4K1VA

Crystal structure of delta5-3-ketosteroid isomerase containing y16f and y57f mutations
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFFRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Rescue of deleterious mutations by the compensatory Y30F mutation in ketosteroid isomerase
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4k1vA00
3EHCA 1DMQA 2HMKB 3S5CA 3DXOA 2A15A 3B7CA 3M8CA 4HVNA 4GB5A 1CQSA 1NWWA 4R9LA 5KP3A 3GZXB 2XR8B 3UJMA 4L8PA 1O7NB 2F99A 3BLZA 3FF2A 5STDA 1E3VA 4HM3B 3F7SA 4WYKB 1Z1SA 1QMAA 3JUNA 5BVBA 3G16A 5CF2A 1OGXA 4HM0B 1E97A 4PEJA 3SOAA 1BUQA 3JUPA 2QGUA 5IG0A 2INXA 2IMJA 3B4PA 3NBRA 2Z77A 5BXQA 3FGYA 3JUQA 1TP6A 1HKXA 1GY6A 3E99A 3EJVA 3K7CA 3OWYA 4CDLA 2RFRA 1JKGA 1O7PB 3ER7A 3DM8A 4HKVB 4L7KA 2PZVA 4HM1B 1JB2A 3MG3A 3GZBA 1OCVA 1OF5A 3FSDA 1JB5A 3HX8A 3SEDA 4OUQA 1S5AA 3FZWA 4Q53A 1GY7A 2BNGA 1ULIB 2HMJB 1SJWA 5IG5A 4HM6B 4HZBB 3MYTA 1GS3A 2I9WA 3DUKA 5AEWB 1NU3A 2YFIB 4N3VA 4LMIA 1UUVB 1O7GB 3F14A 5EVHA 3NV0A 4WP5A 3KZTA 3JUMA 2YFLB 3GRDA 1ASKA 3SOYA 3KE7A 1VZZA 4R9KA 2GEYA 4LEHA 4HM4B 3B4OA 3RGRA 4XDWA 3G8ZA 3A76A 4XM4A 2F98A 5CXOA 1JKGB 2HMNB 4HJLB 1OF5B 1OGZA 1OHOA 1K41A 3T8NA 2OWPA 3OXAA 5DREA 2RGQA 5DRVA 1W02A 2QIYA 3CNXA 4XBYA 2B1XB 5IF6A 4J9AA 1EG9B 1DMMA 4X2HA 4KVHA 2UX0A 3LZAA 1O7WB 3NV0B 4K1UA 5CK6A 3NUVA 1UUWB 2XSOB 2YFJB 3EN1B 5AEUB 5AIIA 5IEOA 3F8HA 2F86B 5IG4A 3RGAA 1ZX2A 3B8LA 3MG1A 4LGQA 1GY5A 4HM5B 4HZ9B 4I4KA 3EN8A 2HMLB 3FLJA 3KSPA 4XBTA 2XSHB 3OX9A 3UNLA 4X2OA 1E3RA 5JPPA 3F9SA 4L8OA 5AIHA 3MKIA 1Q42A 2GEXA 1AR0A 1O7MB 2STDA 5G2GA 5D83A 5KP1A 2JQ5A 3NM2A 5IERA 3DZLA 3D9RA 7STDA 4J8TA 3BB9A 4HM2B 4RZMA 1ISKA 5KP4A 4IIAA 2Z7AA 4K1VA 4XB5A 4XBXA 1IDPA 1ZO2A 5HGRA 4R1KA 4HM8B 5AIGA 2W2CA 5IG3A 2XRXB 2Z76A 1A2KA 5CLKA 3GWRA 2K54A 5AIFA 3LYGA 3CU3A 4U13A 1O7HB 5IEPA 3CNMA 1OPYA 3F8XA 2BMQB 3G0KA 3HK4A 3EX9A 3MHEA 3EQQB 3CPOA 4XDVA 4FCMA 1JB4A 3OWUA 2HMOB 3MG2A 3OWSA 4WWUC 1QJGA 3NHXA 2GBXB 4OVMA 2R4IA 1W00A 4STDA 3FH1A 1U5OA 1JN5A 1OUNA 5IENA 1EA2A 3K0ZA 1WQLB 1TUHA 5D82A 6STDA 1Q40A 3ECFA 3EBYA 2GXFA 3VGNA 8CHOA 3Q90A 2CHCA 3FF0A 3H51A 3VSYA 4MJDA 3JUOA 5FW5A 3F7XA 1DMNA 2HMMB 3GZYB 4FCJA 4HM7B 5JPUA 1W01A 1ULJB 2GBWB 1OH0A 3MSOA 2B24B 3ROBA 3EC9A 4H3UA 1STDA 3DMCA 4WYKA 3STDA 5CF1A 3KKGA 3F40A 5D81A 1OHSA 1OHPA 1JN5B 3GZRA 3T8UA 4ORLA 3FKAA 3HZPA 3I0YA 3NXJA 3WMDA 5AI1A 2CKFB 1Q40B 3IPTA 3H3HA 1W6YA 3OV4A 1GYBA 3EBTA 2RCDA 1NDOB 1C7HA 5TGNA 2BMOB 2BMRB 3EF8A
chains in the Genus database with same CATH superfamily
1GD4A 3BIRA 1DMQA 1I0XA 1UGIA 3EHCA 3NX0A 2HMKB 3HIIA 1GOVA 4LZIA 3S5CA 1UW1A 1I70A 3SLUA 3CCV3 2RNTA 3DXOA 2A15A 1FUSA 3B7CA 1RN1A 3M8CA 1GSPA 2BHMA 4HVNA 2E2VA 4GB5A 1F8NA 1CQSA 1NWWA 1B20A 3N54B 4N6OB 4R9LA 5KP3A 3GZXB 3PXMA 2XR8B 3UJMA 4L8PA 2KAAA 1GOYA 1O7NB 2XFSA 1MWUA 3KN4A 3X41A 2F99A 1T5YA 3N8BA 1WMOA 3CC43 1BSCA 1MWSA 2F5MA 2P38A 3PZWA 4J5KA 5I97A 3HOHA 3BLZA 3FF2A 5STDA 1D6ZA 1E3VA 4HM3B 3CCE3 1I2FA 1LXEA 4KT3B 2V1LA 3F7SA 1DYUA 3GSPA 3WDGB 1JBSA 2M7OA 2LYXA 4WYKB 1Z1SA 1QMAA 4FR9A 3OW22 1S723 4AKZA 3JUNA 5BVBA 1M9GA 4O2HA 3G16A 4EW5A 1OGXA 1PY3A 1QAKA 1E97A 1BRHA 2CFLA 3A5EA 4HM0B 5FGOA 1UI8A 4PEJA 3RNTA 4NPBA 5LC6A 3SOAA 1BUQA 2OOVC 1D6UA 1BSBA 3G4S3 3JUPA 1LVNA 2QGUA 5IG0A 1KWIA 2INXA 2IMJA 3D4AA 2ML6A 2BIRA 4N6V0 3B4PA 1QALA 4EC6A 2QEX3 2F56A 1SIIA 2D42A 2XGNA 2P09A 3NBRA 2Z77A 5BXQA 1JJ22 1IT8A 3BNEA 1BRNL 1TJDA 1DVDA 1SPUA 3FGYA 3JUQA 3NBBA 3RDEA 1M904 1TP6A 2C11A 1Q7HA 1HKXA 1GY6A 3D79A 3E99A 5M19A 2JDIH 2Z6BA 3EJVA 3K7CA 2CG1A 3OWYA 4CDLA 1I2EA 3EE1A 2RFRA 1BRJA 3DGNA 4K61A 1JKGA 1O7PB 3ER7A 3CCQ3 3URPA 1RRHA 3DM8A 4HKVB 5G1LA 7GSPA 4L7KA 1IQXA 2ZL8A 2O9UX 2PZVA 1MNLA 4HM1B 1JB2A 3AMOB 1US1A 3MG3A 3GZBA 1OCVA 1FA3A 1OF5A 3ALAA 3BNDA 3U97A 1I8VA 2CX1A 1MWTA 1JB5A 3FSDA 3HX8A 4OUQA 1RGEA 2W9QA 3SEDA 1YHQ3 1S5AA 1AV4A 2OQEC 1N9EA 3FZWA 3LTDA 4Q53A 1X1UA 4TX4A 2GU3A 1GY7A 2BNGA 1CH0A 1RHLA 1LRAA 3EB8A 1ULIB 1BNGA 3V99A 4GHOA 1RN4A 2HMJB 1SJWA 1V57A 5IG5A 4R4KA 3J7Yd 3UL6A 4HM6B 4HZBB 4O8SA 1X1XA 4CPKA 1TFOA 2UGIA 3MYTA 2E2UA 1GS3A 3LXUX 2I9WA 1YIJ3 1Q814 3DUKA 2C10A 1RGHA 5AEWB 1RDSA 1W2B2 1NU3A 5ELJA 3WR2A 3QRDA 1GMPA 2YFIB 3AHSA 4N3VA 4HYZA 4KFDA 4LMIA 1AVLA 1LQMB 1UUVB 2F5WA 1O7GB 3F14A 5EVHA 6RNTA 2H0IA 