4K26A

4,4-dioxo-5,6-dihydro-[1,4,3]oxathiazines, a novel class of 11 -hsd1 inhibitors for the treatment of diabetes
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
265
structure length
265
Chain Sequence
b'EEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISGIINAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title 1,1-Dioxo-5,6-dihydro-[4,1,2]oxathiazines, a novel class of 11-HSD1 inhibitors for the treatment of diabetes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 101
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2013-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4k26A00
1I3NA 1IHYA 3KOUA 4JJFA 3V5NA 4CV2A 5JYEA 1OAAA 2H6EA 4ALIA 4CJXA 2B5VA 4HY3A 5T6BA 5I8ZA 1ADGA 2VUUA 4YPOA 3P5SA 4MP3A 4E6PA 1IOLA 1LSOA 4CL8A 3Q9NA 3NV9A 4RZIA 3ICCA 4BV9A 4F6CA 3EVTA 2Q49A 4EEZA 5JDIA 1DFHA 1T4DA 5LCXA 3GG9A 4J90A 4L75A 5IXYA 1C1XA 1LLUA 4EI2A 1NP3A 4U0JA 5COAA 5B37A 1LC3A 5JAQA 1RM4A 3PLNA 3SJUA 4BNTA 2PGDA 2IXBA 4MVJG 4FFPA 3W8FA 1E3WA 3VH3A 4BNHA 4W7IA 1C1XB 2AA3A 1DHRA 3E8XA 3MEQA 3I4CA 2X9VA 4CV0A 3GFBA 1E3WB 2VHWA 3O8QA 2FR1A 2Y0EA 3DZGA 1K6JA 5TS3A 4WE3A 1P31A 3WYEA 3LT2A 1UZMA 3ITDA 1YBMA 3PJDA 1NVGA 5TX7A 2J5RA 3GNSA 1U8XX 3H9JA 2X9GA 2ZTMA 4E2YA 3I6IA 4AVYA 1SMKA 4NDNE 1KEWA 4PG6A 5DBIA 1UDBA 3KYDA 1ADBA 3U4CA 4NZ9A 3LU1A 1OI7A 3GA0A 3AI3A 1NFQA 5DP2A 3I9OA 1NVTA 1NTOA 4MVJI 1HKUA 2EIHA 4MVJF 4HV4A 1PL6A 5KNLA 1HDOA 1XKQA 3NDJA 3RFVA 1HZJA 4YJHA 5TJHA 3ETEA 1DBVO 3PJFA 1ISJA 4CMKA 1GCUA 1CERA 1GYPA 1H2BA 2B37A 1H6DA 3HN2A 1XSEA 1NAIA 1CF2O 4YJHB 1OFGA 2HK7A 1YDWA 1XIVA 1YS4A 2YFQA 1ID1A 3JYLA 3UUWA 3NTOA 4UUPA 5HA5A 5IN5A 4JX8A 1JDJA 1NWCA 3WSVA 2X5OA 4MINA 4RQUA 2JFFA 4IIUA 1Y8QA 1E1KA 2Q3EA 1U1IA 1SEPA 3ZV4A 4BIIA 4RPLA 2BH9A 1N9GA 1NPTO 4OKIA 1Y8QB 3O38A 3E1KA 3QVSA 5ER9A 1O5IA 4BOYA 3C24A 1GYRA 5U9CA 5GMOA 2UAGA 4BNXA 1UP7A 1UH5A 3SLGA 3DBHB 3WG9A 3A06A 5AXAA 4LRTB 4L73A 2D5CA 1PZEA 2QW8A 1V8BA 2B0JA 3JV7A 3CMMA 3K2BA 2OBNA 3G79A 3JQEA 2VOJA 3CZMA 1A71A 4XB2A 1Y6JA 4DYDA 3OA2A 4FDAA 4BUCA 5LDHA 1LQTA 4JCOA 1S7CA 1Z6ZA 2DPGA 1NFFA 1YL6A 4Q3AA 3GHYA 3JQ6A 4NG5A 3FWZA 3UVEA 3N74A 2AE2A 3KYCA 5CFZA 3LLVA 4J0FA 4GVLA 5CEJA 3DBVO 3F6YA 4XWYA 1R6DA 1O89A 3V8BA 2EF1A 4MDHA 1UZLA 4AJNA 1B0AA 2P2SA 3AY7A 3GC6A 3JYOA 3Q6IA 4J49A 5ITVA 3NKLA 3C7AA 3WOHA 3LVFO 4TWRA 1LTHR 2X5KO 1ZK2A 2VCYA 5LDGA 5U1PA 3WSWA 5L4SA 1KIFA 2VHXA 3OEYA 1EZ4A 1P1KA 1DAOA 4GVXA 1DC5A 4YJFA 1ZMTA 2I65A 3AU8A 3G17A 1GZ6A 3LC1O 3MJVA 5CPFA 5DBFA 1PS9A 4WASA 1T25A 4I5FA 5C37A 2Q2VA 4WLUA 1PWXA 2P5UA 1I3MA 1Y81A 2B69A 4S1VA 4YJFB 4E2XA 3OBBA 3QWHA 1JLLA 1BWSA 3WGYA 4M86A 1B3BA 1K5HA 5K6AA 1XR3A 2IXAA 4WNCA 3WMXA 3CIFA 2C5EA 4GPD1 4BNLA 4G65A 5T5QA 2BF7A 1GY8A 3D64A 3FNEA 3DHEA 3K6JA 1UXHA 1HE5A 3RUIA 3F3SA 2AG5A 4BNJA 3E6AA 3OETA 4ALLA 4BGUA 1X0VA 3ZZNA 4N5MA 5DOZA 4CM9D 1PX0A 4B79A 3JQGA 3BTVA 1FK8A 4O0LA 3KV3O 2BI8A 3EC7A 4J6FA 3WS7A 4PZDA 4RVSA 1I2CA 2C29D 3JQFC 1JAXA 4DWVA 3JQGB 4KUHA 3SC6A 3HHPA 1BDBA 3W6ZA 2X8LA 3ZWOA 3VPFA 4ZQGA 4HFRA 2DTXA 1UZNA 4RO0A 1KVQA 4ZU3A 4K6FA 1UP4A 3TL3A 3CZRA 3RUDA 3ZN2A 1V3TA 2V6BA 4CUKA 4B7UA 4R54A 1E7RA 2OL4A 1HZZA 3L0DA 1WPQA 4R1SA 3TFQA 3O26A 3V1YA 3H3JA 4XGKA 1B16A 2RH8A 2O23A 1PZGA 4R01A 5ES3A 1P3DA 2BGLA 3LC2O 1YJ8A 3HFGA 2GGSA 5BSFA 1UXJA 4PLYA 1ZCJA 4HBGA 1E6UA 1IY8A 2GASA 4CMIB 2J3KA 3RAJA 1NQ5A 3VZSA 3HJAA 5L95A 3LK7A 5BNTA 1LDBA 2RIRA 2YHUA 3KLMX 3TZCA 1YOVB 5ER6A 1BXKA 4A26A 4BB5A 1ZKMA 3ZV5A 4CM1A 2GNAA 3RC1A 3GLQA 4NNJA 1ARZA 4IXWA 3PIDA 4PLFA 2R2GA 1P1IA 1ZJZA 3ZCXA 3ZHXA 2C7VA 2VOEA 4GL4A 1KEVA 4AJ4A 4BNIA 3DL2A 4BGVA 1EMDA 3DZFA 4I5DA 1JWAB 4LCEA 3RIHA 3MCVA 2HSDA 1RJWA 4J16A 4PCVA 1TLTA 4HWKA 4W4TA 1EFKA 4Q3NA 3I9LA 4Q39A 1ZUD1 3WQSB 4DPMA 1GFSA 3H3FA 1I2ZA 1PL7A 2Y67A 1WXDA 3EHEA 1D8AA 4GMGA 4L4XA 5JAZA 4DGSA 3DTTA 3R3SA 2VWHA 2CFCA 1P0FA 2PD4A 2W8ZA 3R0IA 2HQ1A 4OGWA 4ZHSA 5B4UA 3I9KA 2P68A 2Q1UA 1I36A 4YBZA 4Q3DA 5BNFA 1XU7A 1ZK3A 4BO4A 4Z3KA 2FZEA 5DP1A 4DQUA 1DRUA 3I5MA 3ROQA 2D3TA 2GR9A 4UEKA 4RPJA 2O7QA 1PJCA 3GVCA 2Q4EA 3PGJA 1WZEA 3X2FA 3UCXA 1PJ4A 1DSSG 4J7XA 3IMFA 4IUYA 3RROA 4TVBA 5ILOA 3NGXA 1GZ3A 5HM8A 2WTBA 1Q0QA 5JYDA 5G4KA 4HNGA 2YZ7A 4AJOA 1X0XA 2PGJA 3JQBA 4UVIA 5G4KB 4ALNA 5AVOA 2CDBA 3RJ5A 2EKLA 1QLHA 1W73A 2CY0A 3S2EA 4NU5A 3JYPA 5T64A 3TFOA 1E92A 1ENZA 2D0IA 4FC6A 2ZCUA 2I99A 1LUAA 3L6EA 2P9GA 1E5LA 2VYVA 3AOEC 2NQ8A 1GQQA 1U7TA 1R0KA 5L4LA 4CMAA 4DC0A 3TJRA 4E4YA 4YAEA 2VUTA 1P9LA 4E32A 1ZJYA 3Q11A 4NK5A 1OOEA 2J8ZA 1M76A 3IQDB 4CLDA 3R6DA 3KYBA 1Y7TA 1JN0A 2J3IA 3H5RA 3S2GA 3UKOA 3GN1A 2HKIA 3FF4A 4R69A 6ADHA 3NAQA 2O3TA 2QIOA 1V3UA 5A9RA 4ZVVA 3STHA 3NT2A 4CUZA 4NFSA 2AXQA 4HUJA 4YA6A 4URFA 3UF0A 1E0DA 3OMLA 4FCCA 1P45A 2CF6A 4ALJA 1HEUA 4Z9YA 1U7HA 1EK5A 4PLHA 4LVCA 2Y1CA 3I52A 3RFTA 3DO5A 2NADA 1VL6A 2CNBA 4J2HA 4R1UA 1GR0A 4U8GA 1RM3A 1JQBA 1B15A 1WDMA 3ZU3A 2BD0A 4N7RA 1ZK1A 3NRCA 1R66A 3CKYA 1HTBA 2CDAA 4XB1A 4K1LA 4B4WA 1L7DA 4OKNA 3G1UA 3K9QO 4WUVA 1I24A 5JDIC 4XDZA 2W90A 1WNTA 2JCVA 4TZTA 3U62A 3ZGYA 5MDHA 2YDYA 4AICA 5JCJA 1U3WA 1UUFA 3OJEA 3WIEA 