 3PLBA 1GPZA 1ETSH 1LPZB 3QK1A 4BTUB 2W7UA 1ZTJA 3AW1A 1ZGVA 1C1MA 1LHEH 1FV9A 1UTPA 1AN1E 2FOHA 2ZHWH 3M3SA 3EDXB 1IHTH 2FI4E 4MPWA 1IQJA 5EW1H 3NUMA 2ZGHA 2AS9A 5KEDA 3HK6B 1EAXA 4ZCNA 4NIXA 3E0NB 1QB6A 4WH8A 1T8NA 3GCTF 1SLXB 2H9HA 1O30A 1C5VA 4K3JA 3MMGA 2BY5X 3VB3A 1ARBA 3GY8A 4HTCH 5JBBS 1K2I1 5JPMH 3CS0A 1UVPA 3U8TH 1L0ZA 2P93A 2VB0A 1Z8GA 3SV9A 4O03A 2ALPA 2HGTH 3FAOA 4CH8B 4BOHA 3LT3A 2AHME 1XX9A 4AOQA 4HG6A 1CBWC 3MO6A 1W14U 1NM6A 2PGBB 3A7TA 1HAVA 1PPBH 1EZXC 1BJVA 1C5XB 1VCPA 2V0BA 2O8LA 3P8OA 3M5MA 2SGDE 4ZH8A 1O5GH 3W94A 9ESTA 1PPHE 3LC3A 1HJAC 3U28C 1SSXA 1QJ1B 1O2NA 1FY5A 1K1JA 1HAXB 1BTHH 1P2QA 4THNH 5AFYH 1FY1A 2VWOA 2Z9LA 4B71A 5GIBA 5DP5A 2C4FH 1BDAA 2A2XH 2ZU3A 5EU8A 1O3JA 1C1NA 4YOIA 2PSXA 2VU8E 2Q6FA 1C4U2 3NXPA 4FETA 1SOTA 2A31A 3SZNA 3F2FA 3UUZA 3MQKC 1QGFA 4Y71A 5E2PA 4F48B 3OX7U 4WMFA 1ARCA 3RXGA 1EX3A 5E8EH 1DLKB 3UIRA 1V2UT 3EE7A 4X8VH 1KLIH 1T7CA 4WJG2 1V2RT 3BTWE 2CF8H 3ZYEA 1DS2E 4K5ZA 1AY6H 2RDLA 1NFXA 4Y7AA 2KFWA 5T3HA 1GMCF 2ILNA 3TK6A 2Y7XA 2BLQA 1YPEH 2GMTB 1MCTA 1GBHA 1K1IA 4GLYA 1MU8B 2Z9JA 1TGTA 3DSGA 3RLYH 4X8TH 1QL7A 2ZO3H 1LMWB 2CXVA 3Q77A 2GGVB 3ZZDA 1EB1H 1DUAA 1O33A 1C9TA 3FFGA 1Y3YA 3GYLB 1GBKA 1UO6A 3KQCA 4WWYA 1O2SA 2QXJA 1GCTC 2QGRA 1E38B 1O3BA 1SKYE 5T6DA 5BPEA 1UVOA 1K28D 2TGDA 3HGNA 1WAYB 2WPHS 2XBYA 3FP6E 2A5KA 2Y7ZA 4WMEA 2SGQE 4ISIH 1GI3A 1PFXC 1O5FH 4OS1A 3ZZCA 1O0DH 4TY6A 2G00A 3T28A 1D6WA 1SQAA 2ANKH 5CHBA 1OOKB 2PR3A 2KCOA 4SGBE 4YM9A 3SO3A 2IPQX 1WOFA 2G55A 3TITA 1KXCA 2DE8A 1P2MA 1Y3VA 1TNLA 1LKAA 1MAXA 1NU9A 1TOMH 2TRMA 1ELBA 1KDQA 5AF9H 3C27B 2C8WB 1OYQA 4GSOA 1O2OA 2F9VA 1O3FA 5JDUB 3KNXA 3TK5A 1IQHA 5DP8A 4H42U 2I6SA 2UWPA 2FOCA 3FOAA 3S7HB 5A8YA 4KKDA 4FU7A 1MD7A 2GKVE 1GHWH 4NG9H 2CGAA 1ZLRA 4HZHA 3GOVB 1GMCG 2PSYA 2BVSH 2Z3EA 1IQNA 2ZQ1A 1T4VH 3BG4B 5F8ZA 4FOUC 3SNEA 2XBVA 3HKIB 5E0JA 3QGJA 3MFJA 1S84A 3PV2A 1WYKA 1DPOA 3RU4D 2NU2E 1J15A 1W11U 1W8BH 2VWLA 5L30H 4BAKB 3AAVA 3UREA 3PM3A 4KTSA 3M7QA 2ZG0H 1THRH 2GV7A 1WSSH 3PMAB 4TT3D 5EIYA 1QBNA 1KXEA 2WPKS 1GBLA 3A7YA 3SUGA 3GY6A 1Y5AT 2FP7B 1V2WT 4ABGA 5E0HA 2HWLB 1AFQC 2C3SA 3TGJE 1S6HA 3LONA 3F2HA 3DUXH 2BLWA 1KDQB 3Q76A 2ZCHP 1L1NA 4HFPB 1ELGA 3A8CA 3B9FH 1QZ8A 4X1SU 1XKBC 2BDCA 3RXLA 2BM2A 3PRBA 1GVKB 3SW2B 2KZ4A 4ABEA 4MNXA 4J1YA 5EXMA 2WPJS 5FPTA 1F5LA 