1UCJA 2K3DA 2H0HA 3NV0A 4O02B 4WP5A 4FMBA 3KZTA 3WOEB 2ZDJA 3LT9A 3Q2PA 2KRTA 3AHWA 1JRQA 2W03A 4R80A 3JUMA 1LOXA 4QWTA 3BU4A 4GSPA 1TFKA 2YFLB 1UUGB 2WO0A 3CC73 2PNCA 1QVG2 1J2BA 4MMZB 3GRDA 1ASKA 1RGKA 2C4BA 3KE7A 1VZZA 4KFEA 3SOYA 1VQ43 4R9KA 1UCKA 2GEYA 4LEHA 1BSDA 4HM4B 1FGMA 3B4OA 3RGRA 4LYLB 3X42A 3FG4A 4XDWA 1VQL3 3G8ZA 3A76A 1UCIA 2O3OA 4K90B 4XM4A 1BSEA 2F98A 5CXOA 2BT3A 3DGOA 2KCDA 1JKGB 3AMOA 2IUJA 1UCLA 1SARA 1OACA 2HMNB 1RGFA 1UGHI 1IYYA 1BRSA 8RNTA 4HJLB 4EYCA 1IVVA 3IJEB 1BVIA 3CME3 3CCL3 4HBRA 1OF5B 1OGZA 1TIJA 2MC8A 1OHOA 1NB5I 1VQ93 1K41A 1YGEA 3CD63 1IV9A 1JBRA 3UL5A 1Q7Y4 3T8NA 3FCSB 2OWPA 3OXAA 1ROAA 1B2SA 1TRQA 1C54A 3S28A 5DREA 2RGQA 9RNTA 1PFPA 2OOVA 2BU4A 4GL6A 5DRVA 1W02A 2QIYA 3CNXA 3LT8A 1CYUA 4XBYA 1UDII 2B1XB 5IF6A 1RGLA 4J9AA 4CCVA 1VQM3 2W0QA 3SX1A 1N5PA 1IVWA 1A90A 1A2PA 1N5HA 1EG9B 1YVBI 2R41A 2WOHA 3N9HA 1M1K4 3KCHA 3PCSA 1TU5A 1DMMA 3NBJA 4X2HA 4KVHA 2UX0A 3LZAA 2ZA4A 1O7WB 4WFOA 3LH4A 4BTWA 1Y4KA 1IV7A 1SQWA 1RCLA 3NV0B 1M1XB 1FGQA 3LTBA 4K1UA 5JBSA 1RCKA 3NQZA 5CK6A 4HOHA 3NUVA 2IA7A 1UUWB 1BRKA 2XSOB 2YFJB 3EN1B 3PYJA 5AEUB 4RNZA 1Q9EA 1BUJA 5AIIA 5IEOA 2OCTA 3F8HA 2F86B 5IG4A 3RGAA 1W4NA 1ZX2A 3CCU3 1BRGA 1T3BA 1UI7A 3IMAB 3B8LA 2ZHXB 3MG1A 4LGQA 1D6YA 2CFDA 1FW7A 3CXC2 2OQEA 1GY5A 3D5GA 3D3LA 1BIRA 1I3IA 4RBNA 1FGRA 1AY7A 4HM5B 2CWVA 5HOHA 1NNVA 4HZ9B 2Q07A 4I4KA 3CCS3 1BNIA 1BSAA 3EN8A 1RGAA 2KF5A 1VQN3 2HMLB 3FLJA 1GMRA 3WHOA 3ZG0A 3JVCA 3ZG5A 1YJW3 3KSPA 3LTAA 4XBTA 3D5IA 2XSHB 3K9MC 3OX9A 3UNLA 3O8YA 4X2OA 1E3RA 2D1WA 5JPPA 1VQ73 5M1AA 1T2HA 1RKYA 1W5ZA 3F9SA 1EEJA 4L8OA 3S27A 5AIHA 1GMQA 1LOWA 1ZGXA 3MKIA 3PGBA 3HIGA 1FYSA 1Q42A 2GEXA 1AR0A 2Y73A 1BNJA 1O7MB 1RGGA 2STDA 4MMYB 1B2UA 5G2GA 5BU4A 1Q864 1LOYA 5D83A 5KP1A 3MWZA 2JQ5A 1GD3A 4O3VA 1VQ63 1B21A 3DH2A 2CFKA 3NM2A 2FNQA 5IERA 3DZLA 5EQLA 1IK3A 2CC3A 3D9RA 4JF8A 4N6UA 1B27A 3WODG 7STDA 6GSPA 1AVKA 3DY5A 4G1MB 4J8TA 1G96A 4N6MA 1I2GA 3BB9A 2OTL3 3BNBA 4HM2B 1K28A 1FZUA 2CH9A 4RZMA 1LNHA 2XGLA 3S67A 1ISKA 1WMPA 3Q3FA 2CW9A 4MMXB 4BTYA 2UUGC 5KP4A 1RNBA 4ILFA 4IIAA 3KFQC 3UB1A 1IVXA 1PYLA 2IY2A 2Z7AA 4K1VA 4XB5A 1RN7A 1LQGC 4XBXA 1I3FA 2SARA 1IDPA 3SYUA 1ZO2A 5HGRA 1R4YA 1EUIC 3DGMA 4R1KA 4HM8B 1YGWA 5AIGA 2W2CA 1RLSA 5IG3A 1K9M4 4AKYA 2SBLA 2W9PA 3U1WA 3WOFB 4EBGA 1DE3A 5GSPA 3X3XA 1RRLA 4NREA 1VQ83 1A67A 1MGWA 2GU1A 1IQYA 2XRXB 1EQKA 1I0VA 1ROVA 3V92A 2FXTA 1BRIA 1VQ53 3LOYA 1BNRA 2E2TA 1JZDA 2Z76A 3K63A 3G6E3 1A2KA 5CLKA 4EV5A 3T0UA 2KXGA 1DVCA 3FG3A 1N9JA 3GWRA 2K54A 3LYGA 5AIFA 1X1YA 3CU3A 4LSOA 1IT7A 4U13A 2F4YA 3X3ZA 3K5TA 1O7HB 2CG0A 1STFI 5IEPA 3TDGA 1WTHA 4FMCA 4KFFA 3CNMA 1OPYA 1V58A 2BO9B 3F8XA 1B2MA 5BIRA 1BNEA 2MF7A 3VF1A 1G02A 2BMQB 3G0KA 3QK9A 4OK0A 2KF6A 1HZ1A 4FCZA 3KSED 4BIRA 3HK4A 3Q1CA 3EX9A 1YI23 3MHEA 4H61A 5IW9A 3I563 1L5GB 4JRFA 3EQQB 5CF2A 3CPOA 3PS8A 1FUWA 2IYJA 1IQ8A 1CEWI 2ML5A 1YNVX 3PCRA 1A2VA 4XDVA 1B3SA 1MWRA 4FCMA 1JB4A 3OWUA 2HMOB 1HU9A 1MOLA 4FMDA 3MG2A 1KC84 1G0TA 5A0OB 2Y74A 3OWSA 4WWUC 3CCR3 3X3YA 1QJGA 1RSNA 5AYSC 3NHXA 1QAFA 2GBXB 1AQZA 3AGOA 2R4IA 4OVMA 4RNTA 4BL2A 1W00A 4STDA 3AGNA 3FH1A 1U5OA 3CC23 2LQVA 1JN5A 1OUNA 3G713 5IENA 4RNYA 2L1SA 1GOUA 2KF3A 4NHFA 2IUKA 1YJN3 1EA2A 2P0MA 1WQLB 2W6JH 3K0ZA 3WA3A 1TUHA 1T2IA 5D82A 6STDA 3S29A 1TTOA 1Q40A 3ECFA 3EBYA 2GXFA 1DETA 1BNFA 2CFWA 5RNTA 3VGNA 8CHOA 2CK3H 2WOFA 3Q90A 4FMAA 1BNSA 2CHCA 1JV2B 1MGRA 1ZS7A 2AADA 1WMNA 2CFGA 3FF0A 3H51A 2KF4A 2W56A 1KSIA 4ZM8A 1W6CA 4EV2A 1K8A4 1JNQA 4BTXA 1K734 1SIHA 3GAXA 1BOXA 1R4CA 3CMA3 4N6NB 4WHAA 4KZ1A 1JBTA 2RBIA 2WGOA 2K0MA 2CIUA 5AYRB 3VSYA 1NB3I 5EEOA 5LC7A 3NM7A 4MJDA 1BU4A 2FGTA 4IT7A 1VQO3 5G1KA 1FGTA 3LTCA 1BANA 3JUOA 2CWTA 2P0XA 3KIIA 5FW5A 1BGSA 1YJ93 3F7XA 3X40A 2HOHA 1DMNA 1KQS2 1U8CB 4HAAA 2HMMB 3GZYB 2L4VA 4FCJA 1IU7A 1B2XA 3WA2X 1QVF2 4HM7B 1B2ZA 4BU4A 1WNHA 2CWUA 4EXRA 2H0GA 5JPUA 3CCM3 1W01A 3HI7A 3FG1A 1ULJB 2RSXA 3BNCA 4N6TA 2GBWB 3ZFZA 2XEPA 1RJOA 4BL3A 3I553 1OH0A 1HYFA 5ELUA 3MSOA 2B24B 3ROBA 3EC9A 4H3UA 4DKIA 1W2ZA 1FGOA 4IPBA 1IVUA 1LOVA 1N8QA 1STDA 2YX9A 3DMCA 4WYKA 3STDA 3DGYA 5CF1A 1NJI4 1NO3A 3KKGA 4J5GA 1KD14 3F40A 3NQYA 5D81A 1OHSA 1RGCA 1OHPA 2XF3A 3MPHA 1JN5B 1VQP3 3GZRA 2CX0A 3T8UA 4ORLA 1BAOA 1W6GA 5M18A 2OTJ3 2XH9A 1RMSA 2XFTA 3FKAA 1YVSA 3HZPA 3I0YA 3SXXA 1VQQA 3SVAA 3NXJA 3CPW2 3WMDA 1RTUA 5AI1A 1TRPA 2W04A 2CKFB 1Q40B 1YIT3 3IPTA 1RNTA 1V74A 1X1WA 7RNTA 3H3HA 4MEIA 1PU4A 1EKMA 4I5QA 3V98A 1LNIA 1W6YA 3L0RA 3OV4A 2QA43 2W56B 3DGLA 1GYBA 3EBTA 4N6LA 2WGQA 1W7CA 2RCDA 2J8XB 1NDOB 1N8R4 4CJNA 1JZOA 1C7HA 5TGNA 2BMOB 1Q824 1FUTA 1CYVA 3LMLA 3CCJ3 4AEQA 2BMRB 3EF8A 2AAEA 1VQK3 2P05A 2GSPA
