4K26A

4,4-dioxo-5,6-dihydro-[1,4,3]oxathiazines, a novel class of 11 -hsd1 inhibitors for the treatment of diabetes
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
265
structure length
265
Chain Sequence
b'EEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISGIINAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title 1,1-Dioxo-5,6-dihydro-[4,1,2]oxathiazines, a novel class of 11-HSD1 inhibitors for the treatment of diabetes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 101
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2013-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4k26A00
5TIIA 3N7UA 5DF1A 4BS9A 1GAEO 4GX2A 3GY0A 6ADHA 1VE9A 3B1JA 2X5OA 1XU9A 1D8AA 2X1HA 1PZHA 1R12A 3VOSA 4OOFA 1F12A 1LJ8A 1ZSNA 3QVSA 3NTRA 3GK3A 4Q3NA 1JA9A 5BQFA 2PH5A 1I3LA 3CEAA 3NKLA 4YJDA 4CM9A 3JYPA 5TC4A 2PD4A 3WG9A 1T25A 5I7EA 1JKFA 2CD9A 1ORRA 4UVGA 2QX7A 4XKJA 4HNGA 2NU7A 1UZNA 3TFQA 1Y5MA 4M87A 5AXAA 4GVXA 3PVZA 3DBHA 5TS3A 4CMKA 2Q50A 4M55A 5EQFA 4BNLA 4H15A 1W73A 1EQ2A 1HDGO 1ZO8A 2PY6A 2FMUA 4QFDA 2AQHA 3GA0A 4OXKA 1SOVA 2WE8A 4BNZA 3MJSA 1LLDA 3WWYA 5LC1A 5K6AC 3RUIA 4CMCA 5HS4A 1A27A 2VHYA 4MVJP 5FI3A 4WEQA 1NHWA 1YB1A 3GZNB 5F5LA 3RROA 3U0BA 4IDAA 4E2ZA 4E6PA 1KVSA 2J5RA 3M1AA 4L9RA 3GR6A 4CLXA 1Q7BA 1UUFA 1LSSA 1N1GA 3PTZA 1XA0A 3DC2A 4G2NA 2TMDA 1NTOA 1ISHA 2DVMA 2FR1A 3FR8A 3OMLA 4YR9A 3OQ1A 2NADA 5CDSA 3HNPA 4CM8A 1DRVA 2DC1A 2WYWA 4B4VA 3AY3A 4ZHSA 1EDZA 1RM4A 1HDXA 1SAYA 4R1UA 4XGNA 1W6UA 2VHVA 3QWBA 4BNXA 4BNIA 1HLDA 4J6FA 3JQ9A 3BHIA 4A03A 4UUOA 2BFPA 4IBOA 4JBGA 2Q45A 1HSZA 1YS4A 3LF2A 3GG2A 3PPIA 2VYND 4E5PA 4K6FA 4XZ3A 1WP4A 1B8UA 4BB6A 4BNMA 2O50A 5JDIC 5GY7A 5TJ9A 3CSDA 4CJXA 4H3VA 3PHIA 2R00C 3GRPA 4LK3A 5ITVA 3QLJA 5U1PA 4NK4A 4J7CA 4YVFA 2Q99A 4CM4A 2AXQA 1BGVA 5IF3A 1LRKA 4RPLA 3JTMA 1SB9A 5G0SA 5LCXA 1XKQA 2RAFA 1MLDA 1IZ0A 1GADO 3L4BC 4MVJG 4BO6A 2GD1O 2PTGA 1UZLA 3OHSX 2ZCUA 2OFPA 4LVCA 5B1YA 2HMSA 5L45A 5IN4A 3HSKA 1KS9A 3P2YA 1XGKA 5JNLA 5LDHA 3IL2A 2ZYGA 2B69A 1LDBA 3V8BA 1U7HA 4WLFA 2WYVA 4ZJUA 3Q3CA 1E7MA 4N7RA 4HBGA 3T7CA 4DUPA 3MJCA 3ONFA 3U4HA 1KEUA 1H9AA 3GZ4A 3VDRA 4PRKA 4GWGA 4G81A 3HHPA 1BDMA 3NGLA 4J1TA 2Y93A 3DR3A 3IDSA 4J7UA 1ULSA 1MC5A 2VNSA 4IZIA 3F46A 2AA3A 3AOGA 4MP3A 4KTVE 2YHIB 2DUWA 4RL6A 4L4SA 3ZNOA 4AJ1A 5L4NA 4E5KA 4CM8B 2FY8A 4YT8A 1EUCA 1C1XA 3NTOA 3ZWWA 1PWXA 4OSOA 1RWBA 1U4OA 4F3YA 2NQ8A 4UUMA 3GC6A 4W4TA 3A06A 5KKAA 4Z9XA 3SJ7A 4H7PA 5JMWA 5TJHA 1HE2A 4CMIA 1GUZA 1RYEA 4BMNA 3HE3A 2Y1EA 3PFWO 2WJPA 3OECA 4P8RA 2Q1UA 1KVRA 1Z7BA 3I4FA 2NVUB 1WMAA 4FJ1A 1R15A 3BTUA 3V5NA 8ADHA 3RUFA 4WNCA 2X58A 1PU2A 2QZZA 2W2KA 1P31A 2YHUA 4TSKA 3H3FA 4B3HA 3RBXA 3IIEA 4R16A 1GPDG 4O0LA 4IJKA 4XQ9A 1T2AA 1Q7CA 4ZA2A 4RLHA 4IS2A 1NQ5A 4ZD6A 1LC3A 3WFIA 1DFGA 5DOVA 1D4FA 3NT2A 4XB1A 3GPIA 4R1NA 4UVHA 3VPSA 3ITDA 4YRDA 2WWRA 3QIVA 1K3TA 1DLIA 3P19A 3I3OA 5A5EA 3IOYA 5ILOA 2Y0CA 3QY9A 4JIGA 4PN3A 1I3MA 1EVJA 3I5MA 3ZHYA 5IXYA 3GN2A 4YJFA 3MZ0A 1ADGA 4GWKA 1EVZA 1ZVMA 2HUNA 2DLDA 3DBRA 3RBVA 4AJIA 5FI5A 5KOIA 5JO9A 1ZXBA 3A14A 1BMDA 3D4PA 4O6VA 4AJ4A 1EDOA 4MVJA 1WZEA 4EJ0A 5G4LA 3G1UA 4EI2A 1E3LA 1GTMA 1BRMA 3SLGA 1J5PA 2EKQA 3GDGA 2P4QA 4DMLA 1JWAB 4FFOA 2YFHA 2RIRA 3PYMA 2O23A 4CUZA 2UUPA 3O38A 4U8GA 1ZZEA 3OJLA 2GF2A 3WWZA 3D7LA 4DL9A 1R66A 4K6CA 1G0OA 4CMAA 3S2GA 4EJMA 2VHXA 1ML3A 4IGEA 3X2FA 4CMIB 5IZCC 2W2LD 1DC4A 1N92A 4IDBA 3HDQA 3L6OO 4RPGA 5G4KA 3JYOA 4BHTA 2Q2VA 1CQIA 3QVXA 1E3JA 1DRUA 1M6WA 4TWRA 5JFOA 2HU2A 4R68A 4LISA 5CG1A 2P9CA 3KYDA 4KQXA 2W2KB 3VH4A 5L4LA 3GN1A 3EUWA 4E4YA 2E49A 4P4LA 4CLRA 4LMRA 1UJMA 4BV8A 3WJAA 3I4CA 4OKNA 3RKUA 3VZPA 1P0FA 1VL8A 1WWKA 4CR6A 1KYQA 1NX6A 1PR9A 4CM7A 3DOCA 1KEPA 1XR3A 3ANNA 3AM4A 3INRA 4BO9A 4QSMA 1E5QA 4LCEA 3CZRA 1J49A 4UUPA 1ZW1A 3WGIA 1Y8QA 1DXYA 1BSVA 1FDUA 3H2SA 1YONA 1NVTA 4RVSA 1R4NA 3HB5X 3S8MA 1Y9EA 1YGYA 1C1DA 4EZBA 4IMPA 3H4VA 3D5QA 3EZLA 3DMTA 1NPDA 3AWDA 4XQEA 3CH6A 4EEZA 4J43A 3DQPA 3OFSA 1T2DA 3DBRB 1IULA 1ZUD1 1JWBB 2NTNA 3U62A 3CZMA 3PXXA 1M76A 4WEOA 4WECA 4IXTA 4S3MA 4P22A 1Q0QA 3WLEA 3OP4A 3EY4A 4ND5A 2IZ0A 2V6BA 4RGBA 4OO3A 1L7EA 1OC2A 3E5RA 4QTZA 1PS0A 1ZMOA 4Q3AA 2AMFA 1TVEA 4UEKA 1A4UA 2JKVA 2UYYA 3JD3A 3RAJA 2VWQA 3RBZA 3TOZA 1WVGA 5T8KA 3VC7A 4QFCA 3Q9UA 4FPXA 3H9UA 4AVYA 4GGOA 4S1VA 4E5YA 2QRLA 4AJLA 1TT5A 2EP5A 2DBQA 5CPBA 3LQFA 1GQ2A 1O0SA 1DC5A 1ZFNA 3E6AA 3JQGB 1CIVA 3WYCA 4FR5A 1ZEMA 2CVOA 4FD3A 2XF8A 4OXYA 4UVEA 4NMHA 3ZWNA 3FI9A 2X5JO 1K5HA 5CEFA 4BO8A 2VZ0A 4ZU3A 4BGVA 4J4BA 5A03A 1FDSA 3EYWA 4CLRB 3I9NA 3TOXA 1YDEA 5JC8A 2PZLA 4LN1A 4JCOA 2BMAA 4NK5A 3FNEA 3GVXA 2I67A 3VH2A 3WSWA 4YT4A 3BA1A 1PQPA 3ON5A 4CM9D 4GH5A 1UP4A 1ZJYA 2PA3A 1BG6A 4B79A 3BMCA 2D2IA 1XSEA 2VYNA 3AK4A 4PGFA 3VZRA 1E0DA 4YAIA 4XRGA 4RF4A 4BO7A 2GYYA 2E48A 4Y9DA 4AJPA 1Y8QB 4XA8A 2GO1A 1EK6A 3BZUA 1DIRA 4FN4A 1UP7A 3INGA 1TEHA 1QYXA 2Z1NA 4PZEA 1C1DB 4NJMB 3RVDA 5THQA 2C7GA 3GRKA 5ITWA 1EQUA 5HWSA 2PR2A 1H6CA 3PLNA 1TXGA 4XYEA 3WGZA 1VI2A 2P68A 1A5ZA 2CVZA 4MVJI 2HJSA 3BMQA 4URFA 3NDIA 1E5LA 1B14A 1CJCA 2FSSA 1QYVA 2A94A 2I6TA 