2ZIQH 2GZ8A 1ZRKA 1C5PA 2R0LA 3FVFB 4JYUH 5F03A 2P59A 3P70B 1G30B 4BXSA 1UW7A 1V2NT 2JKHA 4NIVA 5HMAA 1G37A 4K1TA 4UFGH 1MH0A 1AUJA 1MKXK 2Z94A 4K8YA 2B8OH 4YT7H 1GL0E 5EPYA 1TYNA 1E36B 2FDAA 2JDID 4Q7ZA 3L3TA 5B6OA 1E37B 3CNRA 2XC5A 1B7XB 1C5RA 1SMFE 2A4RA 2XC0A 2QF5A 1GGDC 1PPGE 2W6ID 4O3TA 2G51A 2K0QA 2M5TA 1LPKB 1FY3A 4B75A 3QZQA 1GVZA 4DOQA 4Z0KA 4AYYB 1NC6A 1K22H 1J14A 1NRPH 4X6OA 3TJUA 1GBDA 2BX3A 2STBE 2W3KA 4I32A 1JRTA 2Y6TA 4MPXA 1FXYA 1RD3B 1RTFB 1P11E 2Y80A 3IG6B 2Y5GA 1HAIH 3TJOA 2BVXH 1FDPA 3V12A 3MH4A 1NRQH 4CBNA 3PMJA 3TH2H 3PMBB 1CGHA 1XXDA 4E7NA 4CRAA 3E8LA 4JYTA 1WBGB 5L2YH 3A87A 3SJOA 1BBRH 2KCPA 2P3TB 1K21H 2A2QH 2BVRH 1CHOG 2H2ZA 2ZPQA 3SI3H 2BQWB 1YM0A 1TGCA 3OTPA 2IN2A 4MNWA 3UNQA 4ISHH 1VGCB 2PTNA 3RM2H 1CGIE 1O32A 2STAE 2PKAB 3GISB 4K8BA 1FX0B 5E0GA 2HOBA 1MTNC 3V7TA 3N7EA 1SLVB 3A7ZA 3OEED 2G4UA 1K1LA 1L4ZA 3LOXA 3NCLA 1KLJH 1DWCH 1HBTH 1HNEE 1NBMD 2D8WA 3T5FH 1IQEA 2BHGA 4UDWH 4FUHA 4BAHB 1OP2A 1PPEE 1UK3A 1S82A 2VIPA 2C8YB 4B2CA 1JOUB 3D23A 4JZEH 3U8RH 1PYTC 5EJZA 3UOPA 5C5NA 3SJIA 1OP8A 3KQ5A 3QTOH 3VGCB 1ESBA 2ZF0H 2R2MB 1H1BA 4ZMAH 1CT2E 2KCAA 3BSQA 1ABJH 1L1JA 1LDTT 1RJXB 2C90B 5SGAE 4DIIH 1XM1A 1BBRK 2ODPA 1O2LA 5CHAC 1MUEB 2GDEH 1TPOA 2FOGA 3MH6A 4NSYA 1ESAA 1GJDB 1MZDA 2BB4A 1UCYH 2BDYA 1ZPCA 1JWTA 1O3MA 1C4V2 1PQAA 1HJ9A 3HPTB 1Z6JH 4MPVA 2SGAA 1ANBA 1D3DB 1FN6A 3LH1A 2D1JA 3M5OA 4SGAE 4TWWA 3BTGE 3VXFH 1AQ7A 1MKWK 4Y79A 1P0SH 5HGGA 1NZQH 4ZKNU 1C5ZB 1ZOMA 3LGWA 1DWBH 1G2LA 4I33A 4YOGA 1N6YA 5EXLA 5F53A 2GT7A 2BMGB 1N8OC 3LC5A 4Q4LA 1BTPA 2AMDA 2ZDNA 2HPPH 2OD3B 3SYJA 3RU4E 5C0TA 4FUGA 4XFQA 3LKWA 5DP9A 1YPHE 4X6MA 5AVDA 4K69A 3H7TA 1OWIA 2ZHFH 4IN2A 4IGDA 1O2GH 3M3TA 3RXMA 2XBXA 2Z9GA 2WSSD 2A7JA 1QL8A 1V2OT 2WZQA 3K6ZA 2ZGCA 3LJJA 2IJD1 1Y5BT 1ZHRA 1UCYK 3SUDA 3RXTA 1HFDA 1ACBE 5DK1A 3WY8A 2XWBI 3ZZ6A 2A4OA 1DOJA 4AGJA 3T26A 1JXPA 3SU2A 2RCEA 1F92A 4B73A 2BTCE 2UWLA 4TPYA 4UD9H 2ZP0H 3STIA 1J17T 1QB9A 4NZQA 1NFWA 4YZUA 5JB8S 1ORFA 1CO7E 1O2JA 4OGYA 5I25A 2ZFQH 2C8ZB 1A1RA 1J8AA 1FQ3A 4CRGA 4AGKA 1QA0A 4RKJB 1CBWB 3MU1A 4JYVH 3MH5A 3SV6A 3BEUA 2ZTZA 2CJIA 3ZZ5A 5EPNA 2IPHA 1HAOH 3SZEA 3RXKA 2NU4E 4GCHF 2FOEA 1DY9A 5GNDA 4XE4A 2KR7A 5DN6D 1TBRH 1SPJA 3KQEA 5FX5A 3RXPA 1XUJA 2PHBA 2OC7A 3ODDA 1HJAB 1A5GH 2PKSB 4JZDH 7KMEH 5DP7A 5T1VA 2QV1A 2V3HH 