chains in the Genus database with same CATH topology
1GD4A 3EHCA 1DMQA 3NX0A 2HMKB 3HIIA 4LZIA 3S5CA 1UW1A 3SLUA 3CCV3 3DXOA 2A15A 3B7CA 3M8CA 2BHMA 4HVNA 2E2VA 4GB5A 1F8NA 1CQSA 1NWWA 4R9LA 3N54B 4N6OB 5KP3A 3GZXB 3PXMA 2XR8B 3UJMA 4L8PA 1O7NB 2XFSA 3X41A 3KN4A 2F99A 1T5YA 3N8BA 1WMOA 3CC43 2P38A 3PZWA 5I97A 3BLZA 3FF2A 5STDA 1D6ZA 1E3VA 4HM3B 3CCE3 1LXEA 2V1LA 3F7SA 1DYUA 3WDGB 2M7OA 2LYXA 4WYKB 1Z1SA 1QMAA 4FR9A 3OW22 1S723 4AKZA 3JUNA 5BVBA 1M9GA 4O2HA 3G16A 5CF2A 1OGXA 2CFLA 1QAKA 1E97A 4HM0B 5FGOA 1UI8A 4PEJA 5LC6A 3SOAA 1BUQA 2OOVC 1D6UA 3G4S3 3JUPA 1LVNA 2QGUA 5IG0A 1KWIA 2INXA 2IMJA 2ML6A 4N6V0 3B4PA 1QALA 4EC6A 2QEX3 1SIIA 2D42A 2XGNA 2P09A 3NBRA 2Z77A 5BXQA 1JJ22 1IT8A 3BNEA 1DVDA 1SPUA 3FGYA 3JUQA 3NBBA 3RDEA 1M904 1TP6A 2C11A 1HKXA 1GY6A 3E99A 2JDIH 2Z6BA 3EJVA 3K7CA 2CG1A 3OWYA 4CDLA 3EE1A 2RFRA 3DGNA 4K61A 1JKGA 1O7PB 3ER7A 3CCQ3 1RRHA 3DM8A 4HKVB 4L7KA 1IQXA 2ZL8A 2O9UX 2PZVA 1MNLA 4HM1B 1JB2A 3AMOB 1US1A 3MG3A 3GZBA 1OCVA 1FA3A 1OF5A 3ALAA 3BNDA 3U97A 3FSDA 1JB5A 3HX8A 3SEDA 4OUQA 2W9QA 1YHQ3 1S5AA 1AV4A 2OQEC 1N9EA 3FZWA 3LTDA 4Q53A 4TX4A 2GU3A 1GY7A 2BNGA 3EB8A 1ULIB 3V99A 2HMJB 1SJWA 5IG5A 4R4KA 3J7Yd 3UL6A 4HM6B 4HZBB 4O8SA 1TFOA 3MYTA 2E2UA 1GS3A 3LXUX 2I9WA 1YIJ3 1Q814 3DUKA 2C10A 5AEWB 1W2B2 1NU3A 5ELJA 3QRDA 2YFIB 4N3VA 4HYZA 4KFDA 4LMIA 1AVLA 1UUVB 1O7GB 3F14A 5EVHA 3NV0A 4O02B 4WP5A 4FMBA 3KZTA 3WOEB 2ZDJA 3LT9A 3Q2PA 2KRTA 4R80A 1JRQA 2W03A 3JUMA 1LOXA 4QWTA 1TFKA 2YFLB 2WO0A 3CC73 2PNCA 1QVG2 1J2BA 4MMZB 3GRDA 1ASKA 3SOYA 3KE7A 1VZZA 4KFEA 1VQ43 4R9KA 2GEYA 4LEHA 4HM4B 1FGMA 3B4OA 3RGRA 3X42A 3FG4A 4XDWA 1VQL3 3G8ZA 3A76A 2O3OA 4K90B 4XM4A 2F98A 5CXOA 2BT3A 3DGOA 2KCDA 1JKGB 3AMOA 2IUJA 1OACA 2HMNB 4HJLB 4EYCA 1IVVA 3IJEB 3CME3 3CCL3 4HBRA 1OF5B 1OGZA 1TIJA 2MC8A 1OHOA 1NB5I 1VQ93 1K41A 1YGEA 3CD63 1IV9A 3UL5A 1Q7Y4 3T8NA 3FCSB 2OWPA 3OXAA 1ROAA 3S28A 5DREA 2RGQA 1PFPA 2OOVA 4GL6A 5DRVA 1W02A 2QIYA 3CNXA 3LT8A 1CYUA 4XBYA 2B1XB 5IF6A 4J9AA 4CCVA 1VQM3 2W0QA 3SX1A 1N5PA 1IVWA 1A90A 1N5HA 1EG9B 1YVBI 2WOHA 3N9HA 1M1K4 3PCSA 1TU5A 1DMMA 3NBJA 4X2HA 4KVHA 2UX0A 3LZAA 1O7WB 4WFOA 3LH4A 4BTWA 1Y4KA 1IV7A 1SQWA 3NV0B 1M1XB 1FGQA 3LTBA 4K1UA 5JBSA 3NQZA 5CK6A 3NUVA 2IA7A 1UUWB 2XSOB 2YFJB 3EN1B 3PYJA 5AEUB 4RNZA 5AIIA 5IEOA 2OCTA 3F8HA 2F86B 5IG4A 3RGAA 1W4NA 1ZX2A 3CCU3 1UI7A 3IMAB 3B8LA 3MG1A 4LGQA 1D6YA 2CFDA 3CXC2 2OQEA 1GY5A 3D3LA 4RBNA 1FGRA 4HM5B 2CWVA 4HZ9B 2Q07A 4I4KA 3CCS3 3EN8A 1VQN3 2HMLB 3FLJA 3JVCA 1YJW3 3KSPA 3LTAA 4XBTA 2XSHB 3K9MC 3OX9A 3UNLA 3O8YA 4X2OA 1E3RA 2D1WA 5JPPA 1VQ73 1RKYA 1W5ZA 3F9SA 4L8OA 3S27A 5AIHA 3MKIA 3PGBA 3HIGA 1Q42A 2GEXA 1AR0A 2Y73A 1O7MB 2STDA 4MMYB 5G2GA 1Q864 5D83A 5KP1A 3MWZA 2JQ5A 1GD3A 4O3VA 1VQ63 2CFKA 3NM2A 2FNQA 5IERA 3DZLA 5EQLA 1IK3A 2CC3A 3D9RA 4JF8A 4N6UA 3WODG 7STDA 1AVKA 3DY5A 4G1MB 4J8TA 1G96A 4N6MA 3BB9A 2OTL3 3BNBA 4HM2B 1K28A 2CH9A 4RZMA 1LNHA 2XGLA 3S67A 1ISKA 1WMPA 2CW9A 4MMXB 4BTYA 5KP4A 4IIAA 3KFQC 3UB1A 1IVXA 2Z7AA 4K1VA 4XB5A 1RN7A 4XBXA 1IDPA 1ZO2A 5HGRA 3DGMA 4R1KA 4HM8B 5AIGA 2W2CA 5IG3A 1K9M4 4AKYA 2SBLA 2W9PA 3U1WA 3WOFB 4EBGA 3X3XA 1RRLA 4NREA 1VQ83 1A67A 2GU1A 1IQYA 2XRXB 1EQKA 1ROVA 3V92A 2FXTA 1VQ53 3LOYA 2E2TA 2Z76A 3K63A 3G6E3 1A2KA 5CLKA 4EV5A 3T0UA 2KXGA 1DVCA 3FG3A 1N9JA 3GWRA 2K54A 3LYGA 5AIFA 3CU3A 4LSOA 3X3ZA 1IT7A 4U13A 3K5TA 1O7HB 2CG0A 1STFI 5IEPA 3TDGA 1WTHA 4FMCA 4KFFA 3CNMA 1OPYA 2BO9B 3F8XA 2MF7A 3VF1A 3QK9A 2BMQB 3G0KA 4OK0A 4FCZA 3KSED 3HK4A 3Q1CA 3EX9A 1YI23 3MHEA 4H61A 5IW9A 3I563 1L5GB 4JRFA 3EQQB 3CPOA 3PS8A 1FUWA 1IQ8A 1CEWI 2ML5A 3PCRA 1A2VA 4XDVA 4FCMA 1JB4A 3OWUA 2HMOB 1HU9A 1MOLA 4FMDA 3MG2A 1KC84 5A0OB 2Y74A 3OWSA 4WWUC 3CCR3 3X3YA 1QJGA 5AYSC 3NHXA 1QAFA 2GBXB 4OVMA 2R4IA 1W00A 4STDA 3FH1A 3CC23 1U5OA 2LQVA 1JN5A 1OUNA 3G713 5IENA 4RNYA 4NHFA 2IUKA 1YJN3 1EA2A 2P0MA 1WQLB 2W6JH 3K0ZA 3WA3A 1TUHA 5D82A 6STDA 