4K1SA

Gly-ser-splb protease from staphylococcus aureus at 1.96 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
202
structure length
197
Chain Sequence
NVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVRNAYGVYFTPEIKKFIAENIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Staphylococcal SplB Serine Protease Utilizes a Novel Molecular Mechanism of Activation.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Serine protease SplB
total genus 56
structure length 197
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k1sA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k1sA02
1QNJA 3NXPA 1MAXA 2Z9JA 1K1PA 1KSNA 1TLDA 2R3YA 4DT7B 3RXHA 1WBGB 3BSQA 2HPQH 3MH5A 1S0RA 1MKWH 1M9UA 2SNWA 5DP3A 2QAAA 1GBDA 1EAUA 1A7SA 2B0FA 1CGJE 3SJ8A 1GDUA 2HALA 2WV5A 2VGCB 2ZFTA 1XM1A 1O39A 1AUJA 2WPHS 1QB6A 4NA8A 3SU2A 1BTXA 3ZZ9A 3UQVA 1NU7B 1BA8B 2UUYA 1PYTD 1K2I1 2ALVA 1PPGE 2P59A 3RXDA 2DUCA 5EPNA 3NPSA 2IJOB 1G9IE 1C2HA 1N6YA 2ZC9H 4X2YA 1A61H 1L4DA 1BRUP 3E91A 1EZXC 5EQQA 3ATLA 2C93B 1XXDA 1YP9A 3BEIB 3GY7A 5J4SA 3V0XA 4I8KA 1GI7B 5GWZA 1ACBE 2R9PA 2VINA 3MNBA 1S84A 1Z71A 4YESB 3A8BA 2AERH 2XCNA 1C5XB 2A5IA 1C2DA 3E16B 2B9LA 2WPJS 2VWOA 1EZSC 5CHAC 3RXAA 1TB6H 1P2NA 1TNJA 3BTWE 4OS7A 1ZHPA 4MPVA 3RXOA 1XMNB 1TPOA 3ENSB 1F0UA 1NC6A 4UONA 1ZHMA 2NWNA 2JETC 3EA9A 2C8WB 5I25A 2FXRA 1DLKB 1O3GA 3KQEA 1GBTA 1QRWA 1GHAG 2PFEA 2Y81A 4WMEA 5F03A 1KY9A 2J94A 1O5GH 3T2NA 2GCTB 1EOJA 1UCYH 1FY3A 5K7RA 3QO6A 1MZDA 1ESTA 2F3CE 3GDUA 2R0KA 1KLIH 1LDTT 3A8CA 3D62A 3RMMH 1SQOA 1Y5AT 4NZLA 1C2FA 4BTIB 2GD4B 1HRTH 1WQVH 4WH6A 3BG4C 2GT8A 2Z94A 3D65E 2AGIX 1DWDH 2KAIA 1MCTA 2O8TA 2VU8E 1AI8H 1C1QA 2XRCA 2HLCA 3S9BA 3E6PH 1SGCA 1J16A 1LO6A 1ZPCA 2AYWA 1SI5H 5AFZH 1S81A 4ABGA 1Z8RA 2QY0B 3DUXH 1W11U 4WXIA 4GSOA 2QCYA 3PTBA 2PGBB 4YTAA 1CHGA 1FN8A 2PUQH 2GT7A 4CHAC 2O8WA 3RC4A 1ZRKA 1F0TA 4U01A 4BXSA 1CQQA 3IG6B 2ZTYA 1FAXA 1GVLA 1FJSA 4Y7BA 1O2IA 2BX3A 1YLDA 1ZSJA 3LJOA 1AUTC 3UR9A 1QCPA 1O3AA 4RKOB 1FMGA 2HNTC 4HZHA 4DIHH 2ZECA 3PTNA 2HVXA 1GMDG 1PYTC 2RCEA 5PTPA 1G3DA 3PYHA 1GL1A 1UTOA 3RU4E 2ZFQH 3U9AH 3ZYDA 3HK3B 4CRFA 4ASHA 2GZ9A 1HAOH 3A82A 3M5LA 1ZGIA 1HV7A 3RXJA 1QIXB 2JH5D 1O0DH 1H9IE 1WCZA 1YPKH 5F8XA 3BTGE 1MAYA 2NU4E 3A8AA 2ZGJA 1BTZA 1GMHG 2D1JA 4GHQA 1DANH 1P8VC 1CSOE 1QA7A 5EU8A 1C1SA 1ZHRA 1Z8GA 1S6HA 4BAMB 3TGIE 1MUEB 2YNAA 1C5SA 3ODDA 5EW1H 3RXLA 3ATIA 4U2WA 1PPFE 2BDAA 1AFQC 3SU0A 2AGEX 1PPHE 2PWXA 1Z7KA 2YNBA 3M5OA 3FFGA 1B5GH 3SU5A 3W94A 2G4UA 1ANEA 4D76A 1U6QA 5FX5A 2EI8A 4BAOB 4JZDH 3U98H 1O5AB 1RIWC 1HBTH 4K3JA 5IYTA 1UVSH 4TYDA 4YT6H 5EQRA 5ABWA 1OYTH 2AGGX 3GISB 1O2YA 1O2NA 1HLTH 1UMAH 3QWCH 2V3OH 3ITIA 3UFAA 2BYAX 1P9SA 2SGEE 1F0SA 1IHTH 3D49H 4BTUB 1H9HE 2FIRH 2G51A 2O8MA 2WUBA 2ZQ1A 1V2MT 4FUGA 1T8MA 3V3MA 1C1VH 4YT7H 1O35A 3NK8A 1IHSH 3OTJE 2ZNKH 1C2GA 5DP5A 1TOCB 3F68H 1SOZA 2P3UB 1YPLH 2ZPRA 4NIYA 4OS5A 1VCWA 4ZMAH 3SW2B 2PTCE 4JYVH 1SSXA 1P12E 4O97A 2FWWA 1FLEE 1C5PA 2XTTB 3EQ0H 2BDHA 3FZDA 1KXAA 4WMDA 4X6NA 3S9CA 1V2RT 4ZUHA 3LU9B 4A6LA 1E0FD 1EPTA 3MHWU 4MPWA 4WXVA 3TK9A 1QRZA 5DP8A 2H1UA 1Z8IB 1SMFE 3VB3A 2QXJA 3D23A 4JYTA 1V2WT 4OS6A 4IMZA 3H7OA 1XXFA 2ZGBH 1FI8A 2Z9GA 3ODFA 1RFNA 1BB0B 4BTTB 1Y3UA 5E0HA 5LGOA 4DVAU 1OKXA 3L33A 2FYRA 2OQUA 1PFXC 2PSYA 1BTUA 4KGAA 4MPUA 1FONA 3QTVH 4IBLH 3MNCA 1UVUH 5EXNA 1C1PA 1OWHA 1O3PB 1Z6JH 3E0NB 1XVMA 3AW1A 5F8TA 1FXYA 4FUEA 2DE9A 1C1TA 1ZMLA 8KME2 4DOQA 1HJAC 4GLYA 3SUEA 2FI5E 3E8LA 3RXEA 2GDDA 3BTFE 1VITG 1HXFH 1O5BB 3QTOH 3SGBE 3TITA 1P0SH 4I8LA 5A0AE 1HGTH 1C5LH 1C2IA 3EAJA 1OWDA 1K28D 4ZKRU 2I6SA 4UFFH 4B71A 1F7ZA 1TONA 1GBFA 2G00A 2PHBA 1W7XH 1BBRH 3BTHE 2BOHB 4DG4A 1HXEH 1LVOA 2PV9B 7GCHG 1AE8H 1QURH 4DJZB 1VCQA 1HB0B 5IDKA 5DPAA 4IGDA 4MTBA 5EXMA 1AZZA 2A5KA 4J2YB 1FY1A 5AF9H 1E38B 2C8ZB 5C1XA 4MLFB 1RTKA 1V2PT 1G37A 3KGPA 1Q2WA 1ZJDA 2VH0A 3SGQE 2FO9A 1SLUB 2ZA5A 1RIWB 3P17H 5C5NA 1VGCC 1NRQH 1TNLA 3FP7E 1K1MA 2OP9A 1X7AC 4FUHA 2BLQA 2F9NA 5DO4H 3MH4A 2TRMA 4NFFA 3VXEH 4CR5A 3UY9A 2W7SA 2ZCHP 5DP9A 1O31A 1SFIA 1C5OH 2VH6A 3F9FA 3I29A 1TNGA 1MU6B 1C9PA 1OPHB 3A83A 1V6DA 1MTNB 3RXBA 3MFJA 2GV6A 4H6TA 3MMGA 2W26A 3OY6U 5E0GA 3LGVA 3UWJH 4FUDA 2H5DA 1CA0B 4B75A 2CXVA 2GCTC 1NO9H 3PLBA 1UVPA 2BTCE 2Q6DA 1BHXB 2TGDA 3MU0A 3R0FA 3ZZCA 3QZRA 1F0RA 1LQDB 2ZU3A 2ZF0H 3M7QA 2GCHG 1AB9C 1W0YH 3NCLA 2FLRH 1KIGH 3L3TA 2I6QA 2QXIA 4FUBA 1GG6B 1TWXB 1C2LA 3BG8A 4I7YH 1BTPA 2TBSA 1O5EH 1C4U2 2VVVA 3PMJA 1HFDA 5GPIB 3RXRA 2VVCA 1K21H 4U30A 1TA6A 2FTLE 1GBCA 1LVYA 2ILNA 1SG8B 2CMYA 4ZAEA 3UUZA 1ZMJA 4INLA 1F5RA 2AMPA 3TH4H 1L1JA 4CHAB 1FUJA 5C20A 3TH3H 4FU8A 2A7CA 2FOAA 2ZGHA 1ZOMA 3K6ZA 1O2JA 1YGCH 1O3EA 2EI7A 3A80A 5L2YH 1V2UT 2ODYB 3V12A 3GY4A 4TWWA 3KQCA 4CR9A 1OWKA 1YM0A 3MU8A 1JBUH 1VZQH 3TLOA 2GP9B 3GICB 3HKIB 2FMJA 3DFJA 2PKSC 3Q76A 2ULLA 4CRGA 3HGPA 5FAHA 4I8GA 2C8XB 3PB1E 4D9RA 1RGQA 2ZP0H 1EJNA 4NWKA 1EP5A 1T4UH 4Z0KA 2ZFRH 1P3EA 3AASA 3ZZ3A 5E2OA 6GCHG 1Y3XA 5JBBS 1HAHH 2WV4A 3JZ1B 1Y3WA 3P6ZB 2PW8H 3ZZBA 4Y8ZA 1ZTLA 3GYMA 6GCHF 5FCKA 1O2GH 8LPRA 1O2VA 4FU9A 5A8ZA 3TPIZ 3LPRA 