4K1SA

Gly-ser-splb protease from staphylococcus aureus at 1.96 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
202
structure length
197
Chain Sequence
NVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVRNAYGVYFTPEIKKFIAENIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease SplB
publication title Staphylococcal SplB Serine Protease Utilizes a Novel Molecular Mechanism of Activation.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 56
structure length 197
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k1sA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k1sA02
2W5EA 2FEQH 2ODQA 3LONA 1AFQB 4MNWA 5FPSA 3T5FH 2BDYA 2H6MA 4CRBA 4LOYH 1ARBA 2GVFA 5E2OA 5K0HA 4YM9A 4OS4A 5IDKA 4ABBA 3KHVA 2F9OA 2C4FH 4MNXA 1A1RA 3BN9A 1DY8A 1RS0A 5F03A 4OGXA 4I32A 1OWIA 1TNGA 2BDIA 3SUGA 2VGCB 3V0XA 2FX6A 2Y5HA 2VVUA 2ZHFH 1GBDA 3A7WA 5TJXA 1AWFH 1DE7H 2WPLS 1KLJH 2P3UB 1EB1H 1L4ZA 5A0CA 3S69A 1GJ6A 3A83A 1B5GH 2G4UA 3IG6B 3RXGA 1P2JA 2FI3E 5EXLA 2AYWA 2ZO3H 1AMHA 2DUCA 2BM2A 1QBVH 4H42U 1ZGIA 1HAYB 1T8MA 3M5LA 1K1MA 1YM0A 5LPEA 2G8TA 1C1OA 2OC1A 5BPEA 1O38A 1SGNE 1V3XA 4KTUA 1MKWK 3SW2B 1TALA 2GMTC 1D3QB 5I25A 4MNVA 1HJ8A 2CJIA 1C5ZB 4K2YA 1C2KA 1ELCA 5FCRA 4KTSA 1O3GA 2C8YB 2HNTF 1PPGE 1QRZA 1J16A 5TCCA 4X0WU 1LVYA 3MU0A 1BMAA 1UVSH 1TONA 1QRWA 1FNIA 1DLEA 1WV7H 1NZQH 2VIOA 4MPUA 3F9HA 5C20A 3I77A 1EATA 1CT4E 1QRXA 2FTMA 1FY8E 2EA3A 4U30A 4ZKOU 1TOCB 1GJ5H 3ZVGA 3M36A 2ZU2A 4B73A 1CVWH 1C2IA 2GMTB 4FU9A 5C5NA 2FESH 3BG4C 1TQ7B 1OWDA 1G37A 3UNQA 1BRUP 3RMOH 1EJNA 1UTKA 2VIWA 1IQMA 1V2LT 2KAIB 1LKBA 2WINI 2Z7FE 5EG4A 1J15A 1G30B 1V2NT 2Z6BD 4OS5A 1YLCA 4BAQB 1HLTH 4MVNA 1PYTD 2BD8A 1RJXB 1C2FA 2CF8H 1GI8B 1KTTB 3HGNA 3P8NA 1FAXA 3RC6A 4E7NA 3KNXA 3LGWA 3MNSA 5LGOA 2W26A 3A7TA 2B7DH 3A84A 1HGTH 4JMYA 1C5OH 3QGNB 1GJ7B 1C1UH 1QQUA 2G00A 2ODPA 3CENA 1QCPA 1GBTA 1K1NA 4IBLH 4X8VH 5E2PA 1TBZH 4XBBA 4Y8YA 2WV4A 1OKXA 1GHVH 3M35A 1P8VC 1HJ9A 4JK5A 2W3IA 3RMLH 1O5DH 5FAHA 4GUXA 3D65E 3ATKA 1S82A 2VIPA 1W0ZU 1A4WH 2TGAA 3ITIA 3OY6U 3RM2H 3NWUA 3ELAH 1TYNA 4SGBE 3BTME 4INKA 4X1SU 4Y0YE 1IQKA 1GDNA 1PPEE 1BTUA 2ZWLH 4K3JA 1O5CB 3TVJB 1UVTH 1ZTLA 1HAXB 3GY8A 2QIQA 7KMEH 1ELBA 2AGEX 1SMFE 2A7HA 1QL7A 1XMNB 2YOLA 2GT7A 1FPHH 1ZJDA 2GZ7A 3OYPA 4D8NA 2J95A 1WSSH 2ZFQH 3A80A 4AG1A 3SHAH 1PPHE 2HPQH 6CHAB 4D9QA 3SOSA 1JWTA 2ESTE 4ZHLU 1MAYA 1MKXH 1EP6A 1BRBE 1CQQA 1CT2E 2HOBA 1O5AB 2EEKA 1OSSA 1Z8RA 1V2RT 1WUNH 1C9TA 4O3TA 1A61H 3MMGA 4NIVA 1EPTA 1K1IA 1QL8A 4RN6A 5CHAB 1O3NA 1KTSB 1GI1A 1O2TA 4BTTB 5JB8S 1P03A 2BZAA 2HLCA 2ZGHA 4JK6A 3LDXH 5FPTA 4FUCA 2F9BH 1BA8B 4IMZA 1NO9H 3RXOA 3SNDA 1C1SA 4UEHH 2EI8A 2PV9B 1N8OC 4DIIH 4ZHMU 3SNAA 4ZH8A 3VEQB 3EGKH 1SQAA 3SV8A 1C1TA 1CBWC 4ISNA 1GI3A 3ZVBA 3KQBA 1SQTA 1V2PT 1WAYB 5E0GA 2QXJA 5GCHF 3R0FA 1TGSZ 1VITH 2AEIH 1OOKB 3P17H 2HPPH 3LKWA 5GCHG 3QN7A 3W94A 1MQ6A 2Y80A 3NPSA 2J9NA 2OXSA 1HAPH 5PTPA 2M5TA 8GCHF 4Z6AH 1GBMA 3ZYEA 3UNSA 1DXPA 5FBIA 8GCHG 2XBXA 2OQUA 1YCPK 1OPHB 1HYLA 4IW4E 2RCEA 5EPYA 1KY9A 5DJ7A 1ZHPA 1EZXC 2BDCA 3HK6B 2PKSB 2BVSH 4Y10E 1CBWB 2XBVA 3SJ9A 3V13A 4VGCC 1THRH 2IOTA 1S5SA 1K1LA 6ESTA 5HYOA 2FOEA 2AERH 3HKJB 3I29A 1KSNA 4NZQA 1ANDA 1TMUH 3A86A 1O5GH 2XW9A 1AZZA 1B0EA 3E0PB 5T3HA 1LVBA 3K2UA 5IYTA 4AFUA 2CGAA 5C1YA 2SNWA 1SPJA 3S9CA 3QWCH 4MPWA 3SJKA 3QK1A 4X8UH 1GJDB 4WMEA 2FTLE 2OBQA 3M7UA 1RIWB 1HFDA 1ZTKA 6LPRA 2C8XB 1CE5A 1CA0C 3TJVA 4NZLA 3MH6A 4Q7ZA 3ZZ3A 4AORA 1EKBB 3SU0A 1O3CA 2PWXA 1GVKB 3KCGH 5A09A 2GZ8A 5JYIA 1FONA 1O2QA 3QGJA 1VCWA 1ZSKA 1O33A 3A82A 1JOUB 3A7XA 1W7XH 5A8ZA 1FXYA 4CRAA 1YPHE 1LQDB 2VIVA 4ABGA 4FU8A 4TY7A 2NU4E 3LJJA 2UWLA 2XTTB 4ISHH 1K28D 2RG3A 2WPKS 1PQ7A 1P2IA 1DWEH 1MU8B 4JZEH 3D23A 5HM9A 2ZI2H 2FZZA 4X6PA 3PMJA 1UTLM 3UR6A 1Z6JH 3UY9A 3GCHC 3MH4A 1JMOH 1YKTA 1A5GH 1EQ9A 3L6PA 2C3SA 2AH4X 2GCHF 1UO6A 1SLUB 2ZC9H 1QL9A 1F2SE 4AG2A 1DXWA 2GCHG 4ABJA 3A8DA 3GCNA 1OP2A 1QHRB 2OP9A 5GIBA 3EA7A 1ZMNA 3M61U 1BBRK 1Z71A 3URDA 2CN0H 4Y8ZA 2TRMA 1YPKH 2QYIA 2QV1A 3EDXB 1OWJA 1GWAA 1ZMLA 3ENSB 3SORA 1XVOA 2SFAA 2VWOA 1BMNH 4JYUH 1C5SA 1J14A 1MCTA 4Y11E 2BX3A 4MDSA 4ABAA 3KGPA 1A0HB 4AGJA 4FUEA 4LXBH 1QA0A 4FUFA 1ACBE 2R2WU 5L2YH 2ZZUH 2BYAX 1SGTA 2H1UA 1Y3UA 3GCHB 1BJUA 3RXCA 3SJIA 3NK8A 5EQRA 1ESTA 1TBRH 4B76A 1YCPM 2BVRH 4X1PU 4K60A 3N7OA 2SGPE 2BD7A 2ZF0H 3QUMP 5AFYH 4RKOB 2GCTC 3AASA 2XC4A 1T8LA 1BMMH 1IQLA 3ZVCA 1GBCA 4Y79A 1HAZB 1S6FA 1AB9C 1EJAA 2CMYA 2QA9E 1PQ5A 4GCHF 5EQQA 2AGIX 1D3PB 4B74A 4IGDA 4B2CA 4GCHG 1TGTA 3T26A 5FX5A 3MO9A 1UJ1A 3GYMA 5DGJA 5H4IB 3NUMA 1IQHA 1WU1A 2O8UA 3MI4A 1QY6A 4AYYB 5T6FA 1LCYA 1OP8A 2VWMA 4BANB 1EOLA 2P3TB 5A2MH 5C1UA 1VGCC 4CHAB 3RU4D 4BXWA 4WY3A 1DITH 2Y7ZA 3TGIE 3UQVA 2A32A 1YYY1 3T25A 1NY22 5JBBS 3M3TA 1J8AA 4QT8C 2RA3A 2ANYA 2QXGA 4A7IB 1BUIA 4JYTA 1ARCA 4YO9A 4DG4A 4UDWH 3P95A 1AB9B 3FZDA 1PPCE 3NKKA 2GD4B 4Y71A 1GJ8B 2ZFFH 3SV7A 1PQAA 2OUAA 2Q1JA 1C5NH 2ZCKP 4NIWA 1LVOA 3U9AH 4ABIA 3A8CA 4AZ2B 2PLXA 1HPGA 1Z6EA 2ZFPH 4Y7AA 4Y6DA 2TBSA 2G4TA 2W7SA 2RA0A 2ZGBH 1A3BH 2FODA 3SU2A 2FS9A 2OINA 1VGCB 4OS2A 3T2NA 1XX9A 