3KEQA 4YQYA 4WEOA 2YDXA 1JKIA 3TOZA 2E6UX 2G76A 1K6IA 3BHIA 5JSFA 4RZHA 3LDHA 3O4RA 4TRJA 1ENYA 1TT5A 1WVGA 2CVOA 5C7OO 5G0VA 5K9ZA 1KETA 2EGGA 3A9WA 1C14A 1N7HA 5B4VA 3LSYA 1DJNA 4PGFA 1XDWA 1CWUA 4F6LA 2POQX 5K0ZA 3W6UA 1Y9EA 2GLXA 4FOSA 1CJCA 3LC7O 3JQFA 2ZTVA 2WE8A 1HT0A 1VSUA 1GUZA 1GEEA 3M2TA 3TOXA 1BG6A 1C1DA 4LW8A 3GN2A 4RLHA 4DTIA 1SO8A 2IEBA 4EUEA 1LLCA 3WQQA 2PR2A 4XQEA 3GAZA 4ZRMA 3TQHA 5CDTA 1UXKA 1WMAA 3ZWAA 2PH5A 3ZV3A 3DONA 3F4LA 3WX0A 2FR8A 2Y05A 3H7AA 5HBRA 4N54A 3ZWNA 4RF5A 3JD2A 4B3HA 1YDEA 5L40A 5DOVA 1GQYA 2JKVA 1A27A 5I7SA 5L4NA 1VM6A 4QT0A 2ZK7A 4YVFA 4B4OA 4C7KA 2E4AA 2GUGA 1GCOA 3RJ9A 3GMSA 3GGOA 2ET6A 1RM5A 5EQDA 2W2LA 3PLRA 4EDFA 3PI7A 2HJSA 2TMGA 3PXXA 4DA9A 3ROKA 1LLDA 1LRKA 2DFVA 3IP1A 4J2OA 2E49A 3NYWA 1CDOA 3G49A 1M75A 3E9MA 4D42A 1GD1O 4MIEA 1ISGA 1FJHA 1X7DA 4FQ8A 4AJEA 1KVRA 5IZCA 4ND2A 3DR3A 2W98A 2GZ1A 1NFRA 4XJSA 1LDEA 4ALKA 2NNLD 1DOHA 4DIFA 4OQYA 1O94A 4EJMA 4YJDA 4M8SA 3N7UA 1ADFA 4M55A 2CF5A 2VNSA 3CMCO 3R1IA 1U3UA 1ADCA 4RF3A 3Q3CA 2D1YA 4UVDA 2OXIA 1PZHA 2FY8A 3D1LA 1PL8A 1PJQA 5JY1A 5L7YA 4A03A 1E7WA 1LDNA 4BNNA 1T1RA 1PIWA 2Y99A 3T4EA 3GMDA 2PZLA 2Q2WA 5EJ2A 1I0ZA 3AUSA 3H6KA 4GLOA 4ZQBA 5IF3A 2VYND 1YL5A 5DDIP 3ZHBA 1XGKA 4YRDA 2JHGA 1UXGA 3QE3A 1G0OA 1AE1A 3DC2A 3WICA 1PSDA 2G5CA 4CMCA 3DOCA 1C3VA 3PJGA 1N8KA 3VTFA 4RPKA 2C7GA 3VH2A 2VHYA 3ADPA 3PJEA 4BKOA 2PY6A 3INGA 2G82A 3OM9A 5JC8A 1H6CA 1GDHA 4R5MA 4CM4B 3U09A 1B14A 2VNAA 3ULKA 2PH3A 1K6XA 1UP6A 3MJTA 4GX5A 2A9FA 3OHSX 4BKPA 3W4KA 4PRLA 1BVRA 2UV8A 3F47A 3KB6A 4RL6A 2OUIA 1LDMA 2X9NA 3AFNA 3V1UA 4M49A 3JD3A 2OZPA 2X1HA 3W4JA 4MKZA 5JAMA 1HE4A 4HNHA 3EUWA 5I8WA 4S3MA 4E0BA 4LRSB 5K6AC 1EBUA 1J49A 3IUPA 1P1HA 3AOEA 2NLOA 5I9LA 1WDKA 3ZV6A 2Z5LA 5KJ1A 4IMRA 3MOIA 3H5NA 4BO6A 3OJLA 3ZNPA 5FFFA 1GAEO 3I9NA 3PDJA 4E5NA 3BTUA 1WP4A 3QP9A 4I8XA 4IINA 1U5AA 4NQZA 5TJ9A 1BXGA 1CIVA 5FWNA 4IDBA 4BGEA 1MC5A 1PS8A 1SZJG 1R4NA 1TEHA 1LQUA 1ZW1A 4PLGA 5G2OA 1MG0A 2HUNA 4IDAA 1B7GO 1BXGB 4UVGA 3D3WB 2YW9A 3JQ8A 3CH6A 3T7CA 4BO0A 1JVBA 3G0OA 1C0PA 2OFPA 1G6KA 5DF1A 4FJ0A 5KVSA 3Q1LA 4CQMA 4CMEC 1UXIA 4LK3A 3TZQA 4QXMA 2Q1WA 2VHVA 1X7HA 3WB9A 3JQ8B 1I01A 3C3XA 4B3IA 1PQUA 1GTMA 1DXYA 3GK3A 4U6SA 4XYEA 6LDHA 4CQMB 1VSVA 3ENNA 4N5LA 3FNHA 1NR1A 3OJ0A 2F1KA 2HMUA 4FSHA 1UAGA 2PKRA 1S6YA 2YHIB 3NT4A 3I3OA 3KSUA 1W8DA 4CPDA 5JLAA 2JD1A 4IGFA 4OYRA 4Y6PA 4BKQA 4FB5A 4CLOA 3OICA 1QYWA 2DKNA 3GY0A 4ITUA 4PG4A 1KVTA 4LVUA 2V6GA 1B8PA 2RHRA 3RBZA 3EK2A 3NDIA 1T26A 4WECA 1JKJA 4CLOB 1VC2A 4OQZA 1Q1NA 1YB5A 4D3DA 2JCXA 4Y6SA 1L1FA 1NQTA 4IGEA 1C0LA 3FRJA 1AGNA 1EBFA 2D8AA 3AUUA 4HFJA 1QKIA 4CL3A 3OIDA 3K96A 1Q2XA 1D4FA 4NR0A 5BNIA 1DC4A 2FPGA 2V65A 2DUUA 2IYOA 3PYMA 4WGGA 4EUFA 1E7QA 1LSSA 1BSVA 2WD8A 1HYGA 3D3EA 3FPLA 4EBFA 5KVQA 4MJLA 1Z73A 3BMCA 4J1SA 3GDGA 3JD0A 5ADHA 2FP4A 5TRTA 1O95A 2PA3A 3QQPA 2Y1DA 4LMPA 4YDRA 4A27A 4ZQEA 3LF1A 3BMCB 5FI3A 2ZQYA 2Y1EA 5TNXA 1OC2A 2I76A 3KEOA 2O3UA 3E03A 4JROA 4L4RA 3SEFA 5ENDA 1RPNA 1VPDA 3WQRA 2W4QA 4OSOA 1AXGA 2OMEA 4RVHA 4J4TA 1CQIA 2AE1A 2WYVA 4WLFA 4JNKA 2BFPA 1QXSA 3JQCA 4EZBA 1DFGA 3AK4A 3C1OA 2DT5A 3E82A 4BMVA 4L74A 1SNYA 2C0CA 4B8WA 1QORA 4UREA 4QFCA 2FWMX 4P4GA 1DIAA 1YL7A 2PK3A 1IHXA 5AXCA 5T67A 4KMSA 2JJYA 3KHUA 5COBA 5TLSA 2O50A 3ZWXA 2ZB7A 1RYEA 3ZU4A 4XKJA 2IODA 4NBVA 2DTDA 2YV3A 4I9HA 3VPGA 5TT1A 2GPTA 4KDFA 5T8KC 4FS3A 1SC6A 3DBHA 4RQTA 1LC0A 3JQBC 4W6ZA 5KVCA 3DDNA 4BO8A 3TF5A 1UJMA 3JQAA 2VTEA 5EPOA 2JFHA 2B4QA 2BELA 3TZHA 3M1AA 3EDMA 1TVEA 4XQ9A 4NH4A 2DU8A 1X13A 4WLEA 2O4UX 2X4GA 5A05A 3VPSA 3DFUA 4MP8A 3JQAB 3WTCA 1YVEI 4FJ1A 3AY6A 4DLLA 3CUKA 1QV7A 5A5FA 3IDSA 2ZYGA 3PYXA 3L4BA 2O48X 3UCFA 3INRA 2CMDA 3BMNB 1QYXA 3FTNA 4MIOA 3AWDA 4IDCA 1E7YA 3PZRA 4EUHA 1BHSA 3QWIA 2AQIA 2AW5A 2D5AA 4IIVA 4PG7A 3ANMA 1Z75A 3V2GA 2TMDA 2ZB3A 4TVOA 4TQGA 5KJCA 4RPGA 4IQ8A 1ZO8A 3OF2A 2GN4A 2NQTA 3BAZA 3WFJA 3ZDFA 4O5OA 5DZSA 3QHAA 4BVAA 1IYZA 3I1JA 5CG2A 3LLSA 1O0SA 3UCEA 1M6WA 4RF2A 4AJIA 3JSAA 5BQFA 3Q2KA 4BO1A 1NQAO 3F4BA 2DAPA 2AMFA 1KC1A 2DLDA 1FMCA 2JAHA 1ZSYA 3K73O 1FXSA 2YQ5A 1CQJA 4D7AA 5TIIA 4MOWA 2NTNA 3SX2A 1F0YA 4AJPA 1YXMA 2QQ5A 3HZZA 2RCYA 3JYQA 4JP2A 1MC4A 3WNVA 2AG8A 1ORRA 3OJFA 1R4MA 5CPBA 3GGPA 1Y5MA 2D59A 5TGDA 4AG3A 3GPDG 3CXRA 3VTZA 3BHMA 4YAKA 4BNVA 3K8ZA 1PTJA 1R4MB 4R3NA 5IDWA 4KWHA 2GCGA 4XGNA 2AQ8A 3WGHA 3LT0A 3QVXA 1V6AA 4QSMA 3AU9A 1WMBA 1EUDA 4GKBA 1XYGA 5DCWA 3JYNA 4BNFA 1GU7A 4Y9DA 1U4SA 1EE9A 2VWQA 3O9ZA 4II3A 1LU9A 1ZK0A 3DBRA 3OQ6A 2IZZA 3MTJA 1EVJA 4OO3A 3EVNA 4L9RA 4HP8A 4Z0PA 2PWZA 3NX4A 4ZQHA 1QRRA 5U4QA 4DQXA 3DBRB 3COSA 4JN6B 1DIBA 2V6MA 3UH1A 1WW8A 4A10A 3I23A 4CMEA 4M89A 5F1PA 4KOAA 2DBQA 5F1KA 3HWRA 3AUTA 1I3LA 1N1GA 1GUFA 1QG6A 1DLIA 1KEUA 3BTSA 4YACA 1FDUA 3OEWA 1E7SA 3HFSA 3DOJA 1IULA 3ZWWA 3ANNA 4OXKA 2CVQA 1Z45A 2E37A 1WAMA 4WLOA 1YRLA 4TZKA 1YB1A 5JMWA 4CMIA 4YAGA 2HDHA 4YQZA 1E77A 4CM5A 4R51A 2ZKLA 3RBXA 3TL2A 3VVBA 4D46A 3KTDA 5B4TA 5JO0A 1YOVA 4GSKA 3SVTA 1DEHA 2QG4A 5H81A 3OJOA 5THKA 2DTEA 3VPHA 1ZIDA 5A02A 4DUPA 4PZCA 4R68A 3L6OO 1KEPA 3ONDA 5A3VA 3TDKA 3RQSA 