3VTFA 3A1NA 1SNYA 2YV1A 3KZVA 4PLYA 5FWNA 3HDHA 2DUUA 4WOKA 3PGXA 1X1TA 3PJFA 3D5TA 5JO0A 3B70A 1VC2A 2WMDA 3OIDA 3RIHA 5C37A 2FP4A 3JYLA 4MINA 2ZJ0A 1LX6A 3K96A 1I01A 2DBRA 3NT4A 4K1LA 4RPKA 5C3MA 5JY1A 5FFFA 4NU6A 1Y8RA 1E77A 5THKA 2J3HA 4F6LA 4M54A 1YWGO 4Y67A 5BNIA 1B26A 1O95A 1EK5A 3FD8A 3GFBA 1UAYA 4E13A 1E1MA 1A9ZA 2NACA 2GERA 2UV8A 4RQTA 2JD1A 3WQRA 4ZVVA 5IFLA 1U1IA 1Y1PA 2VN8A 4FOOA 3RI3A 4HFMA 2PZKA 4JNKA 3AFMA 4DBZA 5H81A 3TFOA 5TRTA 1A72A 2IE0A 3GEMA 4OYRA 3QJ5A 2NVWA 3F47A 1AHIA 2O2SA 2Y0DA 3Q11A 1HKUA 1XU7A 1B16A 2W4QA 5TSDA 4WOJA 1M67A 3VPXA 4IDFA 1YB5A 3EHEA 4MDHA 1IUKA 4IJVA 3BMCB 4CQLB 5EESA 4QQRA 4Z6KA 2VHWA 2W98A 3NRCA 5KVQA 3WTCA 4BO1A 2QZ9A 5L4SA 1RYDA 5KNLA 2B4TO 5A04A 4ZQGA 4OJNA 4U6QA 3TDKA 5G0WA 3TZCA 4EEXA 3GMSA 3L77A 2Y66A 3WQQA 1R0KA 1MG0A 5L9AA 1QP8A 2O4CA 1Z45A 2I3AA 3ZHZA 3IJPA 3C85A 4LMPA 3VH3A 3H5AA 4CM3A 1GQQA 3QQPA 4FFPA 4DBVO 5F1OA 3BXXA 3QA9A 2Y05A 4IIVA 3JQBC 3EGOA 5A9TA 4AJ2A 1UXJA 5JCXA 4XX0A 3JQDA 2D3TA 2ILTA 3LSYA 1GV0A 3ANLA 3IP1A 2J3JA 4WGGA 1ZK4A 3ZU5A 3DZKA 4A7PA 1U7TA 4K26A 5DP1A 1CRWG 4M8SA 5IXSA 1I24A 3O9ZA 4RVDA 4I5GA 1I3KA 2YV2A 3RUHA 3HZZA 4X54A 4ZQEA 5JC1A 1U28A 1Z7EA 2XOXA 3GF4A 5DCUA 4RF3A 5FF9A 2P5YA 1ZIDA 5KIAA 4WE3A 3RUAA 3UW3A 1WZIA 3ZV4A 3DBLA 5CP8A 2AQ8A 5I8WA 1EZ4A 3WB9A 4WCFC 1XG5A 2X86A 2C29D 3T4EA 5ENDA 3ZU4A 2BGMA 1V0JA 4U0JA 3I52A 3NDRA 4RDHA 5JAQA 4AJNA 5L95A 1NNUA 2C59A 3NX4A 2O3TA 5A05A 2OBNA 1KVQA 1NVGA 1Y81A 3I9MA 4J2OA 4M49A 1ZCJA 1UXKA 3UXYA 2I9PA 1GPJA 3GEDA 3NEPX 2E37A 1B8VA 3BYZA 1EFKA 1P1IA 2DFDA 4FGWA 4FSHA 3SEFA 3QVOA 1E7QA 3QVTA 4JP2A 3F5QA 4GL4A 2DFVA 4JLWA 4ALJA 1HDRA 2A4KA 3LC7O 5I7VA 3OM9A 1P1KA 3R6DA 5A1TA 1RPNA 4YBZA 3ZV6A 3F3SA 1CYDA 3FNGA 3QSGA 4BO3A 1P33A 3WFJA 1H9BA 3S2EA 4JBHA 4CMEC 5ES3A 1MA0A 3MWDB 4YJGB 3KYCB 1N8KA 2BFMA 1O5IA 4BNYA 4ALKA 4YT2A 1YBVA 3H65A 1KY4A 2JAHA 1ZKMA 4DGSA 4BKPA 5GMOA 1HL3A 4FFMA 3E9MA 4BNNA 1E7RA 3GOHA 4LVUA 1E1LA 1JVSA 3D4OA 4G5HA 4J1SA 4N5NA 1VJ0A 3LDHA 3MTJA 3PQEA 2VTDA 1QV7A 5DZSA 4M89A 4IGFA 4XR9A 5A9RA 5CAEA 4J2HA 3FR7A 3U09A 4N18A 1WMBA 3TJRA 3VHRA 1WXDA 2NU6A 4RVHA 1QXSA 2BI7A 5EN4A 1GYQA 3UH1A 3ZHBA 4CPDA 4I5EA 4MIOA 4P4GA 5A3JA 2EV9A 2ZJ1A 1KC1A 2P9GA 3GZNA 4QEDA 2Q1SA 4NDNE 1K2WA 2CUKA 3BHMA 2ZCVA 4DC0A 2EW2A 3ICCA 5AXCA 1YQGA 3JQCA 1P1RA 3C1OA 1P77A 3GAZA 1GEGA 3ADOA 2OBYA 2C20A 5MGBA 2BFOA 2DTXA 4PVDA 2HLPA 4FBGA 3WGHA 2AEFA 4Y6RA 3LLSA 4U7WA 1I5RA 4W9NC 4QT0A 2C82A 2NSDA 3V2UA 4DYDA 2EW8A 4CUKA 3JQFC 3LC2O 3GDFA 5JXWA 5AVOA 5CHEA 1NVMB 3HB4X 3WNVA 4IQ8A 4A27A 2JCVA 2EJVA 2DTEA 1NYTA 2QHXA 5IN5A 3TPCA 2X9VA 4D45A 3LT4A 2X8LA 1MFZA 4IDEA 3BHJA 4Z9YA 1LDEA 2IEBA 3UN1A 1PTJA 4MKRA 3ENKA 3KTDA 4E31A 2V65A 1NHGA 3JQAB 2QQ5A 5DDIP 1DFIA 2CF6A 3WOHA 4GMGA 4YAGA 1ARZA 1AUPA 4I08A 2Q1TA 1SZJG 3HWRA 4PLFA 4MJLA 3IKTA 3INTA 3KBOA 4CMJA 1QYDA 5I9NA 5KKCA 5JDCA 2BGKA 4CL3A 1DAOA 3PIIA 1H2BA 5DCWA 5AQ1A 3JQ8B 5F5NA 2G82A 3HJAA 5EIOA 3L6EA 2JCXA 3KXDA 3RU9A 2DKNA 1ISJA 3KO8A 3KOUA 3ZWBA 2H9IA 1GZ3A 3E03A 4LW8A 2GN6A 3H5NA 5FYDA 1WPQA 4EDFA 5JDIA 1MFPA 2D1YA 2PGDA 1LTHR 4FQ8A 4CM1A 3HQ4O 2R00A 2GN8A 5A9SB 4BGUA 1KVUA 4N54A 2D59A 2UUOA 4EUFA 4MVJH 4JJGA 2YHIA 1ZK1A 3GGPA 4AJOA 2VNAA 5G2OA 3NGXA 5B12A 2YY7A 3I83A 3I1JA 3L4BA 1PJQA 1SBYA 2VUSA 5I9LA 4GSLA 1DB3A 2C0CA 1BW9B 1SEVA 1DEHA 3EAGA 3GFGA 3K92A 1V9LA 3M6IA 3ZZNA 1K6IA 4WUVA 4HV4A 4DQXA 3H7AA 3FNFA 3RSHA 1PEDA 4DC1A 2Z5LA 1LBEA 2GZ1A 3OJFA 3ZCXA 5KWEA 3JQ7B 3MTGA 3H9JA 2NVUA 1DRWA 3PFFA 1T4BA 1PZEA 3ZW9A 1K89A 2JD0A 3PDJA 2ET6A 1HDZA 3P7MA 3PHLA 4LGVA 4E32A 4TKMA 2YDYA 2NWQA 3C24A 4XQCA 3VKVA 3KV3O 1UXHA 1FMCA 4LSMA 1F17A 1GCOA 2OP0A 3OJOA 1DOHA 2P9EA 1ZH8A 1YBAA 5BNTA 4XYLA 1E6EA 2I5PO 2IDZA 4ALLA 1KY5A 2GZ2A 3WGTA 3WTBA 3EVTA 3EK2A 3IP3A 2DPHA 2EF1A 2XXBA 3ROKA 1OI7A 1EBUA 1E3WA 3ZWCA 4MVJF 4YAEA 3NUGA 4BQPA 4DQUA 4IJWA 4HNHA 3K2BA 1YL6A 5DBGA 3D1LA 3VDQA 4BKOA 2ZB8A 2GN9A 4KDFA 3LC1O 1LSOA 3GGGA 3I9LA 4NHEA 4J7XA 5L3ZA 1JU9A 2BHLA 4ZRMA 2H63A 1FF9A 1ADFA 5DBIA 2FHSA 3ENNA 2G1UA 1X7HA 3GUYA 1M75A 5JYEA 3MJTA 3WNQA 1V8BA 1DO8A 3VKUA 3I6QA 2Z95A 5AOVA 4QO7A 1UDAA 1CETA 3BTVA 1WAMA 3VAZA 4PIVA 4DPLA 4PLGA 3RQSA 3V2GA 4RF2A 3DHEA 3KSZO 3WDSA 4KDEA 4U6SA 1UAGA 3KB6A 4XWYA 1NQAO 4XDYA 2Y1FA 2OUIA 4BGEA 2H5LA 5MDHA 4ONEA 2TMGA 3GVIA 1IYZA 3C3XA 3DXFA 4HFRA 4PFJA 2CNBA 3DAGA 4D0RA 2EEZA 4D46A 4E3ZA 1F14A 5TNXA 4ZQFA 5DBFA 3A28A 1C0IA 8LDHA 1EEHA 5KVVA 2BF7A 2IRWA 3D64A 2C5EA 4MKXA 3NJ4A 3I9KA 3P2OA 3AUAA 2G0TA 4DYVA 1EE2A 3W8FA 4D7AA 4BO2A 2PGLA 3E5MA 2HKIA 3F4BA 1JKJA 3JQEA 4CV1A 1P0CA 4JROA 4LRTB 4KQWA 1Q1NA 4MIYA 3ZNPA 1XCBA 4WASA 3UCEA 2WTBA 3RFVA 1K0UA 1U3UA 2BRUA 3NT5A 3W4KA 2QW8A 5A4DA 4XB2A 1E3WB 1GFSA 1SCUA 3K30A 4I1IA 4IDCA 4OM8A 2OOSA 3ABIA 4GX5A 4NIMA 4BNHA 3G1TA 1IPEA 2O4UX 3OJ0A 1D7OA 2X0IA 3DWFA 5I9MA 2CDBA 1VPDA 1DAPA 3JD0A 2Y99A 1YDWA 3DEYX 2OP1A 4HP8A 2D5CA 2WE7A 3RASA 3ETGA 4IINA 3GNTA 4ZQHA 3U4CA 4AL4A 4TMFA 2X4GA 1I32A 3FHLA 2DTDA 1A4IA 2FOIA 3Q9NA 4KUHA 3OA0A 4UVDA 3EMKA 1R6DA 3AJRA 4XRRA 1ZMTA 1RJWA 1NWCA 3O03A 3ZN2A 3W6UA 4B4OA 4DLBA 1HRDA 1ULUA 