4K26A

4,4-dioxo-5,6-dihydro-[1,4,3]oxathiazines, a novel class of 11 -hsd1 inhibitors for the treatment of diabetes
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
265
structure length
265
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISGIINAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1,1-Dioxo-5,6-dihydro-[4,1,2]oxathiazines, a novel class of 11-HSD1 inhibitors for the treatment of diabetes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 101
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2013-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4k26A00
3KYDA 3L07A 2VQ3A 4FN4A 1XG5A 4IM7A 2EG9A 3H3JA 3SXPA 1LU9A 1T2CA 3I23A 1QR6A 3E03A 1DRUA 1RPNA 4AG3A 4MOWA 3JQGA 1H0KA 4GX2A 3I83A 5T64A 2NLOA 2QHXA 3LF2A 1SBYA 3GZNA 4BUCA 3ANMA 3HN2A 1GCOA 3GPDG 1I3KA 3IMFA 4WCDA 1P77A 2FOIA 3ZNQA 3RC7A 5I9LA 2CY0A 2PZKA 1ZK0A 4GMFA 5G0VA 5B4UA 2EF1A 4E13A 4B3IA 4E5NA 4E2YA 1N5DA 2Q4EA 2YFHA 3UCFA 1E7QA 2BLLA 4J4TA 4DREA 3SX2A 1I36A 3WIDA 3H9GA 3EMKA 1SAYA 1ULUA 3GDGA 3OIFA 4LN1A 4OM8A 3RUEA 1SO8A 3ZU5A 4MIYA 4ND2A 1I30A 5IXYA 3R0IA 4IJUA 2RAFA 5U1PA 3G0OA 3L9XA 2NV6A 1A72A 4KP7A 1PL6A 3VPFA 1PS9A 3ZHZA 3ONEA 4CMBA 1XQ1A 4D7AA 3E18A 1KY5A 2J3IA 3ULKA 1X7DA 4YWJA 3W4KA 2H63A 1E7YA 3AY6A 4KTTE 4B4VA 2H9IA 3O8QB 4O63O 4NBVA 4TVOA 5KIAA 1E3IA 3PJEA 5A3VA 4XJSA 2R00A 4UVGA 3EVTA 1JN0A 1TXGA 4JJFA 3GMSA 3DB2A 3IL2A 5JMPA 2X58A 3QVOA 1WWKA 4WUVA 4ID9A 3TOZA 2JFGA 5BNTA 1EFKA 1PR9A 1XWFA 5TLSA 5KJFA 4CM3A 4FB5A 3PTZA 4CMGA 1FDUA 2O3SA 2NU6A 3BMNB 2OUIA 3E82A 3PRJA 3OQBA 1HDYA 2F00A 4CMIA 4ALLA 3DZBA 3GC6A 2TMDA 3A06A 3AW9A 1XGKA 2Y1CA 4EUHA 2JCVA 3E9MA 2A4KA 3MOGA 4NJMA 2NVUA 3O9ZA 4IZIA 2B5VA 4XCVA 4YJDA 1Y6JA 1R15A 3ZV3A 5A9RA 4R4JA 2UDPA 4ALMA 5JMWA 3FNEA 4R16A 1B8VA 2D8AA 3NJ8A 3GDFA 1NVMB 2X6TA 5BNFA 3A9WA 1UXHA 2ET6A 3FD8A 2ZKLA 4BMSA 1E3WA 1PJ2A 3PWSA 5ILOA 2Y99A 3DZIA 2BMAA 3JQAB 4JP2A 5A3JA 3FNGA 1ZXBA 4DPKA 1RM4A 4YAGA 1DPGA 3NTOA 2X4GA 1W6UA 3Q1LA 4R5HA 2Y05A 3K92A 2VHWA 2ZB4A 3C8MA 4YEDA 2JFHA 4E6PA 1I32A 4BVAA 1YBVA 2ZTMA 3V2UA 3VPHA 2ZQZA 1WW8A 1XEAA 4RF2A 3PHIA 4YCAA 4CQMD 1MUUA 1C1DB 1HL3A 2VOJA 4B79A 3AOEA 2FSSA 2GASA 5CAEA 1A27A 3GR6A 4GAEA 5EMHA 3WGTA 2Y1DA 3WLEA 2E49A 1CJCA 2P5YA 2I6TA 4E31A 4OOFA 4BMVA 4EI2A 5TGDA 3C85A 2HCTA 4J90A 2ZYGA 4WNCA 3IOYA 2IE0A 1YDWA 1RKXA 1YOVB 2UUOA 3GQVA 3PEFA 2D4AA 3RBZA 3QVXA 4CL8A 4JQCA 3T4EA 2IDZA 3TDKA 1GPJA 4O59O 2BFMA 4AJLA 4YDRA 3PDJA 3S2FA 4A0SA 1PEDA 3AJRA 2C7GA 4EEXA 2JKVA 4MINA 2UYYA 2HK9A 1PJCA 4GX1A 1E5LA 4M55A 4CV2A 4JX8A 1PWXA 2WEKA 3DHYA 1GYQA 4Y6PA 4GL4A 3WFIA 5AXDA 4GI2A 2CNBA 2RIRA 4XQEA 3WYCA 4PG7A 3GN2A 3B1FA 2GDZA 5L95A 1M2WA 4LISA 1DIGA 4KTVE 3KSDO 3DZKA 3P5SA 4AJJA 1MB4A 4CM8A 1XELA 2YDYA 2EP7A 2J5QA 4A10A 2ZIZA 4PRKA 1W8DA 5TF4A 2VT2A 2DUUA 1Z82A 3L9WA 5KNLA 4Q3CA 1NWHA 5JYEA 5DBGA 2VWHA 4IDBA 4ZQHA 4P8RA 1A9YA 1BG6A 4XD2A 2X22A 2ZB8A 1K5HA 1SZJG 3KSZO 1ZUD1 4L73A 3N7UA 4J1SA 4RVSA 4RZIA 3JQ8B 3STHA 3TPCA 4GVXA 2BGLA 3OM9A 4DA9A 3AOEC 3CUKA 5CPFA 2D5CA 1GUFA 1ISJA 1LLCA 4XGIA 4ZQFA 3ZWPA 3VKUA 5DOZA 3L4SO 1KEVA 4Y9DA 5COBA 3OECA 1T1SA 1LLQA 4GKBA 5JFOA 4YYZA 3DHNA 5MGBA 4RF3A 2HSDA 4YTEA 4NI5A 2FY8A 1Z7EA 5CDUA 2HK8A 4OL9A 3UW3A 3GDOA 1F8FA 3OEWA 4FQ8A 1A4IA 1X0VA 5JSFA 2BRUA 3DZJA 2PGLA 4BNFA 2YFQA 4IGEA 1VC2A 4XIYA 1XR3A 3HFGA 4RL6A 4AVYA 5CDGA 1PWZA 3ICCA 1CQIA 1HT0A 4OXYA 4BNUA 3ON5A 2ZCUA 3BIOA 1Y1PA 4PZDA 1ZVMA 3PK0A 3BMOA 4WNIA 4N54A 1Y8RB 1XCBA 4DLLA 4DQVA 1O0SA 2AMFA 2PA3A 2PH5A 5IG2A 3ZNOA 4K6CA 4WLUA 2WTBA 5FFFA 3KXDA 4B7CA 1TLTA 4WCFC 3LT0A 1HDOA 4J7XA 3RFVA 3UICA 1MC5A 4B7XA 3TZHA 4BNHA 3RJ5A 3MCVA 1PR3A 1GADO 1SMKA 1XU7A 3RWBA 4D44A 1DAOA 2EXXA 4ZHSA 3GPIA 1JA9A 1Y8QB 4FD3A 1U8XX 3AY7A 4DYDA 4NPCA 1HWYA 3ZWYA 4BNTA 2C7VA 2VT3A 4IBOA 3DO5A 4TKMA 3DZGA 2NU9A 3PQEA 3EW7A 2FPPA 2GUGA 3VC7A 4CM4B 3BTVA 1DB3A 4H7PA 1D8AA 4RPHA 4ND1A 4IGFA 1LI4A 3WIEA 3GH3A 3AFMA 3H2SA 1H2HA 1X13A 3H9EO 4JIGA 4LSMA 3DOJA 1UZNA 5HS6A 4BO2A 1DIBA 3OJFA 2ZK7A 5JCJD 4E2ZA 1Y5MA 5A5EA 1OAAA 4P4LA 2UAGA 4UEKA 4RDIA 1WDKA 2H1SA 1JWAB 1S6YA 3D5QA 3HDQA 1DXYA 2VCYA 4IPTA 2XF8A 3DBRB 4O5OA 1E77A 3MJSA 4LMRA 4MIOA 5G4KA 2O50A 1IULA 4L76A 2D2IA 5IJZA 4DPLA 1I3LA 1MFZA 5F1PA 1H93A 4CLXA 5KKCA 2W2KA 4RORA 5BSGA 1TVEA 3JQCA 3QV1A 1BTOA 4RVDA 3I9JA 4Z0PA 1O9BA 1YQGA 3TWOA 4UULA 3R3SA 4UVIA 1HYHA 3OJ0A 3MJ4A 4OXKA 3CKYA 1I3MA 5DBFA 1U2DA 5G0SA 2QQ5A 5G4LA 3CINA 3PHJA 1QMGA 1R6DA 4PLWA 4JGBA 3JQBA 1F14A 1HYEA 4R1UA 3F4BA 2ILTA 3FTPA 1ZXLA 4E33A 4XX0A 1YQXA 4II2A 1U4OA 3VPGA 4CQLB 2O4UX 3KZVA 4TQGA 3PJFA 2NUAA 1UP4A 2RH4A 4TSKA 5A05A 3GVCA 4KUEA 4IS2A 4K1LA 1QRRA 4A03A 3FNFA 3I5MA 3MTGA 3PYLA 5JO9A 1IZ9A 3CEAA 2YV1A 3JQDA 4RPLA 1PSDA 4YXFA 3WG9A 3ROQA 5IFLA 2O23A 2NADA 4BNWA 4E5MA 1H6BA 3ORFA 4ILKA 2RBEA 3PZBA 2CF5A 4ZN6A 1C3VA 3F5QA 1NAHA 2B0JA 5GZ1A 1B7GO 2NTNA 2Q49A 1O8CA 1DDOA 2ZTVA 5AQ1A 1EVYA 5IDWA 2SCUA 3L0DA 5AVOA 5A5FA 1NR1A 2GO1A 1O95A 1PJTA 3K31A 1TT7A 4DYVA 5DP1A 1HLDA 3WOHA 4ZRNA 2BHLA 4D46A 4CM7A 5BR7A 2FRDA 3LT4A 4BO4A 4M87A 4LRSB 5EIOA 1WAMA 2CDAA 2F1KA 8ADHA 