1Q31A 1TE0A 3OX7U 1A0HB 1SGTA 4VGCC 1AMHA 1GBBA 3I78A 5HGGA 3MU4A 3A89A 1DLEA 1O3HA 3KIDU 1BMMH 3LH1A 4K2YA 1K1LA 1O30A 2Z6BD 2BLOA 3BEUA 1MZAA 1TABE 5DP7A 3PM3A 5AHGH 3VB7A 5JBCS 4R8TB 1MBMA 3ZVDA 1QBVH 5DG6A 1F5LA 5A09A 3LIWA 4Y6DA 5K0HA 1O2PA 2ASUB 1SBWA 3E1XB 1C2MA 1V2VT 1AKSB 2PKAA 5LPFA 1K1NA 2P95A 1SLXB 2CF8H 1N8OB 4WY3A 1DE7H 1ETTH 3BTQE 1GBHA 1LCYA 2ZHWH 1D9IA 3T28A 3F9HA 5DP6A 1Z8JB 4X2VA 2VNTA 1EP6A 1UK2A 3RMLH 1GJ5H 2BD8A 4CBNA 5JB8S 4MQAA 4ZHLU 4Y8XA 3BTME 3Q3KA 4INKA 3P8OA 3A7XA 1YPHE 2VWLA 2ZKSA 4Q7YA 4GHTA 1GBJA 2HPPH 2OINA 4ISNA 1BTWA 4M7GA 2G8TA 1XVOA 1YF4A 1BRBE 1IQJA 1UVOA 1UTQA 3P92A 1SGFG 3A7VA 3DHKH 1BRAA 4NSVA 7GCHF 2P94A 1SQAA 1DSTA 1YBWA 2VIPA 2ZU5A 2BDYA 2F9VA 1WUNH 1EATA 1O34A 2ODPA 3M35A 4OS1A 3GCTG 3OSYA 1Y8TA 3SHCH 1CT2E 1SVPA 3MOCA 5EG4A 1LHFH 5GXPA 2OC1A 1C2EA 4XSKU 2CGAA 1FY8E 1OXGA 1TALA 4DGJA 1AVXA 1AE5A 3F9GA 3RXFA 1ZZZA 2P8OC 1ELEE 1THRH 4H6SB 3LOXA 3ZZ6A 3RMOH 2Q6FA 3SNAA 1SB1H 2BY5X 3CS0A 2V35A 2ZDMA 4AORA 1PQ7A 4NIWA 5DKMA 2F91A 2H2ZA 1UK3A 4AFUA 2BOKA 1GI4A 1QB1A 1O3NA 1XKBC 1O3IA 4THNH 1ANCA 1A3EH 5HM9A 5JBTA 4JK6A 3K2UA 1EJAA 3PLKA 3M61U 4I8JA 4AOQA 4E06H 3UOUA 4O3UA 1GVKB 4X6OA 3Q3YA 1N6XA 3PWBA 2OBQA 3A87A 4O3TA 2Y5FA 2BQ7B 2OD3B 5FX6A 2A2QH 1GHBF 3FAOA 2Y7ZA 3ZYEA 1AHTH 3Q3XA 4ABJA 3FZZA 3SU4A 1QJ1B 2ANYA 3LC3A 2FOHA 1C5WB 2EA3A 1O2HA 3GYLB 1D3DB 3ATMA 1BBRE 1BUIA 1MTSA 4IMQA 2FX4A 1O5DH 1RJXB 1ANBA 1C5UA 3GDSA 1HIAB 1MTUA 2BD7A 2P16A 1GJBB 3CENA 4XOJA 5SGAE 1W12U 4NGAH 4CRCA 1C5QA 1NROH 3MO6A 1T4VH 4X1PU 1SR5C 2J2UA 1L1NA 1NRSH 3T25A 2CHAC 3MH7A 1HYLA 1Z1IA 3SU3A 5LPRA 4IN2A 1GI3A 2BDIA 2HOBA 2IN2A 4UD9H 2VWMA 1YC0A 4GAWA 3K6YA 2FP7B 2W3KA 1S0QA 2QF3A 5ESTE 2FOGA 1AQ7A 3S0NA 1SGRE 1SHHB 2FX6A 4DCDA 1FPCH 2HNTF 3QZQA 2F9BH 2EEKA 4A92A 1D6RA 1OX1A 2GCHF 1EPTC 1C1NA 2ZHEH 2NU2E 2BXTH 1ELFA 1RTLA 3AAVA 4NSYA 3SQEE 1O3OA 2AFQB 4Y0YE 4JK5A 3S69A 3LH3A 1F92A 1TMTH 1P05A 1TPPA 1TOMH 2BY6X 2A4QA 4H4FA 1P10A 4AG1A 3RXTA 2D26C 1GG6C 1NTPA 5E8EH 1TGSZ 4GPGA 2GX4A 4AYVB 1D3PB 2AS9A 2O9QA 1KXEA 1CGIE 2XNIA 3QGNB 2GZ7A 1P2QA 1XUHA 2AMDA 3UQOA 1GJ6A 4KKDA 1JXPA 3FP6E 3OYPA 4K60A 1N8OC 2A2XH 4WVPE 3SJIA 3CS7A 3NWUA 3URDA 1S82A 3T62A 3LGTA 2ZDAH 2SFAA 5L2ZH 2ZGXH 3BF6H 2FPZA 1AGJA 2UWLA 3E3TA 5T6FA 1ETRH 5JDUB 2XBVA 1ARCA 1W14U 1A2CH 1ID5H 3NKKA 3SUDA 4CH2B 1GBMA 3TU7H 2XBWA 2QF0A 3PMAB 2ZDKA 1OWIA 1QB9A 4X6MA 1YPJH 4TY6A 3TJOA 1D6WA 1GHYH 3A86A 3STIA 1FN6A 4NIXA 1O2LA 1O2RA 2XW9A 2H9HA 4YOGA 1TYNA 2AH4X 2A4GA 1BJVA 1ELVA 3GDVA 1DUAA 4ZXXH 3H5CB 5C2ZA 2R2WU 4JMYA 2C3SA 3LJJA 4ABAA 2Y5GA 2STAE 2D2DA 2J34A 1FPHH 2QIQA 1DM4B 1J14A 1HUTH 1BMLA 1DPOA 1KXCA 4YLUA 4I31A 1MTWA 4LXBH 4RN6A 1O5FH 3A8DA 4X1RU 2BZ6H 4XBBA 2J92A 3V13A 1L4ZA 2M5TA 1ZSKA 3RXPA 4A1VA 1QGFA 1C5YB 3RXSA 1QR3E 1NFXA 1RXPA 2A45B 1C1MA 2BDBA 1L0ZA 2AEIH 1LHEH 4K1TA 3KHVA 5DK1A 1GBIA 1W8BH 3TJNA 1XUFA 1WAYB 3M7UA 4BAQB 1O2WA 1YPEH 4MNVA 3W95A 5C67A 1GHWH 1TBQH 1V2NT 1O3LA 1GVZA 3NZIA 4AB8A 2RDLA 5HM2A 3VGCB 2QC2A 1GI1A 3UNSA 1E34B 1C1OA 1GHZA 1C5VA 1ESAA 1W0ZU 3M3VA 1FNIA 3UIRA 4BAKB 2P93A 3SUFA 1MQ5A 6CHAB 4I32A 2OTVA 3RC6A 5JYIA 1ZGVA 3GCHB 4JYUH 1KLJH 3MU5A 3RMNH 4D8NA 3UPEA 3BIVH 2O8LA 1OWEA 4XE4A 1PQ8A 1GL0E 2V0BA 4LOYH 3SJKA 2OQ5A 1XUJA 3C27B 4FUIA 5F6MA 3LGYA 3SZNA 1O5CB 3BEFB 3EDXB 3F6UH 1OYQA 3IWMA 3TK6A 1H9LB 2ANKH 1HAXB 1ZSLA 2YOLA 1OWJA 1J8AA 1TX8A 1SL3A 2BB4A 1P2OA 2Z9IA 1GHBG 1CHOG 1HCGA 1DWBH 1VR1H 4NFEA 1C5MD 3QGJA 4VGCB 5GCHG 1BJUA 3DFLA 1SGFA 1H8DH 2BY7X 1F5KU 1HAYB 2GMTB 1PQ5A 3PMHB 2JH0D 1WSSH 3ZV8A 4F4OC 1MH0A 2ODQA 2VGCC 3SV7A 1OP2A 3U1JB 2FZZA 2C4FH 2B7DH 3QUMP 2LNCA 4Y10E 2EC9H 1C2JA 1GDQA 3PMBB 1EZQA 5A2MH 2XBYA 1EB2A 4RKJB 1C5TA 5T6GA 5DP4A 3ZVEA 1DWCH 2P8OB 3SNCA 3ELAH 4E05H 1MCVA 2RA0A 4WH8A 1C4Y2 4BAHB 1NN6A 1PPBH 1VCPA 4AFZA 5EOKA 5ETXA 1RTFB 1E37B 4MPXA 2XC0A 8GCHG 1TIOA 4JCNA 1XUGA 5J4QA 1PPCE 5I46H 1SGYE 3M3TA 4MNXA 2NU0E 3ATWA 4GUXA 1KDQA 5FXLA 3Q77A 1UCYE 1DFPA 1V3XA 1A5HA 5EXLA 1P02A 3S7HB 2ZHQH 3SGAE 2UWPA 1XUIA 3RM0H 3SV8A 2XXLA 2LPRA 3SI4H 1J9CH 3R3GB 4X1NU 4AX9H 5ESBA 4OS4A 5FPYA 1A4WH 1NU9A 1TGTA 4MG3A 4ISLA 1EAWA 1TRNA 3P8NA 1EZUC 3QDZB 4X6PA 3S7KB 2A7JA 1C5NH 1WQSA 3KNXA 1O3MA 1K1JA 1LTOA 1UCYK 3GCOA 1MQ6A 2R0LA 4WWYA 3SUGA 2PLXA 5CE1A 3A84A 1O2KA 3RXKA 3RM2H 2K1QA 3ZZAA 1MKWK 1RS0A 4XFQA 1DT2A 5A8YA 4JZFH 1GI9B 3ESTA 1UTKA 2ZCKP 2Q1JA 3RXCA 5GCHF 3RLWH 4AGJA 1UJ1A 1DY8A 3KEEA 1IQHA 2UWOA 1D3TB 2B8OH 1LQEA 2WYJA 2VWNA 2Y6TA 4UFEH 2ZDLA 1CBWB 1TBRH 3BG4B 2QXHA 1AWHB 5F8ZA 1YCPK 4NIVA 1YCPH 1K1OA 1IOEA 4ABDA 1IAUA 1QJ7B 5JBAS 1FZZA 1IQNA 2BY8X 2ZU2A 1HAVB 1QL7A 2FLBH 5C5OA 1DVAH 2ZG0H 4YOIA 3FVFB 1EPTB 4HTCH 3PROA 1GDNA 1QL9A 4UFDH 4D9QA 2BXUH 1EAXA 3SU6A 2HRVA 3FANA 1SLWB 1DITH 1FV9A 3EGKH 3LGIA 2C90B 1BHXF 4JZIA 3SV9A 3RXUA 3M36A 4CH8B 1V2TT 4B2AA 1KXFA 3RC5A 2Q6GA 1DS2E 2GTBA 3E0PB 1AFEH 1DICA 4CBOA 1BMNH 3SJ9A 4OGYA 4K8YA 2ZPSA 4AGKA 2Y80A 3GCHC 1CHOF 1JRTA 1BTYA 4J1YA 1K1IA 1S83A 1KXDA 3QN7A 3RXIA 2CHAB 3QK1A 1A5IA 4CREA 3ZZ8A 3A7TA 3TH2H 3U8TH 1GI5A 3AW0A 4FUFA 2OC7A 1QFKH 3HK6B 1GJ4H 7ESTE 1NT1A 1O37A 