3S29A 1Q40A 3ECFA 3EBYA 2GXFA 2CFWA 3VGNA 8CHOA 2CK3H 2WOFA 3Q90A 4FMAA 2CHCA 1JV2B 3FF0A 1WMNA 2CFGA 3H51A 2W56A 1KSIA 4ZM8A 1W6CA 4EV2A 1K8A4 1JNQA 4BTXA 1K734 1SIHA 3GAXA 1R4CA 3CMA3 4N6NB 4WHAA 4KZ1A 2WGOA 2K0MA 2CIUA 5AYRB 3VSYA 1NB3I 5EEOA 5LC7A 3NM7A 4MJDA 2FGTA 4IT7A 1VQO3 1FGTA 3LTCA 3JUOA 2CWTA 2P0XA 3KIIA 5FW5A 1YJ93 3F7XA 3X40A 1DMNA 1KQS2 1U8CB 2HMMB 3GZYB 2L4VA 4FCJA 1IU7A 3WA2X 1QVF2 4HM7B 1WNHA 2CWUA 4EXRA 5JPUA 3CCM3 1W01A 3HI7A 3FG1A 1ULJB 2RSXA 3BNCA 4N6TA 2GBWB 2XEPA 1RJOA 3I553 1OH0A 5ELUA 3MSOA 2B24B 3ROBA 3EC9A 4H3UA 1W2ZA 1FGOA 4IPBA 1IVUA 1N8QA 1STDA 2YX9A 3DMCA 4WYKA 1NJI4 3STDA 5CF1A 1NO3A 3KKGA 1KD14 3F40A 3NQYA 5D81A 1OHSA 3MPHA 1OHPA 2XF3A 1JN5B 1VQP3 3GZRA 3T8UA 4ORLA 1W6GA 2OTJ3 2XH9A 3FKAA 2XFTA 3SXXA 3HZPA 3I0YA 3SVAA 3NXJA 3CPW2 3WMDA 5AI1A 2W04A 2CKFB 1Q40B 1YIT3 3IPTA 1V74A 3H3HA 4MEIA 1PU4A 1EKMA 3V98A 1W6YA 3L0RA 3OV4A 2QA43 2W56B 3DGLA 1GYBA 3EBTA 4N6LA 2WGQA 1W7CA 2RCDA 1N8R4 1NDOB 1C7HA 5TGNA 2BMOB 1Q824 1CYVA 3LMLA 3CCJ3 4AEQA 2BMRB 3EF8A 1VQK3 2P05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHC A;  1DMQ A;  2HMK B;  3S5C A;  3DXO A;  2A15 A;  3B7C A;  3M8C A;  4HVN A;  4GB5 A;  1CQS A;  1NWW A;  4R9L A;  5KP3 A;  3GZX B;  2XR8 B;  3UJM A;  4L8P A;  1O7N B;  2F99 A;  3BLZ A;  3FF2 A;  5STD A;  1E3V A;  4HM3 B;  3F7S A;  4WYK B;  1Z1S A;  1QMA A;  3JUN A;  5BVB A;  3G16 A;  5CF2 A;  1OGX A;  4HM0 B;  1E97 A;  4PEJ A;  3SOA A;  1BUQ A;  3JUP A;  2QGU A;  5IG0 A;  2INX A;  2IMJ A;  3B4P A;  3NBR A;  2Z77 A;  5BXQ A;  3FGY A;  3JUQ A;  1TP6 A;  1HKX A;  1GY6 A;  3E99 A;  3EJV A;  3K7C A;  3OWY A;  4CDL A;  2RFR A;  1JKG A;  1O7P B;  3ER7 A;  3DM8 A;  4HKV B;  4L7K A;  2PZV A;  4HM1 B;  1JB2 A;  3MG3 A;  3GZB A;  1OCV A;  1OF5 A;  3FSD A;  1JB5 A;  3HX8 A;  3SED A;  4OUQ A;  1S5A A;  3FZW A;  4Q53 A;  1GY7 A;  2BNG A;  1ULI B;  2HMJ B;  1SJW A;  5IG5 A;  4HM6 B;  4HZB B;  3MYT A;  1GS3 A;  2I9W A;  3DUK A;  5AEW B;  1NU3 A;  2YFI B;  4N3V A;  4LMI A;  1UUV B;  1O7G B;  3F14 A;  5EVH A;  3NV0 A;  4WP5 A;  3KZT A;  3JUM A;  2YFL B;  3GRD A;  1ASK A;  3SOY A;  3KE7 A;  1VZZ A;  4R9K A;  2GEY A;  4LEH A;  4HM4 B;  3B4O A;  3RGR A;  4XDW A;  3G8Z A;  3A76 A;  4XM4 A;  2F98 A;  5CXO A;  1JKG B;  2HMN B;  4HJL B;  1OF5 B;  1OGZ A;  1OHO A;  1K41 A;  3T8N A;  2OWP A;  3OXA A;  5DRE A;  2RGQ A;  5DRV A;  1W02 A;  2QIY A;  3CNX A;  4XBY A;  2B1X B;  5IF6 A;  4J9A A;  1EG9 B;  1DMM A;  4X2H A;  4KVH A;  2UX0 A;  3LZA A;  1O7W B;  3NV0 B;  4K1U A;  5CK6 A;  3NUV A;  1UUW B;  2XSO B;  2YFJ B;  3EN1 B;  5AEU B;  5AII A;  5IEO A;  3F8H A;  2F86 B;  5IG4 A;  3RGA A;  1ZX2 A;  3B8L A;  3MG1 A;  4LGQ A;  1GY5 A;  4HM5 B;  4HZ9 B;  4I4K A;  3EN8 A;  2HML B;  3FLJ A;  3KSP A;  4XBT A;  2XSH B;  3OX9 A;  3UNL A;  4X2O A;  1E3R A;  5JPP A;  3F9S A;  4L8O A;  5AIH A;  3MKI A;  1Q42 A;  2GEX A;  1AR0 A;  1O7M B;  2STD A;  5G2G A;  5D83 A;  5KP1 A;  2JQ5 A;  3NM2 A;  5IER A;  3DZL A;  3D9R A;  7STD A;  4J8T A;  3BB9 A;  4HM2 B;  4RZM A;  1ISK A;  5KP4 A;  4IIA A;  2Z7A A;  4K1V A;  4XB5 A;  4XBX A;  1IDP A;  1ZO2 A;  5HGR A;  4R1K A;  4HM8 B;  5AIG A;  2W2C A;  5IG3 A;  2XRX B;  2Z76 A;  1A2K A;  5CLK A;  3GWR A;  2K54 A;  5AIF A;  3LYG A;  3CU3 A;  4U13 A;  1O7H B;  5IEP A;  3CNM A;  1OPY A;  3F8X A;  2BMQ B;  3G0K A;  3HK4 A;  3EX9 A;  3MHE A;  3EQQ B;  3CPO A;  4XDV A;  4FCM A;  1JB4 A;  3OWU A;  2HMO B;  3MG2 A;  3OWS A;  4WWU C;  1QJG A;  3NHX A;  2GBX B;  4OVM A;  2R4I A;  1W00 A;  4STD A;  3FH1 A;  1U5O A;  1JN5 A;  1OUN A;  5IEN A;  1EA2 A;  3K0Z A;  1WQL B;  1TUH A;  5D82 A;  6STD A;  1Q40 A;  3ECF A;  3EBY A;  2GXF A;  3VGN A;  8CHO A;  3Q90 A;  2CHC A;  3FF0 A;  3H51 A;  3VSY A;  4MJD A;  3JUO A;  5FW5 A;  3F7X A;  1DMN A;  2HMM B;  3GZY B;  4FCJ A;  4HM7 B;  5JPU A;  1W01 A;  1ULJ B;  2GBW B;  1OH0 A;  3MSO A;  2B24 B;  3ROB A;  3EC9 A;  4H3U A;  1STD A;  3DMC A;  4WYK A;  3STD A;  5CF1 A;  3KKG A;  3F40 A;  5D81 A;  1OHS A;  1OHP A;  1JN5 B;  3GZR A;  3T8U A;  4ORL A;  3FKA A;  3HZP A;  3I0Y A;  3NXJ A;  3WMD A;  5AI1 A;  2CKF B;  1Q40 B;  3IPT A;  3H3H A;  1W6Y A;  3OV4 A;  1GYB A;  3EBT A;  2RCD A;  1NDO B;  1C7H A;  5TGN A;  2BMO B;  2BMR B;  3EF8 A; 