5GZ3A 4J1NA 1VJ1A 5T8KC 1B8PA 3E6AA 4DIFA 1PGPA 2EKLA 1I3NA 2GNAA 3DWFA 4IQ8A 2RCYA 3WFJA 2VNSA 2HUNA 1EUDA 2D5AA 1W73A 1U28A 2VTDA 2ZYDA 1R12A 1J49A 4XYGA 1X15A 4D79A 1UDBA 2ZB7A 2BFAA 2DTDA 1LSOA 4UVEA 4PG5A 2FZEA 1H6CA 2NSDA 1YOVA 2BGKA 3DFZA 1UUFA 1X1TA 3GEMA 1YQDA 3GOHA 4Y6SA 4L4XA 4JJGA 2J3HA 5CEFA 3L4BA 4G5HA 4EJMA 4Z9FA 4X54A 3WMXA 3MOIA 4UUPA 3GN1A 3PLNA 2VHVA 4D45A 2RHRA 4Z0TA 3I9NA 3DOCA 5L3ZA 1H2BA 4MVJM 2JAPA 3Q0EA 2YQ5A 2DBZA 3PLRA 1JKJA 4CR6A 1VKNA 1V35A 1HE2A 4MJLA 2FP4A 5THKA 4L75A 3RU7A 3UVEA 3NT2A 2FR1A 2YY7A 4WLNA 3ZW9A 3ZWOA 5H81A 4FOOA 1A5ZA 1U3VA 4AJNA 1U8FO 4IJWA 3A4VA 5JDCC 3C3XA 1NQOA 3ZV5A 2DLDA 1ZK2A 3L4BC 3IAHA 1LRLA 1UXJA 2JD1A 4LMPA 4AJIA 1T2DA 1R4MA 4J49A 2IEBA 4BNLA 2VUTA 1YXMA 1U1IA 4JBHA 2JAHA 4ZD6A 5IN4A 3INGA 1B15A 3F5SA 3NEPX 2JFFA 3ZWNA 1ENZA 3AM3A 3PHHA 4Z9YA 2I76A 5TJ9A 2AA3A 1YH3A 3HJAA 3RUCA 1MA0A 4GQAA 1QSGA 2EP5A 5DNAA 2Y66A 4M89A 3V5NA 1AHHA 2BF7A 2EW2A 4ZGWA 4YT8A 1GYPA 4Q9NA 3WGYA 4PZCA 4RVFA 3BTSA 3GF4A 4MP3A 3V8BA 3LSYA 4DIBA 2VWPA 1UAYA 1NQTA 1O6ZA 3UAGA 3U3XA 4JNKA 1HDCA 5GY7A 5ICMA 4GSKA 1LXCA 1VJTA 2EEZA 1M75A 3WTBA 2B4RO 3HDYA 3JV7A 4JK3A 3WGZA 4PLVA 4KQXA 1K89A 2YQ4A 1V3UA 4MVJG 4R41A 4CV0A 5LDHA 3GHYA 2W2KB 3BTUA 4WLEA 2VOEA 3TNLA 1U5AA 3OICA 1FDSA 1HZJA 4P22A 3TL3A 4NH4A 1V3TA 4OHUA 1EZ4A 4LGVA 3KRTA 4Q39A 1F06A 4WK6A 5JBIA 1P0FA 4QO7A 1ZW1A 3OP4A 2IZ0A 2VHYA 3PFFA 3RROA 4AL4A 3SJ7A 3QWBA 4FJ1A 2CUKA 4BV8A 4LCEA 1PL7A 4BO9A 3TF5A 1OFGA 2JJYA 4AJOA 3JQ9A 2FSVA 2NM0A 4PLPA 1FXSA 4HUJA 3JSAA 4NNJA 2QG4A 4XWYA 2V6MA 1C1DA 4P4NA 4D43A 1EFLA 3D3WA 4DLAA 2BFOA 1Q7BA 1ZIDA 4Q3BA 5CP8A 4RF4A 1I2CA 3RKRA 4F6CA 1E1MA 1MXHA 5THQA 1PJ3A 5ILGA 3CSDA 2PNFA 4AJEA 5ITVA 1DLJA 2NVWA 3D3EA 3ZZNA 4F46A 3T4XA 5I7VA 4RLSA 1M6WA 4INAA 3EUWA 3R1IA 3RU9A 4EUEA 3E9NA 4L4SA 3GEDA 1E3EA 1PZFA 4FDAA 5JAMA 3JYQA 2JCXA 5A4DA 5JNLA 1Y5RA 2HMTA 2Z1MA 3OHSX 4XJTA 3S2IA 1K0UA 4GX0A 3V1UA 4BIIA 1NFFA 2E37A 1MGOA 4XYEA 2AE2A 4W9NA 3UH1A 1CQJA 1ORRA 1GEEA 3JCZA 4QXMA 1P0CA 3WBFA 3WGHA 2P9CA 2Y1GA 5DT9A 1SPXA 3WNQA 1B14A 1NNUA 2BD0A 1NXQA 5ER9A 4W4TA 4BKPA 4QEDA 2VYNA 2AEMA 3OQ1A 4M49A 3FR8A 2O3QA 4XGNA 1Y81A 4YBZA 1HE3A 3LC2O 1PTJA 1I5RA 3ADOA 3KLPX 3PQDA 1E7RA 3D5TA 2GGSA 3GA0A 3UF0A 2OFPA 2Q2WA 3PQFA 3WGGA 4BKQA 3E8XA 3PJGA 2YUTA 1OBFO 3KYBA 1ZEMA 5HM8A 1AXGA 1A71A 4FFRA 1RM5A 4YAIA 1UZMA 1GTMA 2B5WA 4I1IA 4J1TA 2QRJA 3BHMA 1LDYA 1WZIA 3BZUA 3DONA 4RQUA 4WGGA 4AJKA 3AUAA 5AXAA 4KUGA 3BHJA 2O7QA 3TFQA 3LT1A 2GF2A 3DBLA 1WDLA 3T7CA 4CM9D 1WLYA 4NMHA 4AJ4A 1LDEA 1PGQA 3C7DB 3TL2A 1H9BA 3I6QA 1G6KA 5KJEA 4WEOA 4I9NA 2H5LA 2OMEA 2JL1A 2GZ3A 3AI3A 5F21A 4BO5A 2DTEA 2C59A 3JQ9C 4R3NA 1ENYA 3ENNA 2VWQA 1VLLA 1C14A 4WCFA 4LRTB 5TQVA 4D3SA 2XXBA 3HSKA 3I1JA 3HB4X 2YDXA 2AG8A 4GX5A 5TT1A 5FYDA 2O2SA 1WNTA 2EGHA 2GPTA 2YHIA 3M6IA 3DMYA 1MC4A 3LVFO 5BSFA 2B4QA 4BNXA 1IOLA 1PZEA 1QYCA 4B7UA 4U6QA 3TZCA 3V2GA 3D64A 5DDIP 3OIDA 3X2EA 3FBTA 2LDXA 1YB1A 5I7EA 2C07A 2EJWA 3A14A 3PGJA 1DRWA 4RCVA 2X7HA 4E5YA 1V0JA 1T2FA 4PG8A 2J6IA 1ZJYA 4PLGA 4PLTA 2V6BA 5FEUA 4WLFA 1J0XO 2X0JA 3ZU4A 3QWAA 4AJPA 1SOWA 4HV4A 4O1MA 1Q1NA 2CSUA 2OZPA 4ESOA 4FFLA 4IZHA 1DHTA 4W6ZA 4XQGA 4XRRA 3RC9A 3BMOB 1M76A 2DBRA 2Y1OA 4YJHA 1OC4A 3LDHA 2ZTLA 3U0BA 1U9JA 4XKJA 2DKNA 2EJVA 3GRPA 3DZFA 3JD1A 1JVSA 1D1TA 3HWRA 4PFJA 4TRNA 1PS0A 2V65A 3WWZA 4CM6A 1CYDA 1YL6A 3DBVO 4UVDA 1TEHA 4UEJA 4PG6A 5LC1A 3UN1A 1I2ZA 2G1UA 3JQ6A 5KJ6A 1C0KA 1IL0A 4PRLA 3OQ6A 3BMCA 3JQAA 5EESA 1QV6A 1E3WB 2HO5A 4CJXA 1R0KA 5CDTA 1E6UA 4JBGA 1DHRA 3ICPA 5KTKA 2B4TO 3BMQA 5C7LO 5IXSA 3FSRA 4WOJA 1V3VA 2GYYA 4HKTA 1HE5A 4N7RA 3HN7A 1FDTA 1P1HA 2YYYA 1GAEO 5TNXA 1NFRA 3F46A 4BB6A 2OOSA 2GCGA 3JQFC 3BHIA 3QSGA 2IXBA 1WMBA 3AM5A 4J6FA 4UREA 5BQFA 1GZ6A 3KEOA 5EINA 3UFXA 4YR9A 3WJ7A 1LQTA 2IRWA 4XIJA 1YJQA 2VRCA 5DULA 3QP9A 4NJOA 1P31A 1GFSA 1F8GA 4JROA 3G1TA 4IQ0A 4XA8A 4XRGA 1KOLA 4YPOA 4J2HA 4IJKA 3H4VA 2DBVO 2YV3A 3ZV6A 4DBVO 3OEYA 2HLPA 3WNVA 4A2CA 2Q2VA 1NP3A 3AU8A 1L7EA 2P4QA 4CLOB 3NRCA 2C29D 2GR9A 2Y0DA 3K73O 3M1AA 2DPHA 1ZK4A 1ZJZA 4PG4A 2FR8A 1Z6ZA 2W2LD 3RC2A 2OHXA 4FCCA 3PJDA 1LRKA 4ITUA 4E12A 5I8WA 2VN8A 2P2SA 4QX6A 1TB4A 3S55A 4CM1A 3DBLB 3JQBC 5EQDA 3H6KA 4FGWA 4BO1A 1E6EA 4WPGA 1P3DA 2JHGA 3K9QO 4FIZA 4FJ0A 2A92A 1ZK1A 4G65A 1PJQA 2NNLD 1AGNA 2OXIA 2I5PO 3E9QA 5DBIA 1LDMA 1X1EA 1R0SA 4YRBA 1PZHA 4CLRA 4Y6RA 3GLQA 3ST7A 3OETA 3M1LA 2DBQA 1BMDA 2HMUA 2V7PA 3DOOA 1Q0HA 3JQGB 2Y93A 4CM8B 4I5FA 3DZHA 4J16A 1CWUA 1KVQA 1VJ0A 1AUPA 3ROKA 2VNAA 5C7OO 9LDTA 3I4FA 1JLLA 3M2TA 1JDJA 1ZO8A 1EEHA 2XAAA 1GZ3A 5DOVA 4Q3AA 1GPDG 5B4TA 2VRBA 4RDHA 1UP6A 1QYVA 4KDFA 5F5LA 4YJGB 1L7DA 4OXNA 1JAYA 1XQ6A 3JQ8A 4IMRA 3DQPA 1LRJA 4HFJA 1U3WA 3D0OA 3RCBA 2HJRA 1Q7CA 5CG2A 5AXBA 1E0DA 4ZQBA 2PWZA 3GT0A 4NQZA 3ZWXA 2Q99A 2PLAA 4IDAA 4A7PA 3GEGA 1HYGA 1EBUA 3TRIA 1HKUA 2R2GA 2X9GA 1HEUA 1FF9A 1PGNA 2X23A 1G0NA 4N5LA 7ADHA 3AI1A 2P5UA 4OMUA 1DAPA 4IJVA 3X2FA 3TFOA 1E1LA 3ANLA 1LQUA 5COAA 1XHLA 1K6IA 3VH1A 4R54A 5CG1A 2WM3A 1P1IA 3QW2A 1ISIA 2RHCA 3GAFA 3NTRA 3O03A 3JQAD 2UUPA 1HTBA 3GVPA 1TI7A 