1SGPE 2BD5A 3RXRA 3RXJA 1OYQA 3A89A 2W7UA 1O3MA 1O3LA 1C5TA 1SR5C 2XCNA 1C1NA 4IC6A 8ESTE 3DFJA 4I8JA 4YZUA 5GDSH 2BTCE 3BG8A 1XM1A 1HXFH 4A1XA 2AFQB 4AX9H 1GHBF 1SGEE 3ZZCA 3F9FA 2B5TB 1GHBG 1O2YA 1L4DA 1ELGA 1P2KA 1ZSJA 3ODDA 1P9SA 3PO1C 4CREA 4D76A 1E36B 1LHFH 1SQOA 4E06H 3EAJA 4NWKA 4UFDH 2BLWA 1IHSH 2WV5A 2NU2E 3MNXA 1ELDE 4HI3A 2A4GA 1YBWA 1TRYA 2QC2A 1CHOF 2ANMH 1GHXH 3C27B 4U01A 1MCVA 1YCPH 1CHOG 4ABHA 3H5CB 2IJOB 4DGJA 1O39A 2UWOA 1N6XA 1XUGA 4BTIB 5FPYA 1BTZA 1H8IH 1K2I1 1QBOA 1GDQA 2F9PA 4GHTA 2Q6GA 1GBLA 2B0FA 2P94A 3UNRA 4UFEH 1LPZB 2BDAA 3U8OH 1INCA 4CR5A 3TK6A 2VB0A 5DP6A 1O2UA 4KELA 3SV2H 1TIOA 3FVFB 1D6WA 3MOCA 1PPZA 3PO1B 1ESAA 1DX5M 1BZXE 1EASA 1G3EA 1V2TT 1W7GH 4KTCA 3UWIA 1TAWA 2NU0E 2WYGA 1ZZZA 2IPHA 1FLEE 1GCTB 2ZCLP 1OS8A 9ESTA 3Q3XA 3RMMH 1S6HA 2ZQ1A 1E35B 1VR1H 2P93A 1Y3WA 1FQ3A 1DICA 3MFJA 1HJAC 1P9UA 1T4VH 4B75A 2Z9JA 3PLKA 4RKJB 5EGMA 1RD3B 3TU7H 3U69H 1QNJA 1L0ZA 2P95A 2Z9GA 3HGPA 4O03A 1A46H 2QCYA 3ATWA 3GDVA 2UUYA 4DJZB 1LVMA 1GVLA 1BB0B 1VZQH 2FYQA 3EYDA 3BTTE 4I7YH 1MTUA 1O2GH 7ESTE 1Z8GA 1O2NA 1MTWA 1EAIA 2Y7XA 1NTPA 5BRRE 1IQIA 3D49H 2BDBA 1ANBA 4HZHA 1BT7A 3GY3A 4ZUHA 3U8TH 4X2YA 1F5LA 1DUEA 3PMHB 4ZROA 1TWXB 4NA7A 5J4QA 1S81A 1P09A 3LPRA 3UOPA 1TOMH 2FOCA 2XC0A 4Z0KA 1O3JA 4X2VA 3SQHE 1W10U 1HCGA 2UUJB 3RXMA 2O8LA 1AIXH 1XKAC 3LGIA 2PHBA 1IQJA 1FPCH 2VJ1A 5AFZH 3CS7A 1D4PB 1OXGA 1H9IE 1FY3A 3SGAE 4WVPE 3VXFH 5L2ZH 1PPFE 2AMQA 1P10A 3H7OA 3LGYA 3M7QA 1ZRBA 1SC8U 1GBFA 2G81E 3VB5A 3LU9B 3T27A 3ZZAA 1BBRH 1L1NA 3IWMA 3OSYA 1MTVA 4K69A 3A87A 7GCHF 5EXMA 2Z9KA 4WMFA 1GBJA 1ORFA 1ELAA 4GVUA 1KXFA 2BZ6H 7GCHG 4FVDA 3UIRA 3RM0H 2XRCA 4AFQA 4FVBA 3MU8A 1KXCA 1G3DA 1NU9A 4U32A 3U1IB 1RGQA 1HIAB 2SGAA 1F92A 1WYKA 2ZPSA 1IQEA 1GMHF 2YNBA 4WF8A 1AD8H 1XVMA 1GMHG 3RXLA 3F6UH 1QB6A 1T31A 1TBQH 1P04A 3H7TA 3MYWA 1AU8A 2AGGX 4OS6A 1O2XA 2BXTH 1P12E 1OYTH 2HNTC 4A6LA 2A2XH 4YLUA 3ZYDA 2GP9B 1RTFB 1WCZA 2BY6X 1EX3A 2QGRA 2XWAA 1KLTA 1BTWA 3T29A 4X1QU 1TNJA 4CRCA 2ZG0H 2AIQA 3I78A 3GCOA 1LHDH 1TGNA 3BTQE 2Z3DA 1M9UA 3BG4B 1H9LB 4A92A 2ULLA 3A8AA 1TMBH 1L1GA 2FOHA 4ZKSU 4DVAU 5FCKA 1CGHA 2SGEE 3B9FH 2A45B 2SGDE 5AF9H 5B6OA 3MWIU 4J1YA 4UONA 1TA6A 3TGKE 2H5DA 1SOTA 1JIRA 3S0NA 1TGBA 1W14U 3LC5A 1ZHMA 4J2YB 2BOHB 4XE4A 1ZPZA 3GDUA 5A0BA 2FIRH 3PTBA 4FUGA 2J94A 4I8GA 2O8TA 4INHA 2FXRA 1T8OA 1B7XB 1MD7A 2YNAA 3P8OA 2J92A 5T6GA 1O31A 2ZTZA 1UTPA 1Z8JB 3DA9B 2A5AA 1V2KT 1C2LA 2OCVB 3K6ZA 1NRNH 5CMXH 3UFAA 1O2SA 2C8ZB 2JH5D 4CRDA 1C5RA 4O9VA 2JH0D 2ZKSA 1QB1A 2FOFA 3JZ2B 2C93B 1CT0E 3RU4E 2Q6FA 3FFGA 2CHAC 2V3HH 1IHTH 6GCHF 2GTBA 1P3CA 3ZVEA 4OS7A 4TWWA 4AB8A 2H9HA 6GCHG 2ZHWH 1P02A 1AZ8A 2G5VA 3GISB 2GT8A 3DHKH 1C5QA 4YOJA 1SL3A 4WXVA 1OWHA 4X1NU 5DP9A 2A1DB 2BQ6B 2FI5E 2VWNA 1AQ7A 2TGPZ 1AFEH 2IN2A 2SGQE 2G5NA 3SU4A 4A5TS 3E1XB 3R3GB 3VFEA 5EU8A 3HPTB 1HIAA 1N6YA 2BQWB 1T32A 2A4RA 1KDQB 2BB4A 3M5NA 2FS8A 1BTHH 1C9PA 1MUEB 5F8ZA 3SU5A 1C1PA 1DM4B 1E38B 1XKBC 2F9UA 2KAIA 4I31A 3RXDA 2Z94A 5DP3A 2G51A 3QZRA 4DOQA 1F0UA 2FP7B 2ZP0H 2BX4A 1AVXA 1FY1A 1YGCH 4BXSA 1RRKA 2J38A 1GVZA 1XUFA 3TH4H 2D26C 2EI7A 4U2WA 1BHXB 2ZU5A 1GBIA 1Z1JA 1F0SA 4BOHA 1GJAB 1GBEA 1A0LA 3A8BA 1K1PA 1N8OB 4O97A 1NRPH 1O3DA 4WMDA 3SN8A 3UREA 2Y82A 4F4OC 1QJ1B 2A4OA 2A7JA 4LZ1H 3MH7A 1MQ5A 4Y7BA 2ZU4A 1NU7B 2PFEA 4AOQA 2STAE 3UQOA 1SGDE 4HFPB 1ETSH 4CH2B 1LQEA 1W2KH 4KP0A 2O8WA 3FP7E 1O35A 1TQ0B 3MNCA 2DE9A 4TPYA 3GY6A 3E6PH 2FYRA 5C2ZA 4X2WA 1S0RA 3SI3H 3BTEE 4UFGH 4K5ZA 3Q3KA 4NA9H 3SV6A 2WUCA 1Y5AT 1O2MA 1GDUA 3GY2A 1DY9A 1SFQB 1C1RA 1TPAE 3BF6H 2HALA 3FANA 1KXDA 1SGRE 1C5WB 4IMQA 1P0SH 3E91A 5SGAE 1E34B 2R9PA 1FJSA 3VB6A 1C1QA 4VGCB 1A3EH 1RTKA 2Z9IA 1SHYA 3ZZ7A 1UVUH 2CF9H 1AE8H 1TGCA 2ASUB 1FIZA 1QQ4A 5E0HA 1AUJA 4WXIA 2P59A 2A5IA 1SLVB 1V2MT 5ESBA 1MZAA 1O2OA 2VH6A 4K1SA 1V2QT 1ELTA 1ID5H 1V6DA 1O32A 5L6NH 4ESTE 3TITA 2VH0A 1KLIH 2ZHEH 3AW1A 2OQ5A 1DFPA 1FMGA 1EJMA 1TNIA 3ZZ9A 4DURA 1HBTH 4BAHB 3P6ZB 2P3FH 4X8TH 3A88A 1WQVH 2WPHS 4WH6A 1UCYK 1ANCA 2P8OC 3MO6A 1O3PB 1NFXA 3QTOH 1RFNA 1DOJA 4MTBA 4B1TA 1CA0B 1NESE 1W3CA 3Q00A 2HWLB 1WTHD 1G3BA 3LH3A 3RLWH 1C4U2 1KDQA 4NA8A 3P8FA 4ZKRU 2ZFTA 3LGTA 1GI5A 1F0RA 1K9OE 2FX4A 1Y3XA 3MU4A 1C2HA 2BD9A 1Y3YA 3DFLA 1SGFA 1GGDC 1O3KA 2QXIA 2VIQA 3RUOA 1QURH 3BTGE 4NFEA 2JH6D 3TNTA 1K22H 1AI8H 1ZTJA 2OTVA 2UWPA 1DLKB 1BBRE 2TIOA 3PYHA 2H9EH 1K1JA 1UMAH 2ZDMA 1A2CH 1O30A 2Y6TA 1X7AC 2C90B 4WJG2 2P8OB 3PLPA 3S7KB 1TX6A 2V0BA 3QO6A 4DY7B 4D7FA 2PTNA 2WPIS 2PUQH 5F8XA 1FIWA 1NS3A 1FY5A 4CBNA 3B23B 1Y3VA 5GXPA 1G36A 3W95A 1GGDB 3UWJH 3QDZB 2QF0A 3BEIB 1QA7A 4TYDA 1GJBB 1UTJA 2R3UA 2V6NA 5GJ4B 2OC7A 3M7TA 4Q80A 1HB0B 3VB7A 1HAIH 2D8WA 5JDUB 1LHGH 1U6QA 3RXPA 3SGQE 1O0DH 1QJ6B 5EODA 1GBBA 2V3OH 4ISOA 4ZKNU 1GI4A 1LPKB 1P06A 1FDPA 3SU6A 2FM2A 3ZZ8A 4NSVA 1C2GA 4K8YA 1JRSA 3PMBB 1Z1IA 2F9VA 3MH5A 3STJA 3BTWE 2OD3B 2ZFSA 3K65B 1IOEA 5F8TA 3VB3A 1SGYE 4GAWA 2GCTB 2ZNKH 1YPGH 2Z9LA 5DKMA 1GMDF 2ZIQH 2VNTA 3ZVDA 3E16B 1C1VH 3SO3A 1NRSH 1WOFA 1C2EA 1GMDG 2SGFE 5DPAA 1G2LA 2QN5T 3EA8A 2FLBH 3PB1E 1CSOE 5EW1H 5E0JA 1WQSA 3ATMA 