1J15A 1PJPA 3TJVA 4XDEA 6LPRA 1GJ7B 1QY6A 1P2IA 2ANWA 3LC5A 3UOPA 1KTSB 1UO6A 2FOCA 1KYNA 1SGNE 1OOKB 1O2XA 2J95A 4K1EA 1GBEA 5FBIA 4IC5A 5EODA 2G4TA 4LK4A 1AZ8A 1XX9A 5EGMA 3ZZDA 5L30H 1GHAF 1MKXK 5LH8A 4AN7A 5FCRA 1Y5BT 3P70B 1AIXH 2FTMA 2GDEH 1ETSH 2TGAA 1O3KA 3BTTE 2CV3A 1TMUH 2FS9A 2D8WA 1UK4A 2UUKB 4ISIH 1ZRBA 4U32A 1CA0C 2ZFSA 3EA8A 4KTUA 3URCA 1MD7A 3STJA 2BLVA 3KL6A 3P8FA 5HYOA 1O3FA 4X8VH 3M5NA 3ZVFA 4K8BA 1ZR0A 2F83A 2HGTH 4PROA 3O8BA 5FBEA 1UTPA 3K9XB 4BNRA 1EJMA 4Q7ZA 3RXMA 1OP8A 1IQFA 1HJ9A 5T3HA 3P95A 2AIPA 1Y5UT 1IQEA 5HMAA 4NG9H 1QA0A 2WYGA 4NCYA 2A0QB 3AAUA 1YPMH 4MNWA 2QXGA 4Y76A 1GJ8B 1TNKA 4ABFA 2Z3DA 3PO1B 2ZGCA 1FDPA 2OC8A 1A5GH 3F1SB 1SPJA 1GGDC 4ABHA 1TX7A 2PKAB 1SQTA 1HAPH 1LKAA 1KDQB 1ZYOA 1C1WH 2TGTA 2ZQ2A 1HAZB 4ABBA 1FY5A 2R3UA 1O2UA 1QRXA 3TK5A 2GZ8A 4HI3A 7KMEH 1WTGH 1GCTB 3GCNA 3ZZ5A 3DT0H 4Y0ZE 3T27A 4B2CA 2WPKS 4TPYA 2ZTZA 3TGJE 4B74A 4AFQA 4TY7A 3BTEE 1QBOA 4NZQA 1EX3A 3MYWA 2QA9E 4AZ2B 4UFGH 3G01A 1BT7A 2GVFA 1EKBB 1NRNH 2G5VA 1GJ9B 1NFWA 5FHTA 3RUOA 4YM9A 3GOVB 1HJ8A 2SGDE 2SGFE 2CF9H 2WPIS 4WJG2 3T5FH 1ELDE 1YCPM 2A5AA 3EE0B 4K5ZA 2B5TB 1UTLM 1SGDE 2FESH 1BCUH 1KTTB 2OC0A 3QX5H 1UTJA 3OY5U 4E7NA 1TGCA 3M3SA 1TQ0B 2Y82A 3TNTA 4DIIH 2OLGA 3C1KA 3E90B 2ZI2H 3UR6A 1YPGH 5JB9S 1Z6EA 3SI3H 1FY4A 4A1TA 1SC8U 1T31A 2AIQA 1P11E 2TIOA 1IQKA 1G3BA 5E2PA 1LPGB 1DUEA 4NA9H 1LVMA 1ZMNA 3SO3A 2Y5HA 1SOTA 2ZFFH 2ZHDA 5EPYA 1IQMA 1VGCB 1YLCA 3B8JA 4O9VA 3UREA 2H6MA 1LKBA 4X1QU 9ESTA 1BRCE 1AWFH 2Y7XA 2EI6A 1O2MA 3GY5A 1W3CA 2FYQA 2BQWB 1P09A 2BVXH 3I77A 1ANDA 2GMTC 1LVBA 1BIOA 1ZTJA 1AU8A 1VITH 2QGRA 4GVUA 2RA3A 3U8RH 5AVDA 1WYKA 2FI3E 2ZO3H 4YLQH 4Q7XA 1NFYA 3AVZA 3T26A 3KCGH 4DW2U 4D7GA 1YKTA 1DDJA 1NPMA 4ZHAA 1P2KA 1GI0A 1TNIA 1C1UH 3GY8A 2BZAA 3FP8E 1TMBH 4ZKSU 1GPZA 6ESTA 4X2XA 1Y3YA 1KXBA 1Z1JA 2FOEA 1P57B 1ZPZA 5TCCA 3MTYA 4X2WA 1P01A 1P06A 1CBWC 3BTDE 1B0EA 4Y79A 1AB9B 3RP2A 1YYY1 5B6OA 2BY9X 1DXPA 1LHDH 4FVDA 2ZWLH 1ARBA 1HIAA 2SGQE 5A8XA 2H9EH 1SFQB 3PV4A 3M37A 2FOBA 1GCTC 2P3TB 1T8NA 4ZHMU 1BITA 1UTNA 5CMXH 3GCTF 3SNEA 2HWLB 2BDCA 4NWLA 3HPTB 4Q2KA 4ZH8A 3KF2A 3SN8A 1ABJH 1C2KA 3A85A 4CRAA 3B23B 3SV6A 1DSUA 3A7YA 1BTHH 2VIVA 1LMWB 1O3CA 1ELAA 4X8TH 1TNHA 4DURA 2OUAA 1F2SE 5HXFA 5L6NH 4X1SU 1DX5M 1W10U 2SNVA 3VPKA 2BQ6B 3U8OH 1TGNA 3ZVGA 3SU1A 3GY2A 3RLYH 3M5MA 2WINI 1SLVB 1EXFA 1QTFA 2QN5T 1O2ZA 2TPIZ 1BDAA 5GJ4B 3TIUA 1GHVH 1DY9A 2OBOA 5C3NA 2A31A 1FIWA 5C1YA 3ZZ4A 5JPMH 3LGUA 1Y59T 1JIMA 1GHXH 1HPGA 1MTVA 3PLPA 4A5TS 4AB9A 4AFSA 2JH6D 1O38A 3ZZ7A 2BD2A 3WY8A 8ESTE 1V2LT 1YPHC 5DGJA 2VIOA 1CU1A 3MNSA 4R0IA 3KQDA 2VIWA 1BBRK 2W5EA 3LDXH 2XC5A 1ZLRA 3TNSA 4D7FA 4Y8YA 1WU1A 4FUCA 3IITA 6CHAC 1MMJN 3O8RA 2FEQH 2FODA 1VJ9U 1JWTA 4X8UH 5EW2H 2STBE 2UUJB 1J17T 2ZU1A 2BLWA 1BZXE 1A46H 4ISOA 4O03A 4UE7H 4ZKNU 2VIDA 1C4V2 7LPRA 1GCDA 5BPEA 4I33A 3ATKA 1TRMA 3N7OA 2ZIQH 1DXWA 1P03A 4UDWH 1W2KH 1IQIA 5GDSH 2BD5A 3TGKE 1N1LA 1VJAU 1THSH 3PWCA 3GY6A 4FU7A 1GJAB 4IN1A 1S85A 3DA9B 3QLPH 1H4WA 1BOQA 4GCHF 1O2QA 2F9PA 4Z6AH 2P3FH 2ANMH 2QYIA 5H4IB 1CE5A 2BVRH 1E36B 2XBXA 1AFQB 1P2JA 4MDSA 3SNDA 1OSSA 1NESE 2BD9A 4K69A 1UHBB 3S9AA 5T6DA 3BIUH 1MTNC 1BQYA 3RXQA 2ZCLP 4KTCA 4IW4E 4XBCA 3BTKE 3EYDA 1GBKA 1SGEE 1L1GA 4ZXYH 1NRRH 1GI8B 1V2OT 2BDGA 3HKJB 3HGNA 3MH6A 1DOJA 4OGXA 1TRYA 2XC4A 3T29A 1V2KT 3BV9B 4DY7B 1G2LA 3VB6A 1HAGE 1JOUB 2A4RA 2J9NA 3K65B 3UNRA 1GGDB 1CA8B 1SGPE 1ELGA 4HGCA 4H42U 1ZTKA 4B73A 1B7XB 3EA7A 3ZVBA 2BMGB 4IS5A 4YZUA 4KELA 4Q80A 2O8UA 1ZPBA 1C1RA 2DE8A 1GBLA 4B76A 1XUKA 1AVGH 1TX6A 1RRKA 3SV2H 1G36A 3OU0A 1S6FA 4E7RG 4CRDA 3SOSA 2ZHFH 1EOLA 1O2OA 4A7IB 1TQ7B 4ABIA 4ZKOU 1EQ9A 4B1TA 4LZ4B 4GCHG 2BX4A 1B0FA 3ZV9A 3VB5A 1G3CA 4XBDA 1IQGA 1GMHF 1NFUA 1OP0A 4Y71A 2Z9KA 5LPEA 2SGPE 1LPZB 4IC6A 1EB1H 2XWAA 2H5CA 2ZEBA 3UNQA 1O2SA 4ZROA 2PTNA 1NZQH 1QBNA 1TGBA 1AN1E 2OCVB 3LONA 2Z3EA 1A0JA 1GJCB 1K9OE 2G52A 3LGWA 1O33A 1WTHD 1SGIB 2PKSB 2VIQA 2CN0H 3PO1C 1GMCF 1HDTH 1O32A 5CHAB 3RU4T 3RXGA 1P2MA 2UUFB 1S5SA 4I8HA 1GMDF 3TJUA 2A7HA 3SBKA 1A1RA 2PR3A 1CT4E 1TFXA 1H8IH 3UWIA 1QQ4A 3V7TA 4BANB 1LPKB 2RG3A 2ZZUH 2QV1A 3SNBA 1T7CA 1AVWA 1ORFA 1DWEH 2ZDNA 4OS2A 1PPEE 1IQLA 3MO3A 8GCHF 1T32A 1GBAA 4AYYB 1MD8A 1TPAE 5AFYH 1UVTH 4MVNA 4YO9A 4X0WU 1TPSA 1AO5A 2PUXB 3NUMA 3BN9A 1T8LA 1K22H 3VEQB 1HAVA 5DJ7A 2CJIA 2BD4A 3B9FH 1O3BA 4INHA 4TWYA 2NU1E 2V6NA 3M7TA 3MNXA 3O8CA 2J38A 3RDZA 2AMQA 4CRBA 1O3DA 5TJXA 1VITF 1INCA 1D4PB 1ELTA 1GI6A 3A7WA 3H7TA 5EQSA 4ABEA 1E35B 1BMAA 1QJ6B 1NM6A 2WPMS 1ELCA 2JKHA 2ALPA 2ZDVH 2R2MB 1P3CA 1GJDB 3GY3A 4WMFA 4Y11E 4BXWA 2FI4E 4TPIZ 4K1SA 1EAIA 2G81E 4FUJA 1SGQE 3Q00A 4KTSA 2FS8A 1AD8H 1CT0E 1T8OA 1UTMA 1V2ST 1A3BH 5BRRE 2THFB 1ABIH 1O36A 4YOJA 1CO7E 1P04A 4B2BA 5A0CA 2FM2A 2BHGA 2BVSH 1GWAA 1A0LA 2A32A 1G32B 1UHBA 3RU4D 2W3IA 1C5RA 2ESTE 2ZFPH 1P9UA 1JRSA 3CP7A 1FQ3A 1OS8A 1WOFA 3A7ZA 1TA2A 2IOTA 2VB0A 2XWBI 3U69H 5G4BA 2A1DB 3UTUH 1C5ZB 1H1BA 1W13U 2ZU4A 3DD2H 2F9UA 4UEHH 2NU3E 4X8SH 2GKVE 4ESTE 2VVUA 9LPRA 5C1UA 2JETB 2Z7FE 1C9TA 4WF8A 3MI4A 1MU8B 1O2TA 3KQBA 3L6PA 1EUFA 4HFPB 2ZTXA 