4FFNA 2NQTA 2WJPA 2IYPA 1N9GB 2Q45A 1E92A 4TKLA 2PZMA 4RZHA 3BMNA 3KM0A 2IZ1A 3WQQA 5JDCA 6ADHA 1DC4A 1LDBA 1PX0A 4PVDA 2IXAA 3W8EA 4BB5A 1KEUA 4RGBA 1PJBA 4DGSA 4HP8A 4GPD1 4ZICA 2B36A 3GVXA 1AHIA 4MP8A 5L4SA 2AHRA 2C82A 2I3GA 1UP7A 3PWKA 3L77A 4P38A 1HSOA 3L6DA 2NQ8A 3B6ZA 2D1YA 1DJNA 4XGKA 1WPQA 4KZPA 9LDBA 1AE1A 3BMCB 3ZN2A 2AEJA 1Y9AA 5C7IO 2VZ9A 4BNYA 3H65A 3VVCA 2UVDA 5IDXA 2Q4BA 2J5RA 1T2AA 1ZK3A 1YL5A 3N74A 5FI3A 4AFNA 1H6DA 3PHLA 3H3FA 2OGUA 2DFDA 3NDIA 4WKGA 1MG0A 2WD7A 3G17A 2W2LA 1O89A 3ITKA 4E0BA 2X0IA 3GUCA 4TZKA 5IDQA 5KVCA 4E3ZA 4NZ9A 4U0JA 2IZZA 3IP3A 1JKFA 3ASVA 2YW9A 5A04A 1BGVA 3CPSA 4DXHA 4GMGA 2FWMX 1H6AA 4AICA 3VH4A 5B1YA 5L9AA 4IXWA 1Z74A 4ND5A 4R1TA 3WX0A 4IXTA 1LA2A 2Q1SA 4BGUA 5CDSA 5T67A 3AY3A 3EAGA 4EITA 1O5IA 2C2YA 1YS4A 3IC5A 4ZQEA 5BSHA 5L4LA 4E32A 3DEYX 1BVRA 1U3TA 4W82A 4CLOA 3QLJA 2NTVA 1ZKMA 4LVCA 4NBUA 1EMDA 4YAEA 1ISFA 5LCXA 3DR3A 4H3VA 2DC1A 4YAJA 5JXWA 3KUXA 2VUUA 4CM4A 4C7KA 3NJ4A 5L45A 4MPDA 1JU9A 1T1RA 1RM0A 2DM6A 1P1FA 3MEQA 3PVZA 3ONFA 3TQHA 1WXDA 1IE3A 3RBVA 4BKUA 1EUZA 3EK2A 5CDYA 2WYVA 3E1KA 4W9NC 1N9GA 4B4UA 4J3FA 4ZVVA 1ZMOA 4TRJA 3UCXA 4Y8VA 4W7IA 4YRAA 1WVGA 2VWGA 4J9UE 4TWRA 3ZNNA 4CMHA 3WDSA 3NDRA 1QLJA 1V8BA 4MVJA 3SBOA 4RVHA 1LDGA 4CMIB 2NACA 5TC4A 1NPTO 3Q11A 4YQZA 2P68A 4KWIA 1M6HA 3KBOA 4QO8A 4D0SA 1HDZA 3DMTC 3P2OA 3F47A 1R66A 1VL0A 4GLLA 4CODB 3K30A 4RVGA 1EQ2A 5EERA 1B8UA 3SC4A 4NK5A 3CMMA 3L6OO 2NTJA 4NHEA 1HE4A 4XYLA 4HWKA 1DFGA 1ONNA 2J3JA 3I6IA 3ZCXA 3I4CA 3EYWA 1KERA 5F3RA 3FWNA 1GY8A 1GYRA 2EGGA 3UHAA 1HZZA 4DVJA 3GFGA 4WCFB 1A9ZA 2QYSA 5DP2A 3AFNA 4CQLA 1T25A 4IIUA 4J2OA 1I10A 2HKIA 3SLKA 4BNZA 1QYXA 4FPXA 1DRVA 2ZTUA 3S2GA 2WSBA 5LDGA 3S1LA 1MV8A 3NGXA 1VSVA 3WSVA 1W0CA 2QRLA 3AU9A 1YB5A 3I9KA 3O8QA 3QVWA 1CIVA 1LC3A 4I5DA 4GLOA 3KOUA 2PD6A 1LLUA 1P44A 2DFVA 3TJRA 1PQUA 5ES3A 5CHEA 4OOEA 5JE8A 1EUCA 1VM6A 4R51A 5TSDA 4DC0A 3PIIA 3PYXA 4NIMA 4YT2A 2GLXA 4NG5A 3AWDA 2Q46A 4OYRA 1UXIA 2Y1FA 2PGDA 4FC6A 4GWKA 4RPKA 4RQTA 3C7AA 1Z45A 3QRWA 2HU2A 4FOSA 2VZ8A 4IDGA 4URFA 2J5KA 4OJNA 5JDIC 2CVZA 1AXEA 1V9LA 2VYVA 1HDRA 4MIEA 3OIGA 1ADFA 1MFPA 3DBHA 3Q6IA 1YB4A 1OC2A 4Z0HO 1NM5A 4FFPA 1GEGA 2Q2QA 4U8GA 6LDHA 4A5OA 2WWRA 2VUSA 4I5EA 1IUKA 4FSHA 1XYGA 2I66A 3V1YA 1GQYA 4A26A 3WGQA 2FPGA 3ZWCA 5U9CA 1W4ZA 2VZ0A 3LT2A 1N2SA 5T5QA 1B16A 3PFWO 4MVJI 1E1KA 3QIVA 3KV3O 4KDEA 4A73A 1D3AA 5IZCA 3QWHA 3SLGA 2LDBA 2R00C 2FHSA 3HQ4O 4Z6KA 1NTOA 3VHRA 4JN6B 4GVLA 5HBRA 3GFBA 3O38A 3PYMA 5C37A 2PKQO 4YQYA 3LC1O 4CPDA 4ND3A 4CM5A 5A9TA 5IF3A 3WB9A 1ZSYA 3KYCA 4BO0A 3TN7A 4E4YA 4OGWA 1Q7GA 3QE3A 3COSA 5I9MA 3HE3A 5HA5A 2D59A 3ZGYA 2X0NA 2EWMA 3GNTA 4XDYA 4H15A 4GWGA 1BRMA 1JVBA 3PPIA 4IDCA 5I9NA 1I0ZA 1R4NB 3NAQA 4HY3A 1N1EA 3OA0A 5A03A 1QXSA 4L74A 4NU5A 1GV0A 1PJSA 1YE3A 5F5NA 5A06A 4BNGA 1LJ8A 1FJHA 3INRA 3U4CA 2QX7A 1YKFA 5ENDA 1XDWA 4BQRA 1VL8A 3VVBA 3GGGA 3G79A 4MKZA 4NR0A 4RLHA 4IDFA 5TRTA 4R1NA 3EHEA 2BI8A 4WLVA 1MLDA 3FNHA 4NBWA 1ONPA 1K6XA 2E6UX 3IIEA 4FW8A 4NBTA 4FJ2A 5JPIA 1B0AA 1DJQA 4HXYA 1D1SA 4YA6A 4MVJD 3DFUA 2EHDA 4CLHA 3ASUA 1VSUA 1YDEA 4E2XA 3UGKA 3F3SA 3ROMA 2O3JA 2P9EA 4TMFA 2GN4A 5ENVA 4CLRB 3RQSA 3A28A 1CDOA 1KYQA 4R5MA 3RKUA 3RBXA 3GNSA 4PLZA 1SC6A 1XSEA 4JXKA 1RWBA 4RVUA 1IY8A 1P1JA 4RF5A 4U0KA 2NVUB 1M67A 3JTMA 4K26A 4EDFA 4K6FA 2X0RA 4E5KA 4LVUA 3RI3A 3JYOA 5EJ2A 4BGEA 3OA2A 2Z5LA 3MJCA 1WDMA 4II3A 4U6SA 5JO0A 1PQPA 3NKLA 3HZZA 3ZHYA 1N8KA 2NU7A 2J8ZA 1NX6A 1FMCA 5L53A 4I08A 3PIDA 4CM9A 3HNPA 5KVSA 2PD3A 3VAZA 3VZQA 3FR7A 4EBFA 1MXFA 3WGIA 3ZH2A 3F4LA 3NUGA 3RIHA 2ZJ0A 3D4OA 5MDHA 2PGJA 2BKAA 3JD0A 4TVBA 4YJFA 4CMEA 2G0TA 4MVJP 1KVSA 2PH3A 2Q1UA 1UH5A 2VYVD 5L7YA 4DLBA 1KETA 1E7SA 3KB6A 4UAGA 5KWEA 1C0PA 1UJMA 3BAZA 1NPYA 4ALNA 1D4FA 3W8FA 1K2WA 3BYZA 3FCOA 4QT0A 4A27A 3N58A 1YONA 2Y68A 3OMLA 1SEVA 5FF9A 4W7HA 1YBAA 3GK3A 3I9OA 5DCWA 4DPMA 1U3UA 3DDNA 5JW6A 1ULSA 1UR5A 1J5PA 3OBBA 1EVJA 5HWSA 1MP0A 1PIWA 2P4HX 3EZLA 4DQXA 2WYWA 4XR9A 3W6ZA 3IKTA 3VZSA 5I7FA 3AUTA 4D0RA 1Y7TA 1Y8RA 3FWZA 1NVGA 1VE9A 2YHUA 2NVBA 1KVUA 1KBZA 1TT5B 1OI7A 3KTDA 1WZEA 3DTYA 1XU9A 1E3LA 4CMCA 1IZ0A 1EDZA 3Q2KA 3KLMX 3PWZA 1SOVA 3KHUA 3UCEA 1ONOA 4FS3A 2FPIA 1GD1O 4XEHA 8LDHA 3VKVA 1E3SA 3WYEA 5L51A 3GUYA 3MJEA 4YT5A 4N5NA 5U4QA 2QZZA 3G49A 3RUAA 2CFCA 1VRWA 4JBIA 3GHHA 3AI2A 3K8ZA 5EN4A 1BWSA 1GR0A 1R4MB 2HRZA 1KS9A 2O7SA 5G2OA 4WEQA 1U7HA 1ZFNA 3W4IA 3ZWAA 1EE9A 2YZ7A 3VPSA 4S1VA 1J6UA 4DIOA 1RM3A 3M2PA 1CF2O 3LC7O 1GCUA 1U2GA 5JCXA 3RVDA 4NK4A 1YVEI 4LW8A 3RUDA 4Z3DA 2V6GA 3IKVA 3ZDFA 1IPFA 4CR7A 1GQ2A 1YO6A 3IJRA 3K2EA 2GN8A 1BXGA 3FPCA 3V1TC 1E6WA 4J4BA 3UOGA 4QECA 2I9PA 3C7CB 3FF4A 2X5KO 5DF1A 4I9UA 1T26A 4GGPA 4DQUA 2AW5A 2C5AA 3OSUA 2Z95A 3AOGA 1EVIA 2B35A 4QTZA 3WSWA 1X7HA 4OKNA 2O3RA 3JQ7B 2UV8A 1PU2A 3ANNA 4E5PA 4S3MA 1EQUA 4PZEA 1VL6A 3IJPA 4CMKA 5AYVA 1XKQA 3ETEA 4CV1A 1EK6A 4BO8A 1NPDA 4EYEA 3K6JA 3K96A 4N18A 4BHTA 4DC1A 3NX4A 4CV3A 4FGSA 2DQ4A 5A9SB 1JTVA 3ZNPA 2G5CA 1PQWA 3FPLA 3DAPA 4HNGA 3ZHXA 5G0WA 2H6EA 5A9SA 2HMVA 1HETA 1LSSA 4BKRA 1ARZA 1ADCA 1DO8A 3WJAA 2GZ1A 1B3RA 