4C7JA 1R0LA 1UP6A 1FDWA 4PG5A 1PQUA 5JSFA 5KVCA 1DFHA 2VCYA 5JPIA 5KJ1A 5DULA 4WLEA 1I10A 2B4RO 3LK7A 3DHYA 1GU7A 4HXYA 1LA2A 4IDGA 2VWGA 4XGIA 3JQGA 1BVUA 4FW8A 1ONOA 4OL9A 1ZK2A 3ST7A 1P44A 1K6JA 1GYRA 2VT3A 1XIVA 1QLHA 1XWFA 3N58A 1GDHA 3O26A 2EHDA 5BNFA 5KJEA 2OORA 2Y68A 1VM6A 1PJBA 2X6TA 3ZV3A 4FJ0A 3WYBA 4AJKA 3ITKA 3IUSA 3RD5A 3FRJA 2WD8A 4BNGA 1YB4A 4XYMA 3WIDA 2I99A 3AW9A 1R16A 4JN6B 9LDBA 2WD7B 2E82A 4C7KA 4XEHA 2NNLD 4QO8A 4RVUA 3GPDG 3KUXA 2I3GA 1LNQA 3QHAA 4GKVA 5ICSA 3JQAD 4N5MA 2JL1A 5F1PA 4UAGA 1PWZA 4NJMA 4GVLA 5KJ6A 3ETDA 1IPFA 1NBOA 3OEWA 1E1NA 2NQTA 5FEUA 2YQ5A 1B3RA 3C8MA 1A7AA 4J3FA 4RVFA 1T1SA 3W8EA 1LQTA 3H3JA 4R3WA 4DMMA 5G0UA 3HN7A 4NI5A 3QWIA 4KMSA 3VTZA 1GR0A 3CMCO 2PLAA 3CXRA 3ZU2A 4YEDA 1KC3A 3KEOA 1Q7GA 3K6JA 2HQ1A 1V3VA 4DRYA 4KWHA 3H9GA 4E2WA 4F46A 4XCVA 1BTOA 4DVJA 4IJUA 4DLLA 1SB8A 1IHYA 2AEMA 1GCUA 2GSDA 1EFLA 3ZGYA 3CE6A 3IQDB 3KSDO 1KEWA 3QP9A 1BDBA 4N5LA 4DIOA 4W82A 1GQYA 1PIWA 1S6YA 3MWEB 4CODB 4YWJA 2VTEA 1I0ZA 2OHXA 4TQGA 1TI7A 2FR8A 2P2SA 4I5DA 3IS3A 2V7PA 4CMHA 4GKBA 3GT0A 3WR5A 1B8PA 1NQOA 2NTVA 1B3BA 5EQDA 3T7EA 3H5RA 3DHNA 3L4SO 1Q0HA 1WLYA 3PEFA 1HDCA 2O2YA 5JYDA 1JN0A 3WYEA 2FN7A 3NAQA 4QUKA 1I33A 2AQIA 4YPOA 2HRZA 1NP3A 3TWOA 4A26A 5TGDA 3GVPA 5CEJA 2NU8A 2NM0A 4CQLA 3DFUA 1DSSG 4EGFA 2J6IA 4O5OA 5L7TA 2BKAA 1XEAA 4J49A 5EPOA 3WGYA 1H94A 3I23A 4XIJA 1LSJA 3DONA 1PJCA 3F1KA 4Z3DA 4EUEA 1ENOA 1UDCA 4J91A 1ZK0A 2ZTLA 4HUJA 3B1FA 1LSUA 2X22A 3ZDFA 4UVIA 4B4UA 2X7HA 4GLOA 3LU1A 4IIUA 4MP6A 3ZW8A 1GD1O 4O59O 3WIEA 1QR6A 1V35A 3ZNQA 2P4HX 4PLVA 5L40A 4ESOA 3JD1A 4CMBA 2B35A 3R3JA 3DZGA 4UEJA 1BVRA 4OH1A 2C5AA 1VSVA 1PGPA 1QLJA 1YQXA 2ZK7A 2VZ8A 4NBRA 5T8KC 1N5DA 2HK7A 2YJZA 3TL2A 1GUFA 4NFYA 1CEQA 4E2YA 4E5MA 1PR3A 1ZBQA 1IY8A 2NVBA 2BI8A 1Z6ZA 3EW7A 4DREA 2O3JA 3ZWMA 2SCUA 4YRBA 3VPHA 3E8XA 3R0IA 1WDMA 1HE4A 5IZ4A 5IJZA 2CDAA 4FJ2A 2J3KA 4UUNA 1Z82A 4CLDA 1ADBA 2HMTA 3G17A 4L4XA 5F1KA 3UCXA 4OQYA 2ZATA 3ONDA 1SOWA 1U3TA 2HK8A 2V6FA 1W0CA 4GGPA 4HX5A 1D3AA 1TA4A 1Q2XA 2J8ZA 2NU9A 4O1MA 4U0KA 2EXXA 4JJFA 1QSGA 1XQ6A 2OMEA 4PLZA 4A0SA 1Q0LA 1PL7A 2BGLA 4GSKA 3ADPA 2RHCA 2RBEA 1KBZA 1KEVA 1DIHA 2X23A 3SX2A 2GCGA 2E6UX 1E7SA 2GRAA 5KTKA 1YOVB 1LDMA 3PGJA 1M6HA 4OMUA 4Z0PA 4BO4A 2B0JA 5HM8A 3WGQA 1LXCA 3LVFO 4FS3A 2DAPA 3UCFA 1PGJA 3PRJA 1DIAA 2VT2A 1U8FO 2PV7A 1YBMA 2PZJA 3OBBA 4TVBA 5COAA 3L9XA 4CLOB 2IYOA 2HMVA 3ZWVA 2G76A 2JFFA 4D44A 1HDYA 3AU8A 1D1TA 4LRSB 5DNAA 3ZWAA 3UVEA 4FFLA 2JFHA 5BT9A 4CQMA 3S1LA 1DDOA 4HY3A 1LDYA 3BMOA 3HFGA 1H5QA 4Q3DA 4RCVA 2CY0A 2FPPA 4TROA 4CR7A 4Y98A 3CPSA 4YQYA 5TLSA 1AN9A 1IL0A 1N7HA 1N9GB 3U9LA 4WCFA 4YJGA 3KYCA 1I2ZA 5TX7A 5IAAA 2HJRA 5TT1A 1HZZA 4R41A 5JE8A 2QYSA 3NDJA 5B37A 2YV3A 1YVEI 3N74A 4BIIA 3HG7A 1CF2O 2Y1OA 2ZTMA 3DZJA 1CERA 1PX0A 2EIHA 2IODA 4TVOA 1O9BA 5IDWA 3PZBA 1DJNA 3PHHA 1X0VA 2B83A 1GV1A 2RH8A 3GUCA 4OXNA 1DC6A 1BXGA 2FPIA 2VOJA 1AGNA 4NPCA 5HTOA 5T6BA 1NPYA 3LT1A 3ZWYA 4OQZA 3RC1A 2VRBA 2RH4A 2DT5A 3NTQA 3RKRA 2I76A 1U3VA 3HN2A 3Q2IA 4Z0HO 1U2DA 4HWKA 4CLHA 3AI1A 3E82A 3HDJA 3H8VA 3LF1A 2DM6A 3D3WB 3PQFA 2VOEA 1HSOA 5HRUA 1PZGA 3F6YA 3MOIA 4GBJA 4INAA 3BTSA 4D79A 1H6DA 3F1LA 1PGNA 4II3A 4FGSA 4PG8A 3I9OA 2JJYA 4EYEA 3JV7A 2EGGA 4R1SA 1QMGA 1HYHA 4RQUA 2VRCA 3GMDA 4RVGA 1QG6A 4J9UE 4EJ6A 2EWMA 2A35A 2X0RA 2QIOA 4L73A 2VUTA 4OSPA 1OOEA 4YXFA 3GHYA 1QKIA 2UDPA 3PIDA 4BUCA 3G79A 3R3SA 4CM6A 3L07A 4CQMB 2H6EA 3BMOB 2JHGA 3FTPA 5DT9A 1Z74A 3NYWA 4J0FA 1NASA 4E2XA 3OIGA 2FR0A 3AOEA 5JLAA 2X9GA 4WCFB 1LC0A 5B4TA 3I6IA 5IDYA 3VPFA 1HETA 3AY6A 4R69A 1SO8A 4FCCA 1R4MA 3VVCA 3TZ6A 5BR7A 3C1AA 5HS6A 1T4DA 3W1VA 3WBBA 3DMYA 3RUCA 4G65A 3JQAA 1VL6A 3UUWA 1B2LA 4OIMA 4RPHA 2XAAA 3CKYA 1I2BA 5TF4A 5I7FA 3H6KA 4CLEA 2O7SA 2IXBA 4J9VA 4RJTA 4II2A 3AM3A 5U4QA 1BXGB 4ITUA 1LLCA 3FBGA 4XD2A 1IB6A 4W9NA 3JQ8A 2BLLA 4D0SA 1NPTO 3JQFA 3AU9A 2C2XA 5COQA 1F0YA 4PLTA 4Z3KA 4ALIA 4KUEA 4GX1A 3UAGA 1V6AA 4BNWA 5T67A 4BL5A 1QV6A 1ISMA 3TRIA 5A9SA 1C3VA 1VL0A 1YJQA 1HYGA 5CEEA 4OHUA 5DN9A 4GX0A 4A5OA 1PZFA 1I2CA 3UFXA 4DXHA 4EBFA 3FSRA 1X0XA 3U4IA 1C14A 4KTTE 4DIBA 1ENYA 4F6CA 4YRAA 1F8GA 1YRLA 4XQGA 5C7IO 3E48A 1JAYA 1BW9A 3PHGA 5IDQA 3I9JA 5H82A 3SBOA 1E1KA 1O89A 4HFNA 4ZRNA 4K9DA 1GL3A 5K6AA 4PG6A 1HF3A 2BFAA 3AI2A 3PWZA 5L53A 1ZK3A 4AICA 3JD2A 4Y6SA 3JQ7A 1ZJZA 1PJLA 4NU5A 3S2FA 3CUKA 4Z9FA 1C0LA 3LZ6A 4JGBA 1YXMA 1A7KA 1J0XO 1PL6A 3RC7A 2IEDA 2O3UA 4AJHA 1HE3A 2Q49A 4PLCA 2PD6A 2ZB4A 1R4MB 3RFXA 1V3UA 4BV9A 2FZEA 4W7HA 5EL0A 4AG3A 3T4XA 1OBFO 3VZQA 2NTJA 5JAZA 4KWIA 2ZTUA 4Q3BA 1PGOA 3QV1A 4CM5A 1HEUA 2OL4A 3M2TA 3E18A 4DPMA 3U5TA 5JBIA 1LRLA 5C5IA 1WDLA 2G5CA 1P3DA 4ZN6A 3GDOA 1JW9B 4Z0TA 4ID9A 1M66A 3GVHA 3LYLA 4NFSA 2YFQA 1XLTA 1Z73A 4RF5A 5LDGA 3TF5A 4NH4A 3DTTA 1DBVO 4IDDA 4YAKA 2AE1A 1PS9A 3KLPX 2AW5A 2RHRA 4L4RA 4PLHA 5DCYA 4CV0A 4D3FA 2LDBA 5HBRA 4D41A 2H1SA 4U5QA 2UAGA 1PJ2A 5A06A 2GNAA 1RKXA 3X2EA 3FWZA 5CDGA 3DZHA 1MG5A 4IM7A 3H9QA 3UHAA 1UXIA 2CSUA 3G49A 1QRRA 1RM3A 2X5KO 3SXPA 1MXHA 5EMHA 3UOGA 3EC7A 1O8CA 2EP7A 1QYWA 3CMMA 3G0OA 1X7GA 2HDHA 4BKUA 4L8VA 