3DMTC 4OSPA 1M67A 4K9DA 4MKRA 1Z7BA 2AEFA 4XYGA 1U28A 1KC3A 4FFMA 5IZCC 4ESOA 3EAGA 1QLJA 3NJ8A 4GX0A 2FN7A 1LI4A 5AYVA 2H1SA 1T2CA 2BKAA 1T2AA 4KDEA 1PQWA 4QECA 2I5PO 8LDHA 2D2IA 1H6AA 1ZEMA 3HUDA 2BHLA 2P9EA 4WCDA 2C59A 4WOJA 3EY4A 2X23A 4LMRA 2FPPA 5A03A 1HDXA 1UDCA 4HX5A 4RDHA 2AEMA 1YB4A 4FR5A 3NUGA 1XHLA 1FDTA 3IC5A 3GAFA 4NMHA 4LISA 4DIBA 3WGQA 1AN9A 5TSDA 2G0TA 3MWDB 3PVZA 1Y8RB 3PK0A 3PWSA 2GERA 4L0QA 2WMDA 4E30A 4BO7A 2CUKA 1YKFA 5CDUA 2CSUA 4JJGA 4TSKA 2I67A 3EW7A 5KJEA 2HMTA 3VAZA 5BSEA 5KCZA 4JLWA 3PIIA 1JKFA 1IPEA 2OBYA 5F5LA 3W8DA 2VZ0A 4CLEA 2RAFA 3S8MA 1YQXA 2NTJA 2I9PA 1YH3A 4M1QA 4F3YA 3WJ7A 3DOOA 3KETA 2VRCA 3RC2A 3CSDA 2EV9A 3SLKA 3PHJA 4CLHA 3H9GA 1T2DA 2H9IA 3G3EA 5T8KA 4WCFA 3AFMA 1W6UA 3P2OA 3KO8A 5KTKA 2ILTA 4DLAA 4RJTA 3CEAA 3WWYA 1DPGA 3AI1A 4ZICA 3CPSA 4WCFB 1D3AA 2J5KA 4E3ZA 3DHNA 4GSLA 4GMFA 4OM8A 1VJTA 3E9QA 1MX3A 1IPFA 1DIRA 1NQOA 1LXCA 4GH5A 4PG5A 5GZ6A 1X7GA 2ZJ0A 3QVTA 4RVDA 2Y66A 3I9JA 4JGBA 1ISIA 4ZQFA 5C7IO 4KP7A 5EIOA 2X86A 4ND3A 3GUCA 1ML3A 1UR5A 5THQA 1HDZA 1JTVA 4LCJA 4CM7A 1N2SA 1CRWG 5L53A 4OIMA 2EWMA 2CD9A 3Q0EA 1GYQA 1P1JA 1SOVA 3T4XA 3HNPA 1I30A 1LNQA 2ZYAA 2ZB8A 3GNQA 5IXSA 1JAYA 3DBLA 4CR6A 3HG7A 4UULA 4INAA 4YB8A 1QSGA 2ZYDA 1LBEA 3BMOA 3C7DB 3W4IA 3IL2A 3L6DA 2YY7A 4GGPA 4XQCA 3GPIA 3FWNA 1HSOA 3DBLB 3TZ6A 2YV1A 2ZCVA 2GDZA 1VJ0A 2C5AA 3S2FA 1ZXBA 4G5HA 3WGTA 3BMOB 3L9XA 2OGUA 3QSGA 1EVZA 1UDAA 2I3AA 1JU9A 2E48A 1TXGA 1NASA 3OH8A 3WLEA 5A4DA 5IFLA 1Q7BA 1JW9B 2O3JA 4IZHA 3W8EA 3CTMA 5IN4A 3GZNB 1TB4A 3GRKA 1AHHA 1O9BA 5G0TA 4B7CA 4F46A 4YT2A 4DRYA 3O03A 2I3GA 3QLJA 4D43A 1NHWA 2EP5A 4E12A 3KLPX 4J1NA 2IRWA 3ICPA 4QX6A 3NJ4A 4F45A 5JC1A 3VZQA 3KXDA 1ISHA 1VLLA 2LDBA 3GVXA 3PGXA 4EITA 2CZCA 3SBOA 4MVJA 4P4LA 1R37A 2B35A 3JD4A 3U3XA 2NVBA 3ZI0A 2UUPA 4FD3A 1WLYA 3QVWA 3DZJA 2JD0A 1E6WA 4J7CA 1OZAA 1QYCA 2PD3A 1J5PA 1E3LA 3F9IA 1NVMB 4BB6A 4CM8A 4MP6A 1V35A 3EGOA 1PGJA 4DMLA 3DZKA 2IEDA 1BMDA 1SBYA 4IJWA 4PZEA 1R0SA 1E5QA 1DRVA 2XXBA 4CM8B 1FF9A 1H9BA 2HK8A 5H82A 3B1JA 4B4VA 2JFGA 3MJSA 3V2HA 4UEOA 5HWSA 3C8MA 4P38A 4IS3A 4TRMA 4NPCA 3FTPA 4E5PA 1GUYA 1NWHA 1MG5A 3ZU2A 4XCVA 4IM7A 3HB5X 4KTVE 4ILKA 4J9VA 4W7HA 3JTMA 5CHEA 1N7GA 3BXXA 5JS6A 1PJ3A 4ZN6A 1GEGA 4IDDA 4U5QA 5EERA 5MGBA 1XCBA 4GX1A 3GVHA 4J9UE 5DBGA 3PHGA 1I2BA 4XEHA 3FBTA 3QW2A 1K2WA 3B1KA 1T2EA 4YR9A 4YJGB 3GDOA 2XAAA 2B4TO 3ZNNA 1HDCA 2VN8A 2NWQA 4TROA 1G0NA 3C1TA 3DTYA 1MGOA 3EYWA 4FFOA 4NJMA 4YT4A 4FPXA 4IXTA 3G1TA 2XXJA 3GUYA 4E13A 4QO8A 3RSHA 2FMUA 4FBGA 4BO2A 1H5QA 3P19A 2JHFA 2GRAA 4ZD6A 3ZWVA 5COQA 3FNGA 4P22A 3WGIA 4NJMB 1GL3A 1VL8A 3A28A 5GY7A 4RVFA 2OORA 5H83A 4XRGA 4I08A 4MVJP 1R0LA 3H9EO 3ENKA 2QHXA 4W82A 4Y98A 4XIJA 3HB4X 2Y93A 4R1TA 1MXFA 4X54A 3TWOA 4B7XA 2B4RO 1VL0A 3DMTA 4TKLA 3PEFA 4OOEA 5TQVA 3BYZA 3S2IA 4H3VA 1B8VA 3U4HA 2OHXA 3U9LA 2VRBA 5TC4A 1HF3A 4CUJA 4YRBA 1PR3A 5KKAA 1I10A 1ZSVA 2XOXA 3ZW9A 5F3RA 2BFOA 1EDZA 2NU9A 1EVYA 2B5WA 3DEYX 1BDMA 3L4BC 1Y1PA 2YYYA 1DB3A 1P77A 1N92A 5FYDA 2EW8A 3NTRA 3PTZA 3UAGA 1ZVMA 3QY9A 4PLVA 4FGWA 5EMHA 4KUEA 2OP1A 3UHAA 4AJJA 3TZKA 3U4DA 1X14A 1EUCA 2WWRA 3F46A 3PFWO 1T24A 3K2EA 5T57A 7MDHA 4CV3A 5C7LO 4DBVO 3ANLA 3VDQA 4MVJM 9LDBA 4CMBA 3ORFA 2QRKA 2VRCD 5DT9A 4FGSA 5B12A 1E1LA 4E33A 4RGBA 1XQ6A 4ALMA 2HLPA 1EUZA 4R3WA 4CM4A 3QWFA 1QP8A 4W9NC 2VZ8A 4A73A 3RUHA 2HMVA 2VWGA 3B70A 5KWEA 2XF8A 1NX6A 1ZH8A 4MKXA 4WEQA 3OSUA 1ZZEA 2EGHA 4JXKA 3KSZO 3PYLA 4CV1A 3T7EA 2NU6A 3FD8A 2Z1MA 3PRJA 2IZ1A 1RWBA 4XD2A 2Q50A 1ISFA 4Z9FA 5I7EA 4J43A 2VYVD 4MIYA 4NJOA 3BIOA 3D4OA 4NK4A 3BMQA 4CLRA 3RVDA 3HDJA 4KQXA 4DXHA 2WD7B 1AUPA 1TI7A 3D4NA 4CQLA 5G0SA 1E1MA 3I4FA 5JPIA 5IDQA 3F5SA 3BMQB 1N5DA 1YQDA 4GLLA 1HRDA 4CLRB 2Y1OA 1BRMA 2C54A 2IE0A 4XR9A 4BNKA 4OH1A 4OXYA 4BO3A 2Y1GA 4CQLB 1DFIA 1Y9AA 2RH4A 3X2EA 4HFMA 3UFXA 4CR8A 3WFIA 3BA1A 3Q2IA 4Z3DA 5JNLA 2IZ0A 2PZJA 2Q1TA 3D3WA 4R16A 2PKQP 2FSSA 1PGOA 4MO2A 5TT0A 1EEHA 1U3VA 5ICSA 3EZYA 2NM0A 4YYZA 3ZWMA 1C0KA 3IKTA 1MUUA 2GSDA 1VE9A 4W99A 4J1TA 4IJVA 5IDXA 2C2YA 1MXHA 2ZQZA 4GX2A 3WXBA 2YJZA 2YQ4A 2J6IA 1MA0A 3GF4A 4ONEA 1NXQA 5L3ZA 4E2ZA 2NVUA 3PHLA 2YHIA 2OO5A 3ROPA 1U8FO 2P5YA 3LT4A 4GKVA 2J5QA 1X15A 5F1OA 4DYVA 2P4HX 4NU6A 2NVUB 3VH4A 1HDYA 3C7CB 1J0XO 4YWJA 3HDHA 1VJ1A 4WOKA 1OBFO 2BRUA 3NTQA 4KZPA 4R41A 4CM9A 5JCJD 1PU2A 4CM3A 2GN6A 2YUTA 3GEDA 3L77A 3QA9A 2DUWA 3D5TA 1AXEA 3GR6A 5DNAA 1KOLA 2BGKA 4WPGA 1P33A 2GD1O 4CMJA 3FSRA 1NPDA 4UVEA 1HDGO 4BV8A 3BHJA 3QVOA 3K31A 1R16A 4J4BA 2GN9A 4UVHA 3FHLA 4BO5A 1BGVA 2EEZA 2D4AA 4BHTA 4YCAA 3PQEA 4D41A 4E5MA 1IUKA 1IZ0A 1VRWA 2BFAA 3IS3A 5EQFA 1O6ZA 2WJPA 5HS4A 1B26A 2NVWA 1HE3A 3P2YA 4K26A 2AQHA 2PNFA 3ZHYA 4D3FA 2GZ2A 4JJIA 2QYTA 3OECA 5BSHA 2HMSA 5CDGA 1LEHA 4TRRA 4R9SA 1XG5A 5KJFA 1Q0HA 8ADHA 2E82A 1PJSA 3P7MA 4Y8VA 4AJHA 4EJ6A 1GZ4A 3D7LA 1A9ZA 4RDIA 1LA2A 3KRTA 3C85A 4FC7A 5CEFA 3L4SO 3D5QA 1HLDA 3ST7A 3DAGA 2F00A 1I8TA 3INTA 2VUSA 1EQ2A 4ID9A 4WNIA 3GRPA 2PFGA 3WYBA 3DFZA 3RKRA 4TRNA 4XRRA 4PLTA 1DO8A 4AL4A 1HSZA 4XX0A 3O8QB 4I5EA 3ZW8A 2C20A 2GYYA 2NUAA 2PKQO 1LLQA 3ZNOA 3E5MA 