3PI7A 1VI2A 3DXFA 1GDHA 1KEPA 3GVHA 1LBEA 1C0IA 5C3MA 4LK3A 3B70A 3MTJA 2CMDA 3QQPA 2VRCD 3ETDA 2JHFA 1A4UA 3QHAA 4OIMA 1NAIA 3IQDB 3PGXA 3MZ0A 2QRKA 4NFSA 4DMLA 2PY6A 4NDNE 3OFSA 3U4DA 1H94A 5DN9A 3HUDA 4C7JA 3F6YA 3H8VA 5JY6A 2I3AA 4YAKA 1T4BA 4L8VA 2EKQA 4R9SA 1ZMTA 4IUYA 1O94A 1LSUA 3I9MA 3H2ZA 4CMEC 1KY4A 3TZQA 4EUFA 1N7GA 1OMOA 4CUJA 3LLVA 3VDQA 4F6LA 4I8XA 4BO6A 4E30A 2QIOA 2QYTA 3MJTA 2Y67A 5COQA 4H16A 4I5GA 3U09A 1DEHA 1KEWA 4DWVA 1QORA 3RASA 1N92A 3TSCA 3R3JA 5TIIA 5F1OA 4BS9A 1NQAO 2QW8A 3LK7A 4BNMA 1ML3A 3EDMA 4J0EA 4WJZA 4JCOA 1NWCA 1P1RA 3WBBA 4TZTA 1K3TA 5EPOA 1YGYA 3CH6A 2XPCA 4ZQGA 1P45A 4KMSA 4R01A 5ER6A 3RUHA 2IYOA 5IN5A 3DAGA 2X5JO 2FZWA 2CDCA 1BW9A 1E7MA 1BSVA 1G1AA 2BGMA 4XB2A 3V2HA 2DTXA 3JD2A 3GG9A 1A7KA 2GN9A 3H5NA 1M66A 1VPDA 1XLTA 4ALJA 1Q0LA 3LLSA 2I67A 1ISMA 4OSPA 5KCZA 4FR5A 4LSWA 4UEOA 2YV2A 2X5OA 3H9QA 3U9LA 4BL5A 1I2BA 1OOEA 1SNYA 2C54A 3RUFA 3VPXA 2VHZA 2Z1NA 1V6AA 2W90A 3RD5A 4IMPA 2ZJ1A 3TZKA 1HDXA 4Q3EA 2PFGA 3PHGA 4CUKA 3CE6A 3BA1A 1X0XA 1HLPA 3ETGA 1QYWA 3NYWA 3WQRA 1UDCA 3QWFA 3W6UA 1BXKA 4Y67A 3VH3A 2Y0EA 4R68A 4CR8A 1UXKA 5CEJA 5TX7A 3RJ9A 2VTEA 5HTOA 4J9VA 4YJGA 3U49A 2A9FA 3DHEA 4AJ2A 1LX6A 5F1KA 2Q1TA 3PDUA 1A7AA 4OQZA 5AXCA 4J43A 2NWQA 1KC1A 4YACA 2ZYAA 2QZ9A 3RAJA 3ZWWA 5AOVA 2G76A 2HJSA 4KUHA 2EW8A 3KVOA 1DOHA 3I3OA 1YJ8A 1Z75A 2OBYA 3MJVA 3DAFA 3GG2A 1IHXA 4B8ZA 4CL3A 1GV1A 4PIVA 1XIVA 2OBNA 3H5AA 4IDDA 3RFXA 4CLEA 2DT5A 3OJLA 1I24A 5IAAA 2HDHA 3KYCB 5H82A 3L6EA 5K6AC 5L4NA 2Y1EA 3GZ4A 2JCYA 4Q3NA 5HS4A 5G0UA 2GERA 1ZEJA 3CTMA 1HSZA 3U62A 3JQEA 1JWBB 4BV9A 4EJ0A 3R6DA 1GUZA 2E4AA 2GSDA 2W4QA 4KWHA 4TRRA 1B26A 1YL7A 4NFYA 1DFHA 1B2LA 2OP1A 3SEFA 3WXBA 2FMUA 2HMWA 1E3JA 1X14A 5JCJA 1UDAA 1NQ5A 3C1AA 3LU1A 2WMDA 3QY9A 1DLIA 4MP6A 2ZATA 2AEFA 1DIHA 1NFQA 2GD1O 3ZU2A 3JYPA 4WE3A 1CERA 3GGOA 3H9UA 4J4HA 3LZ6A 1LC0A 4FFMA 2DPGA 4J0FA 2O3UA 1NYTA 2CD9A 2W98A 4M54A 4D41A 1Z7BA 1FDWA 2JD0A 2AE1A 3VZRA 4P4GA 3GRKA 4ONEA 2NU8A 2WE8A 1Q2XA 4MKRA 2C0CA 4CMJA 3C1TA 5BNIA 3WQSB 4NFHA 1YBMA 2PTGA 4IY1A 1BDMA 1ZZEA 3ZU3A 3DC2A 3KETA 5I8ZA 3TZ6A 3IP1A 3GY0A 3NTQA 5KOIA 4L0QA 2YJZA 1ZNQO 4LCJA 2EIHA 4KOAA 4EZBA 1HXHA 5A02A 2AXQA 1UZLA 2BH9A 2PK3A 3IDSA 2BELA 4CLDA 5TS3A 4RO0A 4BMNA 1IHYA 3B1JA 1IYZA 3ZW8A 1QLHA 2OP0A 3RC1A 5IZ4A 1E5QA 3QJ5A 2VHXA 2WD7B 2PV7A 4K28A 1GUYA 4F45A 1BVUA 1ADBA 2Q50A 5JC8A 3FBGA 1NHGA 2O2YA 4BKOA 4YT4A 1DC6A 5TT0A 2AQHA 1RYEA 3HG7A 5JDIA 1LDNA 3GVIA 1GQQA 5CFZA 4HX5A 5JY1A 2ZQYA 7MDHA 3DTTA 4XR4A 3G1UA 5KVQA 3AK4A 5ITWA 1DIRA 3ENKA 3ITDA 4PLCA 1IB6A 3EVNA 2P9GA 4D42A 3IUPA 3NDJA 2AQIA 4U5QA 1DFIA 1HF3A 1S7CA 3VTFA 4CUZA 3AUUA 3I52A 2X9VA 4J7UA 4DMMA 4EW6A 1Y8QA 4HFNA 2C2XA 4JJIA 5ADHA 3P7MA 2Y0CA 4R9RA 5KVVA 5GZ6A 3FI9A 3LQFA 2P91A 1ENPA 1QP8A 4GKVA 5JAIA 1SCUA 1NASA 1GL3A 3DMTA 4Z9XA 3ZHBA 1RYDA 5T8KA 3EY4A 2D3TA 5C5IA 5I7SA 4GH5A 4OQYA 1KVTA 2J3KA 4B3HA 1HDGO 3PZRA 5JC1A 1J4AA 4UUMA 2R6JA 3K2BA 3VH2A 2B83A 3U4HA 3BXXA 1DSSG 1LNQA 4JP3A 1DC5A 1EBFA 3VOSA 5GMOA 3W1VA 5L40A 4GSLA 4TRMA 2A94A 4BOYA 1JQBA 4YJHB 2HQ1A 2VYND 1PZGA 3ONDA 4MDHA 4XDZA 2OO5A 3AM4A 5KKAA 2DAPA 4I9HA 4BNVA 1Y9EA 1I01A 5JAQA 2WE7A 4L4RA 4MKXA 1HRDA 3CMCO 4OH1A 4J7CA 4RPGA 2HRBA 3GNQA 1Z73A 4ZRMA 2X8LA 3WICA 4MVJF 4DTIA 3ZV4A 4BO7A 3E5MA 3JQ7A 3VDRA 2FN7A 1D7OA 3BMQB 1DIAA 1ENOA 4BGIA 3F1LA 4J91A 3NT5A 2G17A 1KC3A 1ZSNA 2O3TA 2YHIB 5IDYA 5BT9A 4HADA 2FR0A 5KJCA 3U4IA 1NVTA 3RSHA 2GN6A 3HDJA 3OJOA 3VTZA 1TA4A 1LUAA 4BNKA 1R0LA 2POQX 4PLHA 4YRDA 1C1XB 1FDVA 3W4JA 3HHPA 3PXXA 4AJ1A 3MWDB 1DBVO 1C0LA 2XOXA 2CZCA 3OH8A 3QWIA 4IIVA 2PD4A 4BGVA 3JYLA 4GBJA 2WYUA 4HBGA 4TROA 4PN3A 1LEHA 1JKIA 4UUOA 4QQRA 3SC6A 3I9LA 1P33A 1PGOA 1SEPA 5TJHA 3H7AA 3C1OA 1VKOA 2B37A 1L1FA 1QV7A 5T6BA 1X7GA 4D3DA 5JAZA 1PS8A 4FFOA 4XZ3A 4ALIA 3CZMA 2O48X 4HFMA 1EVZA 5CPBA 1T24A 2PKRA 2HAEA 1TT5A 3TOXA 4J1QA 4WECA 1RJWA 1H9AA 5L7WA 4M1QA 3JYNA 3HFSA 3EZYA 3WGOA 3GMDA 1OZAA 1Q0QA 4R69A 1I33A 3JD4A 4HNHA 4WOKA 5DCYA 3KYDB 4XB1A 4NU6A 2XXJA 1MG5A 4B4OA 4BNNA 1ZBQA 1F12A 4C4OA 5L7TA 4XQ9A 3T7EA 4DUPA 1LTHR 3C24A 3IUSA 3ZWMA 3S2EA 4RJTA 3KSUA 4AJHA 5B37A 4GGOA 1E1NA 2RH8A 4K9DA 5ICSA 2CF6A 3B20A 3B1KA 3D7LA 3Q9UA 3CIFA 3GZNB 2DVMA 3RUIA 4DBZA 1JAXA 1EK5A 1U5CA 1ADGA 3K5PA 1K6JA 2BI7A 2I99A 4B8WA 1P9LA 1AN9A 1GU7A 2EKPA 4O0LA 3HB5X 4M86A 1KVRA 4U7WA 2HMSA 5HRUA 1P74A 3QVSA 4FC7A 2X1HA 2BFPA 5IZCC 3NT4A 1PJLA 3E48A 1BXGB 3BTOA 1H5QA 4OAQA 4D3FA 3MWEB 4ROSA 2D0IA 1R4NA 1R16A 1U7TA 3CZRA 5H83A 4CQMB 3WMWA 3KEQA 1ISHA 1CEQA 2TMGA 1F0YA 3DBRA 2X86A 1DC3A 2OL4A 4BQPA 5FWNA 3WS7A 3A1NA 3ABIA 3GGPA 3D4NA 1CETA 1NHWA 3H5RA 4Q3DA 2Q1WA 5G0TA 1UXGA 3PP8A 1JW9B 4IDEA 2AQ8A 4ZJUA 2AG5A 2DU8A 4PVCA 2E48A 1I8TA 2PZLA 5FI5A 4IINA 4Y98A 2A35A 4OSOA 3F9IA 4Z3KA 1LSJA 1QKIA 3F1KA 5DCUA 1QG6A 1NBOA 2WD8A 4DL9A 3S8MA 3NV9A 3FRJA 3EC7A 1KIFA 3UKOA 3WTCA 4DRYA 4PLYA 4HFRA 5JLAA 2GZ2A 5T57A 5JYDA 3VZPA 1E7WA 3OF2A 4B3JA 3ZWBA 1WP4A 2HK7A 5K6AA 2OORA 2W8ZA 2WDZA 4F3YA 3D4PA 3QA9A 3OJEA 3EGOA 1U4SA 4PGFA 2I65A 4R1SA 3IS3A 3UXYA 5G4KB 4EEZA 3KO8A 1PGJA 3H9JA 4BO3A 1F17A 