1NT1A 3RMNH 1VJ9U 1O2PA 1YP9A 1ZHRA 3GDSA 2PUXB 5C5OA 3RXIA 3ZV8A 4X2XA 1C1WH 2JETC 3GY5A 1ZJKA 5AHGH 4OS1A 3AW0A 2ILNA 4XBDA 1A7SA 1C2DA 2NWNA 3MTYA 1DT2A 1OWEA 2BDGA 2XC5A 3KN2A 1C5LH 2ZDLA 2FMJA 2RDLA 4X8SH 1KXBA 1SVPA 5C67A 3URCA 2P16A 1E0FD 3LOXA 4NWLA 1DSTA 1EAXA 2R2MB 1GHWH 3AAUA 3M37A 4JZDH 2B8OH 1O5FH 1P05A 4ASHA 1O2HA 1BTXA 1GJ4H 3KQEA 3FP8E 1O2IA 5EXNA 1GBKA 3BTKE 1S84A 1EP5A 1UHBB 1TABE 2ZDAH 4WH8A 2BDHA 1AN1E 1Y5UT 4YOIA 5DG6A 1O2JA 2PKAB 2BLOA 3UR9A 4D7GA 5DO4H 2ANWA 1O2LA 1BTPA 4Q2KA 1GHZA 1P01A 2ZGCA 1UTQA 1AO5A 2JETB 2WYJA 4I8HA 1BRAA 1HUTH 1EZQA 1H9HE 2XBWA 3F68H 3FZZA 3RC5A 3SNBA 3P8GA 1DWCH 9LPRA 2OC0A 2JKHA 1QBNA 1TNHA 1TX8A 4FU7A 1AFQC 4GSOA 4YOGA 1O2KA 3RXSA 2C8WB 3PWBA 1DWDH 2XNIA 4YESB 1NRQH 1G32B 1GHYH 1V2WT 5FXLA 3SV9A 1JBUH 1ZYOA 4XDEA 3MO3A 3K9XB 1C2MA 1EAUA 1LTOA 4AN7A 3Q76A 1P2QA 3OY5U 1NROH 1MBQA 3TK5A 1V2JT 3SNEA 1SFIA 1O3AA 4B71A 3OTJE 3D62A 2BLQA 1JIMA 2TPIZ 2F91A 3CS0A 1ZOMA 1O3HA 2OLGA 3O8RA 4H4FA 1O2WA 5LPRA 3OU0A 1UTMA 1C4V2 2ZU1A 1SI5H 2V35A 1PFXC 1O36A 1C1MA 2NU1E 2BOKA 4IC5A 2WPJS 3PTNA 3BIVH 1ESBA 1ELFA 1NFUA 1GI7B 1O3FA 1ZSLA 3GY7A 3O8DA 4PROA 3SGBE 2BD4A 3TJUA 1YPHC 1EAWA 1OWKA 3NZIA 3HATH 3PWCA 1C5XB 2Y5GA 3UPEA 4BAOB 1F5KU 4UD9H 1THSH 1SGQE 4R0IA 2J4IA 1CO7E 1BTYA 4X6NA 2ZHQH 2FPZA 1GBAA 1N1LA 2XWBI 1P3EA 1SGIB 4I8KA 1YF4A 3BTHE 5K7RA 3SHCH 1HJAB 3ATLA 1UCYH 3E0NB 3VGCC 1EPTC 2AS9A 7LPRA 2A4QA 4HTCH 3GY4A 1O37A 1B0FA 3KQCA 2Z3CA 3TNSA 4CRGA 1UHBA 1QGFA 1UK3A 2FOBA 3RXFA 4A1VA 5T6DA 3E90B 2HVXA 2FOMB 2PKAA 2GDEH 3E8LA 1ABIH 4ZHAA 3KIDU 5DP7A 5FX6A 1K1OA 1ZR0A 1ZMJA 1IAUA 4H6TA 1TX7A 2VVCA 2CXVA 3DT0H 1LKAA 1AKSB 1V2UT 2H5CA 1P11E 1H8DH 1IQGA 1V2VT 2H9TH 4E7RG 1BIOA 2D2DA 3SUEA 3VGCB 1DUAA 1EPTB 3ZVFA 4DCDA 1MZDA 1QIXB 1VCPA 3QLPH 4HGCA 3TGJE 1GJCB 3MNBA 4GHQA 4WWYA 1V2OT 2WUBA 2ZPRA 3RC4A 3EE0B 3UTUH 8LPRA 4UFFH 1GI0A 1GI6A 4I33A 3S9AA 4TPIZ 2ANKH 1AUTC 1MH0A 3QTVH 1MAXA 5JPMH 1KYNA 1V2ST 2ODYB 2ALPA 5EW2H 3QX5H 2XBYA 2PR3A 1C5UA 1VJAU 3MU1A 1PYTC 1TNKA 2EI6A 1MMJN 2F83A 3A7ZA 3JZ1B 1E37B 1ELEE 4TWYA 2FI4E 2BVXH 1BOQA 2H2ZA 5ETXA 1C2JA 1TPOA 1Z7KA 4DT7B 2ZFRH 3A7VA 4OGYA 1GBHA 5JBTA 1ZPBA 1SHHB 4MNYA 1AWHB 1SGFG 1HAHH 1TRNA 2ZGJA 2D1JA 4DIHH 1XUJA 2BY9X 3RDZA 1ETRH 1QR3E 1FV9A 5DP5A 2Z3EA 1FZZA 3SBKA 3STIA 5CE1A 3PMAB 3DUXH 1AVWA 1D3TB 2R3YA 3NXPA 5EPNA 6CHAC 3G01A 1SB1H 5FBEA 1VITF 3TK9A 4CBOA 1BHXF 1CGJE 4MG3A 3V7TA 1C5YB 1H1BA 4SGAE 1VITG 4B2AA 3GOVB 2LPRA 4ZXXH 2PGQB 1MD8A 1O3OA 5CHAC 4X1RU 3KF2A 3RP2A 1FI8A 1P57B 4BAKB 1FAKH 1S85A 4JCNA 1HXEH 2ZEBA 3O8CA 2TGTA 1YPMH 2ZGXH 1NFYA 1UVOA 1LDTT 1O2VA 4THNH 5L30H 1O3EA 1QTFA 4BTUB 2GKVE 2ZDNA 1Q31A 1PJPA 1LMWB 1XXFA 3S7HB 2A31A 4NIXA 3CP7A 2FOGA 2K1QA 2R0KA 2ZA5A 1NC6A 5ABWA 1NPMA 4DW2U 3ODFA 3FAOA 1AKSA 2XYAA 2AMDA 4FUIA 1MBMA 1BJVA 4LZ4B 4AFSA 1KXAA 4Y8XA 1O34A 5GPIB 3TPIZ 1F7ZA 1HAVB 4NCYA 4YLQH 3PROA 2BMGB 2QXHA 4MLFB 1Y8TA 1FY4A 4CH8B 2FO9A 2A5KA 1NM6A 2BD2A 1C5PA 2B9LA 4K8BA 1UK2A 1TRMA 5I46H 2CHAB 5ESTE 1NFWA 1C5MD 1LPGB 1ABJH 1KXEA 3A81A 3ZZ5A 3P70B 4Y0ZE 2FOAA 1W11U 3O8BA 1NN6A 2PKSC 1ZRKA 4Q7XA 1MTNC 2BY5X 1YPEH 3M5OA 1QJ7B 2ZTXA 2ZDKA 4MPVA 3LH1A 3F1SB 4E05H 3TH3H 1TNLA 4MPXA 2VWLA 1O2ZA 3NCLA 2A7CA 2TGDA 4MQAA 2OC8A 1CA8B 3KL6A 1NRRH 3F9EA 1SOZA 3E3TA 2A2QH 1Q2WA 1GCDA 1LHEH 2VINA 1FUJA 4XOJA 3K6YA 3IITA 3GYLB 3VXEH 1J9CH 4D9RA 1SLWB 3SJOA 2BLVA 4ISLA 2QY0B 1RIWC 3RXTA 3PLBA 1G2MA 3AVZA 3KQDA 3ZZ4A 3L33A 3LT3A 3P92A 3BIUH 4AYVB 3SUDA 3ZZBA 3TJNA 1HDTH 4JYVH 3EA9A 3B8JA 1MTNB 1SGCA 1QFKH 4K1EA 3T62A 5A0AE 3FP6E 2ZU3A 1JXPA 1O5EH 2QAAA 2XXLA 1J17T 4ZAEA 1GHAF 4AFZA 3ATIA 2XCFA 1GHAG 2FDAA 1K21H 1YPLH 1A5IA 1MTSA 1HAGE 2GGVB 1DVAH 2GDDA 1OP0A 4F49A 2Y81A 2QF3A 1Y59T 4XFQA 1DANH 1JRTA 5J4SA 2GV6A 3RXQA 5TCAA 1HNEE 2BHGA 1EZUC 3GCTF 5A8XA 4X6MA 1AE5A 1ZGVA 3GCTG 3SZNA 5FHTA 2UUFB 3LGUA 2BD3A 4B2BA 1GG6C 4O3UA 1TLDA 4BAMB 1DSUA 1TMTH 3BTDE 1P2OA 3M3VA 4KKDA 3LC3A 1TE0A 3RXHA 2PGBB 1TPSA 4JZ1A 3V12A 2I6QA 3TH2H 1YLDA 2FLRH 1YC0A 2WPMS 3M5MA 3BEFB 1RTLA 4YTAA 1LHCH 1QB9A 4AGKA 1UK4A 4XSKU 2STBE 4FUHA 2BY8X 1MKWH 3ZVAA 1D3DB 1P2NA 1HAVA 2A0QB 1UCYE 1ANEA 1L1JA 1PPBH 1DDJA 5DP4A 3F9GA 1O3IA 3ZV9A 8KME2 1CGIE 3SUFA 3QZQA 1P2MA 2O8MA 2ZQ2A 3HKIB 3A7YA 3TJOA 2AIPA 3LIWA 3ZZDA 3Q77A 4FUJA 1VCQA 1CHGA 5A8YA 1G9IE 1GG6B 4JZIA 1T7CA 1FN6A 2OBOA 1GI2A 5HMAA 4ABFA 3WY8A 3UOUA 3EQ0H 2BQ7B 2VIDA 1PQ8A 2W3KA 3UUZA 2FWWA 4H6SB 1DS2E 2CV3A 4ZMAH 4JZFH 1GPZA 2ALVA 4GLYA 1G3CA 1T8NA 4NIYA 1D9IA 2AMPA 1UVPA 5GWZA 1IQNA 1A0JA 3PV4A 1LO6A 5JBCS 3MHWU 4NSYA 1EB2A 4TY6A 4ABEA 4CRFA 1SG8B 1EOJA 2DE8A 5G4BA 1XUHA 5E8EH 1A5HA 4NG9H 3SU1A 1S83A 3KEEA 5DP8A 1Y5BT 2PSXA 1ZPCA 2ZHDA 3L3TA 4NFFA 4CHAC 1MU6B 4R8TB 2ZECA 5JB9S 1SLXB 2ZCHP 3TLOA 1S0QA 3RXUA 1AGJA 1T4UH 2HRVA 4Y76A 2NU3E 1H4WA 1BQYA 4UE7H 5EQSA 2SNVA 1SSXA 5F6MA 1BDAA 1KIGH 3RU4T 2VVVA 3SJ8A 1L2EA 3U1JB 2HNTE 1AHTH 3U98H 3VPKA 2Q6DA 5JBAS 4GPGA 1BCUH 1SBWA 4AB9A 1YPJH 3M3SA 4M7GA 2BY7X 3RXAA 1RXPA 2PTCE 3BV9B 5LH8A 3SI4H 4X6OA 5HXFA 2EC9H 1HRTH 5EOKA 3RXBA 1C4Y2 1GL0E 4LK4A 1W13U 1W8BH 1WBGB 3RXKA 3BTFE 3BSQA 