3RDZA 1C5WB 1V2KT 1TMTH 2YNAA 4I8KA 3E90B 3UR6A 2JIZD 3LIWA 2ZZUH 5CMXH 2OQUA 3PB1E 1O2HA 1P2OA 3ATMA 4Q2KA 1FN8A 2UUJB 5C2ZA 2BLVA 2WUBA 1WCZA 2BOKA 2GZ7A 2FWWA 3A89A 2BDHA 1IAUA 3OTJE 5HM9A 3UQVA 4I7YH 2BY8X 1BBRE 2BDBA 1O2YA 3ODFA 4I31A 2RFKC 2O8WA 1FPHH 4UFDH 2ZPRA 2ANMH 1JIRA 3M35A 4Y8XA 3E91A 1PQ8A 4P00A 2TIOA 1EJAA 3N7DA 1ESTA 3LGIA 2DE9A 1GJAB 1SHYA 1C1TA 4YO9A 3ATIA 1UJ1A 2QF0A 4NFEA 4WMDA 3D65E 4A5TS 1DM4B 1GBEA 2Y5FA 3MO9A 2A7HA 4A6LA 1FONA 3TJNA 2JH5D 1GJ8B 2TGAA 3T62A 3RUOA 1TE0A 2A4GA 1UK2A 1X7AC 2HVXA 4RKOB 1A0LA 1O2IA 2XTTB 2RA3A 2YMSC 3T25A 2ZHEH 5A8ZA 3MHWU 1P2JA 3TVJB 1TNHA 2AYWA 4GCHG 4O97A 4X2WA 4WH6A 3VB4A 5DSFA 5LPFA 1P03A 5T6FA 3WWBA 1C9PA 4Q7YA 1YYY1 3CP7A 4H6TA 6LPRA 1EKBB 1MQ5A 2AMPA 3ZVGA 2OP9A 2H6MA 4RT0A 4WF8A 1BMNH 3BEIB 5GJ4B 3MU4A 3PRDA 3KQDA 4FXGH 3A81A 2B5TB 1CA0C 3K65B 1MZAA 1TLDA 1THSH 1NBME 4YTAA 1UCYE 2QYIA 1SGDE 3WWFA 4ZKOU 1OWHA 1P3EA 5DJ7A 3SGAE 2H9TH 4K1SA 3EE0B 4IC5A 1XUKA 3SU1A 4XSKU 2WINI 1ZYOA 3E0PB 5EGMA 4DVAU 1ZMNA 2H5CA 3RXRA 3VB5A 2HPQH 1AFEH 2QCYA 1YGCH 1NU7B 3QUMP 1VITH 2OK5A 1O5CB 3KF2A 1DVAH 2Y81A 3RXAA 1G3DA 2FODA 2ULLA 4OS4A 2VWMA 6GCHG 2ZDAH 3RC5A 1BRAA 2ZGBH 1UVTH 1OYTH 3F0OA 3F9HA 4NA7A 1ZHPA 1MCVA 3GY4A 1QBOA 3QLPH 2XYAA 3P8NA 3GICB 2P8OC 2H1UA 2ZDLA 2FS9A 1XUFA 2QIQA 5DG6A 3LPRA 3KEEA 1TQ7B 4ZKRU 3TH3H 3ZZAA 1O5EH 3O8CA 4AFSA 2BDAA 5DP3A 1HRTH 4U30A 1BRBE 1QJ6B 1QNJA 1MD8A 4AC9A 1BHXF 1A0JA 1Z7KA 2OUAA 1OPHB 1TRYA 1VR1H 1AFQB 3RP2A 1GBCA 4M7GA 3A84A 2BQ7B 1Z8JB 5ABWA 2WV4A 3ZVAA 2J9NA 2W3IA 1CSOE 3U9AH 2KCYA 3T2NA 1VJ9U 1UTJA 2A5IA 1F0RA 4XBBA 1A3EH 5DGJA 1V2ST 4NCYA 4X6NA 4JK5A 1EJNA 1O3IA 1BMFD 1TONA 2Z9KA 1UTKA 1ELAA 1H8ED 2O8TA 3LGTA 3T29A 3M3VA 2BXTH 1S6FA 2A5AA 3NK8A 4UEHH 1AE5A 3KN2A 2JJ1D 5DO4H 1GJ9B 2KAIB 5DKMA 1C4Y2 2FO9A 1EJMA 1ZRBA 1Z1IA 1TPPA 3SUEA 2UUKB 2VBCA 1G9IE 3UFAA 1P04A 3A85A 3JZ2B 3SU5A 9LPRA 2JETB 2OQ5A 4AG1A 1W12U 1EATA 2ALVA 2W26A 2ZDKA 4GHTA 3Q3XA 2GCHF 1GDQA 3W95A 5IK2D 2XCNA 5F8TA 4D9RA 1GVLA 6CHAC 4ABBA 4ZHMU 1SB1H 1XXFA 2BDIA 2VIQA 4D8NA 2ANYA 1CT0E 2BZAA 1P9SA 1D3TB 4ABIA 2LP6A 1YCPH 2J4IA 5ETXA 3N7OA 1LVMA 2IOTA 1O2PA 2PWXA 3NKKA 2PP6A 1C2JA 1TWXB 1HDTH 2NU1E 1FJSA 4DT7B 3EA8A 3SV2H 2F9PA 1AKSB 3K9XB 2NU3E 5A09A 1AZ8A 5B6LA 1ETRH 3TNTA 1GHXH 1GI0A 5AHGH 1LHFH 3RXEA 1ZJKA 1QRXA 1P05A 1NN6A 