3WJAA 2PGLA 2W2LD 1LJ8A 2BLLA 2HU2A 1ONNA 2QX7A 5FI5A 2OP0A 1VKOA 3MJEA 3PQDA 4R9RA 3HSKA 1SAYA 1SPXA 1ZBQA 3IAHA 1NYTA 3GOHA 1A5ZA 1LRLA 2EJWA 1M66A 5AOVA 1GADO 4ND5A 3KSDO 3KYDB 4E5KA 4RORA 3WWZA 3VZRA 2HRZA 1NHGA 3GEGA 4OAQA 2Y68A 3WGOA 2PZKA 4DBZA 3FBGA 2C2XA 4WCFC 4II2A 4L76A 4UUMA 3DXFA 1F06A 1F12A 2Q2QA 5KKCA 1RM0A 4A5OA 2V7PA 4PG8A 1DIGA 4RLSA 4BQPA 2DBVO 4JK3A 3BMNA 3VOSA 4XDYA 1E3IA 4NBWA 4BGIA 3WMWA 1OMOA 2RBEA 2WM3A 4P4NA 4PLCA 4ZGWA 4J4HA 3MZ0A 4R4JA 3GVIA 2GZ3A 2W2KA 4L8VA 4D0SA 5L9AA 5A3JA 5FF9A 3E48A 1PS0A 4IPTA 1M6HA 1H0KA 1L7EA 4PVDA 1QMGA 3AM3A 2W2KB 1QV6A 4JBGA 4D79A 3ASVA 1H93A 1N9GB 4GGOA 1Y5RA 1PQPA 2NTVA 4CMGA 3VKUA 1SEVA 3QIVA 3BZUA 1TA4A 4OJNA 1N1EA 1HDRA 3TRIA 4UUNA 1QR6A 5EN4A 4IDEA 4MVJE 1B2LA 2DC1A 1U9JA 4PLWA 4XYMA 3I83A 4AFNA 1DRWA 4W9NA 4DIOA 4ZA2A 3WLFA 4RVUA 2EERA 2SCUA 3PWKA 3JQ9C 4LGVA 1HYEA 4NI5A 3GDFA 3QWAA 3EZLA 4QFDA 1DLJA 5JFOA 1J6UA 2Q45A 3OQBA 4IS2A 4E5YA 1E1NA 4GQAA 2PD6A 4KQWA 4FN4A 9LDTA 2OOSA 5CG1A 4I5GA 2LDXA 3KYCB 1B3RA 2QYSA 3F1LA 4XR4A 2IYPA 1PR9A 1B8UA 2DQ4A 2FOIA 5JAIA 3W1VA 3ABIA 4UAGA 5BR7A 3WYCA 1HYHA 4EGFA 4TMFA 3ETDA 1PJ2A 4ZRNA 1NPYA 2HCTA 3RFXA 2NU7A 2O7SA 5HS6A 3RWBA 4XJTA 3JCZA 2A92A 4PLPA 4ROSA 3IUSA 1SB8A 1D7OA 2WYUA 1Z7EA 4JIGA 4LSWA 3UGKA 4Q3EA 5FEUA 4CR7A 2DFDA 2O2SA 5CP8A 4CQMD 1QYVA 2X0JA 1H2HA 1ONPA 1NAHA 1EFLA 2I6TA 1G1AA 2HAEA 3WGZA 5A9SA 5I7VA 3A1NA 1P1FA 4IY1A 3LZ6A 5L45A 3L07A 4O1MA 3VHRA 4FJ2A 2WSBA 3DZBA 3FN4A 1DIHA 1K3TA 1V9LA 2DPHA 4FFNA 3U0BA 5A9SB 4ZJUA 5ENVA 1WWKA 2V6FA 3GFGA 2HRBA 3IJRA 4A7PA 1A4UA 1J4AA 3RD5A 1KS9A 4G2NA 4CM6A 1ZXLA 4D45A 5JY6A 4N5NA 5LC1A 3DAFA 1XU9A 1E3JA 1HLPA 4C7JA 2RHCA 1HWYA 4PVCA 2ZB4A 1A9YA 2X7HA 4OHUA 4PRKA 3FCOA 2EHDA 5I9NA 4A0SA 3KM0A 3DZHA 3B20A 5G0WA 5GZ3A 1C0IA 4ND4A 4BKUA 3AM4A 4P8RA 2GN8A 4XIYA 4CLXA 4D44A 5JDCC 3UN1A 4B4UA 5ICMA 4HADA 3RBVA 3LF2A 4B8ZA 2BI7A 4Z9XA 5ITWA 1EDOA 1PGQA 3GHHA 1W0CA 3RCBA 4Z0HO 3ITKA 2VWPA 4OMUA 2BFMA 1CETA 4BS9A 1ULUA 1K0UA 1DC6A 3PWZA 1R15A 3H2ZA 3I6QA 5G4LA 4EEXA 1RKXA 4HKTA 4K28A 3HADA 4FW8A 4Z6KA 5JBIA 2GO1A 1LDYA 2QRJA 1SOWA 1YQGA 5CEEA 1E3SA 2X6TA 2ZIZA 1YBVA 4WJZA 1LRJA 1A4IA 1U5CA 3PHIA 3LQFA 2A94A 5JO9A 3RU7A 4XGIA 1DHTA 2B36A 2H5LA 2O3QA 2X22A 4AJKA 4E2WA 2BMAA 2X0RA 4NIMA 1Y8RA 1U2DA 4J91A 4Y67A 3ETGA 1PZFA 3U4IA 1NBOA 1H6BA 3HDYA 2VT2A 3PPIA 4BKRA 4RV9A 4BMSA 1K89A 1MLDA 3TPCA 4XZ3A 2QZ9A 2O2YA 3AI2A 3H9UA 4R1NA 4Z0TA 1U4OA 4QUKA 4WKGA 3DQPA 2HJRA 4IDFA 1Q7CA 2A4KA 5BT9A 3GVPA 3WR5A 5IZ4A 7ADHA 4BNMA 4HFNA 2Y0CA 1H9AA 3JQAD 3RASA 3TSCA 1O8CA 3SJ7A 2YV2A 4JP3A 4AJ2A 3AW9A 2J3JA 1GPJA 1PJBA 4FFLA 1EE2A 3RC9A 1DC3A 4FIZA 3ASUA 3RUFA 3ZHZA 2P9CA 4IJKA 3SC4A 1ZNQO 1T2FA 3ZWYA 5CAEA 1T4BA 1RYDA 3JQDA 4CMHA 1LDGA 3OIGA 1XA0A 4Q9NA 1XLTA 2WEKA 2WYWA 4QEDA 1XELA 1Z82A 2VYNA 4GAEA 3SXPA 1IB6A 4OOFA 5A04A 1OC4A 2CDCA 2C82A 3PHHA 3HDQA 1X1EA 1MV8A 3GQVA 1CYDA 2C07A 3KZVA 3UICA 1UAYA 3RI3A 4E21A 4IJUA 3IJPA 3RKUA 1DJQA 4MVJH 4O63O 5B1YA 3JD1A 3E5RA 3BTOA 2JD2A 2X0IA 4YAJA 1FDWA 2FHSA 5JMPA 1I33A 4GWGA 2P91A 1HL3A 3IP3A 2ZTLA 3H8VA 1M2WA 4DQVA 3MJ4A 3DAPA 4G81A 2J3HA 1LSJA 2VZ9A 4ND1A 5DCYA 1HETA 5IAAA 1XEAA 1VKNA 2G1UA 3DHYA 3H4VA 4DREA 4RCVA 1TT7A 3NGLA 3R3JA 4DL9A 1W4ZA 4YAIA 5HRUA 3D4PA 4NHEA 4BMNA 3VVCA 2R00C 2GF2A 4PIVA 2FSVA 4NFHA 4PFJA 3WDSA 2NU8A 2PTGA 1AHIA 3PFFA 1I5RA 1KY5A 3JQ9A 3QJ5A 5JE8A 5A9TA 3GZNA 1MB4A 1P44A 4YEDA 2VT3A 2EKPA 3GG2A 4U7WA 1E3EA 4YTEA 3AUAA 3IKVA 4AJLA 4JBIA 1Z74A 2Y1FA 4RPHA 3V1TC 4FFRA 4D0RA 1FDSA 1NR7A 1V0JA 2AHRA 4O6VA 5C5IA 2UUOA 3WBBA 5A06A 5HTOA 3GZ4A 3D0OA 1WDLA 1ENPA 2XPCA 3M1LA 3WIDA 4KUGA 1NNUA 2CVZA 3HQ4O 2EXXA 1MFPA 5KVVA 1E7MA 2QZZA 1A7AA 3AOGA 4GI2A 2H63A 2JAPA 4CODB 2EKQA 1A72A 3PZBA 4FOOA 5EESA 3M6IA 2DVMA 2G17A 3GEMA 4Q3BA 3UXYA 1KVUA 3K92A 1ULSA 4Y6RA 3FPCA 1I32A 1H94A 3Q9UA 1NM5A 3RUAA 4DPLA 1ZK4A 3H65A 4DLBA 2O3RA 1LX6A 3AJRA 4L4SA 3ZWCA 2ZATA 5I9MA 3OP4A 3GH3A 1ZSNA 1MP0A 1F17A 2NSDA 4H7PA 3VPXA 1BXZA 4IQGA 1PWZA 4R5HA 3CE6A 1PGNA 4D3SA 4RF4A 5AQ1A 4WK6A 3F1KA 3ONEA 2HK9A 1IL0A 4I9NA 5BSGA 4U6QA 5EL0A 3QWBA 3TN7A 1JWBB 1YE3A 3H5AA 3WNQA 2JCYA 1EVIA 5TF4A 3M2PA 4OXNA 3GT0A 1EQUA 3DMYA 2VTDA 3HE3A 4YJGA 1D1TA 1FDVA 2NV6A 5L7WA 2EW2A 3ROMA 4PLZA 4DPKA 3C1AA 1KERA 3TNLA 3K5PA 4A2CA 5IG2A 2ZTUA 1TT5B 1MFZA 3RUEA 1U2GA 2BGMA 3KBOA 1IE3A 4BNYA 2JL1A 2VHZA 3EMKA 4GWKA 1PGPA 1YO6A 4NBTA 4BO9A 4TKMA 5AXBA 4YRAA 3IIEA 3VDRA 2FZWA 4EYEA 1SCUA 3VKVA 5JDCA 1C1DB 2Q46A 4B3JA 3I9MA 1BTOA 3QRWA 5F21A 3MWEB 4AJ1A 4IDGA 5DULA 2AEJA 3S55A 4DC1A 2HMWA 3NDRA 5F5NA 1ZMOA 2Y0DA 1F8FA 1JVSA 4U0KA 4JBHA 4KTTE 3WGGA 2AQKA 4XQGA 1T1SA 1GQ2A 3DZIA 2O3SA 3FNFA 4NBUA 4E31A 4KWIA 4OL9A 3VC7A 5IDYA 4WLNA 4XYLA 4EJ0A 2WE7A 4Q3CA 2IDZA 4H15A 1BVUA 2P4QA 3B6ZA 2FPIA 2B83A 2DBZA 2Z1NA 4LSMA 4UEJA 2NACA 5AXDA 3F5QA 3UOGA 1YJQA 3AM5A 4M87A 1P1RA 3HN7A 4C4OA 1BW9A 3GNTA 1P0CA 5L51A 4HXYA 1ZFNA 3H2SA 3LT1A 1KYQA 3VZPA 3E9NA 1BW9B 2QRLA 2UYYA 5C3MA 3ON5A 5CDYA 1ONOA 4YXFA 3KVOA 4WLVA 5GZ1A 2Q4BA 1DAPA 5KJ6A 1DDOA 3JQ7A 3WBFA 3RU9A 1PJTA 2I66A 5JW6A 5L7TA 1F14A 3MJCA 2O4CA 1HXHA 