3PM3A 1XXDA 3A85A 1ETTH 2J34A 3DD2H 1Q3XA 2PW8H 1BITA 4K1TA 1EUFA 5HM2A 1GMCF 2PSYA 2THFB 1TA2A 3RXVA 1XUIA 1GMCG 1W0YH 2BXUH 2F9NA 1EZSC 4IN2A 4BNRA 2J2UA 3T28A 1FN8A 3OX7U 1BRCE 1WTGH 5AVDA 5DK1A 1OX1A 2ZPQA 1O5BB 1Z8IB 4FUBA 1O2RA 3SNCA 3AAVA 3U8RH 4YT7H 1F0TA 1THPB 1MKXK 2GZ9A 1BMLA 1CU1A 1ZLRA 4ZXYH 1O3BA 1HV7A 1GJ9B 1UTOA 2I6SA 3ZZ6A 4A1TA 1GI9B 4RSPA 2UUKB 4ABDA 2LNCA 2ZTYA 1TFXA 3VB4A 2O9QA 3HK3B 1UTNA 2F3CE 3C1KA 3LJOA 3Q3YA 1IQFA 2HGTH 4NGAH 3V3MA 1DWBH 1D6RA 4ISIH 5LPFA 4IS5A 1F5RA 2G52A 1ELVA 1EXFA 1TB6H 1W12U 2GX4A 1GCTC 4FXGH 5C1XA 3LGVA 4YT6H 2ZDVH 1TPPA 1AY6H 2R0LA 3SQEE 4FUDA 5HGGA 2VGCC 3TIUA 1HAOH 3BEUA 3GICB 3SU3A 3RLYH 3MU5A 3RXEA 1C5VA 5C3NA 3S9BA 4INLA 1AVGH 3ESTA 4XBCA 4CR9A 4Q7YA 2GV7A 4I8LA 2G55A 1XUKA 2Y5FA 1GL1A 4KGAA 1DPOA 2VU8E 4IN1A
chains in the Genus database with same CATH superfamily
2W5EA 2FEQH 2ODQA 3LONA 1AFQB 4MNWA 5FPSA 3T5FH 2BDYA 2H6MA 4CRBA 4LOYH 1ARBA 2GVFA 5E2OA 5K0HA 4YM9A 4OS4A 5IDKA 4ABBA 3KHVA 2F9OA 2C4FH 4MNXA 1A1RA 3BN9A 1DY8A 5T1VA 1RS0A 5F03A 5C94A 4OGXA 4I32A 1OWIA 1TNGA 2BDIA 3SUGA 2VGCB 3V0XA 2FX6A 3SYJA 2Y5HA 2VVUA 2ZHFH 1GBDA 3A7WA 5TJXA 1AWFH 1DE7H 2WPLS 1KLJH 2P3UB 1EB1H 1L4ZA 5A0CA 3S69A 1GJ6A 3A83A 1B5GH 2G4UA 3IG6B 3RXGA 1P2JA 2FI3E 5EXLA 2AYWA 2ZO3H 1AMHA 2DUCA 2BM2A 1QBVH 4H42U 1ZGIA 1HAYB 1T8MA 3M5LA 1K1MA 1YM0A 5LPEA 2G8TA 1C1OA 2OC1A 5BPEA 1O38A 1SGNE 1V3XA 4KTUA 1MKWK 2J98B 3SW2B 1TALA 2GMTC 1D3QB 5I25A 4MNVA 1HJ8A 2CJIA 1C5ZB 4K2YA 1C2KA 1ELCA 5FCRA 4KTSA 1O3GA 2C8YB 2HNTF 1PPGE 1QRZA 1J16A 5TCCA 4X0WU 1LVYA 3MU0A 1BMAA 1UVSH 3NRLA 1TONA 1QRWA 1FNIA 1DLEA 1WV7H 1NZQH 2VIOA 4MPUA 3F9HA 5C20A 3I77A 2JJ2D 1EATA 1CT4E 2IJD1 1QRXA 2FTMA 1FY8E 2EA3A 4U30A 4ZKOU 1TOCB 1OHHD 1GJ5H 3ZVGA 3M36A 2ZU2A 1BMFD 1CVWH 2V7QD 1C2IA 2GMTB 4FU9A 4B73A 5C5NA 2FESH 3BG4C 1TQ7B 1OWDA 1G37A 3UNQA 1BRUP 3RMOH 1EJNA 1UTKA 2VIWA 1IQMA 1V2LT 2KAIB 1LKBA 2WINI 2Z7FE 5EG4A 1J15A 1G30B 1V2NT 2Z6BD 4OS5A 1YLCA 4BAQB 1HLTH 4MVNA 4Q63A 1PYTD 2BD8A 1RJXB 1C2FA 5C0UA 2CF8H 1GI8B 1KTTB 3HGNA 3P8NA 1FAXA 3F3BA 3RC6A 4E7NA 3KNXA 3LGWA 4ACBA 3MNSA 5LGOA 2W26A 3A7TA 2B7DH 3UAIC 3A84A 1HGTH 4JMYA 1C5OH 3QGNB 1GJ7B 1C1UH 1QQUA 2G00A 2ODPA 3CENA 1QCPA 1GBTA 1K1NA 4IBLH 4X8VH 5E2PA 1TBZH 4XBBA 4Y8YA 2WV4A 1OKXA 1GHVH 3M35A 1P8VC 1HJ9A 4JK5A 2W3IA 3RMLH 1O5DH 5FAHA 3EE7A 4GUXA 3D65E 3ATKA 1S82A 2VIPA 1W0ZU 1A4WH 2TGAA 3ITIA 3OY6U 3RM2H 3NWUA 3ELAH 1TYNA 4SGBE 3BTME 4INKA 4X1SU 4Y0YE 1IQKA 1GDNA 1PPEE 1BTUA 2ZWLH 4K3JA 1O5CB 3TVJB 1UVTH 1ZTLA 1HAXB 3GY8A 2QIQA 7KMEH 1ELBA 2AGEX 1SMFE 2A7HA 1QL7A 1XMNB 2YOLA 2J98A 5B6LA 2GT7A 1FPHH 1ZJDA 2GZ7A 3OYPA 4D8NA 2J95A 1WSSH 2ZFQH 3A80A 1NBMD 4AG1A 3SHAH 1PPHE 2HPQH 6CHAB 4D9QA 3SOSA 1JWTA 2ESTE 4ZHLU 1MAYA 1MKXH 1EP6A 1BRBE 1CQQA 1CT2E 2HOBA 1O5AB 2EEKA 1OSSA 1Z8RA 1V2RT 1WUNH 1C9TA 4O3TA 1A61H 3MMGA 4NIVA 1E79D 1EPTA 1K1IA 5GNDA 1QL8A 4RN6A 5CHAB 1O3NA 1KTSB 1GI1A 1O2TA 4BTTB 5JB8S 1P03A 2BZAA 2HLCA 2ZGHA 4JK6A 3LDXH 5FPTA 4FUCA 2F9BH 1BA8B 4IMZA 1NO9H 3RXOA 3WWBA 3SNDA 1FX0B 1C1SA 4UEHH 2EI8A 2PV9B 1N8OC 4DIIH 4ZHMU 3SNAA 4ZH8A 3VEQB 3EGKH 1SQAA 3SV8A 1C1TA 1CBWC 4ISNA 1GI3A 3ZVBA 3KQBA 1SQTA 1V2PT 1WAYB 5E0GA 2QXJA 5GCHF 3R0FA 1TGSZ 1VITH 1YWUA 4I86A 2AEIH 1OOKB 2CK3D 3P17H 2HPPH 3LKWA 5GCHG 3QN7A 3W94A 1MQ6A 2Y80A 3F2GA 3NPSA 2J9NA 2OXSA 1HAPH 5PTPA 2M5TA 8GCHF 4Z6AH 1GBMA 3ZYEA 3UNSA 1DXPA 4FETA 4ASUD 1S6LA 5FBIA 8GCHG 2XBXA 2OQUA 1YCPK 1OPHB 1HYLA 4IW4E 2RCEA 5EPYA 3H09A 1KY9A 5DJ7A 1ZHPA 1EZXC 2BDCA 3HK6B 2PKSB 2BVSH 4Y10E 1CBWB 2XBVA 3SJ9A 3V13A 4VGCC 1THRH 2IOTA 1S5SA 1K1LA 2XNDD 6ESTA 5HYOA 2FOEA 2AERH 3HKJB 3I29A 1KSNA 4NZQA 1ANDA 1TMUH 3A86A 1O5GH 2XW9A 1AZZA 1B0EA 3E0PB 5T3HA 1LVBA 3K2UA 2J97A 5IYTA 4AFUA 2CGAA 5C1YA 2SNWA 1SPJA 3S9CA 3QWCH 3CNRA 4MPWA 3SJKA 3QK1A 4X8UH 1GJDB 4WMEA 2FTLE 2OBQA 3M7UA 1RIWB 1HFDA 1ZTKA 6LPRA 2C8XB 1CE5A 1CA0C 2EQNA 3TJVA 4NZLA 3MH6A 4Q7ZA 3ZZ3A 4AORA 5DN6D 1EKBB 3SU0A 1O3CA 2PWXA 1GVKB 2F4LA 3KCGH 5A09A 2GZ8A 5DSFA 5JYIA 1FONA 1O2QA 4RI0A 3QGJA 1VCWA 1ZSKA 1O33A 3A82A 1JOUB 3A7XA 1W7XH 5A8ZA 1FXYA 4CRAA 1YPHE 1LQDB 2VIVA 4ABGA 4FU8A 4TY7A 2M2AA 2NU4E 1VKYA 3LJJA 2UWLA 2XTTB 4ISHH 1K28D 2RG3A 5EJ1A 2WPKS 1PQ7A 1P2IA 1DWEH 1MU8B 4JZEH 3D23A 5HM9A 2ZI2H 2FZZA 4X6PA 3PMJA 1UTLM 3UR6A 1Z6JH 3UY9A 3GCHC 3MH4A 1JMOH 1YKTA 1A5GH 1EQ9A 3L6PA 3OEHD 3DSGA 2C3SA 2AH4X 2GCHF 1UO6A 1SLUB 2ZC9H 1QL9A 1F2SE 4AG2A 1DXWA 2GCHG 4ABJA 3A8DA 3GCNA 1E1QD 1OP2A 1QHRB 2OP9A 5GIBA 3EA7A 1ZMNA 3M61U 1BBRK 1Z71A 3URDA 2CN0H 2L6OA 4Y8ZA 2TRMA 1YPKH 2QYIA 2QV1A 3EDXB 1OWJA 1GWAA 1ZMLA 3ENSB 3SORA 1XVOA 2SFAA 2VWOA 1BMNH 4JYUH 1C5SA 1J14A 1MCTA 4Y11E 2BX3A 4MDSA 4ABAA 3KGPA 1A0HB 3GS9A 4AGJA 4FUEA 4LXBH 1QA0A 4FUFA 1ACBE 2QE7D 2R2WU 5L2YH 2ZZUH 2BYAX 1SGTA 2H1UA 1Y3UA 3GCHB 1BJUA 3UB0A 3RXCA 3SJIA 3NK8A 5EQRA 1ESTA 1TBRH 4B76A 1YCPM 2BVRH 4X1PU 4K60A 3N7OA 2SGPE 2BD7A 2ZF0H 3QUMP 5AFYH 4RKOB 2GCTC 3AASA 2AHME 2XC4A 1T8LA 2EY4C 1BMMH 1IQLA 3ZVCA 1GBCA 4Y79A 1HAZB 1S6FA 1AB9C 1EJAA 2CMYA 2QA9E 1PQ5A 2XOKD 4GCHF 2AGIX 1D3PB 5EQQA 4B74A 4IGDA 4B2CA 4GCHG 1TGTA 