3P5SA 4R4JA 1LQUA 3K5PA 4E30A 3DO5A 3ETEA 1VLLA 3DAPA 1BWSA 3FWNA 5DOZA 5BSEA 3PWKA 3K9QO 4ND4A 2GASA 4NFHA 1NXQA 1E3EA 1T2CA 2QYTA 4PZDA 3V2HA 2EERA 1LUAA 4NR0A 1PGQA 3W4JA 9LDTA 3BAZA 3S2IA 3AUUA 1X14A 1P45A 3TZHA 5C7OO 1GYPA 1ZSVA 4RV9A 1VKNA 1OMOA 2EKLA 1AXGA 1C0PA 1HE5A 1PJTA 1PS8A 3V1TC 3L9WA 5JDCC 1X7DA 4GMFA 3IAHA 2B5VA 2NUAA 5AXBA 3GGOA 4BO0A 4JBIA 4W99A 2O7QA 1NR7A 1MB4A 3C7DB 5KCZA 2O3RA 5T57A 4E12A 2CFCA 2BELA 1AE1A 3KLMX 1BXKA 5CFZA 3DZBA 3Q0EA 2G17A 2GPTA 3W6ZA 3TL3A 4DPKA 3IKVA 2VYVA 5B4UA 2ZQZA 1EUZA 3RJ5A 3U49A 2GLXA 1H2HA 2JD2A 4FDAA 1FK8A 3DBHB 3RUEA 2Q3EA 2O3QA 1EVYA 2B4QA 2RCYA 2PFGA 4WLUA 2DBVO 1T26A 5JCJA 3DFZA 1ISIA 2B5WA 2Q2WA 4M1QA 2FSVA 2QRKA 4R54A 4TRRA 1BHSA 5BSGA 4Y8VA 1E7WA 1T1RA 2PKQO 4C4OA 1I36A 2JCYA 5U9CA 4YT5A 3TZKA 1NQTA 1CWUA 5B4VA 1P1JA 2W8ZA 3JQ9C 1FXSA 3GNSA 3GLQA 3A4VA 4WLVA 4JQCA 3DOOA 1MGOA 4PG4A 3FTNA 4CR8A 1KVTA 1LRJA 3FBTA 3PYLA 1JDJA 3RCBA 1U4SA 2GR9A 4YDRA 4ND2A 3MJEA 3D0OA 4PLPA 3OA2A 1HTBA 3PK0A 1HXHA 2YDXA 5J23A 2BD0A 4F45A 4UULA 5EJ2A 1R37A 1X1EA 4YACA 3PI7A 4ILKA 4ZICA 2PGJA 1ZXLA 4IQ0A 2B36A 3RC9A 3KRTA 4XJSA 2C07A 4I9UA 1W8DA 3WMWA 5K0ZA 3OH8A 5H83A 1B15A 3GVCA 2PZMA 3S55A 4BNJA 4B3JA 3E9NA 1PJ4A 4CQMD 1U9JA 5BSFA 1M2WA 4RPJA 1DHTA 4YJHA 2D5AA 1F06A 1P1FA 4J1QA 5JAMA 5JW6A 1E92A 3DZIA 4OKIA 4OGWA 4TZTA 2HAEA 3PQDA 2DPGA 3ROMA 1DPGA 1NWHA 2HMUA 4A2CA 4DQVA 4RZIA 5IDXA 1NFQA 2FWMX 3PYXA 3QWHA 2HRBA 1NM5A 5IZCA 2WD7A 1GY8A 3WBFA 4D3SA 5IG2A 3EVNA 3O4RA 1X15A 4WNIA 4XYBA 5DP2A 5JS6A 4CM4B 4AJEA 1DIGA 3QWFA 3OF2A 4B7CA 1R0SA 4B7UA 4A10A 3FPCA 3STHA 1T2EA 4L76A 5T5QA 5JY6A 2WYUA 2C7VA 4PG7A 2GDZA 1VJTA 1V3TA 3EZYA 1IE3A 3U4DA 1TB4A 3WGGA 4PRLA 2AG5A 5TT0A 2XPCA 5CG2A 2YZ7A 4BQRA 1U8XX 2AQKA 2BH9A 1E3IA 1JTVA 4KUGA 2Q46A 1QORA 4R51A 4BNKA 1N2SA 4FOSA 3W4IA 2A9FA 1XYGA 3AI3A 3NJ8A 1G6KA 3RC2A 3OQ6A 2ZTVA 4B3IA 1YH3A 1YL7A 5L51A 1SPXA 2V6MA 2HMWA 1LU9A 1D1SA 4GQAA 2IZZA 5F21A 2ZB7A 3DZFA 4DTIA 4W6ZA 2AHRA 1XHLA 5TQVA 1P1HA 4IMRA 5G0VA 4QX6A 1KERA 1FDTA 3ORFA 4MKZA 1I8TA 2VRCD 3V1YA 3ZWPA 3F9IA 3K8ZA 4ND1A 1C1XB 3ZHXA 1GEEA 2VHZA 1VKOA 4P4NA 3QVWA 3RFTA 1NR1A 4WLNA 5CPFA 4BNFA 1QYCA 4P38A 4TZKA 3MJVA 4TRNA 3LLVA 3OSUA 1FDVA 2J5KA 2F00A 1YO6A 4GAEA 2OO5A 4YJHB 3VH1A 3PZRA 2Q4EA 4MOWA 5BSHA 3PJDA 3SVTA 4MP8A 3RU7A 2D0IA 4RDIA 3ZV5A 1HWYA 4R1TA 3SC6A 1JLLA 4B7XA 4IZHA 2YQ4A 3PJEA 3UGKA 4WKGA 5ICMA 2R6JA 1NFRA 3GEGA 3UF0A 5I7SA 2PK3A 1LLUA 1OFGA 1Y9AA 4BMSA 4PCVA 3F5SA 3CTMA 3B1KA 3FPLA 5EERA 4EITA 2I66A 2W90A 1MXFA 1VRWA 3WX0A 3ZH2A 1ISFA 4UEOA 2IXAA 1U2GA 5ADHA 4WJZA 2POQX 4BMVA 1ZEJA 4BB5A 2P91A 4CUJA 4FB5A 3COSA 3ASUA 3BMNA 2OZPA 2WM3A 4BNVA 2PH3A 4JXKA 1P74A 1S7CA 1UDBA 3ICPA 4YJFB 4KOAA 4YA6A 2D8AA 3WXBA 4EW6A 4YB8A 2OGUA 5ILGA 1P9LA 1U5AA 3ASVA 4EUHA 4D3DA 2LDXA 4DIFA 5L7YA 1K6XA 1RM0A 2EGHA 4MIEA 4I9HA 1LEHA 2FZWA 2NLOA 2CDCA 4YAJA 1T2FA 1H6BA 4WK6A 3Q2KA 1I3NA 4YTEA 1U5CA 3PWSA 1BXZA 4JP3A 2X0JA 1HT0A 2GZ3A 4NNJA 4RORA 3AFNA 2ZIZA 2WSBA 4XJTA 1HYEA 3VZSA 1LI4A 1H93A 2P5UA 1YOVA 2C54A 4J90A 5G4KB 3KVOA 4NJOA 3TNLA 4RLSA 1AHHA 1TT7A 2PKQP 3OQBA 2Y1GA 1Y5RA 4J1NA 3LT0A 4R5HA 3DMTC 1ID1A 4R9SA 3DB2A 4YQZA 4WLOA 3WMXA 1B0AA 2JFGA 4HKTA 4CLOA 3QRWA 3KYDB 4A73A 4E21A 4IQGA 3WSVA 3JD4A 2Y0EA 4Y6PA 2VQ3A 2ZYAA 2Y1CA 1MX3A 3M1LA 1SC6A 3FN4A 3ROQA 3WS7A 1Z75A 4Q39A 3Q6IA 1XDWA 4L75A 1OC4A 1HZJA 4QXMA 4DLAA 1EBFA 1ONNA 1RM5A 2VUUA 4DWVA 3D3EA 3JYNA 5GZ1A 3WICA 5AXDA 3KSUA 1N9GA 1UH5A 2YW9A 4LSWA 1N1EA 2VWPA 6LDHA 3WLFA 4JX8A 4BKQA 4TKLA 3AUTA 1MV8A 4K28A 7MDHA 2ZB3A 1OZAA 4GPD1 4R9RA 3NV9A 5JMPA 1R4NB 3BMNB 3VVBA 1VSUA 4UREA 3PP8A 4FIZA 1PJ3A 3C7CB 3MJ4A 5I8ZA 3WGOA 3WJ7A 3A9WA 3MOGA 4ALMA 1G1AA 1GZ4A 4JJIA 1DHRA 1OAAA 4BO5A 2WDZA 3AY7A 3C1TA 3RJ9A 4MVJM 1NAIA 3PHJA 4ND3A 3H2ZA 3JSAA 1FJHA 2PKRA 4BNTA 4MO2A 5CDYA 1MP0A 1WW8A 2QRJA 3L0DA 4J0EA 1ENPA 1VJ1A 1L1FA 4AFNA 1YQDA 1U3WA 2ZKLA 3BIOA 3D3WA 2OXIA 4XYGA 3UKOA 5KJFA 1CDOA 1MC4A 4HFJA 3HDYA 2DQ4A 3ONEA 1YJ8A 4R5MA 3IMFA 3BTOA 3JQBA 4FFRA 2FRDA 2DU8A 4FFNA 1TT5B 2HSDA 1EE9A 1CQJA 1E7YA 1TLTA 3PDUA 4L74A 1G0NA 4XGKA 4YYZA 1I30A 3LT2A 2HK9A 5ER6A 4W7IA 3HADA 3DOJA 3E9QA 3PJGA 3MEQA 1XELA 4ROSA 2J3IA 3TN7A 1UXGA 5EINA 1YL5A 1H0KA 1L7DA 1X13A 1EVIA 2J5QA 5K9ZA 4PZCA 3F4LA 2EG9A 3V1UA 4BKRA 3O8QA 1PSDA 1SMKA 1T24A 2AE2A 4D42A 4XR4A 3IJRA 2GUGA 1N7GA 3U3XA 1WNTA 3JCZA 5CDTA 4I9NA 1E6UA 2A92A 1A9YA 2VYVD 3R1IA 4BOYA 1ADCA 1EMDA 3KETA 2R2GA 1NFFA 3DTYA 2FPGA 1IZ9A 1Y7TA 1ENZA 4E0BA 4BNUA 4GLLA 4J4HA 4NG5A 4KP7A 4I8XA 5G0TA 3H9EO 5JCJD 3OEYA 2CF5A 3DL2A 5HA5A 3BMQB 2PD3A 3MCVA 2HCTA 3AUSA 4IS3A 2V6GA 4IUYA 2QG4A 3DBVO 1KIFA 1C0KA 2D4AA 2YUTA 3DDNA 1UR5A 1IHXA 5A5FA 1DLJA 5GZ6A 5T64A 4CMEA 2AEJA 4WPGA 1EUDA 4LCJA 2X0NA 1Y6JA 3L6DA 1J6UA 4Q9NA 2E4AA 4ZQBA 1DJQA 1Y8RB 3KHUA 5C7LO 3GNQA 4J4TA 2XXJA 4IPTA 3ZWOA 4ZGWA 3EDMA 3Q1LA 4NBVA 3JQ6A 2B37A 4KZPA 1ONPA 1H6AA 3GG9A 4OAQA 3SC4A 4R3NA 1WDKA 3RUDA 4R01A 3SJUA 3C7AA 5ENVA 2GN4A 4QECA 1O6ZA 4CMGA 2JHFA 1AXEA 3G3EA 2CMDA 2C2YA 4HADA 1B7GO 4IY1A 3ROPA 4IXWA 1HDOA 1PQWA 1JVBA 2ZQYA 4NBWA 4MPDA 5KVSA 4BVAA 4DA9A 