2C5EA 5CEEA 4N5MA 3HADA 4NBRA 4PLFA 3WWYA 5JS6A 4PCVA 4QSMA 3QVTA 4RV9A 1UAGA 3G3EA 4W99A 3ZI0A 2CVQA 4MVJH 4BNJA 2V6FA 1SB9A 4EJ6A 3UUWA 1PJ4A 4EGFA 5B12A 3DL2A 4QFDA 1IPEA 4IS3A 3RFTA 3WR5A 4G81A 4XQCA 1PL8A 1WMAA 2ZCVA 2CVOA 4FBGA 3P2YA 3LYLA 3AUSA 4XYBA 3U5TA 1T2EA 1BHSA 1XA0A 2DUWA 3P19A 4CMAA 3D1LA 1QYDA 4YJFB 4YB8A 4QUKA 3CXRA 3JD3A 5BSEA 1G0OA 2X9NA 3FTNA 3Q3CA 4O6VA 4MO2A 1LLDA 3FN4A 4E2WA 3NGLA 4B4WA 1ZCJA 3ROPA 4BNIA 3Q9NA 4WLOA 2Q3EA 4OKIA 3HDHA 1NR7A 1N1GA 1C1XA 3SVTA 3D3WB 4E21A 1GZ4A 2IODA 4NJMB 1YWGO 4IQGA 3JQFA 1ID1A 5KJ1A 3E5RA 4MVJE 4WASA 5DZSA 3Q2IA 4R3WA 1SB8A 1YRLA 4ND4A 5K0ZA 4M8SA 1EDOA 1CRWG 2EV9A 2ZB3A 4ALKA 4KQWA 5EQFA 3O26A 3ADPA 1EE2A 1B3BA 3INTA 4L9RA 2IEDA 1FK8A 1R37A 1MX3A 1T4DA 2GRAA 1P1KA 3DBHB 3FHLA 4UUNA 4UVHA 4ZA2A 1BDBA 3SJUA 5A1TA 2JD2A 2CDBA 4XYMA 2B69A 2PZJA 1BXZA 4YVFA 3WLFA 3GAZA 5EL0A 4QFCA 5J23A 2C20A 4RPJA 2E82A 3WYBA 1N7HA 2EERA 2O4CA 4G2NA 2G82A 4OO3A 3LF1A 3O4RA 4ZU3A 2PR2A 2AQKA 5B4VA 5K9ZA 1ZH8A 4CQMA 2PKQP 1ISGA 4JLWA 1ZSVA 3W8DA 3ZWVA 1BW9B
chains in the Genus database with same CATH superfamily
3KYDA 3L07A 1P7VA 2VQ3A 3IKMB 2VF2A 5KYXA 4OATA 1H3FA 1GDDA 1XG5A 3QF4B 3BREA 3R0QA 4N8EA 3RGGA 1T2CA 4URVR 3EPJA 1NVAA 1T1EA 3TM5A 2RE8A 2XQVA 1H0KA 3WJ1A 4RANA 1IMJA 1ORWA 1Y9JA 5AKYA 5T64A 3B6IA 3QXSA 2OYCA 3X1WA 3SJBA 2QR3A 2XW6A 1BFUA 4LV6A 2IXGA 4I55B 2EFEB 3JSXA 1R27A 4Z1MD 4DKJA 4NMLA 2IOFA 3RTBA 1BZYA 1P77A 2FOIA 2Q9AA 4KE9A 1H4SA 3RC7A 3BRWD 1MORA 1C8KA 3FPEA 3RREA 3UK1A 4IJMA 1KO7A 1NT2A 2CY0A 4BLUA 2N1BA 4R2HA 3SXUA 4E5NA 4B3IA 4E2YA 3I42A 3MCZA 2Q4EA 1JEQA 1XMVA 3D3JA 4YO7A 2BLLA 2QTLA 4DREA 3FUVA 3WBJA 1JDSA 1I36A 3C8ZA 4UBJA 3GDGA 1TZMA 3GJ6A 4EEXA 2ZRPA 3UMVA 4JU9A 4P3PA 3D1VA 5IBCA 2Y2VA 4BQNA 4P83A 5C8YF 3ZCVA 1RCFA 2ETXA 1ZH0A 2OHVA 4RBNA 4AF8A 1YS9A 1LW7A 4TTQA 4TLLB 2ZIUB 4YRJA 4A16A 1T6NA 3A27A 2HREA 4DMRA 1NXVA 3V33A 2N3ZA 3ZHZA 4HH4A 4NE2A 2M98A 4RDXA 3E18A 1SK9A 5CVUA 2AFHE 1X7DA 3FSGD 4OHCA 4YWJA 4A2WA 5BUCA 4L5IA 4B4VA 5FJIA 3EGWA 3O8QB 1L4EA 1LZLA 1PJ8A 3GJZA 3PJEA 5A3VA 3NBZC 4X7RA 3W78A 1JN0A 1E4EA 1TXGA 1WXQA 2OBBA 3CZ9A 3GMSA 4JJFA 3AMVA 3IL2A 2PLWA 2QR5A 2ZBRA 3QVOA 3T3IA 5BVHA 5A3RA 1WWKA 3E27A 3GYGA 4WUVA 1DT5A 3GBPA 3RRJA 4HS4A 2VDLB 2RMKA 3GDHA 2NZ8A 2Z98A 1PCXA 3EBPA 2QUHA 5AI5A 2QRPA 2JRLA 4AUKA 1YD7A 2HU5A 4GO1A 4YONB 2UYQA 2PX2A 1IRXA 1EU1A 4CF5A 5K51A 3R3ZA 1YRBA 2PO5A 2SHKA 2BFEB 5DSXA 2O8NA 1HDYA 2F00A 2VVTA 3DZBA 3H5VA 3O93A 1GCGA 1MDFA 4OGKA 4R05A 3FGPA 3MJRA 1W88B 4H1VA 1DKUA 2ZYIA 1HE1C 2PMBA 3DCJA 3UOWA 4GM0A 4OY3A 3E9MA 3O5AA 4C7VA 2VBGA 1FFHA 2GN0A 2NVUA 1JKXA 2B5VA 3O9ZA 4YJDA 1Y6JA 1TM2A 3ZV3A 4BEBA 4R4JA 2UDPA 2A0FA 1QO9A 2CFIA 3IP7A 3KKEA 3FNEA 4A6XA 4LVNA 2B1IA 1LZKA 3GRAA 5ARCA 4M7PA 1NQUA 1VJGA 1UXHA 2J9XB 1U8UA 2ET6A 3FD8A 4FYXA 3TIXB 3MUNA 3R7SA 4B3XA 1XTZA 4DCTA 4YRMA 3NR2A 1Z17A 1JALA 1JFRA 1PJ2A 3D7KA 3QQ5A 4BLOA 2BMAA 3EXHB 3FNGA 3HVJA 2P2DA 3HVHA 1EB9A 5BSVA 4V3CA 1W6UA 4TT3A 4BE9A 1MW8X 5HJEA 3VYUB 1T35A 4IMJB 4LXUA 5ALMA 4E6PA 5LKRA 1WW8A 4RF2A 1SUIA 3R0JA 1VB3A 1MUUA 4OA8A 4C5CA 2UZ1B 1D1PA 4O25A 1TMKA 3NHJA 4GZMA 1ZAYA 1VA4A 2WRZA 4B79A 3USZA 1C9EA 221PA 2FSSA 2GASA 3PPYA 4HWGA 3L41A 3L82B 3ODPA 4MVCA 4DT1B 4RULA 3TG8A 4RKYA 2LIVA 1XCLA 1DCTA 2P5YA 1T3ZA 2D2XA 5EMNA 1IVSA 2J0SA 5KDLA 4A36A 2VSFA 4Z0NA 5IKOA 1TCUA 2W6PA 5REQA 4YXWA 4EI2A 4OX9Y 4QDJA 5TGDA 2FFQA 2G36A 3LA8A 3LQKA 2ASEA 4JI6B 3SYLA 4RTRA 3TLZA 5EVJA 2WWYA 4J90A 1Z2NX 3I76A 4GNRA 2BZ0A 4QULA 1CQIB 1GN9A 5DYIA 4CF4A 1VLJA 3L7MA 1NJ5A 2C42A 1DBPA 4ZT6A 3THYA 4IUCS 3KUCA 3QVXA 4CL8A 4L5BA 2HWWA 3T4EA 4I8DA 4NABA 2B1JA 2JIRA 1OAOC 4GZ5A 4P81A 4G9EA 4NJEA 3HBFA 3CW2A 1CZRA 2A5LA 3PDJA 4YDRA 1G7CA 4JSRA 2H5JA 1RSZA 2QTVB 4KGDA 4ZYTA 5B3LA 1P39A 3CRRA 1QP7A 4AN1A 1AMNA 2AOUA 3R40A 4LFAB 3C6MA 1XD2B 3EGXA 4RKFA 3BSFA 1CJVC 3I9V1 1N0VC 4X97A 3B9RA 4EO4A 4GL4A 1U90A 5ERXA 3WFIA 4GI2A 2FUEA 1C50A 1GRQA 4TMKA 1RWNA 3ER8A 5HZHA 1T0PA 2P41A 1DKLA 2A8YA 2P9JA 3KSDO 4QU0A 5E1OA 1FZTA 1Z4OA 1P6XA 3P5SA 3HM2A 3L0IB 1SVIA 4MSUA 5D5QA 5AQEA 5JALA 1J00A 4YV0A 3HBNA 3F9RA 3L1KA 5TLSA 2FUNB 3TLBA 2YDYA 4MS3B 2R48A 1R0CA 1ZX1A 2XMZA 2W6QA 4H2DA 3UXMA 4W6QA 5A6SB 3Q10A 1W8DA 5TF4A 2KE5A 3RVQA 2DUUA 2FB9A 1QH8A 1Z82A 4XLTA 1QYRA 5DO9A 2UZ3A 1CR1A 4MAMA 4C05A 3QFSA 1K7CA 1NWHA 3MS2A 3HCDA 1S7GA 2VWHA 2GPAA 3QEOA 3ZUGA 3SS9X 3ZX4A 2BKUA 2ZB8A 1K4MA 4QTXA 3KSZO 4QVKA 3T1QA 2OYRA 2ZSJA 4AK9A 2O8FA 4X84A 2R1TB 1DEKA 2W5UA 3ET5A 3JQ8B 3BK2A 3KHKA 4GVXA 4HNRA 3VR6H 3ZS9A 3IILA 3NRJA 2RG1A 2R6R1 1DJPA 3TLXA 2D5CA 3VO1A 2X2EA 3U56A 1G2QA 1L5YA 1I1QB 2RKWA 3VKUA 2G4LA 1NRXA 3L4SO 4XPIA 5JCOA 5BN3B 2IF0A 5COBA 1M33A 3PQ3A 1ZUWA 2XGMA 1JBKA 3W2HA 1LLQA 4GKBA 4YYZA 4MR7A 3DHNA 4LOIA 3KQVA 3M5PA 1OH5A 2HSDA 1UBMS 5JSYA 1MQAA 2FQQA 5LLDA 3GLGE 5CJPA 2IHVA 3C3KA 1RC1A 5CDUA 4YHHB 1DRKA 4RFSB 3OEWA 4D74A 3P9PA 3DEIA 4EOGA 1A4IA 4FHDA 5JSFA 3KOXA 4HGPA 2JBAB 5DHTA 2YVLA 3M9LA 3TX2A 2AR0A 1IN1A 1D2MA 2GT1A 1D5CA 5C31A 3V4FA 3SMQA 4IGIA 4XIYA 3WBKA 4CI9A 1QFMA 1XR3A 1DTSA 3FMGA 1H8ED 3VU1A 4IO0A 4E1BA 