3T26A 5FX5A 3MO9A 1UJ1A 3GYMA 5DGJA 5H4IB 3NUMA 1IQHA 1WU1A 2O8UA 3MI4A 1QY6A 4AYYB 5T6FA 1LCYA 1OP8A 2VWMA 4BANB 1EOLA 2P3TB 5A2MH 5C1UA 1VGCC 4CHAB 3RU4D 4BXWA 4WY3A 2WHXA 1DITH 4TT3D 2Y7ZA 3TGIE 3UQVA 2A32A 1YYY1 3T25A 1NY22 5JBBS 3M3TA 1J8AA 4QT8C 2RA3A 2ANYA 2QXGA 4A7IB 1BUIA 4JYTA 1ARCA 4YO9A 4DG4A 4UDWH 3P95A 1AB9B 3FZDA 1PPCE 3NKKA 2GD4B 4Y71A 1GJ8B 1WXRA 2ZFFH 3SV7A 1PQAA 2OUAA 2Q1JA 1C5NH 2ZCKP 4NIWA 1LVOA 3U9AH 4ABIA 3A8CA 4AZ2B 2PLXA 1HPGA 1Z6EA 2ZFPH 4Y7AA 4Y6DA 2TBSA 2G4TA 2K0QA 2RA0A 2W7SA 2ZGBH 1A3BH 2FODA 3SU2A 2FS9A 2OINA 1VGCB 4OS2A 3T2NA 1XX9A 1SGPE 2BD5A 3RXRA 3RXJA 1OYQA 3A89A 2W7UA 1O3MA 1O3LA 1C5TA 1SR5C 2XCNA 1C1NA 4IC6A 8ESTE 3DFJA 4I8JA 4YZUA 5GDSH 2BTCE 3BG8A 4RT1A 1XM1A 1HXFH 4A1XA 2AFQB 1NBME 4AX9H 1GHBF 1SGEE 3ZZCA 3F9FA 2B5TB 1GHBG 1O2YA 1L4DA 1ELGA 1P2KA 1ZSJA 3ODDA 1P9SA 3PO1C 4CREA 4D76A 1E36B 1LHFH 1SQOA 4E06H 3EAJA 4NWKA 4UFDH 2BLWA 1IHSH 2WV5A 2NU2E 3MNXA 1ELDE 4HI3A 4RT0A 2A4GA 1YBWA 1TRYA 2QC2A 1CHOF 2ANMH 1GHXH 3C27B 3DSPA 4U01A 1MCVA 1YCPH 3PV5A 1CHOG 4ABHA 3H5CB 2IJOB 4DGJA 1O39A 2UWOA 1N6XA 1XUGA 4BTIB 5FPYA 5C17A 1BTZA 1H8IH 2YMSC 1K2I1 1QBOA 1GDQA 2F9PA 4GHTA 2Q6GA 1GBLA 2B0FA 2P94A 3UNRA 4UFEH 1LPZB 2BDAA 3U8OH 1INCA 4CR5A 3TK6A 2VB0A 5DP6A 1O2UA 2LELA 4KELA 3SV2H 1TIOA 3FVFB 1D6WA 3MOCA 1PPZA 3PO1B 1ESAA 1DX5M 1BZXE 1EASA 1G3EA 1V2TT 1W0JD 1W7GH 4KTCA 1TAWA 5EJLA 3UWIA 2NU0E 2WYGA 1ZZZA 2IPHA 1FLEE 1GCTB 2ZCLP 1OS8A 9ESTA 3Q3XA 3RMMH 3DSOA 1S6HA 2ZQ1A 1E35B 1VR1H 2P93A 1YLNA 1Y3WA 1FQ3A 1DICA 3MFJA 1HJAC 1P9UA 1T4VH 4B75A 2Z9JA 3PLKA 4RKJB 5EGMA 1RD3B 2YMSB 3TU7H 3U69H 1QNJA 3DCLA 1L0ZA 2P95A 2Z9GA 3HGPA 4O03A 1A46H 2QCYA 3ATWA 3GDVA 2UUYA 4DJZB 1LVMA 3N7EA 1GVLA 1BB0B 1VZQH 2FYQA 3EYDA 3BTTE 4I7YH 1MTUA 1O2GH 7ESTE 1Z8GA 1O2NA 1MTWA 1EAIA 2Y7XA 1NTPA 5BRRE 1IQIA 3D49H 2BDBA 1ANBA 4HZHA 1BT7A 3GY3A 4ZUHA 3U8TH 4X2YA 1F5LA 1DUEA 3PMHB 4ZROA 1TWXB 4NA7A 5J4QA 1S81A 1P09A 3LPRA 3UOPA 1TOMH 2FOCA 2XC0A 4Z0KA 1O3JA 4X2VA 3SQHE 1W10U 1HCGA 2UUJB 3RXMA 2O8LA 1AIXH 1XKAC 3LGIA 2PHBA 1IQJA 1FPCH 4XD7D 2VJ1A 5AFZH 3CS7A 1D4PB 1OXGA 1H9IE 2KM0A 1FY3A 3SGAE 3KYFA 4WVPE 3VXFH 5CHBA 5L2ZH 1PPFE 2AMQA 1P10A 3H7OA 3LGYA 3M7QA 1ZRBA 1SC8U 1GBFA 2G81E 3VB5A 3LU9B 3T27A 3ZZAA 1BBRH 1L1NA 3IWMA 3OSYA 1MTVA 4K69A 3A87A 7GCHF 5EXMA 2Z9KA 4WMFA 1GBJA 1ORFA 1ELAA 4GVUA 1KXFA 2BZ6H 7GCHG 4FVDA 3UIRA 3RM0H 2XRCA 4AFQA 4FVBA 3MU8A 3W1EA 1KXCA 1G3DA 1NU9A 4U32A 3U1IB 1RGQA 1HIAB 2SGAA 1F92A 3KQ5A 1WYKA 2ZPSA 1IQEA 1GMHF 2YNBA 4WF8A 1AD8H 1XVMA 1GMHG 3RXLA 3F6UH 1QB6A 1T31A 1TBQH 1P04A 3H7TA 1UW7A 3MYWA 1AU8A 2AGGX 4OS6A 1O2XA 2BXTH 1P12E 1OYTH 2HNTC 4A6LA 2A2XH 4YLUA 3ZYDA 2GP9B 1RTFB 1WCZA 2BY6X 1EX3A 2QGRA 2XWAA 1KLTA 1BTWA 3T29A 4X1QU 1TNJA 4CRCA 2ZG0H 2AIQA 3I78A 3GCOA 1LHDH 1TGNA 3BTQE 2Z3DA 1M9UA 3BG4B 1H9LB 3VG8A 4A92A 2ULLA 3A8AA 1TMBH 1L1GA 2FOHA 4ZKSU 4DVAU 5FCKA 1CGHA 2HVYB 2SGEE 3B9FH 2A45B 2SGDE 5AF9H 5B6OA 3MWIU 4J1YA 4UONA 1TA6A 3TGKE 2H5DA 1SOTA 1JIRA 3S0NA 1TGBA 1W14U 3LC5A 1ZHMA 4J2YB 2BOHB 4XE4A 1ZPZA 3GDUA 5A0BA 2FIRH 3PTBA 4FUGA 2J94A 4I8GA 2O8TA 4INHA 2FXRA 1T8OA 1B7XB 1MD7A 2YNAA 3P8OA 2J92A 5T6GA 1O31A 2ZTZA 1UTPA 1Z8JB 3DA9B 2A5AA 1V2KT 2HLDD 4B6FA 1C2LA 2OCVB 3K6ZA 1NRNH 5CMXH 3UFAA 1O2SA 2C8ZB 2JH5D 4CRDA 1C5RA 4O9VA 2JH0D 2ZKSA 1QB1A 2FOFA 3JZ2B 2C93B 1CT0E 3RU4E 2Q6FA 3FFGA 2CHAC 2V3HH 1IHTH 2WZQA 6GCHF 2GTBA 1P3CA 3ZVEA 4OS7A 4TWWA 4AB8A 2K8IA 2H9HA 6GCHG 2ZHWH 1P02A 1AZ8A 2G5VA 3GISB 2GT8A 3DHKH 1C5QA 4YOJA 1SL3A 4WXVA 1OWHA 4X1NU 5DP9A 2A1DB 2BQ6B 2FI5E 2VWNA 1AQ7A 2TGPZ 1AFEH 2IN2A 2SGQE 2G5NA 4P02A 3SU4A 4ACAA 4A5TS 3E1XB 3R3GB 3VFEA 1EFRD 5EU8A 3HPTB 1HIAA 1N6YA 2BQWB 1T32A 2A4RA 1KDQB 2BB4A 3M5NA 2FS8A 1BTHH 1C9PA 1MUEB 2WPDD 3ZIAD 5F8ZA 3SU5A 1C1PA 1DM4B 1E38B 1XKBC 2F9UA 2KAIA 4I31A 3RXDA 2Z94A 5DP3A 3MQKC 2G51A 3QZRA 4DOQA 1F0UA 2FP7B 2V3MA 2ZP0H 2BX4A 1AVXA 1FY1A 1YGCH 2KCAA 4BXSA 1RRKA 2J38A 1GVZA 1XUFA 3TH4H 2D26C 2EI7A 4U2WA 1BHXB 2ZU5A 1GBIA 1Z1JA 1F0SA 4BOHA 1GJAB 1GBEA 1A0LA 3A8BA 1K1PA 1N8OB 4O97A 1NRPH 1O3DA 4WMDA 3N7DA 3SN8A 3UREA 2Y82A 4F4OC 1QJ1B 2A4OA 2A7JA 4LZ1H 3MH7A 1MQ5A 4Y7BA 2ZU4A 1NU7B 2PFEA 4AOQA 2STAE 3UQOA 1SGDE 4HFPB 1ETSH 4CH2B 1QZ8A 1LQEA 1W2KH 4KP0A 2O8WA 3FP7E 1O35A 1TQ0B 2LP6A 3MNCA 2DE9A 4TPYA 3GY6A 3E6PH 2FYRA 5C2ZA 4X2WA 1S0RA 1K0HA 3SI3H 3BTEE 4UFGH 4K5ZA 3Q3KA 4NA9H 3SV6A 2WUCA 1Y5AT 1O2MA 1GDUA 3GY2A 1DY9A 1SFQB 1C1RA 1TPAE 3BF6H 2HALA 3FANA 1KXDA 1SGRE 1C5WB 4IMQA 1P0SH 3E91A 5SGAE 1E34B 2R9PA 1FJSA 3VB6A 1C1QA 4VGCB 1A3EH 1RTKA 2WSSD 2Z9IA 1SHYA 3ZZ7A 1UVUH 3OEED 2CF9H 1AE8H 1TGCA 2ASUB 1FIZA 1QQ4A 5E0HA 1AUJA 4WXIA 2P59A 2A5IA 1SLVB 1V2MT 5ESBA 1MZAA 1O2OA 2VH6A 4K1SA 1V2QT 1ELTA 1ID5H 1V6DA 1O32A 5L6NH 4ESTE 3TITA 2VH0A 1KLIH 2ZHEH 3AW1A 2OQ5A 1DFPA 1FMGA 1EJMA 1TNIA 3ZZ9A 4DURA 1HBTH 4BAHB 3P6ZB 2P3FH 4X8TH 3A88A 1WQVH 2WPHS 1E1RD 4WH6A 1UCYK 1ANCA 2P8OC 3MO6A 1O3PB 1NFXA 3QTOH 1RFNA 1DOJA 4MTBA 4B1TA 1CA0B 1NESE 1W3CA 3Q00A 2HWLB 1WTHD 1G3BA 3LH3A 3RLWH 1C4U2 2F43B 1KDQA 4NA8A 3P8FA 4ZKRU 2ZFTA 3LGTA 1GI5A 1F0RA 1K9OE 2FX4A 1Y3XA 3MU4A 