3QE3A 3O8QB 2EJWA 1DIBA 2W2LA 3FNHA 3HFSA 3PLRA 3FF4A 4AJJA 2VZ9A 2DBZA 3AM5A 3ZU3A 5L7WA 4B8WA 3QWAA 3WQSB 3KEQA 3E1KA 1A71A 1JKIA 1NAHA 1YE3A 2IYPA 2YYYA 4MVJE 3D4NA 1LDNA 4JK3A 4O63O 3ULKA 4FC6A 3QW2A 2CVQA 3ZWXA 2CZCA 2HO5A 4RO0A 2WEKA 1YKFA 4ALNA 1DC3A 3KM0A 3IC5A 2Q1WA 3GQVA 4NQZA 4RZHA 2AG8A 1ISGA 3ZI0A 4NBUA 3DAFA 1KOLA 1PJSA 2GGSA 5CDUA 1F8FA 1J4AA 5AYVA 2O48X 1ZSYA 4B8ZA 4Q3EA 3OETA 3TSCA 3B20A 3JYQA 4XDZA 3UICA 3GAFA 2JAPA 1ZNQO 2X9NA 2Y1DA 4NBTA 2PWZA 3GH3A 3OIFA 3SLKA 2Z1MA 4CL8A 3B6ZA 3M2PA 3IUPA 4PVCA 4M86A 1SEPA 4XIYA 4D43A 5KJCA 4YCAA 4TRMA 1W4ZA 2IZ1A 4L0QA 5JAIA 5A3VA 1GUYA 4BGIA 2EKPA 1JQBA 4CV2A 5GZ3A 1XQ1A 3OICA 4PLWA 5F3RA 1O94A 4OOEA 4Q3CA 1KETA 4MVJD 1UZMA 1MUUA 4TRJA 7ADHA 4GI2A 4E5NA 1HLPA 2Y67A 4E33A 4B4WA 1E6WA 3ZNNA 5ER9A 3DBLB 1IOLA 3AOEC 3RWBA 4J16A 3CIFA 5COBA 3K73O 2UVDA 4WCDA 3TQHA 3CINA 2Q4BA 1LLQA 4I5FA 2ZYDA 2Q2QA 4NZ9A 2I65A 3HUDA 3VPGA 3K31A 1GZ6A 3FCOA 3OJEA 3TZQA 4FC7A 4H16A 3GHHA 2O3SA 1LDGA 3KYBA 2NV6A 2F1KA 5A02A 2VWHA 2PNFA 1JAXA 1E3SA 1PL8A 3ANMA 4CV3A 3W8DA 3K2EA
chains in the Genus database with same CATH superfamily
3ZDRA 3ICEA 2E3JA 2IA5A 2OLKA 1B1AA 2NVOA 1GAEO 4ZXFA 1W1WA 2JKZA 4QOFA 2XT9A 1X8LA 5BXYA 1P3Y1 1L4HA 1P1BA 2JVIA 4RTLA 2HADA 2WSSA 2QQ0A 2X5OA 3TBFA 2IX9A 3D3JA 4YK7A 4L0DA 3R5TA 4OOFA 1F12A 1SCAA 3QVSA 1XPRA 1RJ9A 4F38A 2PS3A 2WFLB 3KQQA 4PX9A 4UBOA 5ALOA 4OQPA 1TM1E 4NCNA 4X94A 2XBMA 2PIAA 1MENA 3CEAA 3K6RA 3F6CA 4Q1VA 4HS9A 4YJDA 4CM9A 2W43A 1PL0A 2H1LA 4NSNA 4KO4S 2B8WA 4OA8A 2PD4A 2CE2X 3R7WB 2ZBRA 3EGVA 5GONB 1IN1A 1JKFA 4LZAA 2GH1A 4DOMA 3CUTA 4TV8F 4ZTBA 3G2NA 2DUMA 4HNGA 3PGA1 4MVXA 1DBWA 4XPIA 3H83A 5A5DA 2YIVX 1AURA 1XHEA 2F1RA 3UMGA 4X97A 5MFPA 2B8JA 2Q50A 2WT9A 4NXMB 4M55A 2XOKD 2WYOA 4H15A 2G09A 2C31A 5J47A 3EB9A 2XDQA 3TNJA 3K0HA 4WOBA 1CZOA 1EQ2A 2XCUA 4RV4A 2PM8A 1G8HA 4OXKA 4JDUA 2VAWA 3MJRA 1QCZA 2FEPA 3VPAA 4GP6A 4BNZA 3AJ9A 2MR6A 5ITSA 1Q11A 1PSWA 2XVMA 3CURA 2PVSA 2AKAB 3B5IA 5TE9A 2VHYA 3KVRA 4FCTA 1N8NA 1FE8A 3DVAB 4RZUA 4WEQA 1Q1AA 3WZ2A 3AR7A 4N82A 4Q4HA 4QYIB 1KPGA 4Z9AA 4JP5A 2JEZA 1H23A 5GVRA 3S2YA 1D5WA 3KVVA 3GZNB 2O0KA 3UHPA 3WKEA 3EXEB 1UPFA 1JQKA 4JI4B 1BYIA 4WAUA 3RABA 4F12A 2WQ6A 2VAMA 3LY5A 4HYYA 1FYXA 4Q6BA 4Q12A 3GR6A 3W6OA 4I3GA 1O57A 1UUFA 3EXHC 2OCPA 3T7DA 1SHLA 3PB3A 3PTZA 2TMDA 1NTOA 1ISHA 2FR1A 3COVA 4X0EA 4FE4A 4WKNA 3S2UA 2NADA 4EO9A 5CDSA 2IS4A 3NWPA 4FNOA 2DC1A 1ADJA 1K7CA 2X6QA 1P60A 2NZJA 1RM4A 1NF9A 1E96A 1HDXA 1G3QA 1SAYA 2XZPA 3PFKA 4R1UA 2VP4A 1N0WA 2IZ7A 4A0RA 4GPAA 1SOMA 2WHRA 2VHVA 3ZQJA 3BRWA 3QWBA 4BNXA 4Q3KA 2XCQA 3GFSA 3ABZA 1V45E 2ANBA 1ND5A 2JZNA 3OPQA 2HBYA 1YRBA 1WZUA 2JGMA 3GLGA 3OD1A 1NYLA 3H5VA 4IBOA 4DV0B 1TYBE 4GEGA 2ERCA 3L05A 1OX4A 2WM2A 3PPIA 2QJFA 5LLTA 1GTL1 4YC7A 4RPCA 3V1NA 2J09A 3GCWA 4MUBA 3CSDA 5EIEA 1C2YA 2HL6A 3OPYI 4CJXA 3HL4A 4H3VA 4ZOLF 1F2DA 1W5BA 1W0KD 3JASB 5ITVA 1OXKB 3NRJA 5U1PA 5CA1B 4J7CA 2UZ4A 4WGFA 2FB9A 3MCAA 3AINA 2V55B 3BRCA 1M2FA 1U31A 4RPLA 1SB9A 1TYCA 3EA0A 1XKQA 3L4BC 4BO6A 1RE0A 2GD1O 2GPWA 3ESCA 3AJ8A 4KK4A 2N0SA 3AVOA 3B12A 4FZ5A 5FFNA 1JHMA 3OHSX 1F2VA 1MT3A 2JI4A 2OFPA 2QN6A 3OZFA 4L02A 3SC2B 5FNVF 3NHJA 1IHPA 1XNJA 2HD4A 4X20A 2WFZA 5HZGA 2Q29A 1NC3A 4HXEB 5JNLA 5LDHA 4HRVA 1C3JA 2ZYGA 1LDBA 4L5CA 3DDHA 4FOPA 5FX2A 1NC1A 1SUIA 2WYVA 2BHNA 5C31A 4ZJUA 3Q3CA 3QYAA 1E7MA 1OXMA 3EY9A 5LYYA 4DUPA 5K8JB 1HEYA 3LQYA 3ONFA 1X42A 1EX9A 1KEUA 1BKDR 2G88A 3SIWA 1VPTA 1FBNA 1MGPA 1OIXA 4QODA 3VDRA 4AAYA 4X6XA 4D6PA 4G5XA 4GWGA 1Z4JA 1BDMA 3HHPA 2Y93A 3DR3A 4MROA 2E6KA 2DBYA 2W6QA 4QXRA 4TTVA 5DI3A 2FUG1 3P9NA 1GNVA 4ZXPA 4KQEA 2AA3A 5IWAB 1TMKA 1QQ5A 3MSXA 4BTLA 4ER5A 1WCYA 2QENA 3CH7A 2IVZA 3OZCA 4FKZA 4L4SA 1X6VA 3NM4A 3ZNOA 3WMFA 2R97A 3AKYA 3RFUA 4CM8B 2JJ2A 1PWXA 4EF5A 4OHRA 4HJXA 4F3YA 2ZRCA 4NF2A 2NQ8A 2NZ2A 2BAGA 3SF8B 3STYA 4DA0A 2PQ0A 3KQKA 4Z9XA 3F6EX 4U00A 1DWUA 3SJ7A 2IE8A 2Q27A 3K35A 4EW1A 5TJHA 2P77A 1PV4A 4KWCA 1WULS 2MSCB 2ZSJA 1GUZA 1OPRA 1Z13A 2G1JA 1HTTA 1HBJA 4IOKA 3SN6A 5J4KA 2HJ9A 1JKMA 3H1AA 3PXUA 2DWQA 2FPRA 3MCUA 3SR0A 4UXJA 3TTWA 1KVRA 2C88A 3BJEA 3F4KA 1W52X 2GFQA 4TTJA 5CNMA 2NVUB 2WM9B 5K0FA 2PANA 1OY1A 4C7VA 2Z8ZA 2YV5A 4FJ1A 1UMKA 2BR5A 3AHEA 5ISMA 3EMVA 2VR1A 4N65A 4TX1A 4ZFNA 1S1MA 3R5JA 4JYAB 2J9XB 2ZT6A 4Z99A 5LSAA 1C30A 1PU2A 2W2KA 2WUWE 4LZLA 5LZ7A 3TLCA 3WGLA 1V48A 1B00A 3H3FA 4B3HA 4D80A 2X77A 5H5JA 5TARA 1GPDG 4IJKA 2LD4A 4JQYA 1BAPA 3C3YA 4U1RA 1EDEA 1KK3A 2F62A 2WB2A 3K0AA 2GDJA 3Q5DA 1L5WA 4ZD6A 1DFGA 3NPAA 1QO7A 1UT5A 4NTZA 3COYA 4MICA 4XB1A 4RZ3A 5BOVA 1CVIA 2D13A 4WERA 3U4QB 2ZAIA 2HWKA 2W8BA 4BQFA 4UHBA 1DKLA 2J0UA 3FHTA 1XFAA 4Y2VA 3FRIA 3I3OA 4P0QB 1XK7A 4J0CA 1Y3HA 2XB9A 3IOYA 3TNDA 1G59A 2QLJA 3E15A 2GHTA 1ZWLA 4JIGA 1SBZA 2VHUA 4QKQA 3QE2A 1EVJA 1RKVA 2NUTB 3HB7A 3OLVA 4TUYB 2R79A 4YJFA 1A9RA 3MZ0A 1H3FA 1ADGA 3O75A 4P4SA 1VG9B 2W6MA 4QDOA 1CUUA 2DLDA 3M3DA 4DGQA 4DG5A 5L3SA 1A1VA 5JO9A 2I6FA 3QVUA 2C4NA 2C8KA 4KN8A 1M73E 1MEEA 4MQFA 2AKYA 2BY4A 5H9VA 1C41A 4MVJA 1BJTA 4ZK6A 2C4VA 3L0CA 5L3QA 3G1UA 1O96B 1GTMA 1BRMA 1UKZA 1J5PA 