5CDGA 3W7VA 2XE6A 4R8LA 4GKKB 4DILA 2F8MA 2VJYA 4PZDA 2BKXA 1GPYA 4ZT5A 4HX2A 2JPDA 3BSSA 1Y8RB 4RH1A 3OPMA 1O0SA 2PH5A 2IYQA 4HPXB 2CKDA 3EQ6A 4NONA 2WTBA 3FA2A 2YOFA 5FFFA 2SKCA 2A1IA 4PXYA 4B7CA 1YCDA 1OB5A 2VDPB 4XXHA 1FBTA 1U5BB 2CNNA 4WCFC 2Q8QA 3VUFA 1N2GA 4J7XA 1EK0A 5AOAA 1GZUA 1OI2A 3OEED 3FLMA 4GPIB 4HYQA 1N0HA 1G63A 3ZIDA 5F4ZA 4BNHA 1UADA 5AHRA 3RJ5A 1U5BA 5H4HA 1AGYA 3MCVA 1NF8A 5E9AA 3SBXA 5JH7F 1L4BA 2EXXA 3F9CA 1V45E 3G2HA 4KPGA 2F3QA 2GWRA 2E85A 1U8XX 1JR3E 1UKZA 1ZJ4A 1SA0B 2NYVA 1KMNA 4FZ3A 3H6GA 2EQ5A 2IC5A 3M4NA 3O84A 4GI5A 3UMMA 4ECEA 5CXUA 1IFXA 4NPCA 3TTSA 1ECFA 4MZXA 3AZPA 4FI3F 5FQNA 1M1YA 3J7TA 2X1VA 4L5YA 1NVVR 3MBKA 4GRIA 4US0R 4BMCA 2V5AA 1XC7A 2VXCA 1KSFX 4TKMA 4E11A 3DZGA 5EXPA 3PQEA 3EW7A 3ILSA 3BE4A 3K70B 2HZ7A 4R1MA 1NBEA 3IHTA 2FPPA 1ST2A 3OZ7A 3OLZA 3FTQA 2VP0A 5GAJA 3UEOA 5BORA 2NOAA 1Y6GA 1DB3A 4RAQA 4AYWA 4Z3KA 1N0UA 1YZUA 4RPHA 1KWKA 3I9V6 4IGFA 1W93A 1AHPA 4M1TA 4DJJA 1H2HA 4BO2A 4PU0A 1UZNA 3TD9A 2R1ZA 4FBLA 1VIAA 1HFEL 1ECPA 4EGQA 4KH1A 4S0ZA 3VHXB 5AW4A 2G8LA 1W75A 4P7FA 4V2UA 3SZ3A 4BWVA 1TF7A 3E7FA 4CCAA 4ENUA 4ZYZA 2QB5A 4WJLA 1XJWA 1M8PA 3UPUA 1V37A 1KZ9A 1UOOA 4ZRDA 5FORA 2XF2A 5CVTA 3N8IA 2XF8A 2V9ZA 3EISA 1WV1A 5BN5A 4FUTA 3G88A 1KZ4A 3MJSA 1XHEA 3L4EA 5CBPA 4FWTA 2POCA 4NENB 1BS2A 1FSFA 2H0QA 3MB5A 4HWOA 1MABB 1PVDA 2Q6LA 4OH7A 1HZZC 4ARZA 4L72A 3MWGA 4UD6A 5FBHA 2BJHA 4KLRA 4BVEA 3K72B 4BTLA 4K9KA 3WA7A 5KKCA 4CEJA 1Z6GA 2PYZA 3OE5A 2GCIA 1TVEA 2M6SA 2QRQA 4GLFA 3PFGA 4JP8A 4MW5A 4NJEB 5HG0A 3NWJA 1CJTC 1G8AA 1O9BA 2G6BA 2JFXA 4OLAA 4DQ0A 3TWOA 4TS1A 3IEPA 3I8XA 3ZE6A 1X7XB 4UVIA 1RYZA 2ZS8A 5IT4A 1KOJA 1JEAA 2O2GA 4EJSC 1JFVA 2HCBA 3N2YA 1EG2A 4PLWA 1PW7A 1ZI8A 1F14A 1HYEA 1YJBA 2EC5A 2X4LA 2VPQA 1E64A 4ZVSA 4E33A 5IS2A 3DOFA 4LNHA 4NSNA 4TQGA 5F2KA 3W3AD 5LUAA 3QUTA 4U7JA 1YR2A 4ENTA 3R6WA 2O54A 2W9XA 1UT8A 3EWNA 3KT8A 4K1LA 3KU4A 3N2LA 4A03A 5CBKA 2C4UA 1IZ9A 2V55B 1SC9A 1K27A 2YV1A 1Z25A 1RWKA 4RPLA 1PSDA 5JS7A 3UC9A 5MN4A 1UT5A 3FHOA 4IRMA 2GILA 3OKCA 3RVBA 1NUHA 3K1YA 1UBLS 1TOAA 2X1LA 1MO6A 5LVAA 1H6BA 4ILKA 4PRYA 3KEFA 4ZN6A 2CF5A 1YIAA 1Z8FA 2PXXA 4GPAA 1Z39A 3V1KA 2BMWA 1COWD 4RXMA 2O7VA 4MH0R 2R8YA 4FNAA 2F90A 3VHLB 1JA0A 1CB0A 1L7MA 3O9VA 4KWCA 2R8ZA 3DP9A 1O95A 2ON6A 2YN0A 1E63A 5DP1A 4IRUB 4KNVA 4B44A 3WOHA 2BDEA 1UT6A 3NBYC 2P79A 1DKOA 4O2AA 1D03A 4LY9A 2BHLA 3EEFA 3FB4A 3SNHA 4CM7A 1VXRA 2FRDA 2PSHA 1J2TA 5HHTA 2CLEB 4BO4A 2F4NA 4A8JC 3C3BA 3KUUA 4N65A 3EGEA 4PM4A 3WYEA 2V4ZA 1A9PA 4G84A 2FG6C 2F1KA 4HLUA 5FT9A 8ADHA 4JVOA 4XTCS 1VPLA 4J1NA 4WUTA 4AY6A 1N9ZA 1TIKA 1M1UA 1VJ1A 3QPWA 4GR9A 4L27A 2Q6OA 3E6AA 4LWQA 1DG3A 2H17A 2ZYVX 3CEMA 5CCEA 4IQ8A 2RCYA 3L92A 4R83A 2E4UA 4OK6A 1XJQA 4KVZA 2IEZA 3NTVA 1MX5A 1RC0A 7MHTA 2PPVA 4N8SA 1LPAB 5KYUA 3DE3X 1EQAA 2EG5A 1W73A 2W8BA 2WT4A 4P2BA 4PWZA 5HE8A 4UHKA 1SBTA 3K9CA 4AM8A 3HK2A 2PH7A 3TCNA 5IF9A 3QX9A 2KX7A 2AMYA 2CLCX 1J49A 1QJCA 1XCJA 2ZI3A 4XYGA 4DDTA 5I47A 5HYVA 1S3GA 4HDAA 2DTDA 3DZ8A 1ACJA 2BP7B 1Q20A 2HBRA 3ABRB 2NSDA 2WY2D 4V0ME 4WHMA 1AUOA 3DFZA 3GEMA 4ZZ1A 2F8TA 3ELDA 3SI7A 4JP1A 1E3DA 2BV3A 4DCJA 1UZUA 4IIEA 1EYZA 4HH0A 3EXIA 4WFJA 2OV4A 5F7ZA 2CL7X 4RWZA 4ETNA 2ZRHA 2BFWA 2HPZA 4PC1A 5T4EA 3WMXA 4LFBB 1KFEB 3JW8A 3PLNA 4ZT4A 2JH8A 2VHVA 3TD2A 4Z0TA 3I9NA 3DOCA 5BV2P 1UK7A 3Q0EA 1XDZA 2Q29A 4CFYA 2GCEA 4BQEA 1VG9B 1XCMA 5CM2Z 2IH2A 4M9UA 4CR6A 4CW7A 3DNMA 4RVCA 1NNSA 1G3MA 1OJ7A 2R2AA 3PL5A 4JYPA 4KFRA 4PZ9A 5AW0A 4BASA 2O52A 3AHCA 4TLBA 3FOEC 4QU5A 1JR3A 1CVRA 2EL9A 3E9EA 1WTAA 3N8HA 2PWYA 1NE2A 1FRZA 3LX6A 2VPIA 3EVGA 3NT2A 4JBYA 4WNYA 3ENVA 5H81A 1XQ9A 4EARA 3KKPA 4AJNA 5EUBA 3I9FA 3U7EB 2XCRB 4IJWA 1DXQA 3CVOA 5CA1F 1EXWA 4WV3A 3ZV5A 2P0AA 4ABTA 3KJZA 1UXJA 3RWOA 4AJIA 4UTRA 2FW6A 1QQ6A 4YMGA 1ZOOA 3TKYA 5DYTA 2W7TA 1YZHA 3OZDA 4J49A 4Q21A 4YMIA 3EARA 4BNLA 3AFIA 4GE0A 2BMFA 4UPVA 2ZUCA 3INGA 2CGEA 5EE0A 4KE8A 3HVUA 1IVYA 3F5SA 4E1VA 4KJXA 2ZJBA 2JFFA 3ZWNA 4PFKA 3CLUC 1N2BA 2I76A 4Z9YA 1YH3A 2CLLB 4OHFA 1QOZA 1NBAA 1R6XA 3KZ1E 3PFCA 4GQAA 3CF4G 4LQDA 1VKHA 3L06A 4MLZA 4LC0A 1QSGA 2EP5A 5HF9A 1ESNA 2Y66A 2EW2A 2BF7A 4ITRC 4JMPA 4QPPA 4ZGWA 4ZCLA 1GYPA 1ULBA 3WGYA 1YMVA 4ZK6A 4RJKA 1VMEA 2QPAA 3BTSA 4QXQA 4Y2SA 3LSYA 5EQJB 5IH3A 2XEDA 3V8BA 3VR5D 4DIBA 3U7GA 2VWPA 2CE2X 5A2QA 5JH7A 1NG9A 3C3YA 4C76A 4CI0B 3UAGA 4E3WA 4F9TA 3OD1A 1SJ9A 4JNKA 4K1XA 3S8MA 3VYRB 3R9WA 2ANCA 4PQEA 1ZNWA 3AHIA 4GSKA 5AP9A 2EEZA 2WILA 4RMJA 5FTJA 4JK3A 3WGZA 2QMOA 2OO7A 2W2MA 3HC7A 2Z2JA 4IXMA 2G72A 3HR4A 2YQ4A 4KQXA 1V3UA 4MVJG 4PLVA 3TK1A 3VX4A 2H00A 5LDHA 4FMCF 5T41A 3ECAA 2W2KB 3R77A 2QK4A 2V8BA 5EA2A 3GB9A 3ESXA 4RSMA 4X8OA 3AW8A 3PS9A 5FOSA 4C78A 4MTCA 1FNBA 2JJQA 1CFJA 2CD7A 4RTKA 1KYIA 3SX4A 4G8JA 2MSDB 1V3TA 2GK4A 4OHUA 1D4OA 3JWJA 3KRTA 1SXQA 2PX6A 1XDBA 5JBIA 4QO7A 1ADYA 5L6MB 3RROA 3PFFA 5CXQA 4MA0A 1KEKA 3X1KA 1RJ9B 3K20A 5BN3A 3LNTA 4Z4IA 1PL7A 3LY7A 3CNHA 4MR7B 3D7NA 4IP0A 3DUFA 1L5FA 1E6KA 2II6A 1JAZA 4HMQA 4MW7A 4TWBA 1FXSA 4HUJA 4NNJA 5IAKA 1X94A 1ZMBA 1EUYA 1G8YA 3BORA 2QG4A 4XWYA 1THTA 1C1DA 1KH2A 2V6MA 3CVYA 