1C2HA 2BD9A 1Y3YA 3DFLA 1SGFA 1GGDC 1O3KA 2QXIA 2VIQA 3RUOA 1QURH 3BTGE 4NFEA 2JH6D 4F55A 3TNTA 1K22H 1AI8H 1ZTJA 2OTVA 2UWPA 1DLKB 1BBRE 2TIOA 3PYHA 2H9EH 1K1JA 1UMAH 2ZDMA 1A2CH 1O30A 2Y6TA 1X7AC 4OM9A 2C90B 4WJG2 2P8OB 3PLPA 3S7KB 1TX6A 2V0BA 3QO6A 4DY7B 4D7FA 2PTNA 2WPIS 2PUQH 5F8XA 1FIWA 1NS3A 1FY5A 4CBNA 3B23B 1Y3VA 5GXPA 1G36A 3W95A 1GGDB 3UWJH 3QDZB 2QF0A 3BEIB 1KMHB 1QA7A 4TYDA 1GJBB 1UTJA 2R3UA 2V6NA 5GJ4B 2OC7A 3M7TA 4Q80A 1HB0B 3VB7A 3KYGA 1HAIH 2D8WA 5JDUB 1LHGH 1U6QA 3RXPA 3SGQE 1O0DH 1QJ6B 5EODA 1GBBA 2V3OH 4ISOA 4ZKNU 1GI4A 1LPKB 1P06A 3F2HA 1FDPA 3SU6A 2FM2A 3ZZ8A 4NSVA 1C2GA 4K8YA 1JRSA 4AC9A 3PMBB 1Z1IA 2F9VA 3MH5A 3STJA 3BTWE 2OD3B 2ZFSA 3K65B 1IOEA 5F8TA 3VB3A 1SGYE 4GAWA 2GCTB 2ZNKH 1YPGH 2Z9LA 5DKMA 1GMDF 2ZIQH 2VNTA 3ZVDA 3E16B 1C1VH 3SO3A 1NRSH 1WOFA 1C2EA 1GMDG 2SGFE 5DPAA 1G2LA 2QN5T 3EA8A 2FLBH 3PB1E 2GJGA 1CSOE 5EW1H 5E0JA 1WQSA 3ATMA 1NT1A 3RMNH 1VJ9U 1O2PA 1YP9A 1ZHRA 3GDSA 2PUXB 5C5OA 3RXIA 3ZV8A 4X2XA 1C1WH 2JETC 3PRBA 3GY5A 1ZJKA 5AHGH 4OS1A 3AW0A 2ILNA 4XBDA 1A7SA 1C2DA 2NWNA 3MTYA 1DT2A 1OWEA 2BDGA 2XC5A 3KN2A 1C5LH 2ZDLA 2FMJA 2RDLA 4X8SH 1KXBA 1SVPA 5C67A 3URCA 1E0FD 2P16A 3LOXA 4NWLA 1DSTA 1EAXA 2R2MB 1GHWH 3AAUA 3M37A 4JZDH 2B8OH 1O5FH 5EIYA 1P05A 4ASHA 1O2HA 1BTXA 1GJ4H 3KQEA 3FP8E 5KGOA 1O2IA 5EXNA 1GBKA 3BTKE 1S84A 1EP5A 1UHBB 1TABE 2ZDAH 4WH8A 2BDHA 1AN1E 1Y5UT 4YOIA 5DG6A 1O2JA 2PKAB 2BLOA 3UR9A 4D7GA 4M9FA 5DO4H 2ANWA 1O2LA 1BTPA 2OK5A 4Q2KA 1GHZA 1P01A 2ZGCA 1UTQA 1AO5A 2JETB 2WYJA 4I8HA 1BRAA 1HUTH 1EZQA 1H9HE 3FN8A 3U28C 2XBWA 3F68H 3FZZA 3RC5A 3SNBA 3P8GA 1DWCH 9LPRA 2OC0A 2JKHA 1QBNA 1TNHA 1TX8A 4FU7A 1AFQC 4GSOA 4YOGA 1O2KA 3RXSA 2C8WB 3PWBA 1DWDH 2XNIA 4YESB 1NRQH 1G32B 1GHYH 1V2WT 5FXLA 3SV9A 1JBUH 1ZYOA 4XDEA 2YMSD 3MO3A 4Z1MD 3SZEA 3K9XB 1C2MA 1EAUA 1LTOA 4AN7A 3Q76A 1P2QA 3OY5U 1NROH 1MBQA 3TK5A 1V2JT 3SNEA 1SFIA 1O3AA 4B71A 3OTJE 3D62A 2BLQA 1WDIA 4YXWD 1JIMA 2TPIZ 2F91A 3CS0A 1ZOMA 1O3HA 2OLGA 3O8RA 5IK2D 4H4FA 1O2WA 5LPRA 3OU0A 1UTMA 1C4V2 2ZU1A 1SI5H 2V35A 1PFXC 1O36A 1C1MA 2NU1E 2BOKA 4IC5A 2WPJS 3PTNA 3BIVH 5FL7D 1ESBA 1ELFA 1NFUA 3FO8D 1GI7B 1O3FA 1ZSLA 3GY7A 3O8DA 4PROA 3SGBE 2BD4A 3TJUA 1YPHC 1EAWA 1OWKA 3NZIA 3HATH 3PWCA 1C5XB 2Y5GA 3UPEA 4BAOB 1F5KU 4UD9H 1THSH 1SGQE 4R0IA 2J4IA 1CO7E 1BTYA 4X6NA 2ZHQH 2FPZA 1GBAA 1N1LA 2XWBI 1P3EA 1SGIB 4I8KA 1YF4A 3BTHE 5K7RA 3SHCH 2KR7A 1HJAB 3ATLA 1UCYH 3E0NB 3VGCC 1EPTC 2AS9A 7LPRA 2A4QA 4HTCH 3GY4A 1O37A 1B0FA 3KQCA 2Z3CA 3TNSA 4CRGA 1UHBA 1QGFA 1UK3A 2FOBA 3RXFA 4A1VA 4P00A 5T6DA 3E90B 2HVXA 2FOMB 2PKAA 2GDEH 3E8LA 1ABIH 2J5UA 4ZHAA 3KIDU 5DP7A 5FX6A 1K1OA 1ZR0A 1ZMJA 1IAUA 4H6TA 1TX7A 2VVCA 2CXVA 3DT0H 1LKAA 1AKSB 1V2UT 2H5CA 1P11E 1H8DH 2QF4A 1IQGA 1V2VT 2H9TH 4E7RG 1BIOA 2D2DA 3SUEA 3VGCB 1DUAA 1EPTB 3ZVFA 4DCDA 1MZDA 1QIXB 1VCPA 3QLPH 4HGCA 3TGJE 1GJCB 3MNBA 4GHQA 4WWYA 1V2OT 2WUBA 2ZPRA 3RC4A 3EE0B 3UTUH 8LPRA 4UFFH 1GI0A 4HG6A 1GI6A 4I33A 3S9AA 4TPIZ 2ANKH 1SQRA 1AUTC 1MH0A 3QTVH 1MAXA 5JPMH 1KYNA 1V2ST 2KCYA 2ODYB 1H8HD 2ALPA 5EW2H 3PRDA 3QX5H 2XBYA 2PR3A 1C5UA 1VJAU 3MU1A 1PYTC 1TNKA 2EI6A 1MMJN 2F83A 3A7ZA 3JZ1B 4XRNA 1E37B 1ELEE 4TWYA 2FI4E 2BVXH 1BOQA 2H2ZA 5ETXA 1C2JA 1TPOA 1Z7KA 4DT7B 2W6JD 2ZFRH 3A7VA 4OGYA 1GBHA 2RFKC 5JBTA 2IPQX 1ZPBA 1SHHB 3WWFA 4MNYA 1AWHB 1SGFG 1HAHH 1TRNA 2ZGJA 2D1JA 4DIHH 1XUJA 2BY9X 3RDZA 1ETRH 1QR3E 1FV9A 5DP5A 2Z3EA 1FZZA 3SBKA 3STIA 5CE1A 3PMAB 3DUXH 1AVWA 1D3TB 2R3YA 3NXPA 5EPNA 6CHAC 3G01A 1SB1H 5FBEA 1VITF 3TK9A 4CBOA 1BHXF 1CGJE 4MG3A 3V7TA 3OFND 1C5YB 1H1BA 3OTPA 4SGAE 1VITG 2JJ1D 4B2AA 3GOVB 2LPRA 4ZXXH 2PGQB 1MD8A 1O3OA 5CHAC 4X1RU 3KF2A 3RP2A 1FI8A 1P57B 4BAKB 1FAKH 1S85A 4JCNA 1HXEH 2ZEBA 3O8CA 2TGTA 1YPMH 2ZGXH 1NFYA 1UVOA 1LDTT 1O2VA 4THNH 5L30H 1O3EA 1QTFA 4BTUB 2GKVE 2ZDNA 1Q31A 1PJPA 1LMWB 1XXFA 2PP6A 3S7HB 2A31A 4NIXA 3CP7A 4FOUC 2FOGA 2K1QA 2R0KA 2ZA5A 3FKSD 1NC6A 5ABWA 1NPMA 4DW2U 3ODFA 3FAOA 1AKSA 2XYAA 2AMDA 4FUIA 1MBMA 1BJVA 4LZ4B 4AFSA 1KXAA 4Y8XA 1O34A 5GPIB 3TPIZ 1F7ZA 1HAVB 4NCYA 4YLQH 3PROA 2BMGB 2QXHA 4MLFB 1Y8TA 4Q4LA 1FY4A 4CH8B 2FO9A 2A5KA 1NM6A 2BD2A 1C5PA 2B9LA 4K8BA 1UK2A 1TRMA 5I46H 2CHAB 5ESTE 1NFWA 1C5MD 1LPGB 1ABJH 1KXEA 3A81A 3ZZ5A 3P70B 4Y0ZE 2FOAA 1W11U 3O8BA 1YY3A 1NN6A 2PKSC 1ZRKA 4Q7XA 1MTNC 5KEDA 3F2FA 2BY5X 1YPEH 3M5OA 1QJ7B 2ZTXA 2ZDKA 2QF5A 4MPVA 3LH1A 3F1SB 4E05H 3TH3H 1TNLA 4MPXA 2VWLA 1O2ZA 3NCLA 2KZ4A 2A7CA 2TGDA 4MQAA 2KCOA 2OC8A 1CA8B 3KL6A 1NRRH 3F9EA 1SOZA 1W0KD 3E3TA 2A2QH 1Q2WA 1GCDA 1LHEH 2VINA 1FUJA 4XOJA 3K6YA 3IITA 3GYLB 3VXEH 1J9CH 4D9RA 1SLWB 3SJOA 2BLVA 4ISLA 2QY0B 1RIWC 3RXTA 3PLBA 1G2MA 3AVZA 3KQDA 3ZZ4A 3L33A 3LT3A 3P92A 3BIUH 4AYVB 3SUDA 3ZZBA 3TJNA 1HDTH 4JYVH 3EA9A 3B8JA 1MTNB 1SGCA 1QFKH 4K1EA 3T62A 5A0AE 3FP6E 3OE7D 2ZU3A 1JXPA 1O5EH 2QAAA 2XXLA 1J17T 4ZAEA 1GHAF 4AFZA 3OAAD 3ATIA 2XCFA 1GHAG 2FDAA 1K21H 1YPLH 1A5IA 1MTSA 1HAGE 2GGVB 1DVAH 2GDDA 1OP0A 4F49A 2Y81A 2QF3A 1Y59T 1H8ED 4XFQA 1DANH 1JRTA 3F0PA 5J4SA 2GV6A 3RXQA 5TCAA 1HNEE 2BHGA 1EZUC 3GCTF 5A8XA 4X6MA 1AE5A 5F53A 1ZGVA 3GCTG 3SZNA 5FHTA 2UUFB 3FOAA 3LGUA 2BD3A 