3H9QA 4IQ0A 1PJLA 3NT5A 3PQFA 4O59O 3JQ7B 3ZWBA 5DN9A 3A4VA 3GGGA 4QTZA 1PEDA 1R12A 1XWFA 4LN1A 1HE2A 1Q7GA 1YGYA 2Q1SA 2PZMA 4RVGA 1E6EA 3K30A 3IOYA 3LYLA 1KY4A 1GV1A 4J1QA 1V3VA 4BNGA 2WD7A 2ZJ1A 4M54A 3ADOA 5I7FA 3A14A 3DB2A 3NEPX 5EINA 1ENOA 1I3KA 3OFSA 1U3TA 3CINA 1YWGO 1SB9A 2PLAA 3OQ1A 4J3FA 3U5TA 1ZEJA 5A1TA 1IZ9A 4QQRA 3RUCA 2EP7A 2VQ3A 4UUOA 1CEQA 3FI9A 4J7UA 4J0EA 3B1FA 3S1LA 3KUXA 2UVDA 1KBZA 5DCUA 2R6JA 2UDPA 4BNZA 5JXWA 5G0UA 4NFYA 3UW3A 4BQRA 1QYDA 4YT8A 3PP8A 4DVJA 4I9UA 2A35A 5CDSA 5IJZA 1GV0A 4N18A 3MOGA 2Z95A 3OIFA 2DM6A 2X0NA 4DMMA 2X5JO 1JA9A 4QO7A 3WTBA 4BNWA 4YT5A 4BNUA 1KVSA 2DBRA 3FR7A 4XA8A 3FR8A 5KIAA 3MTGA 4XYBA 4H16A 5A5EA 5KOIA 2HO5A 3N58A 2YFHA 3AY3A 2R00A 1F8GA 1ISMA 2PV7A 3ONFA 2FRDA 2WDZA 2Q99A 3DWFA 4I1IA 4JQCA 4EW6A 5J23A 1D1SA 2EG9A 5ILGA 1GPDG 4IBOA 4IZIA 1YBAA 1LSUA 3ZWPA 3RC7A 3QV1A 1A7KA 3ZNQA 3L9WA 2EJVA 1VI2A 2FR0A 4GBJA 5JCXA 1XQ1A 4IMPA 4MVJD 4PN3A 1YONA 1R4NB 2X58A 3OA0A 3ZH2A 4NBRA 3V2UA 4BL5A 3U49A 3VH1A 1P74A 1Q0LA 3E18A 3PDUA 4MPDA 1WZIA 1EK6A 3ZU5A 1X1TA 4K6CA
chains in the Genus database with same CATH superfamily
5IKMA 1U81A 1IHYA 4WNAB 4CV2A 1Z22A 5JYEA 2FJPA 3W05A 1Q1EA 2PCLA 4KKXB 1KOJA 3BA6A 1GKLA 3CLUC 5DI9A 4RLFA 2C98A 1LTKA 2JJ8A 1OWMA 2QAGB 4QNRA 2R7KA 4F3TA 3MN1A 4F2WA 1E2BA 3OURA 1EGVB 2AZMA 2WHQA 3M34A 3P5SA 4UZFA 5FL3A 4E6PA 3GXOA 4LHWA 1N6LA 3E3OA 5D00A 4RZIA 2XMQA 3ICCA 4C76A 4BV9A 4GI3A 4F6CA 3LSTA 4F4IA 5HQTA 2CLKB 1DFHA 2C77A 3PX2A 5CT5A 3GG9A 1U6KA 4L75A 1MH9A 1Z16A 1X87A 4JP5A 4TS3A 2AG0A 1ULTA 3G5MA 1XZIA 2PEZA 5E2IA 1H2ZA 4TXLA 1NUPA 3WMRA 1ZL0A 3W8FA 1KSJA 2AA3A 2F43A 5HK9A 2J9YB 2WY2D 1NNLA 2Z6VA 4LBZA 4GRAA 1A5BB 4QHTA 3E2IA 3KOXA 1YGPA 4BMCA 2P2CA 3HGMA 3C5VA 3A0UA 3SF0A 3V4OA 3O8CA 3A11A 4D98A 3ANXA 2QJOA 1K6JA 1XVVA 4WE3A 3WYEA 5JFTA 1P6XA 3BGVA 3LT2A 1JR3D 3ITDA 2J4CA 3CB4A 2W6QA 3AG6A 1U9YA 3K9CA 2H5EA 1Z2NX 3D1JA 3JQQA 2J5RA 4DIDA 2X9GA 1WV0A 3I6IA 4QYXA 4RZQA 4AVYA 3OFND 1SMKA 4NDNE 5IYZF 5K0LA 3UAWA 3KVYA 4AAYA 3EMBA 1F2DA 1PW7A 4ZT5A 3BEOA 4MUHA 5A3SA 3V4LA 3KAJA 4EB0A 4BNIA 2QRMA 1Y4SA 3FFXA 1JF8A 1O1YA 2Q6IA 2VP6A 3KYDA 4NZ9A 3RTBA 2XI4A 3HC7A 1QGOA 1W581 1WUIS 3RREA 4O2BA 3I9OA 1VG8A 2EZ9A 3FNQA 4D9BA 1NTOA 3BMXA 4CIDA 5CXUA 1HKUA 2EIHA 4QYIA 3CX8A 3P1JA 4UE2A 1G8SA 1HDOA 1XRNA 3R5TA 1HZJA 1S2MA 2EJTA 3RFVA 3ZBUA 4WN9A 1S0UA 1TTTA 3PJFA 4F2GA 4IEIA 1YQ9A 3E05A 3A9VA 4MGEA 1N3IA 3OQPA 4C88A 4QYIB 4P3KA 1H6DA 3HN2A 5T4EA 1XSEA 4HNTA 1V1RA 2FWNA 1Y9DA 1OFGA 2HK7A 1YDWA 1Y48E 2VBCA 3JYLA 4JLBA 3IDOA 2PL9A 4WN9B 5KYVA 1C7IA 5K4GA 2YCLA 3B1YA 2AK3A 3DC7A 2C84A 4PYRA 5IN5A 3V42A 2E1PA 3HB0A 3JW8A 4MRNA 1V1RB 2X5OA 4RQUA 2JFFA 1REQA 1ST2A 3DE2X 3WSVA 3DPIA 5B30A 1E1KA 3TTWA 1SEPA 4LOJA 4F84A 2IDJA 2C9DA 3FGNA 3BXFA 4O2RA 4BIIA 1AA9A 1QJCA 1NPTO 2Z4TA 3HBNA 3Q7PA 4OKIA 5DGTA 4D02A 1VBMA 5BQ5A 3QVSA 4OQMA 4OAPA 1KHHA 1L5MA 3LPNA 1GYRA 2E89A 3UWDA 3VSCA 5AVVA 1UODA 1T5HX 4BNXA 4O4JA 4UXJA 2BJVA 4C4ZA 5FI1B 5K0SA 3SLGA 2R7MA 3DBHB 3ODPA 3SOZA 3EGWA 5AXAA 2ONKA 2CFSA 2PV0A 4O3MA 2RARA 2D5CA 4S1TA 4FDTA 1EGMB 2R66A 4O4JB 2QW8A 3BL6A 3FTCA 5EJEA 3QYFA 5LP6A 2IYAA 4Q0MA 2PVCA 3K2BA 2AFHA 3MTBA 4EHBA 4H7EA 5D87A 4I66A 3SZLA 3UB3A 5EXXA 2WU3A 3WAKA 3CZMA 3OY7A 4LE2A 3PXGA 5IABA 1GQFA 1A71A 2B0CA 4XB2A 3JATA 5HR5A 5LP6B 3A4LA 4MS4A 1U0TA 4R6XA 4YNBA 2AFHB 2FSVC 1EX9A 4B85A 2UZ1A 1TD1A 5J2TF 4PFQA 5AM1A 3R9IA 1LQTA 5DN6A 4K9OA 2FG7C 1L5FA 3RVRA 3JATB 4MS4B 5K3CA 4Y18A 5IULC 4NG5A 3V7NA 2M6LA 2C3MA 1QP4A 3UVEA 2DKOA 1SD1A 1LW7A 3DLPX 4B6GA 4H7DA 4HQLA 4J0FA 2UUBB 3RYTC 3OJCA 5SY4A 5CEJA 1IDOA 3DBVO 2PUGA 3V8BA 1UT5A 5FKJA 1F51E 2ZXEA 4MDHA 2RJOA 1UZLA 3FHCB 1GPAA 3ILSA 4HMPA 1BOOA 2ZBDA 3TFWA 4HN4B 3AUXA 1ZY2A 5IBCA 3LVFO 2PUCA 4DR6B 2QRZA 5U1PA 2VCYA 5FLXA 1WB9A 5DW0A 3EEIA 4F92B 1EZ4A 3RTCA 3IRUA 3A2NA 3SNKA 2ACWA 4HH0A 1ZMTA 5A7FA 2CLCX 3G17A 5AQEA 2JH9A 2IYRA 3QELB 1NQVA 1C9KA 4D96A 5BNIA 1UBKS 5DCLA 4IJQA 1G1MA 3EYAA 4LQ4A 3Q10A 2ECKA 4F4DA 1HFKA 4E2XA 3N5CA 1KEZA 2BMVA 1NUAA 1PF7E 2H2IA 2OE2A 3L6CA 4WOCA 3QWHA 5FI0B 2WD9A 4B76A 5ISMA 4NWIA 3QF4B 2HK6A 2CZGA 2Y6VA 4M86A 4UBNA 5DYWA 5KPJA 3W5CA 2ZXFA 1DTWA 2P78A 3AINA 5PGMA 4AO6A 2IXEA 4XSVA 1BEZA 4NH0A 5AHWA 1HY3A 1Q7TA 4WD3A 3FNEA 4HVCA 4UHJA 5HJ7A 1DTWB 4IYRA 2QRUA 4XEUA 3GRVA 5LQMA 3F3SA 1AMUA 5HHTA 3E6AA 5ALMA 2WFZA 5IF9A 4TTAA 1X0VA 3NBQA 3HDTA 3PRHA 4U2GA 1OVGA 4AIIA 1EUDB 1PX0A 2HT6A 3MINA 3HK2A 1L8OA 1CRZA 3PXBA 3JQGA 4D3XA 1S5PA 3HB1A 2G1AA 2OV6A 3ID6C 3JX9A 1PG5A 2CEKA 3PGMA 3IAUA 5CDFE 4RVSA 1UL1X 1AGYA 3OC6A 3JQFC 3ZJ5A 2H7XA 3MINB 1NW3A 4DWVA 3AVPA 3JQGB 4GOMD 1G5PA 3LMKA 1QHEA 5AI8A 2Q0SA 2BCJQ 3UAXA 4JXXA 4EB3A 4KPFC 3B1ZA 4IHKA 3VPFA 1LV7A 1QH1A 1W25A 3QVLA 3DEHA 4HFRA 4BFCA 1ODJA 2R9VA 2VP3A 2G5PA 3DMFA 4JYMA 5HXAA 4FUQA 3D2LA 4C2UA 5JALA 4HDRA 5JU6A 3MS4A 3D3QA 2GZAA 2H08A 1QH1B 4X24A 2YCBA 4DDUA 1E7RA 2OL4A 1NY5A 3TFQA 4UHKA 1NXTA 1QHNA 2FR8C 3HJCA 3JVIA 4FP9A 3WO0A 4ZGBA 2ZJ5A 3NKFA 5EJ7A 5I7OA 1B16A 4HDRB 2O23A 5LZ8A 2F55A 5F98A 2WV9A 1P3DA 2ORWA 1FBTA 2BGJA 3LC2O 1I6WA 1TZ2A 2GGSA 1V43A 2QTVA 