2J4IA 3MU1A 2KAIB 1RD3B 2OXSA 1G3EA 2Z3CA 3O8DA 4ISHH 1EASA 2XCFA 2ZPQA 1L2EA 3SORA 3SQHE 1JMOH 3A88A 2VJ1A 2IPHA 1TAWA 2TGPZ 4Y7AA 3A81A 5FPSA 2PSXA 3TVJB 2WUCA 1HNEE 1XKAC 2C8YB 1AKSA 3RXVA 2WPLS 4SGBE 3KN2A 1V2JT 2BD3A 1SHYA 3JZ2B 3P8GA 4F49A 2A4OA 5TCAA 4KP0A 5GIBA 1QQUA 3ZVCA 2XYAA 2PGQB 3VXFH 3ZVAA 2V3HH 1WV7H 4SGAE 4NA7A 1D3QB 2HNTE 1GI2A 2H9TH 1W7GH 1LHGH 1ZJKA 1HJAB 1GMCG 2FOMB 1Y3VA 1G2MA 4JZEH 1NY22 3SJOA 3VFEA 4LZ1H 3LKWA 1HAIH 1ESBA 3HATH 1CVWH 2FDAA 1FIZA 4BOHA 2GV7A 4AG2A 1FAKH 5A0BA 1AY6H 1G30B 1NRPH 4QT8C 4MNYA 3VGCC 1Q3XA 1MKXH 1JIRA 1LHCH 4JZ1A 4FVBA 1PQAA 1V2QT 2F9OA 3MWIU 3U1IB 2SGAA 3LT3A 2W7UA 4A1XA 3F9EA 1NS3A 1QHRB 3MO9A 5FPTA 1THPB 1MBQA 5E0JA 2G5NA 3SHAH 1CGHA 1O3JA 1PPZA 4FXGH 4RSPA 2GGVB 1TBZH 1ELBA 3VB4A 2BM2A 1QL8A 2G55A 1KLTA 2FOFA 2Z9LA
chains in the Genus database with same CATH superfamily
1QNJA 3NXPA 1MAXA 2Z9JA 2OK5A 1K1PA 1KSNA 1TLDA 2R3YA 4DT7B 1FX0B 3RXHA 5HKKD 1WBGB 3BSQA 2HPQH 3MH5A 3DSGA 1S0RA 1MKWH 1M9UA 2SNWA 5DP3A 2QAAA 1GBDA 1EAUA 2WPDD 1A7SA 2B0FA 1CGJE 5DSFA 3SJ8A 1GDUA 2HALA 2WV5A 2VGCB 2ZFTA 1XM1A 1O39A 1AUJA 2WPHS 1QB6A 4NA8A 3SU2A 1BTXA 2J98B 3ZZ9A 3UQVA 1NU7B 1BA8B 2UUYA 1PYTD 1K2I1 2ALVA 1PPGE 2P59A 3RXDA 2DUCA 5EPNA 3NPSA 1YY3A 2IJOB 1G9IE 1C2HA 1N6YA 2ZC9H 4X2YA 1A61H 1L4DA 1BRUP 3E91A 1EZXC 5EQQA 3ATLA 3FKSD 2C93B 1XXDA 4P02A 1YP9A 2KZ4A 3BEIB 3GY7A 5J4SA 3V0XA 4I8KA 1GI7B 5GWZA 1ACBE 2R9PA 2VINA 3MNBA 2JDID 1S84A 1E1RD 1Z71A 4YESB 3A8BA 2AERH 2W6JD 2XCNA 1C5XB 2A5IA 1C2DA 3E16B 2B9LA 2WPJS 2VWOA 1EZSC 5CHAC 3RXAA 1TB6H 1P2NA 1TNJA 3BTWE 4OS7A 1ZHPA 2JIZD 5B6LA 4MPVA 3RXOA 1XMNB 1TPOA 3ENSB 1F0UA 1NC6A 3F0PA 4UONA 1ZHMA 2NWNA 2JETC 3EA9A 2C8WB 5I25A 2FXRA 1DLKB 1O3GA 3KQEA 1GBTA 1QRWA 1GHAG 2HVYB 2PFEA 2Y81A 4WMEA 5F03A 1KY9A 2J94A 1O5GH 3T2NA 3DSPA 2GCTB 1EOJA 1UCYH 1FY3A 5K7RA 3QO6A 1MZDA 1ESTA 2F3CE 3GDUA 2R0KA 1KLIH 1LDTT 3A8CA 3D62A 3RMMH 1SQOA 3EE7A 1Y5AT 4NZLA 1C2FA 4BTIB 2GD4B 1HRTH 1WQVH 4WH6A 3BG4C 2GT8A 2Z94A 3D65E 5DN6D 2AGIX 1DWDH 2KAIA 1MCTA 2O8TA 2VU8E 1AI8H 1C1QA 2XRCA 2HLCA 3S9BA 3E6PH 1SGCA 1J16A 1LO6A 1ZPCA 2AYWA 1SI5H 5AFZH 1S81A 4ABGA 1Z8RA 2QY0B 3DUXH 1W11U 4WXIA 4GSOA 2QCYA 3PTBA 2PGBB 4YTAA 1CHGA 1FN8A 2PUQH 2GT7A 4CHAC 2O8WA 3RC4A 1ZRKA 1F0TA 4U01A 4BXSA 1CQQA 3IG6B 2ZTYA 1FAXA 1GVLA 1FJSA 4Y7BA 1O2IA 2BX3A 4ACBA 1YLDA 1ZSJA 3LJOA 1AUTC 3UR9A 1QCPA 4OM9A 1O3AA 4RKOB 1FMGA 2HNTC 4HZHA 4DIHH 2ZECA 3PTNA 2HVXA 1GMDG 1PYTC 2RCEA 5PTPA 1G3DA 3PYHA 1GL1A 1UTOA 3RU4E 2ZFQH 3U9AH 3ZYDA 3HK3B 4CRFA 4ASHA 2GZ9A 1HAOH 3A82A 3M5LA 1ZGIA 1HV7A 3RXJA 1QIXB 2JH5D 1O0DH 1H9IE 1WCZA 1YPKH 5F8XA 3BTGE 1MAYA 2NU4E 3A8AA 3KYGA 3N7EA 2ZGJA 1BTZA 1GMHG 2D1JA 4GHQA 5IK2D 1DANH 1P8VC 1CSOE 1QA7A 5EU8A 1C1SA 1ZHRA 1Z8GA 1S6HA 4BAMB 3TGIE 1MUEB 2YNAA 1C5SA 3ODDA 5EW1H 3RXLA 3ATIA 4U2WA 2KCYA 1PPFE 2BDAA 1AFQC 3SU0A 2AGEX 1PPHE 1K0HA 2PWXA 1Z7KA 2YNBA 3M5OA 3FFGA 1B5GH 3SU5A 3W94A 2G4UA 1ANEA 4D76A 1U6QA 4Q4LA 5FX5A 2EI8A 4BAOB 4JZDH 3U98H 1O5AB 1RIWC 1HBTH 4K3JA 2JJ2D 5IYTA 1UVSH 4TYDA 4YT6H 5EQRA 5ABWA 1OYTH 2AGGX 3GISB 1O2YA 1O2NA 1HLTH 1UMAH 3QWCH 2V3OH 3ITIA 3UFAA 1WXRA 2BYAX 1P9SA 2SGEE 1F0SA 1IHTH 3D49H 2M2AA 4BTUB 1H9HE 2FIRH 2G51A 2O8MA 2WUBA 2ZQ1A 1V2MT 4FUGA 1T8MA 3V3MA 1C1VH 4YT7H 1O35A 3NK8A 3PRBA 1IHSH 3OTJE 2ZNKH 1C2GA 5DP5A 4M9FA 1TOCB 3F68H 1SOZA 2P3UB 1YPLH 2ZPRA 5KEDA 4NIYA 4OS5A 1VCWA 4ZMAH 3SW2B 2PTCE 3FO8D 4JYVH 1SSXA 1P12E 4O97A 2FWWA 1FLEE 1C5PA 2XTTB 1MABB 2BDHA 3EQ0H 1KXAA 3FZDA 4WMDA 4X6NA 3S9CA 1V2RT 4ZUHA 3LU9B 4A6LA 1E0FD 1EPTA 3MHWU 4MPWA 4WXVA 3TK9A 1QRZA 5DP8A 2H1UA 1Z8IB 1SMFE 3VB3A 2QXJA 3D23A 4JYTA 1V2WT 4OS6A 4IMZA 3H7OA 1XXFA 2ZGBH 1FI8A 2Z9GA 3ODFA 1RFNA 1BB0B 2KCAA 4BTTB 1Y3UA 5E0HA 5LGOA 4DVAU 1OKXA 3L33A 2FYRA 2OQUA 3PV5A 1PFXC 2PSYA 1BTUA 4KGAA 4MPUA 1FONA 3QTVH 2QF5A 4IBLH 3MNCA 1UVUH 5EXNA 1C1PA 1OWHA 1O3PB 1Z6JH 3E0NB 1XVMA 3AW1A 5F8TA 1FXYA 4FUEA 2DE9A 1C1TA 1ZMLA 8KME2 4DOQA 1HJAC 4GLYA 3SUEA 2FI5E 3E8LA 3RXEA 2GDDA 3BTFE 1VITG 1HXFH 1O5BB 3QTOH 3SGBE 3TITA 1P0SH 4I8LA 5A0AE 1HGTH 1C5LH 1C2IA 3EAJA 1OWDA 1K28D 4ZKRU 2I6SA 4UFFH 4B71A 1F7ZA 1TONA 1GBFA 2G00A 2PHBA 1W7XH 1BBRH 3BTHE 2BOHB 4DG4A 1HXEH 1LVOA 2PV9B 7GCHG 1AE8H 1QURH 4DJZB 1VCQA 1HB0B 5IDKA 5DPAA 4IGDA 4MTBA 5EXMA 1AZZA 2A5KA 4J2YB 1FY1A 5AF9H 1E38B 2RFKC 2C8ZB 5C1XA 4MLFB 3OE7D 1RTKA 1V2PT 1G37A 3KGPA 1Q2WA 1ZJDA 2QF4A 2VH0A 3SGQE 2FO9A 1SLUB 2ZA5A 1RIWB 3P17H 5C5NA 1VGCC 1NRQH 1TNLA 3F3BA 3FP7E 1K1MA 2OP9A 1X7AC 4FUHA 2BLQA 2F9NA 4B6FA 5DO4H 3MH4A 2TRMA 4NFFA 3VXEH 4CR5A 3UY9A 2W7SA 2ZCHP 5DP9A 1O31A 1SFIA 1C5OH 2VH6A 3F9FA 3I29A 1TNGA 1MU6B 2PP6A 1C9PA 1OPHB 3A83A 1V6DA 1MTNB 3RXBA 3MFJA 2GV6A 4H6TA 3MMGA 2W26A 1SKYE 3OY6U 5E0GA 3LGVA 3UWJH 4FUDA 2H5DA 1CA0B 4B75A 2CXVA 2GCTC 1NO9H 3PLBA 1UVPA 2BTCE 2Q6DA 3AK5A 1BHXB 2TGDA 3WWFA 3MU0A 3R0FA 3ZZCA 3QZRA 1F0RA 1LQDB 2ZU3A 2ZF0H 3M7QA 2GCHG 1AB9C 3F0OA 1W0YH 3NCLA 2FLRH 1KIGH 3L3TA 2I6QA 2QXIA 4FUBA 1GG6B 1TWXB 1C2LA 3BG8A 4I7YH 1BTPA 2TBSA 1O5EH 1C4U2 2VVVA 3PMJA 1HFDA 5GPIB 3RXRA 2VVCA 1K21H 4U30A 1TA6A 2FTLE 4TSFD 1GBCA 1LVYA 