4B2BA 1GG6C 4O3UA 1COWD 1TLDA 4BAMB 1DSUA 1TMTH 3BTDE 1P2OA 3M3VA 4KKDA 3LC3A 1TE0A 3RXHA 2PGBB 1TPSA 4JZ1A 3V12A 2I6QA 2KX4A 3TH2H 1YLDA 2FLRH 1YC0A 2WPMS 3M5MA 3BEFB 1RTLA 4YTAA 1LHCH 1QB9A 4AGKA 1UK4A 4XSKU 2STBE 4FUHA 2BY8X 1MKWH 3ZVAA 1D3DB 1P2NA 1HAVA 2A0QB 1UCYE 1ANEA 1L1JA 1PPBH 1DDJA 5DP4A 3F9GA 1O3IA 3ZV9A 8KME2 1CGIE 3SUFA 3QZQA 2JIZD 1P2MA 2O8MA 2W6ID 2ZQ2A 3HKIB 3A7YA 3TJOA 2AIPA 3LIWA 3ZZDA 3Q77A 4FUJA 1VCQA 1CHGA 5A8YA 1G9IE 1GG6B 4JZIA 1T7CA 1FN6A 2OBOA 1GI2A 5HMAA 4ABFA 3WY8A 3UOUA 3EQ0H 2BQ7B 2VIDA 3AK5A 1PQ8A 2W3KA 3UUZA 2FWWA 4H6SB 1DS2E 2CV3A 4ZMAH 4JZFH 1GPZA 2ALVA 4GLYA 1G3CA 1T8NA 4NIYA 1D9IA 2AMPA 1UVPA 5GWZA 2KFWA 4F48B 1IQNA 5HIYA 1A0JA 3PV4A 1LO6A 5JBCS 3MHWU 4NSYA 1EB2A 4TY6A 4ABEA 4CRFA 1SG8B 1EOJA 2DE8A 5G4BA 5KECA 1XUHA 5E8EH 1A5HA 4NG9H 3SU1A 1S83A 3KEEA 5DP8A 1Y5BT 2PSXA 1ZPCA 2ZHDA 3L3TA 4NFFA 4CHAC 1MU6B 4TSFD 4R8TB 2KCPA 2ZECA 5JB9S 1SLXB 2ZCHP 3TLOA 1MABB 1S0QA 3RXUA 4ZCNA 1AGJA 1T4UH 2HRVA 4Y76A 2NU3E 2WV9A 1H4WA 1BQYA 4UE7H 5EQSA 2SNVA 2JDID 1SSXA 5F6MA 1BDAA 1KIGH 3RU4T 2VVVA 3SJ8A 1L2EA 3U1JB 2HNTE 1AHTH 3U98H 3PV2A 3VPKA 2Q6DA 5JBAS 4GPGA 1BCUH 1SBWA 5HIZA 4AB9A 1YPJH 3M3SA 4M7GA 2BY7X 2L74A 3RXAA 1RXPA 2PTCE 3BV9B 5LH8A 3SI4H 4X6OA 5HXFA 2EC9H 1HRTH 5EOKA 3RXBA 1C4Y2 1GL0E 4LK4A 1W13U 1W8BH 1WBGB 3RXKA 3BTFE 3BSQA 2VBCA 3PM3A 1XXDA 3A85A 1ETTH 2J34A 3DD2H 1Q3XA 2PW8H 3F0OA 1BITA 4K1TA 1EUFA 5HM2A 1GMCF 2PSYA 2THFB 1TA2A 3RXVA 1XUIA 1GMCG 1W0YH 2BXUH 2F9NA 1EZSC 4IN2A 4BNRA 2J2UA 3T28A 1FN8A 3OX7U 1BRCE 1WTGH 5AVDA 5DK1A 1OX1A 2ZPQA 1O5BB 1Z8IB 4FUBA 1O2RA 3SNCA 3WW7A 3AAVA 3U8RH 4YT7H 1F0TA 4DT4A 1THPB 1MKXK 2GZ9A 1BMLA 1CU1A 1ZLRA 4ZXYH 1O3BA 1HV7A 1GJ9B 1UTOA 2I6SA 3ZZ6A 5C0TA 4A1TA 1GI9B 4RSPA 2UUKB 4ABDA 2LNCA 2ZTYA 1TFXA 3VB4A 2RDEA 2O9QA 3HK3B 1UTNA 4B6EA 2F3CE 3C1KA 3LJOA 3Q3YA 1IQFA 2HGTH 4NGAH 3V3MA 1DWBH 5EJZA 1D6RA 4ISIH 5LPFA 4IS5A 1F5RA 1SKYE 2G52A 1ELVA 1EXFA 1TB6H 1W12U 2GX4A 1GCTC 4FXGH 5C1XA 3LGVA 4YT6H 2ZDVH 1TPPA 3N99A 1AY6H 2R0LA 3SQEE 4FUDA 5HGGA 2VGCC 3TIUA 5CDFE 1HAOH 5HKKD 3BEUA 3GICB 3SU3A 3RLYH 3MU5A 3RXEA 1C5VA 5C3NA 3S9BA 4INLA 1AVGH 3ESTA 4XBCA 4CR9A 4Q7YA 2GV7A 4I8LA 2G55A 1XUKA 2Y5FA 1GL1A 4KGAA 1DPOA 2VU8E 4IN1A
chains in the Genus database with same CATH topology
2W5EA 2FEQH 2ODQA 3LONA 1AFQB 4MNWA 5FPSA 3T5FH 2BDYA 2H6MA 4CRBA 4LOYH 1ARBA 2GVFA 5E2OA 5K0HA 4YM9A 4OS4A 5IDKA 4ABBA 3KHVA 2F9OA 2C4FH 4MNXA 1A1RA 3BN9A 1DY8A 1RS0A 5F03A 4OGXA 4I32A 1OWIA 1TNGA 2BDIA 3SUGA 2VGCB 3V0XA 2FX6A 2Y5HA 2VVUA 2ZHFH 1GBDA 3A7WA 5TJXA 1AWFH 1DE7H 2WPLS 1KLJH 2P3UB 1EB1H 1L4ZA 5A0CA 3S69A 1GJ6A 3A83A 1B5GH 2G4UA 3IG6B 3RXGA 1P2JA 2FI3E 5EXLA 2AYWA 2ZO3H 1AMHA 2DUCA 2BM2A 1QBVH 4H42U 1ZGIA 1HAYB 1T8MA 3M5LA 1K1MA 1YM0A 5LPEA 2G8TA 1C1OA 2OC1A 5BPEA 1O38A 1SGNE 1V3XA 4KTUA 1MKWK 3SW2B 1TALA 2GMTC 1D3QB 5I25A 4MNVA 1HJ8A 2CJIA 1C5ZB 4K2YA 1C2KA 1ELCA 5FCRA 4KTSA 1O3GA 2C8YB 2HNTF 1PPGE 1QRZA 1J16A 5TCCA 4X0WU 1LVYA 3MU0A 1BMAA 1UVSH 1TONA 1QRWA 1FNIA 1DLEA 1WV7H 1NZQH 2VIOA 4MPUA 3F9HA 5C20A 3I77A 1EATA 1CT4E 1QRXA 2FTMA 1FY8E 2EA3A 4U30A 4ZKOU 1TOCB 1GJ5H 3ZVGA 3M36A 2ZU2A 4B73A 1CVWH 1C2IA 2GMTB 4FU9A 5C5NA 2FESH 3BG4C 1TQ7B 1OWDA 1G37A 3UNQA 1BRUP 3RMOH 1EJNA 1UTKA 2VIWA 1IQMA 1V2LT 2KAIB 1LKBA 2WINI 2Z7FE 5EG4A 1J15A 1G30B 1V2NT 2Z6BD 4OS5A 1YLCA 4BAQB 1HLTH 4MVNA 1PYTD 2BD8A 1RJXB 1C2FA 2CF8H 1GI8B 1KTTB 3HGNA 3P8NA 1FAXA 3RC6A 4E7NA 3KNXA 3LGWA 3MNSA 5LGOA 2W26A 3A7TA 2B7DH 3A84A 1HGTH 4JMYA 1C5OH 3QGNB 1GJ7B 1C1UH 1QQUA 2G00A 2ODPA 3CENA 1QCPA 1GBTA 1K1NA 4IBLH 4X8VH 5E2PA 1TBZH 4XBBA 4Y8YA 2WV4A 1OKXA 1GHVH 3M35A 1P8VC 1HJ9A 4JK5A 2W3IA 3RMLH 1O5DH 5FAHA 4GUXA 3D65E 3ATKA 1S82A 2VIPA 1W0ZU 1A4WH 2TGAA 3ITIA 3OY6U 3RM2H 3NWUA 3ELAH 1TYNA 4SGBE 3BTME 4INKA 4X1SU 4Y0YE 1IQKA 1GDNA 1PPEE 1BTUA 2ZWLH 4K3JA 1O5CB 3TVJB 1UVTH 1ZTLA 1HAXB 3GY8A 2QIQA 7KMEH 1ELBA 2AGEX 1SMFE 2A7HA 1QL7A 1XMNB 2YOLA 2GT7A 1FPHH 1ZJDA 2GZ7A 3OYPA 4D8NA 2J95A 1WSSH 2ZFQH 3A80A 4AG1A 3SHAH 1PPHE 2HPQH 6CHAB 4D9QA 3SOSA 1JWTA 2ESTE 4ZHLU 1MAYA 1MKXH 1EP6A 1BRBE 1CQQA 1CT2E 2HOBA 1O5AB 2EEKA 1OSSA 1Z8RA 1V2RT 1WUNH 1C9TA 4O3TA 1A61H 3MMGA 4NIVA 1EPTA 1K1IA 1QL8A 4RN6A 5CHAB 1O3NA 1KTSB 1GI1A 1O2TA 4BTTB 5JB8S 1P03A 2BZAA 2HLCA 2ZGHA 4JK6A 3LDXH 5FPTA 4FUCA 2F9BH 1BA8B 4IMZA 1NO9H 3RXOA 3SNDA 1C1SA 4UEHH 2EI8A 2PV9B 1N8OC 4DIIH 4ZHMU 3SNAA 4ZH8A 3VEQB 3EGKH 1SQAA 3SV8A 1C1TA 1CBWC 4ISNA 1GI3A 3ZVBA 3KQBA 1SQTA 1V2PT 1WAYB 5E0GA 2QXJA 5GCHF 3R0FA 1TGSZ 1VITH 2AEIH 1OOKB 3P17H 2HPPH 3LKWA 5GCHG 3QN7A 3W94A 1MQ6A 2Y80A 3NPSA 2J9NA 2OXSA 1HAPH 5PTPA 2M5TA 8GCHF 4Z6AH 1GBMA 3ZYEA 3UNSA 1DXPA 5FBIA 8GCHG 2XBXA 2OQUA 1YCPK 1OPHB 1HYLA 4IW4E 2RCEA 5EPYA 1KY9A 5DJ7A 1ZHPA 1EZXC 2BDCA 3HK6B 2PKSB 2BVSH 4Y10E 1CBWB 2XBVA 3SJ9A 3V13A 4VGCC 1THRH 2IOTA 1S5SA 1K1LA 6ESTA 5HYOA 2FOEA 2AERH 3HKJB 3I29A 1KSNA 4NZQA 1ANDA 1TMUH 3A86A 1O5GH 2XW9A 1AZZA 1B0EA 3E0PB 5T3HA 1LVBA 3K2UA 5IYTA 4AFUA 2CGAA 5C1YA 2SNWA 1SPJA 3S9CA 3QWCH 4MPWA 3SJKA 3QK1A 4X8UH 1GJDB 4WMEA 2FTLE 2OBQA 3M7UA 1RIWB 1HFDA 1ZTKA 6LPRA 2C8XB 1CE5A 