4V1CI 3D3WA 3LFHA 4OBEA 4DLAA 5L6LB 2AYYA 1Q7BA 3SP1A 1ZIDA 3CCFA 3L8EA 4F0JA 1E1MA 2GPJA 1ZINA 4UNSA 2YASA 4D2IA 1PJ3A 5LU9A 2QNRA 1KO4A 1OBVA 2ONKA 1JE1A 2XBMA 5I7VA 4IIDA 1W4CA 2D5LA 1M6WA 2QP4A 3W8NA 4EW1A 2OV2A 5E95A 2OCDA 1F6BA 4HAUA 5HZGA 3DF7A 2FOLA 4JQSA 1ABBA 1T6YA 3CX3A 4I4IA 4DJEC 4QHTA 5A4DA 1H85A 3KBBA 1XK7A 4OQXA 3OHMA 3K4QA 1Y5RA 4KMRA 3SZOA 1S2GA 3S2IA 4BIIA 4BWFB 2ZRDA 2BWJA 3FHCB 2E4YA 2ZI5A 1WO8A 3UJ3X 4JQYA 3SQWA 4ESVA 1PTJC 3KWMA 4W9NA 1CQJA 1XRSB 1SPXA 2BD0A 2SNIE 1NXQA 2PBLA 1BJTA 1IK6A 4W4TA 4OBXA 2PAFA 3JARB 2AEMA 4M49A 5DX8A 2QTGA 1TJ3A 1UPCA 4H27A 4XGNA 2GEUA 4YBZA 2WAYA 3DVRX 4C0XA 5F2NA 2VZLA 5CA1A 3ADOA 1Z8DA 1U9ZA 2PMCA 4F93B 5HZMA 1FLDA 2VP2A 1ZIYA 1DTWB 1YQEA 1VE1A 2FW9A 2J9GA 2MYTA 1E7RA 1OT5A 3CONA 1AS0A 2GGSA 3CW8X 2ZETA 3PQDA 2R9VA 4JSYA 5EMMA 2Q2WA 2P3OA 3N76A 4GZ6A 3E3MA 4BKQA 3CLTC 1M1NB 3PJGA 4OUDA 3QEJA 1WXWA 5HM8A 1OVMA 3KTAB 5CURA 1QTQA 4FFRA 5CFRA 2B5WA 4J1TA 1BE8A 4NBNA 1Z5WA 1LDYA 2WU1A 5LIRA 3QBJA 4DPMA 1U0OC 4DLWA 4LSGA 3GJRA 2HBZA 3UJPA 1PR0A 2A1UA 3U39A 2REQB 2CHEA 2XWQA 1TYEB 2NV0A 5AW1A 5J4VA 5MHTA 3TLGA 3G7SA 3R5HA 3BBLA 1UBUS 1KZ6A 3V8RA 4AJ4A 1PGQA 4LYYA 3JYHA 1QIGA 4K7JA 4ZI2A 3I6QA 3R3HA 2E2WA 4AMGA 1BKYA 3O1JC 4M0DA 3EVZA 3K05A 5F21A 2DTEA 1OW3B 2C59A 3JQ9C 4EKIA 1RVDA 2DWUA 1J2YA 3ENNA 4CIAA 3SEAA 1C14A 1WBJB 3WHIA 4JL5A 1J39A 5BRJA 4HNAB 1U99A 1KI1A 1J0AA 2V7QD 2XXBA 4LYGA 4FVTA 2ZIFA 1RRPA 2O2SA 1MOQA 4INZA 4B4DA 3M6IA 4Y8VA 721PA 3DMYA 1LS1A 1T29A 3C6KA 3SC2B 3LVFO 2J0EA 4BX0A 1JB1A 1DPFA 1VL2A 2XUHA 1IOLA 2GEJA 4PTYA 1X9GA 2AJCA 4U6QA 3TOSA 1JG6A 3TZCA 2JGRA 4ZOQI 3CW9A 4REOA 1LWOA 1X8JA 4UDNA 3T54A 4HB2A 5B55A 3D64A 1TYAE 4E15A 3G82C 3P9YA 1W1WA 2C07A 3EVDA 4LFCB 2FSGA 2YJ4A 4NF2A 2AS0A 2EJWA 4B76A 1K75A 2YVKA 3HI4A 1DRWA 1U2TA 3FGZA 2X7XA 2IH4A 3MPOA 2X7HA 4ARBA 3C7KA 1SVLA 4C22A 2YKGA 2P7IA 5K3SA 5JG7A 2J6IA 5FEUA 3ZU4A 1AT1A 3UHFA 1LJLA 1QO7A 3TJZA 4KIWA 3TLJA 2GZSA 1QFXA 3IPLA 3IO3A 4OFBA 4DMCA 4LZAA 1R5NA 1SUSA 1DHTA 4IZHA 1G5IA 2Q0SA 4TTIA 4W63A 3BMOB 2NW6A 3V55A 4I0WB 4YJHA 1GSAA 4HT3B 2PO7A 3EZGA 2FQXA 4FCVA 3U0BA 2QNIA 3ZKAA 2ODBA 1YQWA 2WTAA 3GRPA 1N5OX 3DZFA 4PFJA 1JVSA 3GOQA 5K2MA 4YRIA 4PANA 4TRNA 3WYGA 4ARVA 1AQ6A 1QZZA 3M6WA 3WWZA 2DHEA 4QDZA 3LGSA 1U7UA 4RLFA 5ALEA 3MMNA 3PNVA 3IGFA 2O7NA 1Z8HA 2GUWA 4MI9A 5IAGA 4EPYA 4PG6A 3UN1A 1JKMA 1V16B 4KHPB 3JQ6A 1IM8A 3N70A 3O3MB 3OFVA 3RVJA 1GUDA 1IL0A 5K0TA 3U1VA 1KMQA 4AAYA 2QRHA 3BMCA 4J0CA 5AW9A 5F9HA 3T6KA 3MIIA 3AR8A 5DTJA 3GA7A 4FFWA 5TEVA 1AQJA 3F49S 2HO5A 2OBLA 1EHYA 1R0KA 1TM5E 2XBUA 4KAJA 5CDTA 1W0KD 5KOHB 1EP3B 4JVMA 4BE4A 3NVKI 3TZBA 5HX7A 4BFCA 3H11A 2GYYA 4BMDA 1DV1A 4LNAA 3R0VA 1P1HA 3UT0A 2NP6A 3E61A 3C87A 3OEEA 4C4XA 2ORIA 4QPCA 1QMPA 5TNXA 2CWDA 1DX9A 1FDRA 1TX4B 3X1DA 5TVKA 2MSLA 4F4UA 4Y3UA 3PE3A 3A10A 4MWDA 2VSYA 3AM5A 2RG7A 3WIBA 3EIHA 4KRGA 1N34B 3VJRA 3RG2A 5AW7A 5EINA 5J1TB 3UFXA 1KARA 2W4IA 4TTPA 4XEUA 5F7OA 3I2YX 1GILA 4LXQA 1LQTA 5H68A 3WJ7A 4XIJA 5DIFA 1Q5PA 1YJQA 2J5BA 2FFJA 1U0NA 2WHEA 1MB2A 2ZRLA 4HSEA 3QP9A 4W8HA 4NJOA 1P31A 3QUAA 1GFSA 4BC1A 4BYGA 4JROA 3G1TA 3IBCA 2BOVA 4LQLA 4RHCA 3SHFA 1TPYA 2ZWOA 4MQUA 4QODA 5EG5A 1XP5A 3H4VA 3UMGA 1QHNA 2IOYA 2HX1A 3KUDA 3OEYA 2D6FA 2OVBA 4YUVA 4WBNA 1Q1QA 2NZVG 4TSFD 2J6BA 3FRHA 2C29D 2GR9A 4JXXA 3VU3A 5HFNA 2XNKA 1JTFA 2HIHA 4JJEA 3WLRA 3KNZA 2FUG1 2R62A 2C5GA 4IYJA 3K9HA 4JAVC 1O87A 1T13A 3VHXA 4N39A 1IBKB 1E6MA 1LRKA 1X86B 1Z36A 2CHUA 2E55A 4LF5B 1KZGB 2P2SA 3FKQA 1TB4A 4CM1A 4R7ZA 3F3KA 3DBLB 4BPRA 1WPRA 2P9BA 3AERA 4G0VA 2O2ZA 5EQDA 2G9NA 5K0EA 1JHRA 1RQXA 2XYPA 3H6KA 1YZFA 3C74A 1QE5A 2VAXA 4OB8A 2ZSIA 3IUQA 2YS7A 3L8DA 4QIHA 4KFCA 1A69A 5C0OE 3K9QO 3WV5A 4AF6A 4P82A 1MO4A 4KX3A 2NNLD 1I4DD 4KIFA 1XP8A 5TV2A 5EJMA 3ELYA 2I34A 2R8BA 3GARA 4CLRA 3HCBA 2P4UA 1X74A 3GLQA 4MKIA 1KQOA 1U7PA 4G3XA 1BGWA 3NHBA 2V7PA 1NYQA 3ID6C 1A8HA 3OPNA 4KC0A 4QDUA 3EXHC 3O91A 1NY6A 4CM8B 3EDCA 1DGQA 3LYAA 2WG0A 4J16A 4GOKA 1CX9B 1AS3A 3GBVA 2B61A 4P5EA 3ROKA 3T38A 3HV2A 5BUSA 3PDHA 5C7OO 5LQCA 3DPIA 2QT9A 4LDQA 4W7SA 1ZO8A 1EEHA 1KI3A 1Y6ZA 2I2WA 2WW8A 2XAAA 3KAQA 4XLLA 2WZDA 2Y4NA 4OLFA 2RHLA 5CVJA 1KJZA 5AI8A 3GUUA 4RDHA 1M34B 1ULAA 3M70A 5FUXA 3GP8A 3UV6A 4OXNA 1JAYA 2FCAA 4U63A 4FLMA 5AW2A 1Z4IA 2HFJA 1ZNYA 2VJPA 3JQ8A 3DQPA 1FFXA 4EDHA 4QGHA 1ZUNA 3EJWA 4FHFA 4IXNA 4RZXA 5BXQC 3Q8KA 3L7OA 5IW8A 5CG2A 5AXBA 4UU1A 3GZJA 3V9AA 4N48A 2GHQA 4P54A 4HAXA 2XQGA 3FYUA 4QAQA 3SJZA 4DWOA 1OI4A 3O8LA 4JNCA 5BYJA 2GFIA 3W1EA 4P3XA 5K2OA 4NCBA 2Q99A 3WGJA 1MA3A 4FS8A 1P8AA 4X6XA 1BCSA 3EPPA 4TXMA 4OMDA 4A7PA 4BVGA 2X9GA 4E51A 3PTAA 4DDMA 2V7UA 3RTDA 1WHTA 1G0NA 4JR0A 1TW2A 2FFRA 3L8YA 2BAGA 1F7UA 1JTEA 1FCJA 3ZJ4A 3JZAA 1UOPA 5KEIA 2HSGA 2XUDA 3SS8A 3T5MA 3STXA 1OHHD 3ANLA 1LQUA 4KHZA 4ER0A 2H57A 5J43A 3SF0A 3GRYA 2R6FA 1CIJA 3HCCA 1JJFA 4ND8B 4RKWA 5CG1A 2WM3A 1P1IA 3QW2A 1JB9A 3GAFA 2ONCA 3NTRA 5FYQA 2P2CA 3OOYA 3QOFA 1HTBA 2FVXA 4HQRA 1RRFA 4G8BA 4YUZA 2IYPA 4G0NA 1XZ8A 1FNNA 2LVBA 4TKLA 4RZHA 3BMNA 3SR0A 3TTWA 5DKFA 5HNKA 1KNQA 3TNJA 3UOAB 3CUSA 1T0BA 