#chains in the Genus database with same CATH topology
 1GD4 A;  3BIR A;  1DMQ A;  1I0X A;  1UGI A;  3EHC A;  3NX0 A;  2HMK B;  3HII A;  1GOV A;  4LZI A;  3S5C A;  1UW1 A;  1I70 A;  3SLU A;  3CCV 3;  2RNT A;  3DXO A;  2A15 A;  1FUS A;  3B7C A;  1RN1 A;  3M8C A;  1GSP A;  2BHM A;  4HVN A;  2E2V A;  4GB5 A;  1F8N A;  1CQS A;  1NWW A;  1B20 A;  3N54 B;  4N6O B;  4R9L A;  5KP3 A;  3GZX B;  3PXM A;  2XR8 B;  3UJM A;  4L8P A;  2KAA A;  1GOY A;  1O7N B;  2XFS A;  1MWU A;  3KN4 A;  3X41 A;  2F99 A;  1T5Y A;  3N8B A;  1WMO A;  3CC4 3;  1BSC A;  1MWS A;  2F5M A;  2P38 A;  3PZW A;  4J5K A;  5I97 A;  3HOH A;  3BLZ A;  3FF2 A;  5STD A;  1D6Z A;  1E3V A;  4HM3 B;  3CCE 3;  1I2F A;  1LXE A;  4KT3 B;  2V1L A;  3F7S A;  1DYU A;  3GSP A;  3WDG B;  1JBS A;  2M7O A;  2LYX A;  4WYK B;  1Z1S A;  1QMA A;  4FR9 A;  3OW2 2;  1S72 3;  4AKZ A;  3JUN A;  5BVB A;  1M9G A;  4O2H A;  3G16 A;  4EW5 A;  1OGX A;  1PY3 A;  1QAK A;  1E97 A;  1BRH A;  2CFL A;  3A5E A;  4HM0 B;  5FGO A;  1UI8 A;  4PEJ A;  3RNT A;  4NPB A;  5LC6 A;  3SOA A;  1BUQ A;  2OOV C;  1D6U A;  1BSB A;  3G4S 3;  3JUP A;  1LVN A;  2QGU A;  5IG0 A;  1KWI A;  2INX A;  2IMJ A;  3D4A A;  2ML6 A;  2BIR A;  4N6V 0;  3B4P A;  1QAL A;  4EC6 A;  2QEX 3;  2F56 A;  1SII A;  2D42 A;  2XGN A;  2P09 A;  3NBR A;  2Z77 A;  5BXQ A;  1JJ2 2;  1IT8 A;  3BNE A;  1BRN L;  1TJD A;  1DVD A;  1SPU A;  3FGY A;  3JUQ A;  3NBB A;  3RDE A;  1M90 4;  1TP6 A;  2C11 A;  1Q7H A;  1HKX A;  1GY6 A;  3D79 A;  3E99 A;  5M19 A;  2JDI H;  2Z6B A;  3EJV A;  3K7C A;  2CG1 A;  3OWY A;  4CDL A;  1I2E A;  3EE1 A;  2RFR A;  1BRJ A;  3DGN A;  4K61 A;  1JKG A;  1O7P B;  3ER7 A;  3CCQ 3;  3URP A;  1RRH A;  3DM8 A;  4HKV B;  5G1L A;  7GSP A;  4L7K A;  1IQX A;  2ZL8 A;  2O9U X;  2PZV A;  1MNL A;  4HM1 B;  1JB2 A;  3AMO B;  1US1 A;  3MG3 A;  3GZB A;  1OCV A;  1FA3 A;  1OF5 A;  3ALA A;  3BND A;  3U97 A;  1I8V A;  2CX1 A;  1MWT A;  1JB5 A;  3FSD A;  3HX8 A;  4OUQ A;  1RGE A;  2W9Q A;  3SED A;  1YHQ 3;  1S5A A;  1AV4 A;  2OQE C;  1N9E A;  3FZW A;  3LTD A;  4Q53 A;  1X1U A;  4TX4 A;  2GU3 A;  1GY7 A;  2BNG A;  1CH0 A;  1RHL A;  1LRA A;  3EB8 A;  1ULI B;  1BNG A;  3V99 A;  4GHO A;  1RN4 A;  2HMJ B;  1SJW A;  1V57 A;  5IG5 A;  4R4K A;  3J7Y d;  3UL6 A;  4HM6 B;  4HZB B;  4O8S A;  1X1X A;  4CPK A;  1TFO A;  2UGI A;  3MYT A;  2E2U A;  1GS3 A;  3LXU X;  2I9W A;  1YIJ 3;  1Q81 4;  3DUK A;  2C10 A;  1RGH A;  5AEW B;  1RDS A;  1W2B 2;  1NU3 A;  5ELJ A;  3WR2 A;  3QRD A;  1GMP A;  2YFI B;  3AHS A;  4N3V A;  4HYZ A;  4KFD A;  4LMI A;  1AVL A;  1LQM B;  1UUV B;  2F5W A;  1O7G B;  3F14 A;  5EVH A;  6RNT A;  2H0I A;  1UCJ A;  2K3D A;  2H0H A;  3NV0 A;  4O02 B;  4WP5 A;  4FMB A;  3KZT A;  3WOE B;  2ZDJ A;  3LT9 A;  3Q2P A;  2KRT A;  3AHW A;  1JRQ A;  2W03 A;  4R80 A;  3JUM A;  1LOX A;  4QWT A;  3BU4 A;  4GSP A;  1TFK A;  2YFL B;  1UUG B;  2WO0 A;  3CC7 3;  2PNC A;  1QVG 2;  1J2B A;  4MMZ B;  3GRD A;  1ASK A;  1RGK A;  2C4B A;  3KE7 A;  1VZZ A;  4KFE A;  3SOY A;  1VQ4 3;  4R9K A;  1UCK A;  2GEY A;  4LEH A;  1BSD A;  4HM4 B;  1FGM A;  3B4O A;  3RGR A;  4LYL B;  3X42 A;  3FG4 A;  4XDW A;  1VQL 3;  3G8Z A;  3A76 A;  1UCI A;  2O3O A;  4K90 B;  4XM4 A;  1BSE A;  2F98 A;  5CXO A;  2BT3 A;  3DGO A;  2KCD A;  1JKG B;  3AMO A;  2IUJ A;  1UCL A;  1SAR A;  1OAC A;  2HMN B;  1RGF A;  1UGH I;  1IYY A;  1BRS A;  8RNT A;  4HJL B;  4EYC A;  1IVV A;  3IJE B;  1BVI A;  3CME 3;  3CCL 3;  4HBR A;  1OF5 B;  1OGZ A;  1TIJ A;  2MC8 A;  1OHO A;  1NB5 I;  1VQ9 3;  1K41 A;  1YGE A;  3CD6 3;  1IV9 A;  1JBR A;  3UL5 A;  1Q7Y 4;  3T8N A;  3FCS B;  2OWP A;  3OXA A;  1ROA A;  1B2S A;  1TRQ A;  1C54 A;  3S28 A;  5DRE A;  2RGQ A;  9RNT A;  1PFP A;  2OOV A;  2BU4 A;  4GL6 A;  5DRV A;  1W02 A;  2QIY A;  3CNX A;  3LT8 A;  1CYU A;  4XBY A;  1UDI I;  2B1X B;  5IF6 A;  1RGL A;  4J9A A;  4CCV A;  1VQM 3;  2W0Q A;  3SX1 A;  1N5P A;  1IVW A;  1A90 A;  1A2P A;  1N5H A;  1EG9 B;  1YVB I;  2R41 A;  2WOH A;  3N9H A;  1M1K 4;  3KCH A;  3PCS A;  1TU5 A;  1DMM A;  3NBJ A;  4X2H A;  4KVH A;  2UX0 A;  3LZA A;  2ZA4 A;  1O7W B;  4WFO A;  3LH4 A;  4BTW A;  1Y4K A;  1IV7 A;  1SQW A;  1RCL A;  3NV0 B;  1M1X B;  1FGQ A;  3LTB A;  4K1U A;  5JBS A;  1RCK A;  3NQZ A;  5CK6 A;  4HOH