2ILNA 1SG8B 2CMYA 4ZAEA 3UUZA 1ZMJA 4INLA 1F5RA 2AMPA 3TH4H 1L1JA 4CHAB 1FUJA 5C20A 3TH3H 4FU8A 2A7CA 2FOAA 3U28C 2ZGHA 1ZOMA 3K6ZA 1O2JA 1YGCH 1O3EA 2EI7A 3A80A 5L2YH 1V2UT 2ODYB 3V12A 3GY4A 4TWWA 3KQCA 4CR9A 1OWKA 1YM0A 3MU8A 1JBUH 1VZQH 3TLOA 2GP9B 3GICB 2F43B 3HKIB 2FMJA 3DFJA 2PKSC 3Q76A 2ULLA 4CRGA 3HGPA 5FAHA 5HIYA 4I8GA 2C8XB 3PB1E 4D9RA 1RGQA 2ZP0H 4TT3D 1EJNA 4NWKA 1EP5A 1T4UH 4Z0KA 2ZFRH 1P3EA 2EY4C 3AASA 3ZZ3A 5E2OA 6GCHG 1Y3XA 5JBBS 1HAHH 3DCLA 2GJGA 2WV4A 3JZ1B 1Y3WA 3P6ZB 2PW8H 3ZZBA 4Y8ZA 1ZTLA 3GYMA 6GCHF 5FCKA 1O2GH 1WDIA 1O2VA 8LPRA 4FU9A 5A8ZA 3TPIZ 3LPRA 1Q31A 1TE0A 3OX7U 1A0HB 1SGTA 4VGCC 1AMHA 1GBBA 3I78A 5HGGA 3MU4A 3A89A 1DLEA 1O3HA 3KIDU 1BMMH 3LH1A 4K2YA 1K1LA 1O30A 2Z6BD 2BLOA 3BEUA 4Q63A 1MZAA 1TABE 5DP7A 3PM3A 5AHGH 3VB7A 5JBCS 4R8TB 1MBMA 3ZVDA 3NRLA 1QBVH 5DG6A 1F5LA 5A09A 3LIWA 4Y6DA 2J97A 5K0HA 1O2PA 2IJD1 2ASUB 1SBWA 3E1XB 1C2MA 1V2VT 1AKSB 2PKAA 5LPFA 1K1NA 2P95A 1SLXB 2CF8H 1N8OB 4WY3A 1DE7H 1ETTH 3BTQE 1GBHA 1LCYA 2ZHWH 1D9IA 3T28A 3F9HA 5DP6A 1Z8JB 4X2VA 2VNTA 1EP6A 1UK2A 3RMLH 1GJ5H 2BD8A 4CBNA 5JB8S 4MQAA 4ZHLU 4Y8XA 3BTME 3Q3KA 4INKA 3P8OA 4YXWD 3A7XA 1YPHE 2VWLA 2ZKSA 4Q7YA 4GHTA 1GBJA 2HPPH 2OINA 5C94A 4ISNA 1BTWA 4M7GA 2G8TA 1XVOA 1YF4A 1BRBE 1IQJA 1UVOA 1UTQA 3P92A 1SGFG 3A7VA 3DHKH 1BRAA 4NSVA 7GCHF 2P94A 1SQAA 1DSTA 1YBWA 2VIPA 3KQ5A 2ZU5A 2BDYA 2F9VA 3PRDA 1WUNH 2LELA 1EATA 1O34A 2ODPA 3M35A 4OS1A 3GCTG 2K0QA 3OSYA 1Y8TA 3SHCH 1CT2E 1SVPA 3MOCA 5EG4A 1LHFH 5GXPA 2OC1A 2KCPA 5CHBA 1C2EA 4XSKU 2CGAA 1FY8E 1OXGA 1TALA 4DGJA 1AVXA 1AE5A 3F9GA 3RXFA 1ZZZA 2P8OC 1ELEE 1THRH 4H6SB 3LOXA 3ZZ6A 3RMOH 2Q6FA 3SNAA 1SB1H 2BY5X 3CS0A 2V35A 2ZDMA 4AORA 1PQ7A 4NIWA 5DKMA 2F91A 2H2ZA 1UK3A 4AFUA 2V3MA 2BOKA 1GI4A 1QB1A 1O3NA 1XKBC 1O3IA 4THNH 1ANCA 1A3EH 5HM9A 5JBTA 4JK6A 3K2UA 1EJAA 3PLKA 3M61U 4I8JA 4AOQA 4E06H 3UOUA 4O3UA 1GVKB 4X6OA 3Q3YA 1N6XA 3PWBA 2OBQA 3A87A 4O3TA 2Y5FA 2BQ7B 2OD3B 5FX6A 2A2QH 1GHBF 3FAOA 2Y7ZA 3ZYEA 1AHTH 3Q3XA 4ABJA 3FZZA 3SU4A 1QJ1B 2ANYA 3LC3A 2FOHA 1C5WB 2EA3A 1O2HA 3GYLB 1D3DB 2YMSB 3ATMA 1BBRE 1BUIA 1MTSA 4IMQA 2FX4A 1O5DH 1RJXB 1ANBA 1C5UA 3GDSA 1HIAB 1MTUA 2BD7A 2P16A 1GJBB 3CENA 4XOJA 3WW7A 5SGAE 1W12U 4NGAH 4CRCA 1C5QA 1NROH 3MO6A 1T4VH 4X1PU 1SR5C 2J2UA 1L1NA 1NRSH 3T25A 2CHAC 3MH7A 1HYLA 1Z1IA 3SU3A 5LPRA 4IN2A 1GI3A 2BDIA 2HOBA 2IN2A 4UD9H 2VWMA 1YC0A 4GAWA 3K6YA 2FP7B 2W3KA 1S0QA 2QF3A 5ESTE 2FOGA 1AQ7A 3S0NA 1SGRE 1SHHB 2FX6A 4DCDA 1FPCH 2HNTF 3QZQA 2F9BH 2EEKA 4A92A 1D6RA 1OX1A 2GCHF 1EPTC 2YMSD 1C1NA 2ZHEH 2NU2E 2BXTH 1ELFA 1RTLA 3AAVA 4NSYA 3SQEE 1O3OA 2AFQB 4Y0YE 4JK5A 3S69A 3LH3A 1F92A 1TMTH 1P05A 1TPPA 1TOMH 2BY6X 2A4QA 4H4FA 1P10A 4AG1A 3RXTA 2D26C 1GG6C 1NTPA 5E8EH 1TGSZ 4GPGA 2GX4A 4AYVB 1D3PB 2AS9A 2O9QA 1KXEA 1CGIE 2XNIA 3QGNB 2GZ7A 1YLNA 1P2QA 1XUHA 2AMDA 3UQOA 1GJ6A 4KKDA 1JXPA 3FP6E 3OYPA 4K60A 1N8OC 2A2XH 4WVPE 3SJIA 3CS7A 3NWUA 5CDFE 3URDA 1S82A 3T62A 3LGTA 2ZDAH 2SFAA 3OEED 5L2ZH 2ZGXH 3BF6H 2FPZA 1AGJA 2UWLA 3E3TA 5T6FA 1ETRH 5JDUB 2XBVA 1ARCA 1W14U 1A2CH 1W0KD 1ID5H 3NKKA 3SUDA 4CH2B 1GBMA 3TU7H 2XBWA 1COWD 2QF0A 3PMAB 2ZDKA 1OWIA 1QB9A 4X6MA 1YPJH 4TY6A 3TJOA 1D6WA 1GHYH 2JJ1D 3A86A 3STIA 1FN6A 4NIXA 1O2LA 1O2RA 2XW9A 2H9HA 4YOGA 1W0JD 1TYNA 2AH4X 2A4GA 1BJVA 1ELVA 3GDVA 4ZCNA 1DUAA 4ZXXH 3H5CB 5C2ZA 2R2WU 4JMYA 2C3SA 3LJJA 4ABAA 2Y5GA 2STAE 4AC9A 2D2DA 2J34A 1FPHH 2QIQA 1DM4B 1J14A 1HUTH 1BMLA 1DPOA 5T1VA 1KXCA 4YLUA 4I31A 1MTWA 4LXBH 4RN6A 1O5FH 3A8DA 4X1RU 2IPQX 2BZ6H 4XBBA 2J92A 3V13A 1L4ZA 2M5TA 1ZSKA 3RXPA 4A1VA 1QGFA 1C5YB 3RXSA 1QR3E 1NFXA 1RXPA 2A45B 1C1MA 2BDBA 1L0ZA 2AEIH 1LHEH 4K1TA 3VG8A 3KHVA 5DK1A 1GBIA 1W8BH 3TJNA 3GS9A 1XUFA 1WAYB 3M7UA 4BAQB 1O2WA 1YPEH 4XD7D 4MNVA 3W95A 5C67A 1GHWH 1TBQH 1V2NT 1O3LA 1GVZA 3NZIA 4AB8A 2RDLA 4F55A 5HM2A 3VGCB 2WV9A 2KR7A 1GI1A 2QC2A 3UNSA 1E34B 1C1OA 1GHZA 1C5VA 1ESAA 1W0ZU 3M3VA 1FNIA 3UIRA 4BAKB 2P93A 3SUFA 1MQ5A 6CHAB 4I32A 2OTVA 3RC6A 5JYIA 1ZGVA 3GCHB 2W6ID 4JYUH 1KLJH 3MU5A 3RMNH 4ASUD 4D8NA 3UPEA 3BIVH 2O8LA 1OWEA 4XE4A 1PQ8A 1GL0E 2V0BA 4LOYH 3SJKA 2OQ5A 1XUJA 3C27B 4FUIA 5F6MA 3LGYA 3SZNA 1O5CB 3BEFB 3EDXB 3F6UH 1OYQA 3IWMA 3TK6A 1H9LB 2ANKH 1HAXB 1ZSLA 2YOLA 1OWJA 1J8AA 1TX8A 1SL3A 2J5UA 2BB4A 1P2OA 2Z9IA 1GHBG 1CHOG 1HCGA 1DWBH 1QZ8A 1VR1H 4NFEA 1C5MD 3QGJA 4VGCB 5GCHG 1BJUA 3DFLA 1SGFA 1H8DH 2BY7X 1F5KU 1HAYB 2GMTB 1PQ5A 3PMHB 2JH0D 2AHME 2VBCA 1WSSH 3ZV8A 4F4OC 1MH0A 2ODQA 2VGCC 3SV7A 1OP2A 3U1JB 2FZZA 2C4FH 2B7DH 3QUMP 2LNCA 4Y10E 2EC9H 1C2JA 1GDQA 3PMBB 1EZQA 5F53A 5A2MH 2XBYA 3ZIAD 1EB2A 4RKJB 1C5TA 5T6GA 5DP4A 3ZVEA 1DWCH 2P8OB 3SNCA 3ELAH 4E05H 1MCVA 2RA0A 4WH8A 1C4Y2 4BAHB 1NN6A 1PPBH 1VCPA 4AFZA 5EOKA 5ETXA 1RTFB 1E37B 4MPXA 2XC0A 1UW7A 8GCHG 1TIOA 4JCNA 1XUGA 5J4QA 1PPCE 5I46H 1SGYE 3M3TA 4MNXA 2NU0E 3ATWA 4GUXA 1KDQA 5FXLA 3Q77A 1UCYE 1DFPA 1V3XA 1A5HA 5EXLA 1P02A 3S7HB 2ZHQH 3SGAE 2UWPA 1XUIA 4RT1A 3RM0H 3SV8A 2XXLA 2LPRA 3SI4H 1J9CH 3R3GB 4X1NU 4AX9H 5ESBA 4OS4A 5FPYA 1A4WH 1NU9A 1TGTA 4MG3A 4ISLA 1EAWA 1TRNA 3P8NA 1EZUC 3QDZB 4X6PA 3S7KB 2A7JA 1C5NH 1WQSA 3KNXA 1O3MA 