1CA0C 3TJVA 4NZLA 3MH6A 4Q7ZA 3ZZ3A 4AORA 1EKBB 3SU0A 1O3CA 2PWXA 1GVKB 3KCGH 5A09A 2GZ8A 5JYIA 1FONA 1O2QA 3QGJA 1VCWA 1ZSKA 1O33A 3A82A 1JOUB 3A7XA 1W7XH 5A8ZA 1FXYA 4CRAA 1YPHE 1LQDB 2VIVA 4ABGA 4FU8A 4TY7A 2NU4E 3LJJA 2UWLA 2XTTB 4ISHH 1K28D 2RG3A 2WPKS 1PQ7A 1P2IA 1DWEH 1MU8B 4JZEH 3D23A 5HM9A 2ZI2H 2FZZA 4X6PA 3PMJA 1UTLM 3UR6A 1Z6JH 3UY9A 3GCHC 3MH4A 1JMOH 1YKTA 1A5GH 1EQ9A 3L6PA 2C3SA 2AH4X 2GCHF 1UO6A 1SLUB 2ZC9H 1QL9A 1F2SE 4AG2A 1DXWA 2GCHG 4ABJA 3A8DA 3GCNA 1OP2A 1QHRB 2OP9A 5GIBA 3EA7A 1ZMNA 3M61U 1BBRK 1Z71A 3URDA 2CN0H 4Y8ZA 2TRMA 1YPKH 2QYIA 2QV1A 3EDXB 1OWJA 1GWAA 1ZMLA 3ENSB 3SORA 1XVOA 2SFAA 2VWOA 1BMNH 4JYUH 1C5SA 1J14A 1MCTA 4Y11E 2BX3A 4MDSA 4ABAA 3KGPA 1A0HB 4AGJA 4FUEA 4LXBH 1QA0A 4FUFA 1ACBE 2R2WU 5L2YH 2ZZUH 2BYAX 1SGTA 2H1UA 1Y3UA 3GCHB 1BJUA 3RXCA 3SJIA 3NK8A 5EQRA 1ESTA 1TBRH 4B76A 1YCPM 2BVRH 4X1PU 4K60A 3N7OA 2SGPE 2BD7A 2ZF0H 3QUMP 5AFYH 4RKOB 2GCTC 3AASA 2XC4A 1T8LA 1BMMH 1IQLA 3ZVCA 1GBCA 4Y79A 1HAZB 1S6FA 1AB9C 1EJAA 2CMYA 2QA9E 1PQ5A 4GCHF 5EQQA 2AGIX 1D3PB 4B74A 4IGDA 4B2CA 4GCHG 1TGTA 3T26A 5FX5A 3MO9A 1UJ1A 3GYMA 5DGJA 5H4IB 3NUMA 1IQHA 1WU1A 2O8UA 3MI4A 1QY6A 4AYYB 5T6FA 1LCYA 1OP8A 2VWMA 4BANB 1EOLA 2P3TB 5A2MH 5C1UA 1VGCC 4CHAB 3RU4D 4BXWA 4WY3A 1DITH 2Y7ZA 3TGIE 3UQVA 2A32A 1YYY1 3T25A 1NY22 5JBBS 3M3TA 1J8AA 4QT8C 2RA3A 2ANYA 2QXGA 4A7IB 1BUIA 4JYTA 1ARCA 4YO9A 4DG4A 4UDWH 3P95A 1AB9B 3FZDA 1PPCE 3NKKA 2GD4B 4Y71A 1GJ8B 2ZFFH 3SV7A 1PQAA 2OUAA 2Q1JA 1C5NH 2ZCKP 4NIWA 1LVOA 3U9AH 4ABIA 3A8CA 4AZ2B 2PLXA 1HPGA 1Z6EA 2ZFPH 4Y7AA 4Y6DA 2TBSA 2G4TA 2W7SA 2RA0A 2ZGBH 1A3BH 2FODA 3SU2A 2FS9A 2OINA 1VGCB 4OS2A 3T2NA 1XX9A 1SGPE 2BD5A 3RXRA 3RXJA 1OYQA 3A89A 2W7UA 1O3MA 1O3LA 1C5TA 1SR5C 2XCNA 1C1NA 4IC6A 8ESTE 3DFJA 4I8JA 4YZUA 5GDSH 2BTCE 3BG8A 1XM1A 1HXFH 4A1XA 2AFQB 4AX9H 1GHBF 1SGEE 3ZZCA 3F9FA 2B5TB 1GHBG 1O2YA 1L4DA 1ELGA 1P2KA 1ZSJA 3ODDA 1P9SA 3PO1C 4CREA 4D76A 1E36B 1LHFH 1SQOA 4E06H 3EAJA 4NWKA 4UFDH 2BLWA 1IHSH 2WV5A 2NU2E 3MNXA 1ELDE 4HI3A 2A4GA 1YBWA 1TRYA 2QC2A 1CHOF 2ANMH 1GHXH 3C27B 4U01A 1MCVA 1YCPH 1CHOG 4ABHA 3H5CB 2IJOB 4DGJA 1O39A 2UWOA 1N6XA 1XUGA 4BTIB 5FPYA 1BTZA 1H8IH 1K2I1 1QBOA 1GDQA 2F9PA 4GHTA 2Q6GA 1GBLA 2B0FA 2P94A 3UNRA 4UFEH 1LPZB 2BDAA 3U8OH 1INCA 4CR5A 3TK6A 2VB0A 5DP6A 1O2UA 4KELA 3SV2H 1TIOA 3FVFB 1D6WA 3MOCA 1PPZA 3PO1B 1ESAA 1DX5M 1BZXE 1EASA 1G3EA 1V2TT 1W7GH 4KTCA 3UWIA 1TAWA 2NU0E 2WYGA 1ZZZA 2IPHA 1FLEE 1GCTB 2ZCLP 1OS8A 9ESTA 3Q3XA 3RMMH 1S6HA 2ZQ1A 1E35B 1VR1H 2P93A 1Y3WA 1FQ3A 1DICA 3MFJA 1HJAC 1P9UA 1T4VH 4B75A 2Z9JA 3PLKA 4RKJB 5EGMA 1RD3B 3TU7H 3U69H 1QNJA 1L0ZA 2P95A 2Z9GA 3HGPA 4O03A 1A46H 2QCYA 3ATWA 3GDVA 2UUYA 4DJZB 1LVMA 1GVLA 1BB0B 1VZQH 2FYQA 3EYDA 3BTTE 4I7YH 1MTUA 1O2GH 7ESTE 1Z8GA 1O2NA 1MTWA 1EAIA 2Y7XA 1NTPA 5BRRE 1IQIA 3D49H 2BDBA 1ANBA 4HZHA 1BT7A 3GY3A 4ZUHA 3U8TH 4X2YA 1F5LA 1DUEA 3PMHB 4ZROA 1TWXB 4NA7A 5J4QA 1S81A 1P09A 3LPRA 3UOPA 1TOMH 2FOCA 2XC0A 4Z0KA 1O3JA 4X2VA 3SQHE 1W10U 1HCGA 2UUJB 3RXMA 2O8LA 1AIXH 1XKAC 3LGIA 2PHBA 1IQJA 1FPCH 2VJ1A 5AFZH 3CS7A 1D4PB 1OXGA 1H9IE 1FY3A 3SGAE 4WVPE 3VXFH 5L2ZH 1PPFE 2AMQA 1P10A 3H7OA 3LGYA 3M7QA 1ZRBA 1SC8U 1GBFA 2G81E 3VB5A 3LU9B 3T27A 3ZZAA 1BBRH 1L1NA 3IWMA 3OSYA 1MTVA 4K69A 3A87A 7GCHF 5EXMA 2Z9KA 4WMFA 1GBJA 1ORFA 1ELAA 4GVUA 1KXFA 2BZ6H 7GCHG 4FVDA 3UIRA 3RM0H 2XRCA 4AFQA 4FVBA 3MU8A 1KXCA 1G3DA 1NU9A 4U32A 3U1IB 1RGQA 1HIAB 2SGAA 1F92A 1WYKA 2ZPSA 1IQEA 1GMHF 2YNBA 4WF8A 1AD8H 1XVMA 1GMHG 3RXLA 3F6UH 1QB6A 1T31A 1TBQH 1P04A 3H7TA 3MYWA 1AU8A 2AGGX 4OS6A 1O2XA 2BXTH 1P12E 1OYTH 2HNTC 4A6LA 2A2XH 4YLUA 3ZYDA 2GP9B 1RTFB 1WCZA 2BY6X 1EX3A 2QGRA 2XWAA 1KLTA 1BTWA 3T29A 4X1QU 1TNJA 4CRCA 2ZG0H 2AIQA 3I78A 3GCOA 1LHDH 1TGNA 3BTQE 2Z3DA 1M9UA 3BG4B 1H9LB 4A92A 2ULLA 3A8AA 1TMBH 1L1GA 2FOHA 4ZKSU 4DVAU 5FCKA 1CGHA 2SGEE 3B9FH 2A45B 2SGDE 5AF9H 5B6OA 3MWIU 4J1YA 4UONA 1TA6A 3TGKE 2H5DA 1SOTA 1JIRA 3S0NA 1TGBA 1W14U 3LC5A 1ZHMA 4J2YB 2BOHB 4XE4A 1ZPZA 3GDUA 5A0BA 2FIRH 3PTBA 4FUGA 2J94A 4I8GA 2O8TA 4INHA 2FXRA 1T8OA 1B7XB 1MD7A 2YNAA 3P8OA 2J92A 5T6GA 1O31A 2ZTZA 1UTPA 1Z8JB 3DA9B 2A5AA 1V2KT 1C2LA 2OCVB 3K6ZA 1NRNH 5CMXH 3UFAA 1O2SA 2C8ZB 2JH5D 4CRDA 1C5RA 4O9VA 2JH0D 2ZKSA 1QB1A 2FOFA 3JZ2B 2C93B 1CT0E 3RU4E 2Q6FA 3FFGA 2CHAC 2V3HH 1IHTH 6GCHF 2GTBA 1P3CA 3ZVEA 4OS7A 4TWWA 4AB8A 2H9HA 6GCHG 2ZHWH 1P02A 1AZ8A 2G5VA 3GISB 2GT8A 3DHKH 1C5QA 4YOJA 1SL3A 4WXVA 1OWHA 4X1NU 5DP9A 2A1DB 2BQ6B 2FI5E 2VWNA 1AQ7A 2TGPZ 1AFEH 2IN2A 2SGQE 2G5NA 3SU4A 4A5TS 3E1XB 3R3GB 3VFEA 5EU8A 3HPTB 1HIAA 1N6YA 2BQWB 1T32A 2A4RA 1KDQB 2BB4A 3M5NA 2FS8A 1BTHH 1C9PA 1MUEB 5F8ZA 3SU5A 1C1PA 1DM4B 1E38B 1XKBC 2F9UA 2KAIA 4I31A 3RXDA 2Z94A 5DP3A 2G51A 3QZRA 4DOQA 1F0UA 2FP7B 2ZP0H 2BX4A 1AVXA 1FY1A 1YGCH 4BXSA 1RRKA 2J38A 1GVZA 1XUFA 3TH4H 2D26C 2EI7A 4U2WA 1BHXB 2ZU5A 1GBIA 1Z1JA 1F0SA 4BOHA 1GJAB 1GBEA 1A0LA 3A8BA 1K1PA 1N8OB 4O97A 1NRPH 1O3DA 4WMDA 3SN8A 3UREA 2Y82A 4F4OC 1QJ1B 2A4OA 2A7JA 4LZ1H 3MH7A 1MQ5A 4Y7BA 2ZU4A 1NU7B 2PFEA 4AOQA 2STAE 3UQOA 1SGDE 4HFPB 1ETSH 4CH2B 1LQEA 1W2KH 4KP0A 2O8WA 3FP7E 1O35A 1TQ0B 3MNCA 2DE9A