A;  3NUV A;  2IA7 A;  1UUW B;  1BRK A;  2XSO B;  2YFJ B;  3EN1 B;  3PYJ A;  5AEU B;  4RNZ A;  1Q9E A;  1BUJ A;  5AII A;  5IEO A;  2OCT A;  3F8H A;  2F86 B;  5IG4 A;  3RGA A;  1W4N A;  1ZX2 A;  3CCU 3;  1BRG A;  1T3B A;  1UI7 A;  3IMA B;  3B8L A;  2ZHX B;  3MG1 A;  4LGQ A;  1D6Y A;  2CFD A;  1FW7 A;  3CXC 2;  2OQE A;  1GY5 A;  3D5G A;  3D3L A;  1BIR A;  1I3I A;  4RBN A;  1FGR A;  1AY7 A;  4HM5 B;  2CWV A;  5HOH A;  1NNV A;  4HZ9 B;  2Q07 A;  4I4K A;  3CCS 3;  1BNI A;  1BSA A;  3EN8 A;  1RGA A;  2KF5 A;  1VQN 3;  2HML B;  3FLJ A;  1GMR A;  3WHO A;  3ZG0 A;  3JVC A;  3ZG5 A;  1YJW 3;  3KSP A;  3LTA A;  4XBT A;  3D5I A;  2XSH B;  3K9M C;  3OX9 A;  3UNL A;  3O8Y A;  4X2O A;  1E3R A;  2D1W A;  5JPP A;  1VQ7 3;  5M1A A;  1T2H A;  1RKY A;  1W5Z A;  3F9S A;  1EEJ A;  4L8O A;  3S27 A;  5AIH A;  1GMQ A;  1LOW A;  1ZGX A;  3MKI A;  3PGB A;  3HIG A;  1FYS A;  1Q42 A;  2GEX A;  1AR0 A;  2Y73 A;  1BNJ A;  1O7M B;  1RGG A;  2STD A;  4MMY B;  1B2U A;  5G2G A;  5BU4 A;  1Q86 4;  1LOY A;  5D83 A;  5KP1 A;  3MWZ A;  2JQ5 A;  1GD3 A;  4O3V A;  1VQ6 3;  1B21 A;  3DH2 A;  2CFK A;  3NM2 A;  2FNQ A;  5IER A;  3DZL A;  5EQL A;  1IK3 A;  2CC3 A;  3D9R A;  4JF8 A;  4N6U A;  1B27 A;  3WOD G;  7STD A;  6GSP A;  1AVK A;  3DY5 A;  4G1M B;  4J8T A;  1G96 A;  4N6M A;  1I2G A;  3BB9 A;  2OTL 3;  3BNB A;  4HM2 B;  1K28 A;  1FZU A;  2CH9 A;  4RZM A;  1LNH A;  2XGL A;  3S67 A;  1ISK A;  1WMP A;  3Q3F A;  2CW9 A;  4MMX B;  4BTY A;  2UUG C;  5KP4 A;  1RNB A;  4ILF A;  4IIA A;  3KFQ C;  3UB1 A;  1IVX A;  1PYL A;  2IY2 A;  2Z7A A;  4K1V A;  4XB5 A;  1RN7 A;  1LQG C;  4XBX A;  1I3F A;  2SAR A;  1IDP A;  3SYU A;  1ZO2 A;  5HGR A;  1R4Y A;  1EUI C;  3DGM A;  4R1K A;  4HM8 B;  1YGW A;  5AIG A;  2W2C A;  1RLS A;  5IG3 A;  1K9M 4;  4AKY A;  2SBL A;  2W9P A;  3U1W A;  3WOF B;  4EBG A;  1DE3 A;  5GSP A;  3X3X A;  1RRL A;  4NRE A;  1VQ8 3;  1A67 A;  1MGW A;  2GU1 A;  1IQY A;  2XRX B;  1EQK A;  1I0V A;  1ROV A;  3V92 A;  2FXT A;  1BRI A;  1VQ5 3;  3LOY A;  1BNR A;  2E2T A;  1JZD A;  2Z76 A;  3K63 A;  3G6E 3;  1A2K A;  5CLK A;  4EV5 A;  3T0U A;  2KXG A;  1DVC A;  3FG3 A;  1N9J A;  3GWR A;  2K54 A;  3LYG A;  5AIF A;  1X1Y A;  3CU3 A;  4LSO A;  1IT7 A;  4U13 A;  2F4Y A;  3X3Z A;  3K5T A;  1O7H B;  2CG0 A;  1STF I;  5IEP A;  3TDG A;  1WTH A;  4FMC A;  4KFF A;  3CNM A;  1OPY A;  1V58 A;  2BO9 B;  3F8X A;  1B2M A;  5BIR A;  1BNE A;  2MF7 A;  3VF1 A;  1G02 A;  2BMQ B;  3G0K A;  3QK9 A;  4OK0 A;  2KF6 A;  1HZ1 A;  4FCZ A;  3KSE D;  4BIR A;  3HK4 A;  3Q1C A;  3EX9 A;  1YI2 3;  3MHE A;  4H61 A;  5IW9 A;  3I56 3;  1L5G B;  4JRF A;  3EQQ B;  5CF2 A;  3CPO A;  3PS8 A;  1FUW A;  2IYJ A;  1IQ8 A;  1CEW I;  2ML5 A;  1YNV X;  3PCR A;  1A2V A;  4XDV A;  1B3S A;  1MWR A;  4FCM A;  1JB4 A;  3OWU A;  2HMO B;  1HU9 A;  1MOL A;  4FMD A;  3MG2 A;  1KC8 4;  1G0T A;  5A0O B;  2Y74 A;  3OWS A;  4WWU C;  3CCR 3;  3X3Y A;  1QJG A;  1RSN A;  5AYS C;  3NHX A;  1QAF A;  2GBX B;  1AQZ A;  3AGO A;  2R4I A;  4OVM A;  4RNT A;  4BL2 A;  1W00 A;  4STD A;  3AGN A;  3FH1 A;  1U5O A;  3CC2 3;  2LQV A;  1JN5 A;  1OUN A;  3G71 3;  5IEN A;  4RNY A;  2L1S A;  1GOU A;  2KF3 A;  4NHF A;  2IUK A;  1YJN 3;  1EA2 A;  2P0M A;  1WQL B;  2W6J H;  3K0Z A;  3WA3 A;  1TUH A;  1T2I A;  5D82 A;  6STD A;  3S29 A;  1TTO A;  1Q40 A;  3ECF A;  3EBY A;  2GXF A;  1DET A;  1BNF A;  2CFW A;  5RNT A;  3VGN A;  8CHO A;  2CK3 H;  2WOF A;  3Q90 A;  4FMA A;  1BNS A;  2CHC A;  1JV2 B;  1MGR A;  1ZS7 A;  2AAD A;  1WMN A;  2CFG A;  3FF0 A;  3H51 A;  2KF4 A;  2W56 A;  1KSI A;  4ZM8 A;  1W6C A;  4EV2 A;  1K8A 4;  1JNQ A;  4BTX A;  1K73 4;  1SIH A;  3GAX A;  1BOX A;  1R4C A;  3CMA 3;  4N6N B;  4WHA A;  4KZ1 A;  1JBT A;  2RBI A;  2WGO A;  2K0M A;  2CIU A;  5AYR B;  3VSY A;  1NB3 I;  5EEO A;  5LC7 A;  3NM7 A;  4MJD A;  1BU4 A;  2FGT A;  4IT7 A;  1VQO 3;  5G1K A;  1FGT A;  3LTC A;  1BAN A;  3JUO A;  2CWT A;  2P0X A;  3KII A;  5FW5 A;  1BGS A;  1YJ9 3;  3F7X A;  3X40 A;  2HOH A;  1DMN A;  1KQS 2;  1U8C B;  4HAA A;  2HMM B;  3GZY B;  2L4V A;  4FCJ A;  1IU7 A;  1B2X A;  3WA2 X;  1QVF 2;  4HM7 B;  1B2Z A;  4BU4 A;  1WNH A;  2CWU A;  4EXR A;  2H0G A;  5JPU A;  3CCM 3;  1W01 A;  3HI7 A;  3FG1 A;  1ULJ B;  2RSX A;  3BNC A;  