1IQGA 1RTKA 1Z71A 2KM0A 2DUCA 1SGCA 2HNTE 2BD3A 3SHAH 1INCA 4D9QA 1AD8H 2SNWA 5FCKA 2SGPE 1NFYA 1TRMA 3RC6A 3FP8E 3OYPA 2O8UA 3O8BA 2AIPA 1O2TA 1SGNE 2BDGA 2FLRH 4ZXYH 2SFAA 3E1XB 3EAJA 4DCDA 4WVPE 3D49H 1YCPK 3L6PA 3IWMA 2K8IA 4A1VA 2BD4A 4Y11E 3NWUA 4I8GA 1O31A 1P2KA 1O34A 2Z3DA 1RXPA 1PPFE 5JB9S 2FOMB 2ASUB 2VWNA 1GWAA 4U2WA 1ID5H 1JBUH 3RMOH 5JYIA 2GCHG 1HV7A 3SORA 3UAIC 1BUIA 1EAWA 4U01A 2OTVA 4U32A 4Y10E 1SLWB 3BG8A 4MVNA 1RIWB 3U1IB 1ZPZA 5C67A 1BRUP 2J97A 1F7ZA 1T4UH 1TMUH 3MOCA 5FAHA 1AWHB 1TPSA 1C5LH 3MWIU 3U69H 1CT4E 2OXSA 2VIWA 2Q1JA 1QBVH 1LVYA 1TX6A 5CHAB 1O3DA 2V3MA 2EI8A 3G01A 4LOYH 5FX6A 1V2VT 1YY3A 2FM2A 5J4SA 1FY8E 1QURH 3PMHB 1BJUA 1EB2A 1LHDH 1KXFA 3B23B 1ZJDA 1QTFA 1O2UA 4CBOA 1C5MD 2OINA 4IMZA 4DURA 1UTOA 1UMAH 4X2YA 3PWBA 2QXHA 1SGFA 2R9PA 3ZZ9A 1MBMA 3A86A 4CHAC 4X1PU 4OM9A 1CHOF 1KIGH 1P06A 4IBLH 2Z9IA 8GCHF 1IQKA 2FIRH 4JZ1A 4WY3A 1ZSKA 2ODYB 5EG4A 1UVSH 1ZPBA 3KIDU 4YESB 1HXFH 4Q80A 3URCA 1AU8A 2OLGA 3LGVA 4NFFA 3TGIE 4ZHLU 2Z3CA 1P10A 1UTQA 1A0HB 2F3CE 3A7VA 1TX7A 3M7UA 1UTNA 2CV3A 3SJKA 4ABDA 3U1JB 3F9GA 1UVUH 4MG3A 2WPDD 2GMTC 4YLQH 1W13U 2PKAA 5I46H 5F6MA 4DG4A 2B7DH 2ODQA 1GI9B 5KGOA 1C1VH 2ZHDA 3PROA 4XOJA 1Z8IB 2EI6A 4F4OC 3VB6A 1FI8A 1TNGA 2HNTF 3KQBA 1E35B 5JBTA 2FZZA 4XBDA 2C8XB 2P95A 3ATWA 3OY5U 2WHXA 1W10U 3GCHC 3RU4T 4KTUA 1QJ7B 2FTMA 3SUFA 1EXFA 1YLDA 1IQIA 1F0TA 2V7QD 1C2HA 3AK5A 3BTFE 2P3FH 3SOSA 1VJAU 4FUDA 4ZROA 3OY6U 1FIWA 5L6NH 4A92A 1LPGB 1G3EA 1S6LA 4K60A 1Z1JA 1BTYA 3WW7A 5HKKD 3HK3B 2IJOB 1C1QA 2F9UA 5JBAS 8GCHG 2HLCA 3KCGH 1AZZA 1EPTB 3HKJB 5EOKA 5FHTA 3MNBA 2QN5T 4Z1MD 5L2ZH 1VITF 5DPAA 1F5KU 3ZVBA 1F5RA 1AVXA 2W5EA 3N99A 3Q3YA 4FVDA 1YWUA 1BCUH 2AFQB 1KXDA 3SNDA 2J5UA 2FESH 2ZU5A 3A8DA 3RXCA 1AWFH 3PTBA 2H9EH 3S9BA 3BG4C 4I8HA 1TRNA 3E6PH 4ZKSU 4XRNA 2OBOA 1TPAE 1ELEE 3TK9A 1SL3A 3ENSB 2ZFPH 3H7OA 3U8OH 1ZGIA 2C93B 2CMYA 1D9IA 1LQEA 2AERH 2RG3A 1L2EA 4B1TA 4ESTE 1AHTH 4ABAA 2QY0B 5J4QA 1ZZZA 1UHBB 1HAYB 1SGTA 2R3YA 2W7SA 5GXPA 1A7SA 2FOFA 3ZZ8A 1K1MA 1QQ4A 1BRCE 1P2NA 2AGIX 2XOKD 1P09A 3ATKA 1XMNB 1GG6B 1YF4A 2ZFSA 1C5SA 1QY6A 1CHGA 4OGXA 2XNDD 2YMSB 4VGCC 2AGGX 1BITA 4OS6A 3PO1B 3BF6H 2XXLA 2GX4A 1DITH 1G36A 1L1GA 2VJ1A 4FUFA 2VGCC 4Z6AH 2J38A 4NGAH 2GV6A 5EQRA 2J98B 5BRRE 1S0QA 1YCPM 2GJGA 3RXBA 1WQSA 3P6ZB 2QAAA 1O5AB 