2PGIA 1PX0A 2EU8A 2XYQA 3FPJA 4J6EA 1IQPA 3W8EA 3ZDRA 2DLNA 3SR4A 1ZM3A 1KJJA 2HD4A 1NL3A 1PJBA 4ND6A 2QPTA 1K7SN 2XX3A 4ZICA 3CF4A 1VCIA 1AHIA 1S8FA 3R23A 3GRCA 3HY6A 3S29A 2Q3FA 3ZJYA 5KREA 2JHAA 4H0NA 1RBYA 3COYA 4UFOA 4F38A 3PVCA 2YOHA 3CCCA 4FN5A 3BEOA 4Q01A 1EA7A 4YH1A 4YMSA 3S28A 2BL4A 1G16A 1AE1A 3BMCB 4MITA 2BBWA 2J48A 1R64A 4Y6OA 3A11A 1VCNA 4AF7A 1Y9AA 2VZ9A 2FCRA 3A4TA 3K6RA 3LECA 4QJ5A 4DG5A 4TSFA 1WY5A 3VVCA 5DX1A 1UBOS 2J5RA 2Q4BA 4YDSA 5EYPA 1N7IA 1YL5A 4X64B 3UGJA 4ILEA 3DYIA 5FI3A 4MGZR 4AFNA 1H6DA 1KJWA 3PHLA 6AT1A 3U44B 2OGUA 1EZ1A 2DFDA 2V5VA 2AF3C 4ZEXA 3G17A 3JQPA 1OSNA 3M6VA 3TVTA 1H4VB 5EI5A 1O89A 3ITKA 1I1HA 4IVNA 5IDQA 5KVCA 4LJ7A 4G5RA 1CUGA 2IZZA 3AHHA 4H60A 4M9QA 3ASVA 1G291 3FOCA 5CA1B 5YASA 1YDFA 2D2EA 2BN4A 1BGVA 1Z68A 3WHPA 3PC2A 3HB0A 3SVLA 1CUCA 3EA4A 3BEDA 1DWOA 3VO9A 2ZT6A 5J4KA 2R79A 2FJUA 3DE2X 4MKHA 4MQEA 1XRLA 3I32A 3KR1A 4YJ3B 5H7XA 2H1OA 1VKZA 2F6RA 2TMKA 4ZVMA 3AP2A 4IXTA 1LA2A 1NXWA 2DPXA 2JANA 4WW0A 2W2NA 3JATB 3LRPA 4L5JA 3U9TA 4BGUA 2FX2A 3AY3A 4KXUA 2FPUA 3EAGA 3KAPA 1RZVA 2ZPTX 1YS4A 3IC5A 1J9ZA 2EDAA 4KFUA 5BNZA 3DEYX 1U3TA 1C30B 2G7ZA 2O1EA 3CLSC 3P9NA 4MKFA 1H0RA 4C2UA 4R0VA 4ZREA 3LHDA 1FE8A 5LCXA 4DR1B 3CUUA 3DR3A 4H3VA 1Q11A 2C9DA 2DC1A 4X7BA 4YAJA 1X7XA 4P80A 4YI3A 2VT7A 4NOLA 3LUBA 4OQNA 3V8NA 1M0EA 3NJ4A 2ZSEA 5LZ8A 3IESA 1WETA 3TNYA 1NJFA 4EVSA 4IDNA 5IARA 3HFJA 1YZKA 1RM0A 4I2VA 2FWRA 3PG5A 1TUBA 1UKVY 1P1FA 2QTVA 3PQ2A 2ZRAA 1G5HA 3TQHA 1RAFA 1X9IA 2FTKE 3R0ZA 1FFXB 1E1QD 3RBVA 1GU0A 3T1VA 3ZG6A 2QBYA 2BSXA 2WKSA 4U9HS 3RS4A 3H17A 1D4AA 1N9GA 5J9FA 5K4GA 4XVUA 1TO1E 2G1PA 4ZVVA 1A77A 3L7IA 1P4RA 2QP3A 4OAPA 1WVGA 4O2BA 3CWQA 4CGZA 1QH0A 3TBKA 3TTTA 3WDSA 1XAHA 4HNSA 3TAUA 3SBOA 5BW8A 1YRHA 3C8DA 4YI5A 421PA 4GUDA 3BDIA 1JFSA 2XRMA 1SUCA 3W5VA 5F76A 2P68A 1NLZA 2QU7A 1ZU5A 2FMKA 4D9KA 4D0SA 1CKEA 1DO2A 2AXEA 4OD0A 3CN7A 2N0SA 4NCNA 4WMLA 2E4XA 1EM8B 3OUZA 2MYPA 1DARA 1I6MA 1PV1A 2C2KA 1ZDMA 3ZIAA 1XZNA 2Q27A 2UVPB 1Z6TA 1DFGA 1E99A 1ONNA 2RGBA 1U9IA 5J40A 3I4CA 5EWLA 4KXLA 1GY8A 1DKPA 3H9BA 3VU0A 2G71A 1ZESA 4NPAA 3AYZB 3UHAA 1HZZA 4DVJA 1H2FA 5C8YB 3EWIA 4J0IA 1OT3A 2QYSA 4Y2GA 5DP2A 1KZYC 2I4RA 5G3YA 1VSQA 1KH3A 1P3JA 1GT6A 2HTFA 4R1OA 3UKDA 1OIVA 3VAAA 2P6RA 3HXKA 4QOGA 3SLKA 3TECE 1WBBA 3SIWA 3OU7A 2WU3A 4W5OA 1S02A 1DRVA 3S2GA 4HATA 5I48A 3PNMA 1FMLA 2IU4A 5LDGA 5I9IA 3S1LA 1ZYUA 1MV8A 3AL2A 3MNFA 4JI8B 5B3JC 3WSVA 1Z15A 4FHGA 5FL7A 1RAHA 1U9CA 4DA6A 3BSYA 3TVDA 3I9KA 3IERA 3PNBA 1CIVA 1DNPA 3QVWA 4R2XA 5CNIA 3MPUA 3WKAA 4MUBA 3JVEA 4Y2JA 5SYNA 7GPBA 3KOUA 3P8ZA 2V9CA 4WKPA 4KREA 1JLSA 1LLUA 1DQYA 3TJRA 1PQUA 4I8IA 1NMQA 2GTIA 2YZ2A 5ES3A 2J6HA 1EUCA 2W8BB 5TSDA 2PPLA 1TIPA 3FFWA 3N2NA 3H1GA 4KODA 4UMDA 4NG5A 4DB2A 2EYQA 2Z04A 4OQMA 3LKVA 4RPKA 3REOA 1T9ZA 3NASA 3C7AA 4RQTA 4TTRA 1OB2A 4FOSA 4URFA 1OUMA 1WSAA 1RFGE 2RJOA 4Q4AB 2SKDA 2AKYA 1KDVA 1Q1EA 1Y48E 2OD7A 1Z88A 1E4VA 3C2QA 2HA4A 4JDUA 1PJAA 4MIEA 4TUYA 4KQ2A 4CIWA 3CA8A 1OZFA 3A1FA 5JU6A 3N8DA 2IEGA 2GK7A 4U8GA 2B20A 5JWRA 3BCUA 1AZSC 2DFKB 5A5VA 4I5EA 3ZD9A 3QEMA 4Q7MB 2QLFA 1OLUB 1J9EA 1CQJB 2I66A 2MSEB 3UV3A 4MYDA 3H5TA 4HUTA 4GI7A 2Q9BA 4BUJA 5U9CA 2W2QA 4EY3A 2OCKA 1AGRA 3NI2A 2CHFA 3D81A 2Q6IA 3LVBA 4A73A 1FVFA 5EHIA 5IZCA 2YW2A 1JJBA 2R00C 2E6KA 2FMIA 3BWYA 3C6BA 3NJRA 4ZQIA 2CJXA 4GOOD 1NBME 5HBRA 3KOYA 3O38A 4DW8A 2PKQO 4LF7B 2FPXA 3ELBA 4EMBA 4DV2B 4TXNA 4UBMA 1WIWA 3KZXA 3H9CA 3TN7A 3ZOZA 4BO0A 4E4YA 4OGWA 3WLSA 3OT4A 3QE3A 1TLLA 5EZYF 4OJQA 4BP9A 1DO0A 3KIPA 2D59A 4FOPA 4UPEA 3P0RA 4LTDA 3GNTA 4XUCA 2H4HA 4XDYA 1G19A 3ZZTA 4EECA 4L3WA 3I1IA 5I7HA 1FLVA 2WHPA 3M3DA 3RFUA 2YIDA 2OZVA 2RSLA 1CEYA 3N75A 3F67A 4HWTA 1JP7A 3NS7A 1GV0A 3PGMA 1EIWA 5IAJA 5KYVA 1YE3A 1V26A 3ABZA 3L02A 4EG5A 1LJ8A 2GM9A 3PE4A 2H85A 3WMRA 4C89A 4QLBA 5C32A 1TK2A 1XDWA 4RHYA 5ENDA 2X8WA 1BX1A 2Q2NA 5F9FA 1VL8A 3MF4A 5DW3A 1PR2A 1GG9A 3A3PA 1A50B 2EX1A 2HRDA 3Q6MA 2C3UA 3HUTA 4MNTA 5BSMA 1UQRA 4MYTA 2I1WA 2B6HA 1U0SY 4MKGA 2OO3A 1XDGA 4H1UA 4WLVA 3NWBA 4XM1A 1D9ZA 2AGVA 1U1FA 5CVEA 2Q5JA 1F2TB 3AESA 1MLDA 3H0CA 1JHXA 3FNHA 4JUCA 3QJGA 4RZUA 1ONPA 4ZC8A 2EKDA 3VR3D 4LOLA 3TLMA 3HYLA 3V4PB 2C99A 3VNBA 2R6GA 4TMWA 3TD6A 5JSZA 3JVIA 1VYVA 3QX7A 4NBTA 4OXRA 1UMBB 1XF1A 4RFLA 4MJ7A 3PXGA 2QZ4A 5BWOA 4TLDA 3ZWQA 2FEKA 2V3WA 1D1SA 4PZAA 2I4LA 1XFDA 2EHDA 1UWKA 3HABA 3ASUA 4Y1RB 4B6GA 4CLHA 5IJWA 4I9GA 1YULA 3OX2A 4C1NA 1MPXA 3FTCA 3VR5H 4C0BA 3A28A 2WP0A 1GGVA 2BMVA 4FHEA 1KYQA 1M8KA 2DWPA 4NTZA 4DCCA 1PK7A 3QUSA 5HQJA 4ZHQB 5KTYA 5IC5A 4A91A 4D92A 2O1XA 4JR1A 1HH4A 1VIYA 4LVOA 1IY8A 2Z09A 4RVUA 4KH0A 4RF5A 3ZOKA 4EP1A 5EHGA 1RZRA 5EUMA 4LIPD 3VR2A 4JLUA 5J4LA 3UWOA 4K26A 1N5MA 2MSWA 3H8JA 2A3NA 4E5KA 3ZDBA 3ZZ0A 4Y7CA 1N4AA 4BGEA 2J6CA 1O0BA 1ADJA 2JLYA 4Z53A 2IPOA 4ER6A 3ZDXB 1P7ZA 1WMDA 3DDOA 3MBOA 5AW8A 1RWWA 1UINA 1PQPA 2F55A 2OUKA 3ORSA 3NKLA 2J3DA 3G5UA 1M2OA 2Q7XA 3ISTA 4J29A 4TKVB 5D1HA 2NU7A 4OHZA 2J8ZA 4EGAA 5EJ9A 1NX6A 1JR4A 2KPOA 1PJRA 3V4OA 5L53A 2BFBA 1QC5B 4DZRA 3PIDA 3INYA 5H4GA 1CNFA 5KVSA 4HB3A 3B8EA 3LHSA 1DINA 1MXFA