5KQRA 3SCZA 4EW2A 2AHOA 4DMLA 5D6NA 1TCBA 1KFBB 3TEMA 1QNFA 2ZI5A 4CUZA 4U8GA 1ZZEA 3G8BA 3TTUA 4EJMA 4K6CA 4WXMA 2ERXA 2P30A 1ML3A 2IT1A 1ZD2P 3RS5A 1WPGA 1NVVR 2W2LD 5IT4A 3EYAA 1YFLA 2WK1A 5G4KA 2AJBA 2I6XA 1CUEA 2ZRNA 4OAOA 4YRLA 3R20A 4V38A 4OKSA 1G66A 4JVSB 3X1XA 4DB4A 3IDQA 1M6WA 4TWRA 5JFOA 3FUTA 2LR0A 3NEYA 2VJDA 4LE1A 2R1UA 1NONA 5CG1A 1D6SA 3KYDA 3JZMA 4QATA 3UJAA 1S2MA 4LNHA 1W19A 2RGNC 3GN1A 3EUWA 3P9YA 3QUCA 3NHMA 1UJMA 4EW3A 3LW7A 3I4CA 1Z5VA 4ZOQI 2SBTA 1CUIA 1UBHS 3F90A 1LK7A 2HSZA 1JKJB 2C5HA 2NP6A 5JFGA 4ACBA 1NX6A 4YREA 1PW7A 2CL5A 4DKJA 5LBIA 3CR3C 3UY4A 4B75A 3DOCA 2VJLA 1TJ4A 3ANNA 4BO9A 1JHRA 1VPEA 2OBLA 2HRCA 3AUFA 4LCEA 1J8FA 3C3KA 1QRTA 3T5CA 2I2AA 4REOA 2JLWA 1ZR4A 5I9TA 1G20E 4NLLA 5JD3A 1GSHA 1KQ3A 1P7PA 1QHFA 1A96A 1R4NA 1QZTA 1Y9EA 1YGYA 3ASYA 4HNAB 1QAMA 3TR6A 2FZGA 2O0LA 3D5QA 1UODA 1CJVC 3EZLA 2I2DA 1KRHA 3GLRA 3ZD8A 2ZREA 1WG8A 3RC8A 4J43A 3DQPA 3OFSA 1VKJA 4ZVQA 2HRQA 5HP4A 1M8GA 1KFEB 2IDJA 4DWWA 1E1DA 2WAMA 5KHLB 1SHZA 5DHSA 4YFVA 1JI3A 1BVYF 1JB1A 1M76A 1WEHA 2VSOA 3DL0A 3LUFA 4U7GA 1IEQA 2UYHA 1Q0QA 1QIEA 3WDLA 3WLEA 2OZLB 2IZ0A 2V6BA 2PAFA 2PQ2A 3E5RA 1W34A 1NI4A 4K6MA 1NT4A 3T3IA 2PDAA 1J9EA 1EXNA 1RZVA 1T5BA 2AMFA 2N42A 2OBMA 2QUBA 2ZRJA 4IHAA 4M1MA 4U7PB 4AUNA 2QWXA 1TVEA 1BDIA 5K2MA 1C3OB 2P6NA 1H0RA 3OZBA 4CKZA 4YUWA 3OY7A 2W71A 5LZ8A 3TOZA 4B2IA 3TNFA 3H9UA 2AN9A 5HRAA 2QRLA 4XVCA 2C84A 4QTYA 4MR8A 2ZVPX 4W1RA 3VU3A 5BWBA 5CPBA 1H5UA 2H2HA 3FAKA 3TXAA 4NYIR 1HKHA 3Q3EA 3U56A 1G7RA 3EWNA 5CVDA 5HTKA 5IFLA 3GJ6A 3NUQA 5JASA 4NMHA 3ZWNA 3FI9A 2X5JO 2H2AA 5FOSA 1BJKA 5C81A 3HJCA 2NO6A 3HSYA 5KOJA 1H3NA 2BGGA 4KIUA 4BGVA 1TIPA 4CU5A 5A03A 1FDSA 1SKBA 1RHMA 1MB2A 3A3OA 3AFHA 5T4HA 2WSLA 3FMPB 3FYUA 3NBMA 4CLRB 2OZEA 4GNRA 5JC8A 4LN1A 4JCOA 1UKBA 1I0LA 4C07A 5I9IA 4C14A 4U39A 3FNEA 4P34A 1Y7LA 5FBRB 4TT3D 3WLHA 4YT4A 5JJ5A 1PQPA 3AR6A 3ON5A 4HUTA 2WI8A 1Z0AA 3MFYA 2Q1YA 4K8OA 5EQTA 1ZJYA 1BG6A 3SR3A 1AIPA 1XSEA 4XRGA 4PGFA 5J4HA 1UJCA 1NULA 1VSQA 3MTEA 3CBQA 4RF4A 1N6PA 4BO7A 3NVMB 1UFKA 5DISB 3NW9A 1A50B 2GI4A 3BZUA 1DIRA 1T9GR 2OG2A 3INGA 2QAGA 3ADKA 2JAXA 3R5FA 4PZEA 1C1DB 3PHBE 5ITWA 5JNSA 2A6PA 4Q7EA 1EQUA 1ORHA 2PR2A 1H6CA 1SWWA 4K9OA 4J3NA 2CVZA 3TKAA 1QPGA 2WICA 1M1YB 1IY1A 1GVNB 3DKRA 1OROA 3B36A 4LYHA 5E4JA 1CJCA 2ZRIA 2RGRA 1LPNA 3PQ2A 5IC5A 3KZVA 3GLGE 3F5DA 4G2TA 1UBLS 4HDKB 2DUUA 4JKYA 4KODA 2VXOA 3PGXA 1V37A 4EEKA 5FWNA 5JO0A 1WXHA 1HNZB 5EHXA 1AKWA 2QAIA 1D4OA 3LWDA 2I2CA 1O97C 4MCJA 5HIMA 2ZJ0A 3K96A 5J4LA 2MSWA 2ZIWB 4K1LA 3QIAA 4DADA 2YMPA 1KDRA 1RAAA 4NU6A 1YR6A 5DTRA 4DCMA 4DJFC 1HI9A 1UZUA 4DC9A 1E77A 2PUBA 1ZN8A 4J29A 4KV7A 4Z4FA 3JWJA 4L50A 3M5PA 4Q7LA 4TN5A 3EA4A 1B26A 3PKZA 1F0PA 2A67A 4Y67A 4F4DA 1FQJA 3CZ5A 3L8CA 3PTLA 1JALA 2G9QA 1EK5A 4PCAA 1UAYA 4IHQA 1AKUA 2GERA 3K94A 4JB2A 4NBKA 2JD1A 2QM0A 5CJJA 5B30A 1JLRA 1NQWA 4ZKEA 2K7FA 1X1AA 2G04A 4BFYA 2WKRA 2CKMA 2YWEA 3PXCX 4OU5A 4PSUA 2OXTA 3TM5A 1UFVA 1AVTA 2JS7A 3FI0A 4W5NA 4DM3A 2IE0A 3GEMA 2PTHA 4HWRA 2PHZA 3FCCA 1NF3A 3KFVA 3KJEA 2NVWA 3F47A 1DI0A 2O2SA 3NM6B 4AIIA 1Y7HA 2Y0DA 3PNKA 3Q11A 4GW3A 3N2KA 4M0CA 4ZYLA 4J75A 2X2FA 4YLGA 3S5UA 3KOXA 5JMTA 1Q1QA 5C4GB 1SVWA 5KYVA 4MDHA 4HVAA 4NBSA 1IUKA 1R4ZA 3KZOA 4IJVA 1IDOA 3BMCB 4L9WA 1H2ZA 4L9AA 4MQEA 4DNOA 3WB1A 2CXNA 4EP1A 5KVQA 3QLTA 3OCUA 4UU1A 1O6CA 1WNFA 2K7ZA 1JA0A 2XUQA 1E18A 1XLWA 3H1PA 1MAWA 2PUHA 2QZ9A 2WJZB 2ZQ5A 3JATA 4HQLA 2AG6A 4BZZA 5L4SA 3JWHA 3BXEA 1XD2B 3UYKA 3KDAA 4RX1A 2YASA 2O1WA 1QUFA 2EOAA 3V8RA 5FUQA 4AKIA 2O4CA 1GGNA 1R0CA 3RHZA 1DUIA 3ZZUA 3T3DA 5JSYA 2P3LA 3DOEA 4BWVA 3CBGA 2IDMA 3IJPA 5CM8B 3VH3A 3IAEA 1CUGA 1NSYA 1GQQA 3V33A 1CY1A 1THGA 3SZLA 1PT7A 2CFTA 2P0EA 1YQ9A 1EINA 3OIVA 3BXXA 5KYWB 4Z53A 2I54A 5KSZA 2NN3C 2XIJA 4D98A 1P6XA 4QASA 3IUNA 1HUQA 3U7FB 2D3TA 4JU9A 3S1AA 3LSYA 1VXOA 3GI1A 3VHXB 2J3JA 5LMCA 3OKAA 5BOSB 2TMYA 4D9CA 3Q7RA 5ADWA 2NO9A 2WU8A 3IV9A 1HYBA 5DP1A 2CCKA 2WVAA 1ZCFA 4PF1A 1I24A 2YCBA 1QB8A 1Z0KA 4EPTA 5JCOA 2QIPA 3FDFA 1VE3A 1L7PA 5BVHA 4RU1A 3IUYA 2XOXA 5J9FA 4RF3A 4EYQA 2P5YA 5LJLA 3JPYA 4FT4A 2OV8A 2KW5A 4RD1A 2ZW9A 3E3MA 1SUCA 1Y9JA 2JLRA 3RUAA 4O2BF 1WZIA 2H8KA 2NU9B 3VX4A 2IHYA 1C1HA 7REQB 1B42A 2AQ8A 2I4OA 1H85A 1VI6A 1EGVB 1EZ4A 3A1VA 3HVHA 3QX9A 1KQOA 1ESCA 3KG2A 1XG5A 4O2LA 1OZHA 1NBWB 3CF6R 5ENDA 2JAUA 2BGMA 4ZANA 3ZU4A 5BORA 1GAWA 4GL2A 4RDHA 2C59A 2Z43A 4FMCF 4F5ZA 3WISA 5CNKA 1ZI9A 4CE6A 1XVLA 4WIAA 2YVAA 2OBNA 4OAPA 1IN8A 4E5SA 4TQUS 1GPNA 3TINA 5DTQA 1XXHE 3IXMA 3U39A 1R2QA 3UIEA 3VBCA 1FUIA 5FBQB 1GPJA 3GU3A 5JQGA 1FLVA 3IP6A 1QR2A 3HB0A 1D6NA 2E37A 2YOHA 3BYZA 2DFDA 4FGWA 4P1ZA 4X45A 4XJXA 3QVOA 3HYCA 4QOGA 3W6PA 4NOMA 2XAUA 3E3LA 3LC7O 2ZJ4A 3OM9A 1P1KA 2F3SA 1TMGE 4I9GA 5IK2D 1RPNA 1OXTA 3HVKA 4D57A 5KX5B 3TRFA 1WZ2A 3QSYA 1CYDA 1LPMA 3QSGA 3ZXXA 1RQPA 3SHOA 3SKVA 2WKWA 3IYLW 3D0KA 3WFJA 1H9BA 3OFVA 4CMEC 3FKJA 2Q8QA 3DF7A 2W6ID 2EFEB 3BGDA 4B31A 2BFMA 5B7NA 5DIFA 4YT2A 2ZETA 3ND6A 3QZUA 4PAQA 5K3FA 1N33B 3R09A 4NBLA 4CI9A 1QHSA 4DGSA 1VLVA 2ZRPA 4F8JA 3CRMA 4F97A 4MW4A 1RADA 1GA6A 2IXDA 1XTRA 