3ZZBA 5DP6A 3EQ0H 3P95A 1OWDA 1BTWA 3NPSA 3V3MA 3GDSA 1ETTH 1SQOA 1T8MA 4I86A 1VITG 1V2JT 3SGQE 3AW0A 1FAKH 1GL1A 1P01A 1M9UA 3PWCA 3HGPA 2ZDVH 1LHCH 2CN0H 5C0UA 1XUIA 3BIVH 4X1QU 3SNAA 1V2LT 1FZZA 2AMQA 2BD7A 1V6DA 3MNSA 1O3HA 1GDUA 3S7KB 4ZUHA 3RMMH 1C5OH 2F43B 1V2TT 2FX4A 1TB6H 1ZHMA 1K1NA 2VIVA 3DFLA 3TH4H 2P3UB 1PQ7A 1QL9A 2G5NA 3ZVFA 5LPEA 3BIUH 2NWNA 4ASUD 4KTCA 1OS8A 3A83A 1GJ4H 3GDVA 1DSTA 4FU8A 1ZTLA 4Y0ZE 3STJA 1GBBA 1HYLA 4AORA 4RSPA 1AB9C 2VVCA 4B6EA 1TBQH 3C1KA 1VCWA 1GHBF 2J94A 3EA9A 3VB7A 5GWZA 5K0HA 1QRWA 4DW2U 5C5OA 5C1UA 4RI0A 4X8SH 4Q7XA 3AVZA 1TFXA 5DP4A 3ZZ4A 2AH4X 1TNIA 1SGFG 2GCTC 2XBWA 1IQMA 3SJ8A 2LNCA 2VVVA 4IN1A 1DXPA 1UTLM 4GPGA 5FBEA 5C3NA 5A0BA 4K1EA 5K7RA 1MQ6A 1TQ0B 5HIYA 3GY7A 2ZC9H 4ISOA 1G32B 1S85A 3RXQA 2HLDD 1N1LA 1ZMJA 1VGCC 2A32A 5EXNA 3QX5H 1RFNA 2PGQB 2PW8H 1GMDG 4X1RU 2QF4A 4AN7A 3MNCA 1CGJE 3MU5A 1P57B 2G81E 1EP6A 1O2XA 1K1PA 1UTMA 2NU0E 3TLOA 2M2AA 1Q31A 2UWOA 3DHKH 2VIOA 5CE1A 2RDEA 4ZHAA 1NESE 2ZTXA 4DIHH 1XUHA 6GCHF 2F9OA 4ISNA 3RXJA 1GCDA 8KME2 3RXFA 4ACBA 1THPB 1O3GA 4KGAA 3KYGA 5EJLA 2THFB 5T6GA 2WUCA 3BTME 3VGCC 1GMHF 1HPGA 1O3EA 1AVGH 1DANH 5AFZH 2ZCKP 2ZFRH 1JRSA 1PYTD 6CHAB 3ZZ7A 1GCTB 3ITIA 2A1DB 1KSNA 1A2CH 3VPKA 3FZDA 2FMJA 1LTOA 4I8JA 1D6RA 4B74A 1EZUC 1GHBG 1SVPA 1TX8A 2WYGA 2OC1A 1NFUA 4RN6A 3F2GA 4ABHA 1L4DA 1DDJA 3GCNA 1ANDA 4TY7A 1O2WA 3AAUA 4GVUA 5PTPA 4I8LA
chains in the Genus database with same CATH topology
5H4IB 4B76A 1GHAF 1XVOA 4BTTB 4NWLA 3Q00A 3O8DA 4WXIA 3RC4A 2XW9A 2VIDA 4BAOB 1C1PA 4OS5A 1D4PB 4YLUA 2WPMS 3UY9A 2BD8A 4CRDA 2ZTYA 3V13A 4J2YB 1O35A 2HALA 4CREA 1O5BB 1HIAB 1K1OA 4E06H 5IYTA 1SQTA 2GT8A 1S0RA 5A2MH 3S9CA 1TOCB 2I6QA 4LK4A 3T27A 2QXGA 4TWYA 1O3KA 2XNIA 4FU9A 1FLEE 1DWDH 1RS0A 1NO9H 2ESTE 2PUQH 1W2KH 1DX5M 5LH8A 1BMAA 1GBAA 1A46H 1YPHC 2F91A 4MNYA 1C2KA 4JZFH 1YP9A 1MU6B 1T8LA 1IQLA 1MTSA 1GI7B 1ZSLA 2GTBA 2KAIA 1GMHG 1GBJA 1DICA 4Y8ZA 1G3CA 1DUEA 4AZ2B 3EYDA 4OS2A 1CVWH 1MTVA 1OWJA 5A0CA 1ZMLA 4AFZA 2FS8A 3FANA 2FX6A 1SR5C 1WTHD 3AASA 1HAHH 3F68H 2ZA5A 1O3CA 1ZTKA 1PPZA 4JK6A 4MQAA 1XUGA 1HUTH 1SFQB 1GDNA 5FXLA 3OU0A 1YPMH 7GCHG 3S69A 1BIOA 1LCYA 2D2DA 4CRBA 1FIZA 4INLA 5ESTE 4IMQA 1KXAA 1F0SA 1OWEA 2R0KA 1DT2A 1OWKA 2P94A 5C1XA 1SGRE 1ELCA 4FVBA 2CHAC 3RMNH 4AFUA 1GHAG 2PV9B 1EUFA 1TA6A 2PKSC 