1K1JA 1LTOA 1UCYK 3GCOA 1MQ6A 2R0LA 4WWYA 1VKYA 3SUGA 2PLXA 5CE1A 3A84A 1O2KA 3RXKA 3RM2H 2K1QA 3N7DA 5KGOA 3ZZAA 1MKWK 1RS0A 4XFQA 1DT2A 5A8YA 4JZFH 1GI9B 3ESTA 1UTKA 2ZCKP 2Q1JA 3RXCA 5GCHF 3RLWH 2L6OA 4AGJA 1UJ1A 1DY8A 3KEEA 1IQHA 2UWOA 1D3TB 2B8OH 1LQEA 2WYJA 2VWNA 2Y6TA 4UFEH 2ZDLA 1CBWB 1TBRH 3BG4B 2QXHA 1AWHB 5F8ZA 1YCPK 2J98A 2LP6A 4NIVA 1YCPH 5C0UA 1K1OA 1IOEA 4ABDA 1IAUA 1QJ7B 5JBAS 1FZZA 1IQNA 2BY8X 2ZU2A 1HAVB 1QL7A 2FLBH 5C5OA 1DVAH 2RDEA 2ZG0H 4YOIA 3FVFB 1EPTB 4HTCH 3PROA 1GDNA 1QL9A 4UFDH 4D9QA 2BXUH 1EAXA 3SU6A 2HRVA 3FANA 4B6EA 3OFND 1SLWB 1DITH 1FV9A 3EGKH 3LGIA 2C90B 1BHXF 4JZIA 3SV9A 3RXUA 3M36A 4CH8B 3CNRA 1V2TT 4B2AA 1KXFA 3RC5A 4FOUC 3WWBA 2Q6GA 1DS2E 2GTBA 3E0PB 1AFEH 5GNDA 1DICA 4CBOA 1BMNH 3SJ9A 4OGYA 4K8YA 2ZPSA 4AGKA 2Y80A 3GCHC 2WHXA 1CHOF 1JRTA 1BTYA 4J1YA 1K1IA 1NBME 1KXDA 1S83A 3QN7A 2CHAB 3QK1A 1A5IA 3RXIA 4CREA 3ZZ8A 3A7TA 3TH2H 3U8TH 1GI5A 3AW0A 4FUFA 1EFRD 2OC7A 1QFKH 3HK6B 2KX4A 1GJ4H 5C0TA 1NT1A 7ESTE 1O37A 1J15A 1PJPA 3TJVA 4XDEA 6LPRA 1GJ7B 1QY6A 1P2IA 2ANWA 3LC5A 3UOPA 1KTSB 1UO6A 2FOCA 1KYNA 1SGNE 1OOKB 1O2XA 2J95A 2WZQA 3KYFA 4K1EA 1GBEA 5FBIA 4IC5A 4P00A 5EODA 4FETA 2G4TA 4LK4A 1AZ8A 1XX9A 5EGMA 3ZZDA 5L30H 1GHAF 3UAIC 1MKXK 5LH8A 5EJ1A 4AN7A 5FCRA 1Y5BT 3P70B 1AIXH 2FTMA 2GDEH 1ETSH 2TGAA 1O3KA 3BTTE 2CV3A 1TMUH 2FS9A 2D8WA 2L74A 1UK4A 2UUKB 4ISIH 1ZRBA 4U32A 1CA0C 2ZFSA 3EA8A 4KTUA 3URCA 1MD7A 3STJA 2BLVA 3KL6A 3P8FA 5HYOA 1O3FA 4X8VH 3M5NA 3ZVFA 4K8BA 1ZR0A 2F83A 2HGTH 4PROA 3O8BA 5FBEA 1UTPA 4I86A 3K9XB 4BNRA 1EJMA 4Q7ZA 3RXMA 1OP8A 1SQRA 2WSSD 1IQFA 1HJ9A 5T3HA 3P95A 2AIPA 1Y5UT 1IQEA 5HMAA 4NG9H 1QA0A 2WYGA 4NCYA 2A0QB 3AAUA 5EJZA 1H8ED 1YPMH 4MNWA 2QXGA 4Y76A 1GJ8B 1TNKA 4ABFA 2Z3DA 3PO1B 2ZGCA 1FDPA 2OC8A 1A5GH 3F1SB 1SPJA 1GGDC 4ABHA 1TX7A 2PKAB 1SQTA 1HAPH 1LKAA 1KDQB 1ZYOA 1C1WH 2TGTA 2ZQ2A 1HAZB 4ABBA 1FY5A 2R3UA 1O2UA 1QRXA 3TK5A 2GZ8A 4HI3A 7KMEH 1WTGH 1GCTB 3GCNA 3ZZ5A 3DT0H 4Y0ZE 3T27A 1E1QD 5EIYA 4B2CA 3F2HA 2WPKS 4TPYA 2ZTZA 3TGJE 4B74A 4AFQA 4TY7A 3BTEE 1QBOA 4NZQA 1EX3A 3MYWA 2QA9E 4AZ2B 4ACAA 4UFGH 3G01A 1E79D 1BT7A 2GVFA 1EKBB 2XOKD 1NRNH 2G5VA 1GJ9B 2KM0A 1NFWA 5FHTA 3RUOA 4YM9A 3GOVB 1HJ8A 2SGDE 2SGFE 2CF9H 2WPIS 4WJG2 3T5FH 1ELDE 1YCPM 2A5AA 3EE0B 4K5ZA 2B5TB 1KMHB 1UTLM 1SGDE 2FESH 1BCUH 1KTTB 2OC0A 3QX5H 1UTJA 3OY5U 4E7NA 1TGCA 2HLDD 3M3SA 1TQ0B 2Y82A 2F4LA 3TNTA 5C17A 4DIIH 2OLGA 3C1KA 3E90B 2ZI2H 3UR6A 1YPGH 5JB9S 1Z6EA 3SI3H 1FY4A 4A1TA 1SC8U 1T31A 2AIQA 1P11E 2TIOA 1IQKA 1G3BA 5E2PA 1LPGB 1DUEA 4NA9H 1LVMA 1ZMNA 3SO3A 2Y5HA 1SOTA 2ZFFH 2ZHDA 5EPYA 1IQMA 1VGCB 1YLCA 3B8JA 4O9VA 3UREA 2H6MA 1LKBA 4X1QU 9ESTA 1BRCE 1AWFH 2Y7XA 2EI6A 1O2MA 3GY5A 1W3CA 3OEHD 2FYQA 2BQWB 1P09A 2BVXH 3I77A 1ANDA 2GMTC 1LVBA 1BIOA 1ZTJA 1AU8A 1VITH 2QGRA 4GVUA 2RA3A 3U8RH 5AVDA 1WYKA 2FI3E 2ZO3H 4YLQH 4Q7XA 1NFYA 3AVZA 3T26A 3KCGH 4DW2U 4D7GA 1YKTA 1DDJA 1NPMA 3F2FA 4ZHAA 1P2KA 1GI0A 1TNIA 1C1UH 3GY8A 2BZAA 3FP8E 1TMBH 4ZKSU 1GPZA 6ESTA 4X2XA 1Y3YA 1KXBA 1Z1JA 2FOEA 3UB0A 1P57B 1ZPZA 3OTPA 5TCCA 3MTYA 4X2WA 1P01A 1P06A 1CBWC 3BTDE 1B0EA 4Y79A 1AB9B 3RP2A 1BMFD 1YYY1 5B6OA 2BY9X 4XRNA 1DXPA 1LHDH 3SYJA 4FVDA 2ZWLH 1ARBA 1HIAA 2SGQE 5A8XA 2H9EH 1SFQB 3PV4A 3M37A 2FOBA 1GCTC 2P3TB 1T8NA 4ZHMU 1BITA 1UTNA 5CMXH 3GCTF 3SNEA 2HWLB 2BDCA 4NWLA 3HPTB 4Q2KA 4ZH8A 3KF2A 3SN8A 1ABJH 1C2KA 3A85A 4CRAA 2EQNA 3B23B 3SV6A 1DSUA 3A7YA 1BTHH 2VIVA 1LMWB 1O3CA 1ELAA 4X8TH 1TNHA 4DURA 2OUAA 1F2SE 5HXFA 5L6NH 4X1SU 1DX5M 1W10U 2SNVA 3VPKA 2BQ6B 3U8OH 1TGNA 3ZVGA 3SU1A 3GY2A 3RLYH 3M5MA 2WINI 1SLVB 1EXFA 1QTFA 2QN5T 1O2ZA 2TPIZ 1BDAA 5GJ4B 3H09A 3TIUA 1GHVH 1DY9A 2OBOA 5C3NA 2A31A 1FIWA 5C1YA 3ZZ4A 5JPMH 1OHHD 3LGUA 1Y59T 1JIMA 1GHXH 1HPGA 1MTVA 3PLPA 4A5TS 3FN8A 4AB9A 5EJLA 4AFSA 2JH6D 1O38A 3ZZ7A 2BD2A 3WY8A 8ESTE 1V2LT 1YPHC 5DGJA 2VIOA 1CU1A 3MNSA 2XNDD 4R0IA 3KQDA 2VIWA 1BBRK 2W5EA 1NBMD 3LDXH 2XC5A 1ZLRA 3TNSA 4D7FA 4Y8YA 1WU1A 4FUCA 3IITA 6CHAC 1MMJN 3O8RA 2FEQH 2FODA 1VJ9U 1JWTA 4X8UH 5EW2H 2STBE 2UUJB 1J17T 2ZU1A 2BLWA 1BZXE 1A46H 4ISOA 4O03A 4UE7H 4ZKNU 2VIDA 1C4V2 7LPRA 1GCDA 5BPEA 4I33A 3ATKA 1TRMA 3N7OA 2ZIQH 1DXWA 1P03A 4UDWH 1W2KH 1IQIA 5GDSH 2BD5A 3TGKE 1N1LA 1VJAU 4Z1MD 1THSH 3PWCA 3GY6A 4FU7A 1GJAB 4IN1A 1S85A 3DA9B 3QLPH 1H4WA 1BOQA 4GCHF 1O2QA 2F9PA 4Z6AH 2P3FH 2ANMH 3N99A 2QYIA 5H4IB 1CE5A 2BVRH 1E36B 2XBXA 1AFQB 1P2JA 4MDSA 3SNDA 1OSSA 1NESE 2BD9A 4K69A 1UHBB 3S9AA 5T6DA 3BIUH 1MTNC 1BQYA 3RXQA 2ZCLP 4HG6A 4KTCA 3DSOA 4IW4E 4XBCA 3BTKE 3EYDA 1GBKA 1SGEE 1L1GA 4ZXYH 1NRRH 1GI8B 1V2OT 2BDGA 3HKJB 3HGNA 3MH6A 1DOJA 4OGXA 1TRYA 2XC4A 3T29A 1V2KT 3BV9B 4DY7B 1G2LA 3VB6A 1HAGE 1JOUB 2A4RA 2J9NA 3K65B 3UNRA 1GGDB 1CA8B 1SGPE 1ELGA 4HGCA 4H42U 1ZTKA 4B73A 1B7XB 3EA7A 3ZVBA 2BMGB 4IS5A 4YZUA 4RI0A 4KELA 4Q80A 2O8UA 1ZPBA 1C1RA 2DE8A 3OAAD 1GBLA 4B76A 1XUKA 1AVGH 1TX6A 1RRKA 3SV2H 1G36A 3OU0A 1S6FA 4E7RG 4CRDA 3SOSA 2ZHFH 1EOLA 1O2OA 4A7IB 1TQ7B 4ABIA 4ZKOU 1EQ9A 4B1TA 4LZ4B 4GCHG 2BX4A 1B0FA 3ZV9A 3VB5A 1G3CA 4XBDA 1IQGA 1GMHF 1NFUA 1OP0A 4Y71A 2Z9KA 5LPEA 2SGPE 1LPZB 4IC6A 1EB1H 2XWAA 2H5CA 2ZEBA 