3H2IA 4RZXA 5ALGA 5BSFA 1UXJA 1N7JA 2WC1A 3SS7X 4J3JA 3R2JA 3NXKA 1E6UA 1U7PA 4HBGA 2VUIB 3HA2A 4K2HA 4L3VA 4Q1VA 1QIFA 4RA9A 5CJPA 1LBTA 3RAJA 5IASA 3FCAA 4EYSA 4PGMA 5L95A 1DJMA 1S02A 5JXHA 3LK7A 4JI5B 3P9ZA 4M2LA 4RA9B 1RT9A 1YOVB 2BISA 2WAYA 5ER6A 5DHRA 4LZZA 1I94B 5IJXA 1GPBA 4J0IA 1UKCA 1LD3A 1NC3A 3QE0A 3TMKA 4CTKA 4KI0A 4D8XA 4ZAWA 2R6AA 3H18A 2JC3A 4YDSA 4O02B 5LQKA 2WF5A 2VOEA 2XF2A 2R8BA 4G1VA 1Q0ZA 1WB4A 3VAYA 2W11A 1NC1A 1OTXA 3PGVA 2QE7A 1DV1A 2WIAA 1Y8ZA 2KQUA 2PGAA 2YOGA 3THSA 4LCEA 1PI3A 2CNKA 2CVPA 1YB2A 1W44A 2D2FA 1OE0A 3RTDA 2E21A 2IHUA 1EFKA 2J7PA 3HVUA 1J8VA 2GARA 2WQZA 4LYAA 1E2PA 4D80A 1VIAA 1GFSA 4DPMA 5DHFA 1I2ZA 1PL7A 1S3GA 2FMXA 3EHEA 4C7MA 2NYRA 5C8YA 4GMGA 1L7XA 1PR2A 2QI9F 3R3SA 4L28A 1WBJB 2CFCA 2VLBA 2PSHA 1E98A 2QTRA 1P0FA 1T34A 1K3FA 1THGA 4Q15A 2W8ZA 3KPUA 5MN6A 3IIIA 3IAM6 3JYHA 1QGUA 3LXUX 4YUVA 2XMPA 1VG1A 4O25A 2P68A 5C8ZA 1I36A 4DBLC 2WJIA 2PUTA 1JTEA 3UT5A 3WI7A 1SZDA 3HY3A 4D8YA 3HV2A 3PC6A 2VPTA 1TYAE 4KN6A 2A88A 4BO4A 4C4SA 2FZEA 1ZLXA 3I5MA 2D3TA 4OQQA 4IXNA 5HF5A 4MUKA 1OAKA 5IU6A 2IUTA 2Q4EA 3PGJA 3UT5B 4TMXA 3R3HA 1DSSG 5AW9A 3TTUA 1ZL2A 2HYIC 1F9AA 3VISA 1UC8A 1VKHA 4QBFA 5ALQA 1N0IA 2XX3A 4Y2PA 4ZEOA 3ZLBA 4RPIA 1X7ZA 3D6HA 3NGXA 5C18A 4LVOA 5LPNA 2I29A 1FUKA 1CUAA 1X1QA 1Q0QA 3ES9A 1AHNA 4NZOA 4ETWA 2MYNA 1Q15A 2VBIA 4MQ4A 4AJOA 1STOA 1F2UB 1L5NA 1X7ZB 2WJVA 1AMNA 3FIJA 5KNCH 3C2QA 3ISTA 3EVCA 4YJ2F 3STXA 4BFXA 2CL6X 3ACCA 4KO1S 4MVWA 4RTJA 1RLUA 1JEYA 1Q1QA 2D5BA 1T5TA 1Z15A 4Z4QA 4D5EA 1PV4A 1W73A 4RY9A 4AB1A 3FFWA 5CTJA 5CBPA 3GFOA 2ID4A 1E92A 2KSQA 4FKBA 4MUEA 4WESB 5JSQA 1JEYB 5ALHA 2I99A 3EEOA 1Z8DA 1XQYA 2Q3BA 1XTUA 1E5LA 5ADHA 3AOEC 4EPRA 5LWQA 1B6RA 3C45A 2B9VA 2WP0A 4LEIA 2PMKA 1J2YA 2XKBA 2R62A 3DW1X 2FVYA 3LBAA 5EKSA 4UDOA 3ZK9A 4CCSA 1Z8FA 4DC0A 5CFMA 2WJGA 2D2VA 1FSGA 1FS4A 1SHUX 1G5QA 1ZJYA 2J5XA 1OOEA 3Q11A 2FRDC 2OBBA 1M76A 4KLZA 3R9WA 2UYOA 4Z7JA 3SYRA 2V0NA 3AXSA 1AKUA 1KQPA 3K5HA 2J3IA 5EJIA 2CLFB 5FUWA 1MZVA 3I45A 4YJKA 3Q7EA 2F1OA 4C0WA 1ORIA 1T36A 4JOCA 4UEWA 4PTYA 2O3TA 2QIOA 1V3UA 1BOFA 3BE8A 4UM9D 4NFSA 4CGYA 1XP5A 2VL7A 3I8XA 5AH0A 4BB0A 2PH1A 4BNDA 2Q9AA 1DO2A 1E0DA 2AD5A 1T36B 3AP3A 4OHPA 3RSQA 1NQWA 3IKMB 3O1LA 2Y4OA 2JGFA 3NM4A 5KQGA 3CO0S 4BECA 1ZQ9A 4A0FA 3SQXA 5FPPA 2FE1A 1WUKS 4HGPA 5DV9A 4BNDB 1ZITA 2HF8A 2REOA 4KQ2A 4G0YA 1KI9A 2AMYA 4NYMR 4Q12A 2NADA 1VL6A 2IOHA 3SZ3A 5I4IA 1ZI8A 3ANYB 2ODWA 4Z4HA 1JFTA 3F67A 4R1UA 1GR0A 1NSTA 1VKJA 2G9VA 4LZOA 1WDMA 1QK4A 1XRPA 2OVFA 4R2MA 3TSAA 5DEOA 1MJHA 1KOFA 1R66A 2BM9A 3U7EB 5HJEA 1V9CA 1RP1A 2CDAA 4MWSA 2D5LA 3HU1A 4XB1A 3NHAA 2DFKB 1E1RA 4S05A 5T4FA 2X2PA 4H7HA 2W90A 3M6FA 2Y9PB 3OU6A 2PX6A 3F7TA 4BV3A 4JR1A 1KSFX 4HI0E 1VLQA 3LDUA 3U62A 4FNAA 2FZVA 4FM9A 5JCJA 4RBNA 1PDWA 2BCGY 4Z49A 4ABTA 3KEQA 1GQOA 1HC7A 1EFPA 4R2IA 4JLDA 5FT9A 4OYHA 3KQNA 3AKDA 3TOZA 2JFPA 2C2GA 2G76A 4EATA 1BXRA 2GNOA 1RZ3A 2BL4A 4JL6A 4RZHA 4TRJA 5KTPA 1PYGA 1WVGA 2ZVDA 3K0AA 1XEFA 2YN2A 3KEFA 2DWQA 4N3GA 4WFKA 3KJXA 5KAMA 5B4VA 1C14A 5I7HA 1PNRA 3LSYA 1DJNA 4KVAA 4JZYA 3WP1B 1CWUA 1BXRB 1HO3A 1M6NA 2POQX 2QTAA 3FVWA 4JQOA 1G98A 1R0CA 3K0AB 2HGZA 5DIZA 1Y9EA 4Z0NA 5EWLA 5LBUA 4PYOA 5B53A 1EWRA 2ZYRA 2HBZA 3JQFA 5AVTA 3FHTA 2C7BA 1GEEA 4P3PA 3SC3A 1BG6A 1ZA2A 2ID7A 3QEKA 1G64A 4RLHA 2ZT5A 3FFAA 4EUEA 1EA7A 3GEEA 3MWEA 5TMBA 1J0EA 3SX4A 2PR2A 4IIJA 1RE0A 1YVRA 1XDGA 1W0KA 4XQEA 2HPVA 4Q34A 3RAGA 1J06A 5DLQC 1YZKA 5CB4A 3UUGA 1OXMA 4QOEA 3PCRB 3EISA 1UXKA 1Z7YA 2YRFA 1MX9A 4G0PA 2PH5A 1VLZA 4E7PA 3AVWA 5EHQA 4ACBA 3ZDDA 1C9DB 4D9CA 3ZWNA 2FR8A 2R7NA 4I6GA 3GLGA 4N54A 1FNCA 2IY8A 3CGWA 1YDEA 4UUBA 5L40A 2GJ4A 1K6EA 1H0RA 1TEVA 3FLAA 3MSCA 4DJJA 4MMXB 4P5DA 2AFHE 4I4LA 3T5CA 4DCJA 1UKZA 3GGOA 3MYYA 2B6HA 2XYRA 2W2LA 1H5NA 1P4GA 1WY7A 2WIBA 2BJWA 3RVJA 4JJ4A 2VF7A 3C7KA 2P9JA 5DASA 1NJ6A 1Q6YA 1YJXA 1K97A 3JZIA 1BD4A 3K09C 3D31A 2QB5A 3IP1A 4MV1A 4AZ3A 4CIYA 1UDWA 4KIUA 4B4KA 1M75A 4GXRA 1H4TA 1AUQA 1W94A 2X77A 3GGJA 4M21A 5D7BA 3A27A 4DRXA 5HZGA 4HB2A 2FQYA 3NHBA 1ISGA 2REXB 4QGBA 2ZUVA 3WK9A 1XU4A 3NBKA 4FQ8A 4MGIR 3OJWA 4ND2A 3U81A 1R9JA 1OJ7A 1G8MA 2WTAA 2NSLA 2O2CA 2W98A 4XD7A 5IAEA 1UEXC 3Q5GA 3E9EA 2GRJA 4XJSA 4G8CA 1X86B 3WMEA 3QEAZ 2Q4DA 3HPQA 1BVHA 3IV7A 1L7MA 2WFLA 1ECPA 5FADA 1F38A 2I4NA 2VXCA 4UNQA 3VPCA 3LP5A 2R47A 1CUZA 2GHTA 3AF3A 3EQ2A 1AKNA 1JEJA 2XNDD 4QU9A 1Z5ZA 5C51B 3LT5A 2F2TA 4G5RA 1BHO1 2C42A 3CMCO 2NU9B 1A9TA 1A8QA 1ADCA 1WD7A 2AR7A 2D1YA 2VDUE 1RLJA 1PZHA 2CMHA 3LWDA 3Q3CA 2HPHA 5HIIA 2AYZA 2VF8A 2I1QA 1SXPA 3A4NA 3A4TA 1YJ5A 4FGLA 3H8SA 1T1RA 1YQTA 1QZ3A 4K46A 3KZMA 2P90A 4B83A 4X64B 2WUFA 2R48A 4GOLD 2EX0A 3N7AA 3DLBA 2VYND 2CKMA 1YL5A 5T41A 5DDIP 4ICIA 4NARA 5A2QA 3PKJA 1UAAA 4NONA 1XGKA 2RGBA 4O4HB 4QIHA 1CJVC 1TMGE 2JHGA 1XDDA 2I4TA 2O2ZA 1AE1A 3DC2A 3QE3A 4IVNA 2VDQB 4OGLA 1TF5A 3DT9A 2IU4A 1NJ8A 1JHMA 3ROGA 4OTZA 1OIXA 1XVUA 1YZNA 3NEJA 3OPYA 3CZ9A 4TMZA 3DXYA 4HDSA 5EJMA 3VH2A 1J25A 4JIMA 3COYA 3C8ZA 2PY6A 1G3RA 1YSCA 5ALWA 1EB8A 2TSYB 2VNAA 4ZCRA 1IIRA 2PH3A 1BMQA 4BKPA 5C32A 3E3MA 3W4KA 4PRLA 1BVRA 