3GOHA 1WXEA 4ZPXA 3D4OA 4G5HA 3P9ZA 2DMRA 1S96A 4N5NA 2ETVA 6REQB 3JWEA 3FTQA 4V03A 2ZE8A 1BKYA 2OC9A 3IPLA 2J33A 3C3MA 3DWIA 3KJFA 3N07A 5T3UA 3VC2A 5F9FA 3K20A 2GVNA 4M89A 4E46A 3H1FA 5A0VA 3FVWA 3KQOA 3KK0A 3HRIA 3DW3X 2RARA 3T0FA 4NECA 1BHQ1 4IEFB 3GD5A 2OG1A 3ZHSA 2MTBA 4HDNA 1N75A 1WXDA 2Z3WA 2NU6A 2IPMA 4IO1A 4Q9JA 1UPCA 1JEDA 1MC8A 1VKZA 3UUGA 1NXVA 3AESB 4H6PA 1AN0A 1FNCA 1GXSB 4AY4A 1G291 5IP5A 4BC1A 4G0PA 4I5EA 4M0LA 1CQWA 1HFKA 2JFUA 4CPDA 1T36A 2AKEA 5HIJA 3OMWA 3ZI4A 2A3NA 2B61A 1GZUA 2ZJ1A 3OUZA 4I1UA 3VC3A 3ZWQA 4O2AB 1RRGA 4AXXA 1TKRA 3M6UA 5LM3A 4OTZA 4S24A 4NDNE 1K2WA 5F5XA 4IUBS 4HX9A 4QXPA 4PX3A 4DCUA 3DB1A 3O9VA 2EW2A 5F9HA 4G67A 1UM9A 5HX7A 2HLDD 2IUYA 1P1RA 3O8OA 1XCOA 5F4BA 1GEGA 3E22B 5ALGA 5KB3A 5MGBA 4YAOA 4R7TA 3WBBA 3P0HA 3EGDB 2KM1A 1PLKA 4G1UC 4H7IA 5J2TA 4PWYA 3ZD9A 4UMFA 1H1LB 5PNTA 3P52A 3R6WA 1RWKA 2YY6A 5GOTA 3A6FA 3LVQE 3PQ3A 4TWJA 4GU5A 1KYXA 4ZDKA 3OZEA 1S02A 3C4VA 1R5OA 3O5AA 3WGHA 4Y6RA 2Z6QA 3LLSA 2DKFA 1MV5A 2ZAMA 2EFYA 3TQOA 5ICCA 2C82A 4OY3A 4UFNA 2WY2D 1JPVA 4CUKA 3NYRA 3JQFC 3HGMA 3LC2O 3PCXA 3R0QA 4IHJF 4RY9A 4UDXX 5ALEA 2I8CA 4KL8S 3SJCA 4EKGA 1DUVG 4IQ8A 5G1PA 2VPXA 3OWHA 3OWOA 4OYYA 4KXYA 4R05A 4A27A 1O58A 1NKTA 4C4YA 5J2UA 3TPCA 3OQIB 4NENA 4BFLA 2OXRA 3KKNA 5BUCA 1P2VA 1LDEA 3M49A 3GA5A 4ME6A 1Q83A 3AF2A 1ODLA 4MKRA 3DE0X 1TFRA 2DFKB 1CS0B 1IN5A 4G8BA 3UUFA 3KQUA 2QZJA 3TR0A 2AG0A 2VCHA 3WLPA 1HE8B 3UMYA 2IBMA 1DFIA 1KYIA 2WJYA 3EWSA 4QDJA 3JVEA 3W78A 3SSNA 1G2QA 3F78A 1DARA 4I08A 1DCKA 4GM4A 4ND8A 5EJEA 3HWRA 4W63A 5EWJA 1K97A 1KR2A 3VKWA 3K9BA 1Y9DA 4LYJA 4L2IB 1WTCA 2QR5A 5I9NA 2LBPA 3MCZA 5FEMA 2QN3A 4UTVA 3PIIA 5DCWA 2F43B 5F5NA 3BG5A 1T6XA 4I50B 2OD9A 4MIKA 1UINA 1Z6PA 1NJ1A 3R7LA 3F71A 4UXHA 4DYHA 1ZHHA 4LE0A 2NYUA 3EFOB 3TTXA 1ISJA 1UBEA 5JANA 3KOUA 5SY9A 3ZWBA 3K8OE 3QTBA 4ML3A 4PQFA 2I1WA 4W5QA 3TCNA 5B64A 3RAFC 2GSWA 3SP1A 4Z2AA 1Q0UA 1H2FA 1RBQA 5C46F 5IKEA 2PGDA 2QRVB 4NAVA 4ARBA 4F4JA 2QD4A 2PEYA 3K15A 5ERXA 4J0GA 4CM1A 3FROA 3D8RA 3U19A 3MFQA 4MS4A 4TMTA 5A9SB 4BGUA 1KVUA 4QAJA 3SZGA 5KTMA 3M8KA 3A6EA 2QNRA 2WV7A 4M1YA 3P5BA 2VNAA 1E6CA 4N5DA 3L4BA 5B12A 1J7JA 3I1JA 2Z1DA 3DH0A 1D9ZA 2ON6A 3DGEC 3ZCVA 1SBYA 3L93A 2C0CA 1NMZA 2GZAA 2DLNA 4GSLA 4IVPA 4M0EA 1BW9B 1P2TA 3ENWA 5TV2A 2FKAA 1QU3A 3EAGA 3PENA 4OGGA 4JLDA 1V9LA 3ZZNA 3KD3A 4HV4A 1GUAA 1UBRS 3HCDA 4DQXA 5K7SA 3FNFA 3BH7A 3F5FA 1A0OA 1E69A 4HX2A 4LK2A 2X76A 2GWHA 3JQ7B 1RWXA 3HA7A 3MTGA 3ZX4A 4Q37A 4WZAA 1V16A 1W25A 2R8PA 4PBRA 4Z4HA 1T4BA 5BSVA 4EMTA 1K89A 1OV4A 1VYTA 2JD0A 3I12A 4WACA 2ET6A 1HDZA 3II6X 5C34B 5IX8A 1NW8A 4DV4B 1Y6GA 1N2HA 2YDYA 4FX2A 3ZGLA 1I4WA 2VK1A 3UWMA 2PQMA 5JNRA 3C24A 4JLKA 1I5EA 3KV3O 4E5DA 4FHGA 1CTQA 4FE7A 1M0WA 4HSGA 4N0DA 3E9DA 2W6JD 5HRCA 2GJ4A 3CXUA 5BNTA 4OQEA 4F5DA 3N6RA 1YS9A 2PZBA 3AB7A 4XM2A 3SXUB 2AK3A 4OUDB 2HSGA 2IDZA 4QU8A 1XEWX 2HO4A 3KQVA 2PKWA 1ZC4A 2FDXA 3QLUC 4Z7JA 3WY9A 4F04A 3EK2A 4D1YA 3D4BA 3SZRA 1H69A 4TKUA 1M1NA 1P6UA 1EBUA 1C4OA 3ZWCA 2HX1A 5KDOA 3QF4B 2FPWA 3OLWA 3PCRB 3A04A 1CZUA 1QC5A 3RPEA 3A2LA 3OX3A 3NUGA 2HY7A 3PDHA 3T9CA 4BQPA 2ZITA 3NVAA 3UTCA 3LP6A 1S3GA 1YL6A 3D1LA 2WR8A 4G4GA 1TE2A 1TPZA 3GGGA 4NHEA 3HABA 2MOKA 1YASA 4PQEA 2R96A 3K9WA 4ZEOA 5REQA 1V4VA 4C6RA 4B74A 3GUYA 5I7WA 4OFXA 1QIIA 2ZYSA 4OMCA 3VNRA 3WNQA 1DO8A 2REXB 2P3OA 3I6QA 2O1EA 3G7SA 4C21A 3W3AD 3S0JA 1R0XA 4LVNA 1KI7A 5GGYA 1EQAA 1SUSA 2H2DA 5K51A 3WYFA 2WVGA 5E6SA 3RQSA 1MO2A 3V2GA 4RF2A 3DHEA 3KSZO 4AWAA 5AM1A 3WDSA 4G23A 4JGGA 2B4KA 3EW9A 4X65B 3I5XA 2IXGA 1T6YA 3CRQA 2WF9A 1NQAO 3ZDBA 2W2OA 4XDYA 3VNVA 2I8AA 1RXCA 2UVPB 5FUWA 5HKOA 1IBKB 1NXXA 1AKRA 2H5LA 2C2GA 2IKSA 3PFHA 4NNPA 3EF1A 4P82A 3U3RA 4EUSA 1Q7EA 2CZGA 3ABSB 3EMBA 3ZDXB 4B44A 3QU4A 1IYZA 2OQ2A 4MV8A 5AVXA 3WRXC 1SC4A 2CNBA 3I76A 1E9EA 4IRMA 4D0RA 2EEZA 5TNXA 2ZUVA 3GJ5A 5IAEA 1TUEA 5DBFA 2H2FA 3AF3A 1ATIA 1CJTC 1L4EA 4X95A 4M9QA 1GAQA 5BMVB 1NV8A 2RK3A 1YR8A 5IKOA 4KMOA 5DNUA 5A2QA 4IH9A 3QF7A 4MKXA 4LOKA 1NI3A 2XB4A 3AX6A 3I9KA 4KB5A 2FSVC 16PKA 4K8RB 2G0TA 4UHKA 1QZUA 4DYVA 4EB6B 1NVXQ 1E9VA 1FTNA 2X19A 2O8FA 2XVXA 4IW3B 4DRZA 2GCOA 2VK4A 2G8NA 1E0KA 2CFOA 3FVTA 3KWFA 4TTQA 3CVJA 2GOYA 1UIMA 4JROA 4LRTB 2IYTA 2GRJA 1Y1RA 3PF9A 4K88A 1Q1NA 1KDYA 3AZOA 3ZNPA 1XCBA 5DRTA 2WTBA 4FZJA 3DBIA 2HN9A 2ZPAA 1U3UA 2VPPA 5F2OA 2WIJA 1WEKA 2ZJZA 3OTQA 5FPQA 5KZMB 1SCUA 4J1TC 1AGXA 4I1IA 1YB6A 2GHRA 1DCMA 2GHQA 3ABIA 2Z5GA 2ZYRA 3NBUA 4NIMA 4FBMA 4PPGA 3EBLA 4UE6A 3TZEA 4FGJA 4D96A 1W48A 3KJZA 4DMKA 4FT2A 1F7VA 2CDBA 3NWJA 4H0FA 1G21B 4TM8A 3OPVA 3LQ1A 1JR2A 1BH2A 2Y99A 1YDWA 1M34E 1JAHA 2WWYA 2PEZA 2J9FB 4FXPA 5FORA 5HQ3B 3WRVA 4EATA 4F0JA 4IDPA 4UHCA 4K9PA 4BJ3A 4W5OA 3S44A 3Q9NA 4RQAA 2R7KA 2XA9A 3LO8A 4KO2S 5JARA 3HK2A 2MIIA 4KUHA 1FFXB 1YA8A 4GRAA 1PP4A 4JYPA 1I7DA 4N9QA 4PZAA 2PR7A 5AVUA 1R6DA 3DJFA 1U0EA 3D81A 1TGVA 5ICFA 1M6VA 1RJWA 2HR1A 1S5PA 4EQ6B 3DCYA 4DLBA 4XUCA 4KXMA 1R0LA 3LPLA 1FDWA 3LNTA 1PQUA 4D26A 3ZPXA 4MW0A 5KVCA 4Z0NA 3T5MA 3AKEA 2FN9A 5JPIA 2QTNA 4BE4A 2VA8A 1I10A 4G1VA 4Q9IA 2O0HA 2V5UA 3AEYA 1SC1A 2I03A 2LVBA 