3UNQA 1O2SA 4ZROA 2PTNA 1NZQH 1QBNA 1TGBA 1AN1E 2OCVB 3LONA 2Z3EA 1A0JA 1GJCB 1K9OE 2G52A 3LGWA 1O33A 3W1EA 1WTHD 1SGIB 2PKSB 2VIQA 2CN0H 3PO1C 1GMCF 1HDTH 1O32A 5CHAB 3RU4T 3RXGA 1P2MA 2UUFB 1S5SA 4I8HA 1GMDF 3TJUA 2A7HA 3SBKA 1A1RA 2PR3A 1CT4E 3PV2A 1TFXA 1H8IH 3UWIA 1QQ4A 3V7TA 4BANB 1LPKB 5HIZA 2RG3A 2ZZUH 2QV1A 1YWUA 3SNBA 1T7CA 1AVWA 1ORFA 1DWEH 2ZDNA 4OS2A 1PPEE 1IQLA 3MO3A 8GCHF 1T32A 1GBAA 4AYYB 1MD8A 1TPAE 5AFYH 1UVTH 5FL7D 4MVNA 4YO9A 4X0WU 1TPSA 5KECA 1AO5A 2PUXB 3NUMA 3BN9A 1T8LA 1K22H 3VEQB 1HAVA 5DJ7A 2CJIA 2BD4A 3B9FH 1O3BA 4INHA 4TWYA 2NU1E 2V6NA 3M7TA 3MNXA 3O8CA 2J38A 3RDZA 2AMQA 4CRBA 1O3DA 5TJXA 1VITF 1INCA 1D4PB 1ELTA 1GI6A 3A7WA 3H7TA 5EQSA 4ABEA 1E35B 1BMAA 1QJ6B 1NM6A 2WPMS 1ELCA 2JKHA 2ALPA 2ZDVH 2R2MB 1P3CA 1GJDB 3GY3A 4WMFA 4Y11E 4BXWA 2FI4E 4TPIZ 4K1SA 1EAIA 2G81E 4FUJA 1SGQE 3Q00A 4KTSA 2FS8A 1AD8H 1CT0E 1T8OA 1UTMA 1V2ST 1A3BH 5BRRE 2THFB 3MQKC 1ABIH 1O36A 4YOJA 1CO7E 1P04A 4B2BA 4F48B 5A0CA 2FM2A 2BHGA 2BVSH 1GWAA 1A0LA 2A32A 1G32B 1UHBA 3RU4D 2W3IA 1C5RA 2ESTE 2ZFPH 1P9UA 1JRSA 3CP7A 1FQ3A 1OS8A 1WOFA 3A7ZA 1TA2A 2IOTA 2KCOA 2VB0A 3F2GA 2XWBI 3U69H 5G4BA 2A1DB 3UTUH 1C5ZB 1H1BA 1W13U 2ZU4A 3DD2H 2F9UA 4UEHH 2NU3E 3FOAA 4X8SH 2GKVE 4ESTE 2VVUA 9LPRA 5C1UA 2JETB 2Z7FE 1C9TA 4WF8A 3MI4A 1MU8B 1O2TA 3KQBA 3L6PA 1EUFA 4HFPB 2ZTXA 2J4IA 3MU1A 4DT4A 2KAIB 1RD3B 2OXSA 1G3EA 2Z3CA 3O8DA 4ISHH 1EASA 2XCFA 2ZPQA 1L2EA 3SORA 3SQHE 1JMOH 3A88A 2VJ1A 2IPHA 1TAWA 2TGPZ 4Y7AA 3A81A 5FPSA 2PSXA 3TVJB 4RT0A 2WUCA 1S6LA 1HNEE 1XKAC 2C8YB 1AKSA 3RXVA 2WPLS 4SGBE 3KN2A 1V2JT 2BD3A 1SHYA 3JZ2B 3P8GA 4F49A 2A4OA 5TCAA 4KP0A 5GIBA 2V7QD 1QQUA 3ZVCA 2PGQB 2XYAA 3VXFH 3SZEA 3ZVAA 2V3HH 1WV7H 4SGAE 4NA7A 1D3QB 2HNTE 1GI2A 2H9TH 1W7GH 1LHGH 1ZJKA 1HJAB 1GMCG 2FOMB 1Y3VA 1G2MA 4JZEH 1NY22 3SJOA 3VFEA 4LZ1H 3LKWA 1HAIH 2YMSC 1ESBA 3HATH 1CVWH 2FDAA 1FIZA 4BOHA 2CK3D 2GV7A 4AG2A 1FAKH 5A0BA 1AY6H 1G30B 1NRPH 4QT8C 4MNYA 3VGCC 1Q3XA 1MKXH 1JIRA 1LHCH 4JZ1A 4FVBA 1PQAA 1V2QT 2F9OA 3MWIU 3U1IB 2SGAA 2QE7D 3LT3A 2W7UA 4A1XA 1H8HD 3F9EA 1NS3A 1QHRB 3MO9A 5FPTA 1THPB 1MBQA 5E0JA 2G5NA 3SHAH 1CGHA 1O3JA 1PPZA 4FXGH 4RSPA 2GGVB 1TBZH 1ELBA 2K8IA 2BM2A 3VB4A 1QL8A 2G55A 1KLTA 2FOFA 2Z9LA 2KFWA
chains in the Genus database with same CATH topology
1QNJA 3NXPA 1MAXA 2Z9JA 1K1PA 1KSNA 1TLDA 2R3YA 4DT7B 3RXHA 1WBGB 3BSQA 2HPQH 3MH5A 1S0RA 1MKWH 1M9UA 2SNWA 5DP3A 2QAAA 1GBDA 1EAUA 1A7SA 2B0FA 1CGJE 3SJ8A 1GDUA 2HALA 2WV5A 2VGCB 2ZFTA 1XM1A 1O39A 1AUJA 2WPHS 1QB6A 4NA8A 3SU2A 1BTXA 3ZZ9A 3UQVA 1NU7B 1BA8B 2UUYA 1PYTD 1K2I1 2ALVA 1PPGE 2P59A 3RXDA 2DUCA 5EPNA 3NPSA 2IJOB 1G9IE 1C2HA 1N6YA 2ZC9H 4X2YA 1A61H 1L4DA 1BRUP 3E91A 1EZXC 5EQQA 3ATLA 2C93B 1XXDA 1YP9A 3BEIB 3GY7A 5J4SA 3V0XA 4I8KA 1GI7B 5GWZA 1ACBE 2R9PA 2VINA 3MNBA 1S84A 1Z71A 4YESB 3A8BA 2AERH 2XCNA 1C5XB 2A5IA 1C2DA 3E16B 2B9LA 2WPJS 2VWOA 1EZSC 5CHAC 3RXAA 1TB6H 1P2NA 1TNJA 3BTWE 4OS7A 1ZHPA 4MPVA 3RXOA 1XMNB 1TPOA 3ENSB 1F0UA 1NC6A 4UONA 1ZHMA 2NWNA 2JETC 3EA9A 2C8WB 5I25A 2FXRA 1DLKB 1O3GA 3KQEA 1GBTA 1QRWA 1GHAG 2PFEA 2Y81A 4WMEA 5F03A 1KY9A 2J94A 1O5GH 3T2NA 2GCTB 1EOJA 1UCYH 1FY3A 5K7RA 3QO6A 1MZDA 1ESTA 2F3CE 3GDUA 2R0KA 1KLIH 1LDTT 3A8CA 3D62A 3RMMH 1SQOA 1Y5AT 4NZLA 1C2FA 4BTIB 2GD4B 1HRTH 1WQVH 4WH6A 3BG4C 2GT8A 2Z94A 3D65E 2AGIX 1DWDH 2KAIA 1MCTA 2O8TA 2VU8E 1AI8H 1C1QA 2XRCA 2HLCA 3S9BA 3E6PH 1SGCA 1J16A 1LO6A 1ZPCA 2AYWA 1SI5H 5AFZH 1S81A 4ABGA 1Z8RA 2QY0B 3DUXH 1W11U 4WXIA 4GSOA 2QCYA 3PTBA 2PGBB 4YTAA 1CHGA 1FN8A 2PUQH 2GT7A 4CHAC 2O8WA 3RC4A 1ZRKA 1F0TA 4U01A 4BXSA 1CQQA 3IG6B 2ZTYA 1FAXA 1GVLA 1FJSA 4Y7BA 1O2IA 2BX3A 1YLDA 1ZSJA 3LJOA 1AUTC 3UR9A 1QCPA 1O3AA 4RKOB 1FMGA 2HNTC 4HZHA 4DIHH 2ZECA 3PTNA 2HVXA 1GMDG 1PYTC 2RCEA 5PTPA 1G3DA 3PYHA 1GL1A 1UTOA 3RU4E 2ZFQH 3U9AH 3ZYDA 3HK3B 4CRFA 4ASHA 2GZ9A 1HAOH 3A82A 3M5LA 1ZGIA 1HV7A 3RXJA 1QIXB 2JH5D 1O0DH 1H9IE 1WCZA 1YPKH 5F8XA 3BTGE 1MAYA 2NU4E 3A8AA 2ZGJA 1BTZA 1GMHG 2D1JA 4GHQA 1DANH 1P8VC 1CSOE 1QA7A 5EU8A 1C1SA 1ZHRA 1Z8GA 1S6HA 4BAMB 3TGIE 1MUEB 2YNAA 1C5SA 3ODDA 5EW1H 3RXLA 3ATIA 4U2WA 1PPFE 2BDAA 1AFQC 3SU0A 2AGEX 1PPHE 2PWXA 1Z7KA 2YNBA 3M5OA 3FFGA 1B5GH 3SU5A 3W94A 2G4UA 1ANEA 4D76A 1U6QA 5FX5A 2EI8A 4BAOB 4JZDH 3U98H 1O5AB 1RIWC 1HBTH 4K3JA 5IYTA 1UVSH 4TYDA 4YT6H 5EQRA 5ABWA 1OYTH 2AGGX 3GISB 1O2YA 1O2NA 1HLTH 1UMAH 3QWCH 2V3OH 3ITIA 3UFAA 2BYAX 1P9SA 2SGEE 1F0SA 1IHTH 3D49H 4BTUB 1H9HE 2FIRH 2G51A 2O8MA 2WUBA 2ZQ1A 1V2MT 4FUGA 1T8MA 3V3MA 1C1VH 4YT7H 1O35A 3NK8A 1IHSH 3OTJE 2ZNKH 1C2GA 5DP5A 1TOCB 3F68H 1SOZA 2P3UB 1YPLH 2ZPRA 4NIYA 4OS5A 1VCWA 4ZMAH 3SW2B 2PTCE 4JYVH 1SSXA 1P12E 4O97A 2FWWA 1FLEE 1C5PA 2XTTB 3EQ0H 2BDHA 3FZDA 1KXAA 4WMDA 4X6NA 3S9CA 1V2RT 4ZUHA 3LU9B 4A6LA 1E0FD 1EPTA 3MHWU 4MPWA 4WXVA 3TK9A 1QRZA 5DP8A 2H1UA 1Z8IB 1SMFE 3VB3A 2QXJA 3D23A 4JYTA 1V2WT 4OS6A 4IMZA 3H7OA 1XXFA 2ZGBH 1FI8A 2Z9GA 3ODFA 1RFNA 1BB0B 4BTTB 1Y3UA 5E0HA 5LGOA 4DVAU 1OKXA 3L33A 2FYRA 2OQUA 1PFXC 2PSYA 1BTUA 4KGAA 4MPUA 1FONA 3QTVH 4IBLH 3MNCA 1UVUH 5EXNA 1C1PA 1OWHA 1O3PB 1Z6JH 3E0NB 1XVMA 3AW1A 5F8TA 1FXYA 4FUEA 2DE9A 