4N6T A;  2GBW B;  3ZFZ A;  2XEP A;  1RJO A;  4BL3 A;  3I55 3;  1OH0 A;  1HYF A;  5ELU A;  3MSO A;  2B24 B;  3ROB A;  3EC9 A;  4H3U A;  4DKI A;  1W2Z A;  1FGO A;  4IPB A;  1IVU A;  1LOV A;  1N8Q A;  1STD A;  2YX9 A;  3DMC A;  4WYK A;  3STD A;  3DGY A;  5CF1 A;  1NJI 4;  1NO3 A;  3KKG A;  4J5G A;  1KD1 4;  3F40 A;  3NQY A;  5D81 A;  1OHS A;  1RGC A;  1OHP A;  2XF3 A;  3MPH A;  1JN5 B;  1VQP 3;  3GZR A;  2CX0 A;  3T8U A;  4ORL A;  1BAO A;  1W6G A;  5M18 A;  2OTJ 3;  2XH9 A;  1RMS A;  2XFT A;  3FKA A;  1YVS A;  3HZP A;  3I0Y A;  3SXX A;  1VQQ A;  3SVA A;  3NXJ A;  3CPW 2;  3WMD A;  1RTU A;  5AI1 A;  1TRP A;  2W04 A;  2CKF B;  1Q40 B;  1YIT 3;  3IPT A;  1RNT A;  1V74 A;  1X1W A;  7RNT A;  3H3H A;  4MEI A;  1PU4 A;  1EKM A;  4I5Q A;  3V98 A;  1LNI A;  1W6Y A;  3L0R A;  3OV4 A;  2QA4 3;  2W56 B;  3DGL A;  1GYB A;  3EBT A;  4N6L A;  2WGQ A;  1W7C A;  2RCD A;  2J8X B;  1NDO B;  1N8R 4;  4CJN A;  1JZO A;  1C7H A;  5TGN A;  2BMO B;  1Q82 4;  1FUT A;  1CYV A;  3LML A;  3CCJ 3;  4AEQ A;  2BMR B;  3EF8 A;  2AAE A;  1VQK 3;  2P05 A;  2GSP A; 
#chains in the Genus database with same CATH homology
 1GD4 A;  3EHC A;  1DMQ A;  3NX0 A;  2HMK B;  3HII A;  4LZI A;  3S5C A;  1UW1 A;  3SLU A;  3CCV 3;  3DXO A;  2A15 A;  3B7C A;  3M8C A;  2BHM A;  4HVN A;  2E2V A;  4GB5 A;  1F8N A;  1CQS A;  1NWW A;  4R9L A;  3N54 B;  4N6O B;  5KP3 A;  3GZX B;  3PXM A;  2XR8 B;  3UJM A;  4L8P A;  1O7N B;  2XFS A;  3X41 A;  3KN4 A;  2F99 A;  1T5Y A;  3N8B A;  1WMO A;  3CC4 3;  2P38 A;  3PZW A;  5I97 A;  3BLZ A;  3FF2 A;  5STD A;  1D6Z A;  1E3V A;  4HM3 B;  3CCE 3;  1LXE A;  2V1L A;  3F7S A;  1DYU A;  3WDG B;  2M7O A;  2LYX A;  4WYK B;  1Z1S A;  1QMA A;  4FR9 A;  3OW2 2;  1S72 3;  4AKZ A;  3JUN A;  5BVB A;  1M9G A;  4O2H A;  3G16 A;  5CF2 A;  1OGX A;  2CFL A;  1QAK A;  1E97 A;  4HM0 B;  5FGO A;  1UI8 A;  4PEJ A;  5LC6 A;  3SOA A;  1BUQ A;  2OOV C;  1D6U A;  3G4S 3;  3JUP A;  1LVN A;  2QGU A;  5IG0 A;  1KWI A;  2INX A;  2IMJ A;  2ML6 A;  4N6V 0;  3B4P A;  1QAL A;  4EC6 A;  2QEX 3;  1SII A;  2D42 A;  2XGN A;  2P09 A;  3NBR A;  2Z77 A;  5BXQ A;  1JJ2 2;  1IT8 A;  3BNE A;  1DVD A;  1SPU A;  3FGY A;  3JUQ A;  3NBB A;  3RDE A;  1M90 4;  1TP6 A;  2C11 A;  1HKX A;  1GY6 A;  3E99 A;  2JDI H;  2Z6B A;  3EJV A;  3K7C A;  2CG1 A;  3OWY A;  4CDL A;  3EE1 A;  2RFR A;  3DGN A;  4K61 A;  1JKG A;  1O7P B;  3ER7 A;  3CCQ 3;  1RRH A;  3DM8 A;  4HKV B;  4L7K A;  1IQX A;  2ZL8 A;  2O9U X;  2PZV A;  1MNL A;  4HM1 B;  1JB2 A;  3AMO B;  1US1 A;  3MG3 A;  3GZB A;  1OCV A;  1FA3 A;  1OF5 A;  3ALA A;  3BND A;  3U97 A;  3FSD A;  1JB5 A;  3HX8 A;  3SED A;  4OUQ A;  2W9Q A;  1YHQ 3;  1S5A A;  1AV4 A;  2OQE C;  1N9E A;  3FZW A;  3LTD A;  4Q53 A;  4TX4 A;  2GU3 A;  1GY7 A;  2BNG A;  3EB8 A;  1ULI B;  3V99 A;  2HMJ B;  1SJW A;  5IG5 A;  4R4K A;  3J7Y d;  3UL6 A;  4HM6 B;  4HZB B;  4O8S A;  1TFO A;  3MYT A;  2E2U A;  1GS3 A;  3LXU X;  2I9W A;  1YIJ 3;  1Q81 4;  3DUK A;  2C10 A;  5AEW B;  1W2B 2;  1NU3 A;  5ELJ A;  3QRD A;  2YFI B;  4N3V A;  4HYZ A;  4KFD A;  4LMI A;  1AVL A;  1UUV B;  1O7G B;  3F14 A;  5EVH A;  3NV0 A;  4O02 B;  4WP5 A;  4FMB A;  3KZT A;  3WOE B;  2ZDJ A;  3LT9 A;  3Q2P A;  2KRT A;  4R80 A;  1JRQ A;  2W03 A;  3JUM A;  1LOX A;  4QWT A;  1TFK A;  2YFL B;  2WO0 A;  3CC7 3;  2PNC A;  1QVG 2;  1J2B A;  4MMZ B;  3GRD A;  1ASK A;  3SOY A;  3KE7 A;  1VZZ A;  4KFE A;  1VQ4 3;  4R9K A;  2GEY A;  4LEH A;  4HM4 B;  1FGM A;  3B4O A;  3RGR A;  3X42 A;  3FG4 A;  4XDW A;  1VQL 3;  3G8Z A;  3A76 A;  2O3O A;  4K90 B;  4XM4 A;  2F98 A;  5CXO A;  2BT3 A;  3DGO A;  2KCD A;  1JKG B;  3AMO A;  2IUJ A;  1OAC A;  2HMN B;  4HJL B;  4EYC A;  1IVV A;  3IJE B;  3CME 3;  3CCL 3;  4HBR A;  1OF5 B;  1OGZ A;  1TIJ A;  2MC8 A;  1OHO A;  1NB5 I;  1VQ9 3;  1K41 A;  1YGE A;  3CD6 3;  1IV9 A;  3UL5 A;  1Q7Y 4;  3T8N A;  3FCS B;  2OWP A;  3OXA A;  1ROA A;  3S28 A;  5DRE A;  2RGQ A;  1PFP A;  2OOV A;  4GL6 A;  5DRV A;  1W02 A;  2QIY A;  3CNX A;  3LT8 A;  1CYU A;  4XBY A;  2B1X B;  5IF6 A;  4J9A A;  4CCV A;  1VQM 3;  2W0Q A;  3SX1 A;  1N5P A;  1IVW A;  1A90 A;  1N5H A;  1EG9 B;  1YVB I;  2WOH A;  3N9H A;  1M1K 4;  3PCS A;  1TU5 A;  1DMM A;  3NBJ A;  4X2H A;  4KVH A;  2UX0 A;  3LZA A;  