3GY2A 1C5NH 3P92A 3S0NA 2ZFTA 1TMBH 1O36A 4AB8A 2TGTA 2ZGJA 5C1YA 1AKSA 1PJPA 3A8BA 2VVUA 2WYJA 1BTZA 1O39A 2RA0A 1WV7H 1LVBA 1O2ZA 2XWAA 4CHAB 1GJ5H 2TBSA 1Y3WA 1P8VC 3RXUA 3UPEA 1HLTH 2ZGXH 3UTUH 1V2QT 1CE5A 1WU1A 3ZVCA 1GI6A 3SU0A 3V0XA 2ZCLP 1QHRB 1UK4A 3A7XA 4INHA 3BEFB 4ISLA 3GCTG 1OX1A 2BX4A 4UFEH 3M36A 1C1UH 1EZQA 2ZU1A 3R0FA 1B5GH 1ANCA 3VFEA 1HAVB 3RLWH 1YC0A 2Q6DA 3QN7A 2G5VA 1AE8H 1YPGH 3QWCH 1H9LB 4WXVA 1H8IH 2GZ9A 2J34A 4KP0A 1GGDB 5HM2A 3RXDA 1Q3XA 1LVOA 1P3CA 1OXGA 1QQUA 1LKBA 4UONA 2ZEBA 1C5UA 3QO6A 1DWEH 3BTEE 3RM0H 3SQHE 2YOLA 3RXVA 1H9IE 3M37A 1NRSH 3P8GA 4LXBH 4OS7A 5HXFA 1GHZA 2G4TA 2J92A 3ESTA 2PLXA 4MDSA 3ZV9A 3UQOA 3GCHB 1QR3E 2BQ6B 2PFEA 1ABIH 5FBIA 1C2GA 3DT0H 4A1XA 4BXWA 2B9LA 3SU3A 3ZV8A 1S83A 2VNTA 3EA7A 1HAGE 1JIMA 2R2WU 4JMYA 2P16A 4NIWA 2HRVA 4DGJA 4TYDA 4Y76A 3KHVA 2ZHQH 1DXWA 1AUTC 1C2LA 1D3QB 6ESTA 1C1SA 1GI5A 2QC2A 4JZIA 3UNRA 4CR5A 2EEKA 1P2IA 2Q6GA 4CRCA 3DA9B 2Z7FE 1IQFA 1GI1A 1V2PT 3PTNA 1MTNB 5FPYA 1NROH 1VZQH 1P9UA 4A1TA 4FUBA 1C5QA 1O3NA 4NA9H 4R8TB 4HGCA 5G4BA 3ELAH 4FUIA 1CU1A 2JH0D 3I78A 2WPIS 3U98H 1O2MA 2ZI2H 1C2DA 3LGYA 4GHQA 1BMMH 1O3OA 2YNBA 3BV9B 1ELDE 4BAQB 4E7RG 1HCGA 3UNSA 3SV7A 1GI2A 3ZVDA 2SNVA 1IOEA 2D26C 1Z8RA 1AO5A 1F2SE 3BTDE 2CF9H 5TCAA 4H4FA 2XCFA 1A61H 3RXOA 3F1SB 5GCHF 2F9NA 5GPIB 2Z6BD 5HYOA 3F6UH 1O38A 5EODA 3E3TA 1O2VA 1DSUA 1MKXH 1GHYH 3F9EA 1YBWA 4MPUA 1Y3UA 3MU0A 1C2IA 2GVFA 1XKAC 4O9VA 1BOQA 1ELTA 4MLFB 3A82A 2XC4A 4X1NU 1A5IA 4VGCB 1D3PB 1MMJN 1S81A 3QTVH 3MH7A 3NZIA 4DJZB 1QIXB 4AB9A 2FYRA 3ATLA 1F0UA 4ABFA 2OBQA 3URDA 1J9CH 1EQ9A 1EAIA 2BY9X 2VGCB 1B0FA 1O5DH 3MYWA 4NZLA 2FXRA 1GI8B 2ZDMA 2JH6D 3SNCA 1N8OB 1BZXE 1EAUA 1HB0B 1U6QA 1W0ZU 3PLKA 5EQSA 4BNRA 1KY9A 1GBMA 1E34B 2J95A 2A45B 1EPTA 3RXIA 4IW4E 4CH2B 2BY7X 3SV8A 3QGNB 3LDXH 1HJ8A 1G2MA 1GJ7B 1FMGA 4H6SB 1P12E 2B0FA 4PROA 3TU7H 5JBCS 2SGEE 4X8UH 4YOJA 1WUNH 4A7IB 4IS5A 3A7WA 4CRFA 2JETC 3ZYDA 1GJCB 3SHCH 4TPIZ 3UOUA 4CR9A 2G8TA 2FLBH 5FPSA 3SGBE 3F9FA 1ZSJA 1XVMA 3S9AA 4NA8A 4BAMB 5GCHG 2XRCA 5LGOA 1TA2A 3FP7E 1AMHA 4KELA 1AVWA 1NT1A 1TGSZ 2ZWLH 1E0FD 2ZPSA 1KTTB 3KGPA 2FI5E 1EASA 4BTIB 7LPRA 2ZECA 2F83A 1SBWA 1BT7A 1C2FA 1AB9B 5EQQA 2QXIA 3ZVEA 3BTHE 4FUEA 1UHBA 1W3CA 3TIUA 2FOBA 2ANWA 3TNSA 4B2AA 3RMLH 5F8XA 1EZSC 1TNKA 3GYMA 1SFIA 1CA8B 4X0WU 4NWKA 