1C1TA 1ZMLA 8KME2 4DOQA 1HJAC 4GLYA 3SUEA 2FI5E 3E8LA 3RXEA 2GDDA 3BTFE 1VITG 1HXFH 1O5BB 3QTOH 3SGBE 3TITA 1P0SH 4I8LA 5A0AE 1HGTH 1C5LH 1C2IA 3EAJA 1OWDA 1K28D 4ZKRU 2I6SA 4UFFH 4B71A 1F7ZA 1TONA 1GBFA 2G00A 2PHBA 1W7XH 1BBRH 3BTHE 2BOHB 4DG4A 1HXEH 1LVOA 2PV9B 7GCHG 1AE8H 1QURH 4DJZB 1VCQA 1HB0B 5IDKA 5DPAA 4IGDA 4MTBA 5EXMA 1AZZA 2A5KA 4J2YB 1FY1A 5AF9H 1E38B 2C8ZB 5C1XA 4MLFB 1RTKA 1V2PT 1G37A 3KGPA 1Q2WA 1ZJDA 2VH0A 3SGQE 2FO9A 1SLUB 2ZA5A 1RIWB 3P17H 5C5NA 1VGCC 1NRQH 1TNLA 3FP7E 1K1MA 2OP9A 1X7AC 4FUHA 2BLQA 2F9NA 5DO4H 3MH4A 2TRMA 4NFFA 3VXEH 4CR5A 3UY9A 2W7SA 2ZCHP 5DP9A 1O31A 1SFIA 1C5OH 2VH6A 3F9FA 3I29A 1TNGA 1MU6B 1C9PA 1OPHB 3A83A 1V6DA 1MTNB 3RXBA 3MFJA 2GV6A 4H6TA 3MMGA 2W26A 3OY6U 5E0GA 3LGVA 3UWJH 4FUDA 2H5DA 1CA0B 4B75A 2CXVA 2GCTC 1NO9H 3PLBA 1UVPA 2BTCE 2Q6DA 1BHXB 2TGDA 3MU0A 3R0FA 3ZZCA 3QZRA 1F0RA 1LQDB 2ZU3A 2ZF0H 3M7QA 2GCHG 1AB9C 1W0YH 3NCLA 2FLRH 1KIGH 3L3TA 2I6QA 2QXIA 4FUBA 1GG6B 1TWXB 1C2LA 3BG8A 4I7YH 1BTPA 2TBSA 1O5EH 1C4U2 2VVVA 3PMJA 1HFDA 5GPIB 3RXRA 2VVCA 1K21H 4U30A 1TA6A 2FTLE 1GBCA 1LVYA 2ILNA 1SG8B 2CMYA 4ZAEA 3UUZA 1ZMJA 4INLA 1F5RA 2AMPA 3TH4H 1L1JA 4CHAB 1FUJA 5C20A 3TH3H 4FU8A 2A7CA 2FOAA 2ZGHA 1ZOMA 3K6ZA 1O2JA 1YGCH 1O3EA 2EI7A 3A80A 5L2YH 1V2UT 2ODYB 3V12A 3GY4A 4TWWA 3KQCA 4CR9A 1OWKA 1YM0A 3MU8A 1JBUH 1VZQH 3TLOA 2GP9B 3GICB 3HKIB 2FMJA 3DFJA 2PKSC 3Q76A 2ULLA 4CRGA 3HGPA 5FAHA 4I8GA 2C8XB 3PB1E 4D9RA 1RGQA 2ZP0H 1EJNA 4NWKA 1EP5A 1T4UH 4Z0KA 2ZFRH 1P3EA 3AASA 3ZZ3A 5E2OA 6GCHG 1Y3XA 5JBBS 1HAHH 2WV4A 3JZ1B 1Y3WA 3P6ZB 2PW8H 3ZZBA 4Y8ZA 1ZTLA 3GYMA 6GCHF 5FCKA 1O2GH 8LPRA 1O2VA 4FU9A 5A8ZA 3TPIZ 3LPRA 1Q31A 1TE0A 3OX7U 1A0HB 1SGTA 4VGCC 1AMHA 1GBBA 3I78A 5HGGA 3MU4A 3A89A 1DLEA 1O3HA 3KIDU 1BMMH 3LH1A 4K2YA 1K1LA 1O30A 2Z6BD 2BLOA 3BEUA 1MZAA 1TABE 5DP7A 3PM3A 5AHGH 3VB7A 5JBCS 4R8TB 1MBMA 3ZVDA 1QBVH 5DG6A 1F5LA 5A09A 3LIWA 4Y6DA 5K0HA 1O2PA 2ASUB 1SBWA 3E1XB 1C2MA 1V2VT 1AKSB 2PKAA 5LPFA 1K1NA 2P95A 1SLXB 2CF8H 1N8OB 4WY3A 1DE7H 1ETTH 3BTQE 1GBHA 1LCYA 2ZHWH 1D9IA 3T28A 3F9HA 5DP6A 1Z8JB 4X2VA 2VNTA 1EP6A 1UK2A 3RMLH 1GJ5H 2BD8A 4CBNA 5JB8S 4MQAA 4ZHLU 4Y8XA 3BTME 3Q3KA 4INKA 3P8OA 3A7XA 1YPHE 2VWLA 2ZKSA 4Q7YA 4GHTA 1GBJA 2HPPH 2OINA 4ISNA 1BTWA 4M7GA 2G8TA 1XVOA 1YF4A 1BRBE 1IQJA 1UVOA 1UTQA 3P92A 1SGFG 3A7VA 3DHKH 1BRAA 4NSVA 7GCHF 2P94A 1SQAA 1DSTA 1YBWA 2VIPA 2ZU5A 2BDYA 2F9VA 1WUNH 1EATA 1O34A 2ODPA 3M35A 4OS1A 3GCTG 3OSYA 1Y8TA 3SHCH 1CT2E 1SVPA 3MOCA 5EG4A 1LHFH 5GXPA 2OC1A 1C2EA 4XSKU 2CGAA 1FY8E 1OXGA 1TALA 4DGJA 1AVXA 1AE5A 3F9GA 3RXFA 1ZZZA 2P8OC 1ELEE 1THRH 4H6SB 3LOXA 3ZZ6A 3RMOH 2Q6FA 3SNAA 1SB1H 2BY5X 3CS0A 2V35A 2ZDMA 4AORA 1PQ7A 4NIWA 5DKMA 2F91A 2H2ZA 1UK3A 4AFUA 2BOKA 1GI4A 1QB1A 1O3NA 1XKBC 1O3IA 4THNH 1ANCA 1A3EH 5HM9A 5JBTA 4JK6A 3K2UA 1EJAA 3PLKA 3M61U 4I8JA 4AOQA 4E06H 3UOUA 4O3UA 1GVKB 4X6OA 3Q3YA 1N6XA 3PWBA 2OBQA 3A87A 4O3TA 2Y5FA 2BQ7B 2OD3B 5FX6A 2A2QH 1GHBF 3FAOA 2Y7ZA 3ZYEA 1AHTH 3Q3XA 4ABJA 3FZZA 3SU4A 1QJ1B 2ANYA 3LC3A 2FOHA 1C5WB 2EA3A 1O2HA 3GYLB 1D3DB 3ATMA 1BBRE 1BUIA 1MTSA 4IMQA 2FX4A 1O5DH 1RJXB 1ANBA 1C5UA 3GDSA 1HIAB 1MTUA 2BD7A 2P16A 1GJBB 3CENA 4XOJA 5SGAE 1W12U 4NGAH 4CRCA 1C5QA 1NROH 3MO6A 1T4VH 4X1PU 1SR5C 2J2UA 1L1NA 1NRSH 3T25A 2CHAC 3MH7A 1HYLA 1Z1IA 3SU3A 5LPRA 4IN2A 1GI3A 2BDIA 2HOBA 2IN2A 4UD9H 2VWMA 1YC0A 4GAWA 3K6YA 2FP7B 2W3KA 1S0QA 2QF3A 5ESTE 2FOGA 1AQ7A 3S0NA 1SGRE 1SHHB 2FX6A 4DCDA 1FPCH 2HNTF 3QZQA 2F9BH 2EEKA 4A92A 1D6RA 1OX1A 2GCHF 1EPTC 1C1NA 2ZHEH 2NU2E 2BXTH 1ELFA 1RTLA 3AAVA 4NSYA 3SQEE 1O3OA 2AFQB 4Y0YE 4JK5A 3S69A 3LH3A 1F92A 1TMTH 1P05A 1TPPA 1TOMH 2BY6X 2A4QA 4H4FA 1P10A 4AG1A 3RXTA 2D26C 1GG6C 1NTPA 5E8EH 1TGSZ 4GPGA 2GX4A 4AYVB 1D3PB 2AS9A 2O9QA 1KXEA 1CGIE 2XNIA 3QGNB 2GZ7A 1P2QA 1XUHA 2AMDA 3UQOA 1GJ6A 4KKDA 1JXPA 3FP6E 3OYPA 4K60A 1N8OC 2A2XH 4WVPE 3SJIA 3CS7A 3NWUA 3URDA 1S82A 3T62A 3LGTA 2ZDAH 2SFAA 5L2ZH 2ZGXH 3BF6H 2FPZA 1AGJA 2UWLA 3E3TA 5T6FA 1ETRH 5JDUB 2XBVA 1ARCA 1W14U 1A2CH 1ID5H 3NKKA 3SUDA 4CH2B 1GBMA 3TU7H 2XBWA 2QF0A 3PMAB 2ZDKA 1OWIA 1QB9A 4X6MA 1YPJH 4TY6A 3TJOA 1D6WA 1GHYH 3A86A 3STIA 1FN6A 4NIXA 1O2LA 1O2RA 2XW9A 2H9HA 4YOGA 1TYNA 2AH4X 2A4GA 1BJVA 1ELVA 3GDVA 1DUAA 4ZXXH 3H5CB 5C2ZA 2R2WU 4JMYA 2C3SA 3LJJA 4ABAA 2Y5GA 2STAE 2D2DA 2J34A 1FPHH 2QIQA 1DM4B 1J14A 1HUTH 1BMLA 1DPOA 1KXCA 4YLUA 4I31A 1MTWA 4LXBH 4RN6A 1O5FH 3A8DA 4X1RU 2BZ6H 4XBBA 2J92A 3V13A 1L4ZA 2M5TA 1ZSKA 3RXPA 4A1VA 1QGFA 1C5YB 3RXSA 1QR3E 1NFXA 1RXPA 2A45B 1C1MA 2BDBA 1L0ZA 2AEIH 1LHEH 4K1TA 3KHVA 5DK1A 1GBIA 1W8BH 3TJNA 1XUFA 1WAYB 3M7UA 4BAQB 1O2WA 1YPEH 4MNVA 3W95A 5C67A 1GHWH 1TBQH 1V2NT 1O3LA 1GVZA 3NZIA 4AB8A 2RDLA 5HM2A 3VGCB 2QC2A 1GI1A 3UNSA 1E34B 1C1OA 1GHZA 1C5VA 1ESAA 1W0ZU 3M3VA 1FNIA 3UIRA 4BAKB 2P93A 3SUFA 1MQ5A 6CHAB 4I32A 2OTVA 3RC6A 5JYIA 1ZGVA 3GCHB 4JYUH 1KLJH 3MU5A 3RMNH 4D8NA 3UPEA 3BIVH 2O8LA 1OWEA 4XE4A 1PQ8A 1GL0E 2V0BA 4LOYH 3SJKA 2OQ5A 1XUJA 3C27B 4FUIA 5F6MA 3LGYA 3SZNA 1O5CB 3BEFB 3EDXB 3F6UH 1OYQA 3IWMA 3TK6A 1H9LB 2ANKH 1HAXB 1ZSLA 2YOLA 1OWJA 1J8AA 1TX8A 1SL3A 2BB4A 1P2OA 2Z9IA 1GHBG 1CHOG 1HCGA