2IZ5A 2UV8A 4HDSB 1JH9A 4RL6A 3VAAA 2FFHA 2XDQA 4KMRA 5A5DA 5DU2A 2X9NA 3VVMA 1DCMA 4BV2A 3BXPA 3V48A 2OZPA 2X1HA 5ERYA 1NGSA 5JAMA 3ZYZA 3LRPA 2NU6B 5DGCA 2R1ZA 2XDQB 4B73A 4YI5A 3LY5A 2LBPA 1NBHA 2RHMA 2UYQA 3ZCUA 5K6AC 1LPMA 1PEYA 2XITA 2W6CX 3AOEA 1M7GA 4TVSA 4FGUA 4XUDA 4BBZA 1AZTA 2IP4A 4C89A 3ZV6A 4QPNA 1KYIA 4QGSA 1P5FA 4RHXA 3OJLA 3RHTA 4A16A 1XCGB 1AC5A 3NGMA 3I9NA 3IILA 2D1RA 3BTUA 1WP4A 3QP9A 4K6KA 2EF0A 3O74A 1E60A 1WZCA 2CFOA 2FE4A 2H8KA 4I1SA 3V4FA 4CNBA 1SQSA 2J3QA 1XUOA 3OY2A 3M4YA 1SZJG 721PA 1ZW1A 1R4NA 1TEHA 4P1ZA 1X1BA 1RI5A 5AK0A 4QRDA 3HABA 1XDUA 3H11A 3L8HA 4CIVA 2OB2A 2R8PA 3TOVA 4B5KA 3D3WB 3T7CA 3JALA 1JVBA 2ODTX 1FQOA 4O4LA 2OFPA 2QXYA 3PRKE 3NV7A 3F9CA 4W1SA 4CMEC 3HXKA 1UXIA 2Z09A 3H11B 3T3DA 4QXMA 4Q21A 4CQMA 3BKWA 1A2BA 3ER6A 4PTZA 4RW0A 3BCUA 2DR3A 4P9NA 3JALB 1YIAA 1MORA 1TKBA 4O4LB 5FOWA 4ARIA 3UKDA 4XYEA 4CQMB 3FYTA 3AL3A 2ZRGA 2C2OA 3UTCA 2LKDA 3P9XA 1D5WA 1U9IC 1K8XB 2YHIB 3NT4A 2UZAA 3THYA 4FONA 1USKA 3KSUA 1O97C 4RXUA 3BL8A 3FOBA 5DLPA 4OYRA 1MQSA 3GY0A 1Z0AA 1KVTA 4HVTA 4UNPA 1UK6A 4AYTA 2H5IA 3HS3A 3PNMA 3THYB 1B8PA 4Y2QA 3NDIA 3JRNA 5EXEA 1ECFA 4IO1A 5JANA 1Q1NA 2ARKA 4D3DA 4EQ6A 4Y6SA 2P75A 3OEEA 1L1FA 4IIBA 1H69A 2HA3A 2IWRA 3ZYCA 4E5VA 3ZVNA 4B6EA 4YDHB 2O8NA 1IN4A 5GWXA 4H6PA 5DYNA 3VZCA 3C8DA 2EEPA 4LTMA 1NBMD 3OIDA 1IM8A 1UJ2A 1G60A 1MT0A 3KJZA 4NR0A 4D81A 1CJUC 1DC4A 1DCFA 1EESA 2DUUA 5JAHA 1FUEA 2IYOA 3PYMA 4IH1A 4F4HA 1XROA 1GGFA 1K6MA 2CNOA 2QN2A 3ENQA 2WPDA 4JKIA 1OV4A 3R76A 4XIGS 3O3CA 5KUTA 4CHGA 2I1VB 1NMZA 2ZGVA 3A1SA 4KHZA 2OHJA 2CHEA 3BMCA 4QREA 4TYMA 5KVQA 2HIAA 4R71A 2WMYA 4HGYA 4A8PA 4LJ8A 4ENWA 1X7XB 1D0IA 1QK5A 4LQDA 1XFDA 3UAOA 4DCSA 4PAGA 4C21A 3BMCB 3LO5A 2MINB 2GCIA 3LBHA 3U7IA 1XNRB 4B45A 3NCHA 2O2XA 4Z4EA 1R50A 1GAWA 1V5GA 1WSWA 2B78A 2WKQA 5HIJA 1E2MA 3SEFA 3FNIA 5K8CA 4QQFA 4DLSA 3W77A 4KPGA 3KFVA 1XMPA 2EL7A 4L3OA 1IY0A 1W5SA 2YC4C 3IBGA 4FYPA 2QMEA 4LXGA 2DQYA 1QPBA 4RVHA 3WLAA 2HNAA 4R81A 4BQQA 3T35A 1UPAA 4RV4A 1QXSA 2XNSA 1DFGA 3C1OA 4LX0A 2XUJA 2DT5A 4PSUA 3DYIA 2VPXA 3LBFA 1H2WA 4DKXA 1SNYA 2WQ6A 1E1QD 5AKHA 1OLSA 1AXRA 4P4GA 4QKQA 4GOOD 3AUYA 2UUCB 4BN0A 5EYPA 2PK3A 4FWBA 3GV0A 1R5NA 3KE9A 3NM5A 1RPAA 1R9GA 3SM9A 3W2GA 1XN4A 3ZU4A 4XKJA 3SCZA 2HTEA 1HV8A 2IODA 1RKQA 3DF9A 2CW5A 2YV3A 2J07A 4NBVA 4I9HA 5EYPB 4BJ3A 4DTCA 3K09A 4B3XA 3VPGA 2GPTA 4ZVMA 4Y2SA 4FS3A 5ESDA 1S8FA 1SC6A 3OT4A 4NL4H 4W6ZA 4CKCB 2HF7A 3GPBA 1NL3A 1KYWA 2VTEA 3JQAA 2JFHA 2B4QA 2WLTA 4QTTB 5EPOA 3TZHA 3EDMA 4DEVA 2HT1A 1FLNA 1PVOA 2YJ6A 1DKMA 3TD6A 3EXHC 1X13A 5A7GA 2X4GA 3LUDA 4YCNA 3VPSA 3BBPA 3JQAB 4X1KA 4XSGA 3WTCA 5ITVA 1SPBS 5AM0A 1QTIA 1N57A 2YWJA 2H0QA 3P9KA 4IHJB 4UTXA 5DNUA 3AFHA 3CUKA 1QV7A 2WF8A 4JODA 5A5FA 1ABEA 2GESA 4CI0B 1CLUA 1JJIA 1G18A 2YWDA 4C78A 3L4BA 1CUFA 1TQ4A 1EGQA 2CMDA 1X70A 3B6MA 4JUFA 3UV3A 3C39A 1QYXA 3BORA 3EX7C 1ELOA 4ZYXA 4EUHA 3RGGA 2DJ5A 2XB2A 1NR5A 3S28A 1O0CA 4PG7A 2YZNA 4DV6B 1Z75A 1R6BX 3G1WA 3HEMA 4CG0A 3RAEC 3MPUA 4KO2S 5F78A 4IQ8A 3SZGA 1XVLA 1ZO8A 2Z9DA 2NQTA 4BZZA 4DW8A 1FU8A 3U40A 1NUTA 2UKDA 5J47A 5FTMA 4O5OA 3U7FB 2PZGA 4DSNA 1GLNA 4FZ5A 1O0SA 2P3SA 1ECBA 2OLJA 3DMRA 1GPUA 1Z8NA 8GPBA 3G2JA 2HRDA 3OQVA 2XZLA 2REQB 4DR7B 2VFAA 2H2WA 5CIYA 1O9HA 1E94E 3VBCA 4CTJA 1IFXA 1BHQ1 2ZWIA 1KY2A 3BFKA 5ADVA 3T3OA 1J70A 1FMCA 2LWIA 4JI1B 4PZZA 2OKGA 4BCBA 1FXSA 4UOQA 5K45A 2H00A 3UWSA 1K0FA 3LBYA 5CJ2A 4KR0A 2XH8A 2ZIWB 2CJYA 1P2GA 1YS6A 2NZWA 2P1ZA 1EZ1A 3I37X 1DCKA 3NWOA 3N76A 1ESZA 2RCYA 4GP6A 1NRXA 2BFDB 1MC4A 5KYUA 2AG8A 1SIBE 3DFMA 5F33A 5A4IS 4MDFA 3AW8A 5KNDH 1R4MA 4G0XA 1TMOA 4MV6A 5CPBA 4DQLA 3GGPA 1TMKA 4F4JA 4BC1A 1XZFA 2GPNA 1I7LA 5P21A 2XMBA 5KYUB 3VTZA 3BHMA 1V4NA 1CSEE 2XBLA 1N6OA 2O1WA 3CUWA 3V4SA 1W2GA 1KO5A 1PTJA 1R4MB 3K8ZA 2G9QA 2ZFUA 2GCGA 3HH8A 1KFEB 1D07A 4XGNA 1MD9A 2AQ8A 2VEDA 3KQVA 4JASB 4BMZA 1V6AA 3FWPA 2OB1A 1MJGA 3FCYA 1Y6ZA 3LZCA 1Y8CA 4RAQA 3NHKA 1IM2A 4Y9DA 3VX3A 1X8XA 1LY1A 4N82A 3U3DA 3UTDA 1U02A 1Z0SA 1CT9A 3ZY6A 3KVVA 1WM1A 3BJRA 2AFVA 4OO3A 1JR2A 2OCPA 4P82A 4BFVA 3S29A 1OWNA 3VA7A 1JR3E 4YY3B 2QR3A 2SKEA 5U4QA 4DQXA 4IHAA 4JN6B 4MGYR 3F3YA 4BQSA 3DDSA 4CMEA 4F6RB 4LXHA 3AIMA 1NDQA 4FEAA 2VDLB 3MG9A 3CZAA 1D03A 3HWRA 3MWJA 2VRWA 5E9AA 3AB3A 4ARUA 3QEOA 1W5EA 4PR0A 4NE7A 3EG9B 4HNUA 4YACA 5B55A 4UJ3A 2GYWA 1ST3A 1FDUA 3OEWA 2Q9UA 3DOJA 1IULA 1BS2A 4Z4CA 1U9IA 1MHPA 2CVQA 1Z45A 2IHTA 2R6DA 2WMNB 3LNCA 1RWNA 5K3FA 1YRLA 4TZKA 5KOJB 3EGVA 3R7BA 3OX1A 1VYVA 2B21A 4YQZA 1Z6TA 3DT8A 4GT1A 4LYEA 4ZMSA 2IK8A 1TADA 3M1IA 1W85A 1XP8A 4TTSA 5EKTA 5A5GA 3KTDA 1L7VC 3W79A 4D8WA 2P6MA 2NO7A 4UE6A 5H81A 1B23P 3I2HA 3OFJA 3SR4A 1AKWA 4X94A 2AL7A 1PWHA 2DTEA 3M7IA 3OJOA 1ZIDA 4TV8F 1JJAA 1W85B 2FRXA 4EGSA 1WB5A 2H1CA 4YMWA 3WMFA 3L6OO 5YASA 3HJGA 2EBHX 4FE4A 5FBHA 2W6ZA 3T41A 2KWIA 3OO1A 3OIWA 1Z8HA 5E6RA 1EKXA 2ZITA 2ZI9A 4HAVA 5JYBA 5CYOA 3LA8A 4A9AA 3DEIA 4JEMA 1O4VA 1WIWA 2JFBA 4L2IA 4P3OA 2AEFA 1GZ5A 5E6RB 3RS8A 1ECJA 1WEKA 3EGCA 5FULA 3BRQA 3AT1A 1SXIA 5AYVA 1KOGA 2H1SA 1P81A 3AHEA 4L2IB 4DIEA 4ZZ3A 4A8JC 2BKAA 1T2AA 4X9XA 5HKOA 