3I77A 2GCTB 1NPMA 1Y5UT 1FPCH 5A8XA 3GDUA 3UWIA 3L33A 4X2XA 3SBKA 3OSYA 1JMOH 3Q3KA 3K6YA 1EP5A 3EGKH 1TABE 2BLOA 2HNTC 4ZAEA 1HAZB 2O8MA 1O3PB 2V35A 1TAWA 1QRZA 3E16B 3PV4A 3SQEE 1K9OE 2EC9H 4GAWA 1W7XH 5A0AE 4MTBA 1SLUB 1C1RA 2QF3A 4LZ1H 3MI4A 3RXHA 1TIOA 4E05H 2GDDA 1OKXA 1MKWH 2FTLE 2H5DA 3SU6A 1SGPE 5E2OA 1W0YH 2EI7A 2A7CA 1RIWC 2BYAX 1YPKH 1J16A 2AIQA 4DY7B 1C5TA 4Y8YA 1SGEE 4B2BA 3TJVA 1O37A 3IITA 1NS3A 1GI4A 4ASHA 3M7TA 4Y6DA 1DY8A 1TNJA 3M5NA 3TPIZ 4BANB 1H8DH 2TGPZ 4F49A 1G3BA 3MNXA 3PYHA 1KXBA 8ESTE 1BTUA 3RXSA 4HI3A 3CENA 1V2MT 2ZNKH 4INKA 1O2KA 1BTXA 1NTPA 2BXUH 4K2YA 1MBQA 2VINA 1LQDB 1CA0B 2BOHB 2EA3A 4XBCA 3DFJA 4IC6A 2FI3E 4AYVB 1T31A 2V6NA 3VEQB 1GBTA 5FCRA 2F9BH 1B0EA 3UWJH 1FAXA 2ZKSA 3SN8A 4LZ4B 1TGNA 1GMDF 2PUXB 3QZRA 1NRNH 3O8RA 3DD2H 4UE7H 1C2EA 2FEQH 1KTSB 4NIYA 4ZXXH 2O9QA 1KLTA 1V3XA 1WTGH 1LHGH 3D62A 1YKTA 3LGUA 2V3OH 1YPLH 1Y3XA 1QB1A 2WPLS 4UFFH 2FYQA 3H5CB 1AI8H 1GJBB 2GP9B 1C2MA 3BTKE 2Y82A 3SU4A 1Y8TA 3BTTE 1MTWA 2AGEX 4D7FA 1S5SA 2A4QA 1HXEH 1H9HE 2QA9E 1OP0A 4FUCA 3M5LA 3I29A 3A88A 1RRKA 1O3LA 2UUYA 2P8OB 3FZZA 4AFQA 1BMLA 1DFPA 3TGKE 1NY22 4FUJA 2OC8A 2ZQ2A 1A4WH 2R3UA 3MU8A 3LJOA 5ESBA 1BQYA 1IHSH 5GDSH 1VCQA 3JZ1B 2LPRA 4D7GA 2OCVB 1OSSA 1QFKH 1YLCA 3SNBA 8LPRA 2BD2A 1Z6EA 1Q2WA 1YPJH 3BTQE 1O3AA 1EOJA 4JCNA 2CHAB 3GY3A 1KYNA 1SGQE 3CS7A 1GHVH 3MTYA 4MNVA 2UUFB 1ELVA 4ABJA 5IDKA 1N6XA 1EPTC 3LH3A 1ELFA 2ZFFH 3KL6A 1P02A 1SC8U 3GY5A 3PLPA 3R3GB 2J2UA 1C5YB 2WV5A 1BA8B 5C20A 3QDZB 3UR9A 1T32A 1SOZA 1SGYE 3SJ9A 4AX9H 5TCCA 1LO6A 1SG8B 2BD5A 2BD9A 4X6PA 3MO3A 1FY4A 2GD4B 1Y59T 3K2UA 2A0QB 1QA7A 2AEIH 4Y0YE 1FNIA 4QT8C 1CQQA 1H4WA 1HIAA 1AGJA 4Y7BA 1WQVH 1RTLA 1T8OA 1O2QA 1AIXH 2G52A 4XDEA 1FUJA 1TGBA 1A3BH 1BB0B 2OC0A 1HAPH 1EOLA 3A8AA 1O2RA 1BHXB 1PQ5A 1TALA 4GUXA 2PTCE 5EW2H 2VH0A 7ESTE 3B8JA 1ZR0A 1GBFA 2BZ6H 3ZZ3A 4D76A 1A5HA 4O3UA 1W7GH 3SI4H 1PPCE 2BY6X 1C1WH 7GCHF 3HATH 1SGIB 1MAYA 3BN9A 2VH6A 3P17H 5LPRA 1SHHB 3P8FA 1GG6C 2ZU4A 4X2VA 4R0IA 1DE7H 4YT6H 4NSVA 2K1QA 1ANEA 3A80A 2ZU2A 1QCPA 4AG2A 1DLEA 2SGFE 3PO1C 2FPZA 1C1OA 2Y5HA 1MTUA 2TPIZ 3LU9B 1RGQA 3GCOA 3VXEH 1SI5H 3M61U 1NRRH 5TJXA 1GBIA 1GJ6A 1TBZH 1HGTH 2FOAA 3PLBA 1GPZA 1ETSH 1LPZB 3QK1A 4BTUB 2W7UA 1ZTJA 3AW1A 1ZGVA 1C1MA 1LHEH 1FV9A 1UTPA 1AN1E 2FOHA 2ZHWH 3M3SA 3EDXB 1IHTH 