1YZTA 3DHYA 4ZARA 1M2EA 2B78A 3U4AA 5JVDA 2QSUA 2G9RA 4HXYA 3E2PA 1J20A 4ZOEA 1QTQA 1PCXA 2VWGA 3QPBA 2AX3A 4XGIA 3JQGA 1T8RA 1QH8A 2FE4A 2I7VA 4HB3A 1ZK2A 3QMWA 4M83A 1ZQ1A 1YFKA 4QDTA 5DNVA 2X0DA 4BLTA 2WJ4A 1P44A 2AZDA 1E60A 2XUDA 1VCMA 1QIFA 4P0TA 3HCWA 2VT3A 4LZWA 5DO9A 3K0FB 2O8CB 1QP4A 2MSLA 3Q9LA 1LBQA 1SIOA 3IPXA 4UOEA 3MB5A 2BP7B 2X6TA 4O5AA 4EABA 1TQDA 4HUQB 4E4TA 2W9XA 4FJ0A 3WYBA 1O3YA 3ITKA 2XT6A 2MMCA 2JGAA 2WA2A 4LHXA 3U1BA 5IMBA 2HU7A 3ZY2A 2FUEA 4FI3C 2ZBVA 3RVRA 4PM4A 4XYMA 2FLVA 3EPLA 2VK8A 4BIMA 4G9EA 4WESA 2P9FA 4JN6B 3IT2A 4MRPA 2HF9A 3T0IA 5AM4A 5IPFA 3OT1B 4RVUA 1QIHA 2QUHA 2CJPA 2QG6A 3CZCA 3GPDG 5ICSA 1ZOIA 2BDEA 1L7RA 3H0CA 2A9RA 1E2GA 2CKDA 5KTOA 4WI1A 2JL1A 2O7VA 4MJ7A 1GGVA 4G07A 3GIDA 4HTFA 3RWOA 3TKLA 4UAGA 4MVWA 1PWZA 1Z5PA 4KAXA 5DSXA 4ZU6X 4GVLA 5A4FS 4KR3A 1IPFA 1CRZA 2XTMA 3CNOA 1YBHA 4Q4AB 3AR3A 1E1NA 3OEWA 3A2KA 3D3KA 2WU4A 3HCAA 3OT4A 5AD1A 2BUCA 1LTKA 4YIKA 1R7RA 1X7XA 1G38A 1T5HX 4LF5B 3T4PA 1EVKA 1LQTA 3TQRA 1REQA 3B6IA 3B9BA 5AOBA 2R25B 5IRCD 3QPCA 3MWGA 1SU7A 4JLVA 3IUBA 3RNLA 3LZDA 5KSYA 3CMCO 4TQ9A 5E0OA 3AKDA 1KC3A 2GEBA 3KEOA 1Q7GA 1G9SA 1EB9A 1XZCA 1WCV1 3K6JA 1HT1E 2FQQA 5FYQA 3A6HA 3G9TA 4HWTA 4R7ZA 3SQOA 4MPJA 6AT1A 2GSDA 3O82A 1ZIOA 3H6HA 4GWLA 5AJYA 3A2MA 3DNMA 3IDZA 3T5DA 3WE7A 3QP9A 2QJRA 1KEWA 4P81A 3P97A 1Z6YA 2PGNA 3NIGB 4G5OA 4PAWA 1S6YA 4UASA 1KMHB 4CODB 4MXDA 4RKFA 4DXDA 4JSRA 4BWGA 5H4GA 5IAOA 1WL8A 2PXHA 4IV0A 1Q0RA 4Z1MA 3ZE6A 3CPJB 3OTHA 4I5DA 3MINB 2V7PA 3WFZA 3VKGA 2PL3A 2JVKA 1JR3A 1BZYA 2QX4A 2R6AA 3GT0A 4FYMA 2NTVA 3ESRA 4PPFA 4XX1A 4F21A 1FP7A 1CP2A 3PHCA 5BSUA 5KYNA 4ODIA 2JEYA 2W6OA 1Q0HA 1RRMA 1WLYA 4L8FA 1QJ4A 1HDCA 1D1QA 4OQDA 3LGXA 4RA6B 3WDKA 1FP4A 4EKIA 4X24A 2ZRGA 1U1FA 2FN7A 3D59A 1CR0A 4QUKA 4EBBA 1I33A 4F5YA 4YPOA 2HRZA 4DLTA 1NP3A 3LKBA 4G24A 4DJAA 5BSKA 5IYZB 4I9FA 1TTHA 2AEEA 1XAHA 1JDBC 3VR2D 5CEJA 2ACVA 2I6GA 2UZ1A 1JLLB 5CITA 2IPXA 1R1DA 1MIOB 1HEIA 2HMYB 2GPNA 3ESQA 1KI6A 1XVUA 4M1TA 4PAMA 5BN5B 2GN0A 1H94A 3WGYA 5BW8A 4XIJA 3UMCA 4PO9A 3DONA 1PJCA 3JVDA 1T8TA 3QXJA 4EUEA 2YHSA 3KUUA 4AG6A 2P2LA 4WNAA 3ZR4B 1LSUA 3O74A 3UT5B 5A6SA 3ZDFA 2X7HA 2QLBA 4GLOA 4MP6A 4JL8A 4DUZB 2FUCA 3ZG6A 2OCKA 1PR6A 1V35A 5LA6A 5AIAA 1XKXA 1KORA 2B1QA 2BFDA 5A71A 4ESOA 5L40A 3MLEA 3R3JA 4RTOA 3PC6A 2C5GA 1J97A 3NOQA 3I2IA 4HDQB 3WHKA 4QBFA 2HK6A 3BUSA 2O5RA 4MKHA 2EC5A 1A8PA 4RV5A 1VSVA 3I53A 1YQXA 2ZK7A 2VZ8A 3MTDA 4JUBA 5HM6A 4E2YA 4C29A 4NFYA 2J46A 1BJRE 3VU9B 4Z8XA 1BS1A 1RI3A 1FIUA 1ZBQA 1ESZA 1N9KA 3COPA 4JP8A 2V5AA 1G2PA 1IY8A 3PD0A 2WF5A 1Z6ZA 1TIKA 2I55A 3HBNA 5KOYA 3P32A 1U3CA 4YRBA 1ANKA 3H5IA 1JDSA 3E8XA 3O3MB 3M3HA 2O06A 3TO5A 3IESA 1TJ3A 1D2EA 1KJYA 2QE7D 3N86A 2VJOA 1CLUA 4I6EA 3TLEA 2PG3A 2ZIAA 3DE7X 4QPDA 4UUNA 3UK6A 4CLDA 1J2YA 4U2EA 3Q88A 5F1KA 1E79A 2P9BA 1IIRA 1KRWA 2ZATA 2HK8A 1MO6A 1E2MA 4RPJA 1GKLA 1GUDA 3IXLA 3O47A 4U0KA 3DDCA 3MILA 3R8CA 4WH0A 3LX4A 4EYGA 3ZU6A 4K40A 1J00A 1KHHA 1ZHOA 1QS0A 1BROA 1J8DA 2PJUA 4GSKA 2FEMA 3ADPA 3K1TA 1H8EA 5GTDA 2PYIA 4KAJA 2TS1A 4O25A 4BV2A 4MI3A 1GN9A 1ECGA 4YMUA 1E7SA 1YR3A 1MAHA 2GRAA 2O2ZA 1YOVB 3LUKA 1L3CA 3PGJA 4OMUA 2QL6A 4Z0PA 2O6HA 4UFPA 4XWKA 2QL7A 3GLIE 3C8ZA 3G2LA 4Q1FA 4DR1B 4FS3A 2J45A 4ER6A 4YRJA 4KFCA 1M1ZA 2X8WA 1UJBA 1V7CA 4N6OA 2GEUA 3SFVA 2ZU0C 3CX3A 3K1JA 4DM4A 3U3KA 3OZUA 1BO6A 2HMVA 3ZWVA 5GONF 5UKDA 3IEIA 1X1BA 1KAGA 3IIMA 2XCLA 5IEJA 4RJJA 2V0CA 1HDYA 2A5GA 1D1TA 5DNAA 4R1MA 3FYDA 1VYVA 5BT9A 3CUWA 3S1LA 4EHFA 4HY3A 1LDYA 5AK0A 4B6RA 5KNDA 1A9OA 4Q3DA 3W3ZB 3THWA 2CY0A 2QTVB 4PW0A 2IYLD 4TROA 4FEAA 4UPDA 4NZMA 2Y4OA 1AN9A 4H7HA 4CWAA 1N9GB 2OGWA 2XNDD 4Y6QA 3KYCA 2F8LA 1SFRA 5IAAA 3IUJA 2HJRA 4DFDA 3D8SA 2O59A 5B37A 3G5TA 3FTEA 2YV3A 1YVEI 2O19A 4LI0A 2QY6A 1YDGA 1CF2O 5FUVA 3W9SA 1EAYA 5J5CA 1YS6A 1CERA 1PX0A 1TEVA 2EIHA 2IODA 2UZ0A 1O9BA 1V71A 2XYRA 5DHAA 3GFVA 1FEZA 2C2BA 2IYAA 5LP6C 4BTVA 5JZSA 3N39C 4DSTA 2FRXA 3WGJA 1J1UA 4ZIRA 2OVBA 2UXBB 2FW7A 3GUCA 1WS6A 5DPMA 2FW1A 2VOJA 3BGSA 5B2EA 4NPCA 1JIQA 3EXIB 2WNIA 3NHWA 4X1IA 5CTJA 4UDYX 1Z62A 2XQVA 4EMBA 1P5HA 3NTQA 1UJNA 1V5WA 3J81A 1C8KA 2I76A 2AOWA 1WQ3A 2C3OA 5TQ0B 3OWXA 3Q2IA 3U81A 1U2DA 1A9TA 3OCZA 3AI1A 1YFZA 3E82A 1Z0IA 3H8VA 3HDJA 4GZ6A 2GD0A 2DM6A 2PJRA 1ZM3A 4BNDA 1P3JA 1JZTA 1HSOA 1SQFA 3M70A 5DT2A 1XVTA 3JWIA 5CH3A 1PZGA 3MOIA 2EEPA 3BGWA 3RVPA 2AJ8A 3F1LA 2RG1A 1TZMA 1SWVA 2FX5A 5CA0B 2ZU6A 1QYRA 1TTTA 3N0XA 4XFDA 3PEEA 2VKTA 1NUUA 1VB3A 3I9OA 3U9SA 4LZJA 2ZAOA 2VP9A 2X3FA 4Q05A 1IFXA 4U2KA 5HFNA 1EXDA 3DO8A 621PA 2VRCA 3B53X 1Z4KA 3B6KA 1E9FA 1PVVA 1QG6A 2EGUA 2PX3A 4KIJA 3QX8A 4EVSA 7GPBA 5IH3A 1XJ0A 3IA2A 2VJMB 4YUYA 1FNNA 2VUTA 3O8CA 5CW2A 5CA1F 1N5OX 2CK3D 4MQ5A 3V1KA 4X1YB 4CM6A 1TAUA 3LL7A 2H6EA 3EZ6A 1JJFA 2ZTSA 2V8BA 1SK9A 1U04A 2MINA 4ZMRA 1CUHA 4D0GA 4AROA 1FZQA 1Z74A 2XITA 2WG2A 1NASA 2WTXA 4WZZA 4A0QA 4UZSA 4BX2A 4PHCA 4R83A 2Q5JA 5JLAA 2FMTA 4O4HA 3V4RA 4CEHA 3HDTA 1GARA 2NXNA 3CLTC 3I6IA 3L0YA 5EXEA 1R4MA 4DLVA 4E5UA 1RI4A 5ESXA 3NXSA 4P5EA 2AUTA 4RPHA 4HGNA 1J8QA 1U28C 2XAAA 3CKYA 4HXFB 3WL8A 4N41A