4C1NA 1M8GA 2D2IA 1WQ3A 3HUDA 1H4QA 1ETHA 3A3PA 3BH0A 3B48A 2C59A 4Q7KA 3EVEA 3EY4A 3LX6A 4HRAA 4EL0A 3WIVA 4BZWA 1MJFA 3LP6A 1MC8A 3K2QA 3H05A 1NBWB 1NMXA 3LUKA 4OBEA 4PE5B 5HTKA 5DJ5A 4YX9A 5ALKA 1B4DA 3TMYA 1MOQA 1XHLA 3D6TB 3GAFA 3IC5A 4KG7A 3TTTA 3VFDA 1DRKA 1QGAA 1Y1SA 1P4SA 1AN9A 5JD4A 1O5OA 2G0TA 3A4IA 4QEZA 3WGKA 1P7VA 3TW8A 2NZVG 3VVCA 3H99A 3L8EA 1AURA 1PUXA 2H1RA 1AK2A 2WMDA 3IBSA 1ID8A 5IKOA 2ODAA 1YKFA 2LKCA 4UAVA 1GPNA 1XPRA 2X8AA 2JIDA 2HMTA 3VAZA 2XCLA 3GARA 1FTYA 4PRYA 4JLWA 3TW8B 1JKFA 1IPEA 2FEWB 2MT9A 2NSHA 1L4EA 2OBYA 3GA7A 4IG9A 3ZTYA 1XDZA 2VZ0A 4N03A 2XEDA 4TTPA 2Z57A 3S8MA 3BVPA 2GXQA 2I9PA 1YH3A 4F3YA 1MEEA 1RVDA 2B2NA 3A70A 4PM4A 3KETA 2ZVJA 5GIPE 2LGJA 1LF5A 3B8HA 3C3EA 4GM4A 3RC2A 3TSZA 3PHJA 1PDOA 5TR9A 1E9SA 3IERA 4Y2GA 1KIAA 3G3EA 1SOUA 2IEGA 5LA6F 1QIGA 3JSXA 4MARA 4WADA 3CR3C 1GN8A 1CXZA 2PYDA 3KO8A 2A3RA 3LPLA 2GA9A 4V1CB 5HFJA 2RB4A 4RJTA 4GYWA 5F7OA 2JASA 3WWYA 1SC3A 2X4LA 3EXHA 1CKEA 3D0QA 3KTFA 4N6OA 1D2GA 4QOIA 221PA 3UMJA 1CUSA 5JLJA 3U1VA 3WGVA 3DHNA 2LPMA 4OM8A 3E9QA 3O73A 3L7NA 4Y2JA 2CLSA 4LE0A 1Z5PA 1ZWKA 1T0BA 1MX3A 3T0GA 4OLBA 1ZUNA 5AUOB 3RUPA 4V0NA 3IBFA 1QHGA 3EA4A 4V0OA 4DV0B 4R2WA 1PFUA 1D4ZA 2ZI5A 3E23A 2Y66A 2CNWA 3DE5X 3DEAA 2XV1A 4U1RA 5FNVF 4JR2A 4KP7A 4G1CA 1ZUNB 3QEMA 3NHUA 4NCIA 5JWRA 1AO0A 2ZR9A 2VDNB 4XLZA 5M5BA 3HBAA 4KE7A 1RXEA 3B3QA 4KQ6A 4OIMA 2CD9A 3Q0EA 1GYQA 3G5UA 4ZRDA 1A77A 2WHEA 1XAJA 3FDZA 3W7BA 3QEMB 1SELA 2JI8A 3QTTA 4FLEA 2GZDA 3JR3A 3GCDA 1UDXA 2QLBA 3FSGA 2J6BA 2RAPA 1Z2OX 4CR6A 3HG7A 4EECA 4FFSA 2I03A 3FDZB 2V7XA 2Q7DA 3ONNA 3W4IA 2HIGA 1XHEA 2JAUA 2O1SA 1UIMA 3H2KA 2ZJAA 1HSOA 3I05A 3JAKA 1H05A 1TYZA 2YV1A 1TL7C 1YC2A 3SS9X 4ND8A 5EZ6B 4ZYUA 4YONB 4JD5A 2C5AA 1F4LA 2V55B 3GUZA 3W2TA 2PZFA 4B43A 4Z7OB 1CUDA 2WKPA 3QSGA 2I6GA 4WOBA 3ZD7A 5BY2A 4JOBA 3WLEA 2ZRQA 4DSUA 1JW9B 2NXNA 3CLTC 4IZHA 3D1VA 3PA8A 4KFCA 1IHPA 3H04A 2PWYA 3LCRA 2VP4A 5FO0A 3VYSB 4AUNA 2G9RA 4IX9A 5HQ3A 1OFUA 1SHZA 3CTMA 5DNWA 3GZNB 3NB0A 1DXOA 3TQIA 3N6RA 2BI4A 1AHHA 1UPFA 4JITA 4KIGA 4UBJA 4YT2A 3ZJUA 3T3MB 4DRYA 1OILA 3SHVA 4BVGA 2EP5A 3DE3X 2W7TA 2X1MA 3ICPA 3M8KA 4QX6A 3OI7A 1ZJ6A 5HQ3B 4JZKA 4A15A 2KE5A 3NJ4A 4MNTA 5IYZB 4OHYA 2W6ID 1VLLA 4PYKA 4HEJA 3GJQA 1WDWB 1QJ4A 1J99A 2OV8A 3GVXA 1TQ8A 2CZCA 3PGXA 4NS4A 1NJ2A 3K9BA 4HWGA 4RH1A 3ZI0A 1W48A 3U3XA 2NVBA 3ZH9B 2ZBPA 1H2YA 4DUYB 5JATA 1N36B 1SCBA 4CVNA 1OTYA 5EMNA 1QYCA 3BBLA 1O2DA 4DMHA 2A9OA 1ZD9A 5K6RA 3F9IA 2BHSA 1FFAA 3ER8A 2ZYWX 4G8DA 2K2WA 4MP6A 1WVIA 2MSCB 2QD3A 3W3AA 4U3JA 3ZIAA 3TUIC 2FG6C 4LHVA 4C7BA 3EGOA 4IMPA 1L7QA 1RJ9B 2A59A 4G1FA 4PZEA 4K8RB 1M2JA 3VKFA 1E5QA 4KV7A 1Z5WA 1COWA 4U3JB 5LNK1 3N2LA 5H82A 4B4VA 2J0EA 3CVJA 5K4AA 2JFGA 3V2HA 5HWSA 2AKAB 4H1TA 2ZAOA 4YP7A 3VV3A 4Y2UA 5FPHA 1NW8A 4XVHA 4IM7A 1NF3A 3HB5X 2X0EA 4AUMA 1AQIA 5ERXA 2PKXA 1GN9A 2WNSA 5JS6A 3BXXA 3RSOA 3LFHA 4G5QA 2AJLI 3EN0A 2ZIGA 3ENWA 5BURA 2Q2OA 1OFUX 1I2BA 2Z56A 1QIKA 3FBTA 5DTRA 5ILQA 4X3OA 2WAOA 5I8PA 1ZOLA 2VC2B 3OFKA 4YJGB 2ZUCA 3GDOA 1IMJA 2B4TO 1YR7A 4HGRA 3CC8A 2GETA 1U7UA 1G0NA 3C1TA 3DTYA 3EYWA 4FFOA 4TROA 1B0UA 3PFNA 2HJ9A 2Z5VA 2PMEA 4BX9A 4IXTA 4A23A 4QLBA 1IN1A 3Q5EA 4JY7A 3GUYA 3W9YA 1DBPA 3COWA 2FMUA 4FBGA 1Z5NA 1H5QA 4KLNA 2VA9A 2YZ2A 1N9ZA 3WGIA 5J2TA 1VBKA 3A28A 4LRXA 5GY7A 3RV4A 4RVFA 3STVA 4K0RA 5H83A 1WE2A 3A3NA 4I08A 1WA5A 1FVXA 3H9EO 2X5NA 3ENKA 3IELA 3MCUA 5EUCA 3FUUA 4EW1A 1MXFA 1OHHD 4B6RA 1X6VA 2MSWA 4NEHB 3W04A 5J2TB 1Q3HA 4EK9A 1Z4MA 3ADCA 3E70C 5CH5A 5TQVA 3BYZA 3WL5A 3T5MA 2CV0A 1YV9A 3BJIC 1I4WA 1NP6A 2YIVX 4PCLA 3V8PA 4E6EA 3CNEA 1PKXA 1TAGA 5K4HA 2HPAA 1QHYA 2IHVA 3JZFA 5G1OA 1QANA 4YP1A 2O57A 3CF6R 3IEKA 4GR9A 1Z6YA 4YRBA 1CJKC 5IPFA 5KKAA 4ARSA 3L7OA 5JRJA 4LHEA 3TAHA 5FJJA 2AI2A 5F3RA 3RS0A 1L4UA 4Y0VA 2F17A 1ZA1A 2BKLA 3HN6A 3IQHX 1V8DA 1JIKA 2I2XB 1MCZA 2KHZA 5AI6A 1J7JA 1DL5A 3BPSA 5AHRA 3V3TA 2QD1A 1HBJA 3DEYX 1BDMA 2R8OA 4YYEA 4ZI5A 1GPYA 4EY6A 1VKZA 3AJ8A 3SBDA 3CVVA 3NVKI 1PR4A 4K03A 4EB8A 2DGDA 2I62A 4G5GA 4P58A 5JCOC 3M70A 4GZ6A 1CEYA 1G9SA 1ODLA 4XWTA 1YVDA 2IVZA 3AZPA 3HCBA 4YMLA 5BNZA 1UQUA 5EMHA 3N5KA 3ZJ4A 2GBIA 3MBKA 3GAMA 4BYMA 2RB5A 1X3SA 4Z1OA 4KO8A 4AUEA 2WWRA 2V8BA 1OSNA 5K3EA 3F46A 2A14A 2WV7A 1A0OA 3KCNA 4DBVO 4DWWA 4C04A 3ANLA 3ZR4B 4EY8A 1TPYA 3D8BA 3TIGA 5B12A 3EGXB 2AI1A 1Z35A 1E1LA 3HMQA 2IH4A 2QV0A 4X8HA 3MA0A 2COEA 4KPUA 1XQ6A 1XT6A 1QH0A 2HLPA 2WILA 3WZLA 1QP8A 4RK0A 3CLKA 2NSJA 4OHVA 1TEXA 4KR3A 3RUHA 4M1KA 1D5CA 1KYZA 2ZUUA 1P2UA 3G02A 2DQZA 3B70A 3L7DA 5JS2A 4ZO7A 1TTQB 1XEXA 4CXMA 1CZNA 3CKKA 1ZH8A 1YUBA 3N2GA 1PYOA 3MCAA 4TLEA 4ZVLA 2K7FA 1QCYA 2R6CA 3WOVA 2CJWB 1XEXB 5IEJA 1VSQA 3N2GB 5J4HA 1ISFA 5CFPA 4UCXA 4RHYA 4WXEA 4XWOA 2R1VA 2PMWB 3BIOA 5I47A 3NIBA 3WHIA 3IA2A 1YR2A 2PX4A 4LRUA 4RTLA 3R7NA 5KSOA 1G5TA 1QH9A 2OAGA 2FH5B 2RG1A 1BGXT 2H1HA 5A0FA 4B3BA 4CCAA 2QRHA 2R1VB 3HEBA 4ZAFA 3IP9A 5E4YA 1YCFA 3FJYA 2PXXA 3TO5A 4EHKA 3PDWA 1QVZA 2FW0A 1M8FA 1FMJA 1DDGA 4MMYB 4H7KA 1MW8X 1LTQA 2GBFA 1IZ8A 5AVXA 5I7WA 1QAOA 2A4MA 2G7ZA 5FAXA 4OXYA 5LYJA 3WDKA 3ZZMA 1SVLA 4N39A