1O7W B;  4WFO A;  3LH4 A;  4BTW A;  1Y4K A;  1IV7 A;  1SQW A;  3NV0 B;  1M1X B;  1FGQ A;  3LTB A;  4K1U A;  5JBS A;  3NQZ A;  5CK6 A;  3NUV A;  2IA7 A;  1UUW B;  2XSO B;  2YFJ B;  3EN1 B;  3PYJ A;  5AEU B;  4RNZ A;  5AII A;  5IEO A;  2OCT A;  3F8H A;  2F86 B;  5IG4 A;  3RGA A;  1W4N A;  1ZX2 A;  3CCU 3;  1UI7 A;  3IMA B;  3B8L A;  3MG1 A;  4LGQ A;  1D6Y A;  2CFD A;  3CXC 2;  2OQE A;  1GY5 A;  3D3L A;  4RBN A;  1FGR A;  4HM5 B;  2CWV A;  4HZ9 B;  2Q07 A;  4I4K A;  3CCS 3;  3EN8 A;  1VQN 3;  2HML B;  3FLJ A;  3JVC A;  1YJW 3;  3KSP A;  3LTA A;  4XBT A;  2XSH B;  3K9M C;  3OX9 A;  3UNL A;  3O8Y A;  4X2O A;  1E3R A;  2D1W A;  5JPP A;  1VQ7 3;  1RKY A;  1W5Z A;  3F9S A;  4L8O A;  3S27 A;  5AIH A;  3MKI A;  3PGB A;  3HIG A;  1Q42 A;  2GEX A;  1AR0 A;  2Y73 A;  1O7M B;  2STD A;  4MMY B;  5G2G A;  1Q86 4;  5D83 A;  5KP1 A;  3MWZ A;  2JQ5 A;  1GD3 A;  4O3V A;  1VQ6 3;  2CFK A;  3NM2 A;  2FNQ A;  5IER A;  3DZL A;  5EQL A;  1IK3 A;  2CC3 A;  3D9R A;  4JF8 A;  4N6U A;  3WOD G;  7STD A;  1AVK A;  3DY5 A;  4G1M B;  4J8T A;  1G96 A;  4N6M A;  3BB9 A;  2OTL 3;  3BNB A;  4HM2 B;  1K28 A;  2CH9 A;  4RZM A;  1LNH A;  2XGL A;  3S67 A;  1ISK A;  1WMP A;  2CW9 A;  4MMX B;  4BTY A;  5KP4 A;  4IIA A;  3KFQ C;  3UB1 A;  1IVX A;  2Z7A A;  4K1V A;  4XB5 A;  1RN7 A;  4XBX A;  1IDP A;  1ZO2 A;  5HGR A;  3DGM A;  4R1K A;  4HM8 B;  5AIG A;  2W2C A;  5IG3 A;  1K9M 4;  4AKY A;  2SBL A;  2W9P A;  3U1W A;  3WOF B;  4EBG A;  3X3X A;  1RRL A;  4NRE A;  1VQ8 3;  1A67 A;  2GU1 A;  1IQY A;  2XRX B;  1EQK A;  1ROV A;  3V92 A;  2FXT A;  1VQ5 3;  3LOY A;  2E2T A;  2Z76 A;  3K63 A;  3G6E 3;  1A2K A;  5CLK A;  4EV5 A;  3T0U A;  2KXG A;  1DVC A;  3FG3 A;  1N9J A;  3GWR A;  2K54 A;  3LYG A;  5AIF A;  3CU3 A;  4LSO A;  3X3Z A;  1IT7 A;  4U13 A;  3K5T A;  1O7H B;  2CG0 A;  1STF I;  5IEP A;  3TDG A;  1WTH A;  4FMC A;  4KFF A;  3CNM A;  1OPY A;  2BO9 B;  3F8X A;  2MF7 A;  3VF1 A;  3QK9 A;  2BMQ B;  3G0K A;  4OK0 A;  4FCZ A;  3KSE D;  3HK4 A;  3Q1C A;  3EX9 A;  1YI2 3;  3MHE A;  4H61 A;  5IW9 A;  3I56 3;  1L5G B;  4JRF A;  3EQQ B;  3CPO A;  3PS8 A;  1FUW A;  1IQ8 A;  1CEW I;  2ML5 A;  3PCR A;  1A2V A;  4XDV A;  4FCM A;  1JB4 A;  3OWU A;  2HMO B;  1HU9 A;  1MOL A;  4FMD A;  3MG2 A;  1KC8 4;  5A0O B;  2Y74 A;  3OWS A;  4WWU C;  3CCR 3;  3X3Y A;  1QJG A;  5AYS C;  3NHX A;  1QAF A;  2GBX B;  4OVM A;  2R4I A;  1W00 A;  4STD A;  3FH1 A;  3CC2 3;  1U5O A;  2LQV A;  1JN5 A;  1OUN A;  3G71 3;  5IEN A;  4RNY A;  4NHF A;  2IUK A;  1YJN 3;  1EA2 A;  2P0M A;  1WQL B;  2W6J H;  3K0Z A;  3WA3 A;  1TUH A;  5D82 A;  6STD A;  3S29 A;  1Q40 A;  3ECF A;  3EBY A;  2GXF A;  2CFW A;  3VGN A;  8CHO A;  2CK3 H;  2WOF A;  3Q90 A;  4FMA A;  2CHC A;  1JV2 B;  3FF0 A;  1WMN A;  2CFG A;  3H51 A;  2W56 A;  1KSI A;  4ZM8 A;  1W6C A;  4EV2 A;  1K8A 4;  1JNQ A;  4BTX A;  1K73 4;  1SIH A;  3GAX A;  1R4C A;  3CMA 3;  4N6N B;  4WHA A;  4KZ1 A;  2WGO A;  2K0M A;  2CIU A;  5AYR B;  3VSY A;  1NB3 I;  5EEO A;  5LC7 A;  3NM7 A;  4MJD A;  2FGT A;  4IT7 A;  1VQO 3;  1FGT A;  3LTC A;  3JUO A;  2CWT A;  2P0X A;  3KII A;  5FW5 A;  1YJ9 3;  3F7X A;  3X40 A;  1DMN A;  1KQS 2;  1U8C B;  2HMM B;  3GZY B;  2L4V A;  4FCJ A;  1IU7 A;  3WA2 X;  1QVF 2;  4HM7 B;  1WNH A;  2CWU A;  4EXR A;  5JPU A;  3CCM 3;  1W01 A;  3HI7 A;  3FG1 A;  1ULJ B;  2RSX A;  3BNC A;  4N6T A;  2GBW B;  2XEP A;  1RJO A;  3I55 3;  1OH0 A;  5ELU A;  3MSO A;  2B24 B;  3ROB A;  3EC9 A;  4H3U A;  1W2Z A;  1FGO A;  4IPB A;  1IVU A;  1N8Q A;  1STD A;  2YX9 A;  3DMC A;  4WYK A;  1NJI 4;  3STD A;  5CF1 A;  1NO3 A;  3KKG A;  1KD1 4;  3F40 A;  3NQY A;  5D81 A;  1OHS A;  3MPH A;  1OHP A;  2XF3 A;  1JN5 B;  1VQP 3;  3GZR A;  3T8U A;  4ORL A;  1W6G A;  2OTJ 3;  2XH9 A;  3FKA A;  2XFT A;  3SXX A;  3HZP A;  3I0Y A;  3SVA A;  3NXJ A;  3CPW 2;  3WMD A;  5AI1 A;  2W04 A;  2CKF B;  1Q40 B;  1YIT 3;  3IPT A;  1V74 A;  3H3H A;  4MEI A;  1PU4 A;  1EKM A;  3V98 A;  1W6Y A;  3L0R A;  3OV4 A;  2QA4 3;  2W56 B;  3DGL A;  1GYB A;  3EBT A;  4N6L A;  2WGQ A;  1W7C A;  2RCD A;  1N8R 4;  1NDO B;  1C7H A;  5TGN A;  2BMO B;  1Q82 4;  1CYV A;  3LML A;  3CCJ 3;  4AEQ A;  2BMR B;  3EF8 A;  1VQK 3;  2P05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...