2FI4E 4MPWA 1IQJA 5EW1H 3NUMA 2ZGHA 2AS9A 3HK6B 1EAXA 4NIXA 3E0NB 1QB6A 4WH8A 1T8NA 3GCTF 1SLXB 2H9HA 1O30A 1C5VA 4K3JA 3MMGA 2BY5X 3VB3A 1ARBA 3GY8A 4HTCH 5JBBS 1K2I1 5JPMH 3CS0A 1UVPA 3U8TH 1L0ZA 2P93A 2VB0A 1Z8GA 3SV9A 4O03A 2ALPA 2HGTH 3FAOA 4CH8B 4BOHA 3LT3A 1XX9A 4AOQA 1CBWC 3MO6A 1W14U 1NM6A 2PGBB 3A7TA 1HAVA 1PPBH 1EZXC 1BJVA 1C5XB 1VCPA 2V0BA 2O8LA 3P8OA 3M5MA 2SGDE 4ZH8A 1O5GH 3W94A 9ESTA 1PPHE 3LC3A 1HJAC 1SSXA 1QJ1B 1O2NA 1FY5A 1K1JA 1HAXB 1BTHH 1P2QA 4THNH 5AFYH 1FY1A 2VWOA 2Z9LA 4B71A 5GIBA 5DP5A 2C4FH 1BDAA 2A2XH 2ZU3A 5EU8A 1O3JA 1C1NA 4YOIA 2PSXA 2VU8E 2Q6FA 1C4U2 3NXPA 1SOTA 2A31A 3SZNA 3UUZA 1QGFA 4Y71A 5E2PA 3OX7U 4WMFA 1ARCA 3RXGA 1EX3A 5E8EH 1DLKB 3UIRA 1V2UT 4X8VH 1KLIH 1T7CA 4WJG2 1V2RT 3BTWE 2CF8H 3ZYEA 1DS2E 4K5ZA 1AY6H 2RDLA 1NFXA 4Y7AA 5T3HA 1GMCF 2ILNA 3TK6A 2Y7XA 2BLQA 1YPEH 2GMTB 1MCTA 1GBHA 1K1IA 4GLYA 1MU8B 2Z9JA 1TGTA 3RLYH 4X8TH 1QL7A 2ZO3H 1LMWB 2CXVA 3Q77A 2GGVB 3ZZDA 1EB1H 1DUAA 1O33A 1C9TA 3FFGA 1Y3YA 3GYLB 1GBKA 1UO6A 3KQCA 4WWYA 1O2SA 2QXJA 1GCTC 2QGRA 1E38B 1O3BA 5T6DA 5BPEA 1UVOA 1K28D 2TGDA 3HGNA 1WAYB 2WPHS 2XBYA 3FP6E 2A5KA 2Y7ZA 4WMEA 2SGQE 4ISIH 1GI3A 1PFXC 1O5FH 4OS1A 3ZZCA 1O0DH 4TY6A 2G00A 3T28A 1D6WA 1SQAA 2ANKH 1OOKB 2PR3A 4SGBE 4YM9A 3SO3A 1WOFA 2G55A 3TITA 1KXCA 2DE8A 1P2MA 1Y3VA 1TNLA 1LKAA 1MAXA 1NU9A 1TOMH 2TRMA 1ELBA 1KDQA 5AF9H 3C27B 2C8WB 1OYQA 4GSOA 1O2OA 2F9VA 1O3FA 5JDUB 3KNXA 3TK5A 1IQHA 5DP8A 4H42U 2I6SA 2UWPA 2FOCA 3S7HB 5A8YA 4KKDA 4FU7A 1MD7A 2GKVE 1GHWH 4NG9H 2CGAA 1ZLRA 4HZHA 3GOVB 1GMCG 2PSYA 2BVSH 2Z3EA 1IQNA 2ZQ1A 1T4VH 3BG4B 5F8ZA 3SNEA 2XBVA 3HKIB 5E0JA 3QGJA 3MFJA 1S84A 1WYKA 1DPOA 3RU4D 2NU2E 1J15A 1W11U 1W8BH 2VWLA 5L30H 4BAKB 3AAVA 3UREA 3PM3A 4KTSA 3M7QA 2ZG0H 1THRH 2GV7A 1WSSH 3PMAB 1QBNA 1KXEA 2WPKS 1GBLA 3A7YA 3SUGA 3GY6A 1Y5AT 2FP7B 1V2WT 4ABGA 5E0HA 2HWLB 1AFQC 2C3SA 3TGJE 1S6HA 3LONA 3DUXH 2BLWA 1KDQB 3Q76A 2ZCHP 1L1NA 4HFPB 1ELGA 3A8CA 3B9FH 4X1SU 1XKBC 2BDCA 3RXLA 2BM2A 1GVKB 3SW2B 4ABEA 4MNXA 4J1YA 5EXMA 2WPJS 5FPTA 1F5LA 2ZIQH 2GZ8A 1ZRKA 1C5PA 2R0LA 3FVFB 4JYUH 5F03A 2P59A 3P70B 1G30B 4BXSA 1V2NT 2JKHA 4NIVA 5HMAA 1G37A 4K1TA 4UFGH 1MH0A 1AUJA 1MKXK 2Z94A 4K8YA 2B8OH 4YT7H 1GL0E 5EPYA 1TYNA 1E36B 2FDAA 4Q7ZA 3L3TA 5B6OA 1E37B 2XC5A 1B7XB 1C5RA 1SMFE 2A4RA 2XC0A 1GGDC 1PPGE 4O3TA 2G51A 2M5TA