4K2HA

Crystal structure of c103a mutant of dj-1 superfamily protein stm1931 from salmonella typhimurium
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
185
structure length
185
Chain Sequence
MKKVAVLLAPGFEEAEAIVTLDILRRLHIDVETLACAESRAVVSYHDIPMVADSTLSERQQALFDAVVLPGGPQGSANLAANPAVIAFVARHDAAGKLICPIASAAARVLGAHGLLKGRRYVCSGDLWKAVPEGVYVDAPVVEDGNLISGKGLGHVFDFALTLSARLLGDDAPVREQAEHIYYPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of C103A mutant of DJ-1 superfamily protein STM1931 from Salmonella typhimurium
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Unknown function
molecule keywords Intracellular protease/amidase
total genus 66
structure length 185
sequence length 185
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4k2hA00
2RK6A 4OJYA 1Q7RA 3CNEA 3EJ6A 3P9RA 1PV2A 1WL8A 2ZUUA 3ZR4B 3F5DA 1CE8B 2VDJA 2YWCA 3SF8B 3FSEA 2NV0A 2ZUTA 4RKWA 4AUNA 1T3TA 3N7TA 4GE3A 2YWBA 3NORA 2AB0A 2WJZB 3CZ9A 3RHTA 4ENPA 3VU3A 4I46A 1ONSA 3TTUA 4E08A 2W7TA 4L8YA 4Y1RB 1VCMA 3TQIA 1C3OB 1A9XB 1UCFA 3M3PA 1VCOA 4L95C 3TTVA 1GGEA 4P35A 4QYXA 3TTYA 1QVVA 3NOOA 3OT1A 1P80A 4WXYB 4Y1RA 1CS0B 2A9VA 3ER6A 4ZDKA 3L18A 3PQ4A 4I4NA 4Y1GA 4L8FA 3TTXA 4BIMA 4ENRA 3ZJ5A 1JVNA 4RKYA 4B40A 1FY2A 5JZMA 1KXJA 2GHRA 2R1TB 5SY9A 4ENUA 2ISSD 4AULA 1QVZA 2GK3A 4MGHA 4ZGGA 4UZSA 1JDBC 1VHQA 1OI4A 2R1TA 4P2GA 4ZDJA 4XLLA 4ENQA 1P7ZA 5LIRA 3TTWA 4ADSG 4PXYA 3EZGA 2R1UA 1KA9H 1OX6A 3MGKA 3SOZA 2VKTA 3ZJ4A 1OX4A 1QF7A 3BWEA 2AD5A 3F71A 1P81A 3UOWA 4WINA 1GGHA 3FIJA 4BTEA 1SY7A 4OGFA 3R74A 4ZDIA 3BHNA 4LRUA 1QVWA 4ENSA 3P9PA 3SF8A 1GGFA 3UMMA 4K2HA 2OR3A 1R9GA 1CF9A 4UOQA 4AUMA 1GGKA 5JZOA 1IZYA 3P9QA 3PQ6A 2H2WA 1IPHA 2V4UA 2D7JA 4BFLA 1PE0A 4HCJA 1T0BA 4OIFA 1GPMA 1G2IA 2RK3A 1I7QB 1OY1A 4B31A 4B5KA 4MTCA 3B38A 5E9AA 4GUDA 4JQSA 3CZAA 1FYEA 4OFWA 3CYFA 4QYTA 3PQ5A 3R76A 4MNTA 2VRNA 3NOQA 3KKLA 4B7AA 1KEEB 3B36A 3EWNA 1C30B 4UCFA 4ENTA 1KWGA 5K4AA 2RK4A 3EN0A 1PDWA 1U9CA 1OX5A 4Y0NA 3D54D 1QWSA 4OGGA 4UOZA 4S0ZA 1T36B 5IP5A 1SOAA 4GE0A 5SY4A 4R7GA 4L7QA 2VPIA 3EFEA 4P36A 4Y1FA 1N57A 4ENVA 2VXOA 3PQ7A 1GG9A 3L4EA 1I7SB 2ZUSA 4P5PA 1O1YA 1K9VF 3L3BA 1L9XA 4UNIA 1OX4B 2LXNA 2R1VA 3PQ3A 2FEXA 1J42A 2YWJA 4I2NA 3TTTA 3UJNA 1VCNA 1QDLB 4N0MA 1S1MA 3GRAA 4D1YA 2YWDA 1I1QB 1P7YA 2ZUWA 5SYAA 4ENWA 4B2YA 4P34A 4OQ4A 1GGJA 2XF2A 3NVAA 4L8WB 4N12A 4Y1EA 1P5FA 2IUFA 3L7NA 5SY6A 3R75A 3WFZA 5BV2P 4AUEA 1M6VB 1Q2UA 5DFAA 2ZUVA 2R1VB 4LGYA 1GPWB 3TTSA 1KWKA 3PQ2A 3UGJA 4L78A 2ABWA 3OT1B 3MIIA 3NOVA 1PDVA 3PQ8A 3NONA 3CY6A 4E5VA 1BXRB 2NV2B 3B3AA 1IZZA 3UK7A 3P9SA 4AJ9A
chains in the Genus database with same CATH superfamily
3A25A 4EFDA 2FN7A 4OP1A 1MAHA 4QDZA 4C7KA 1U65A 4LNUA 2AE2A 2HPAA 2COEA 2WICA 3MWYW 1U90A 3ZU3A 1NBOA 1YIDA 3GHHA 4OHWA 4ESEA 4BXOA 1KYQA 2OUIA 3H7IA 1E7QA 1OBFO 1J9EA 1T9GR 3UJ9A 2O7VA 5DNUA 2I1QA 4M8IA 3KJXA 3PWZA 2O5RA 2M6RA 2C5GA 4FZ5A 4CLXA 1W34A 4CUJA 4A7PA 1EWYA 5EIOA 1NXTA 3ZXSA 4XD2A 1XK6A 2HT1A 1S9DA 3D3JA 3LPLA 3UAOA 4MKRA 5F9MA 3H16A 4UEKA 4TS4A 4WY5A 2BFBA 2Q41A 4ERXA 1SBQA 5KYXB 4WUVA 4HAWA 1QAMA 5HCNA 1WMDA 4XWOA 2VPWA 3ESXA 3WBJA 1L7QA 4XWTA 5JDIC 1V48A 1UXOA 1AQUA 5JXHA 4P9NA 1BSVA 3OE4A 3NETA 3EVCA 1LPAB 2VYNA 4TRJA 5I7HA 1FDTA 2BR3A 2C7VA 2CJWB 3OTIA 4PLFA 4MUIA 3EUWA 4RVCA 2FHPA 1FU8A 4J76A 3ZLJA 4YIHA 2OBYA 4R68A 1M1NB 2BGMA 3D81A 4IFTA 2XWPA 3EYAA 3OSUA 3OVMA 4RWZA 1J8MF 1ULAA 2XADA 4I3HA 1IN4A 4NNPA 2YWRA 4MS1A 4P5EA 4PR3A 4H1WA 4BC1A 3TQCA 4UOQA 4BVEA 2ESRA 2GN9A 3P9QA 4L8LA 2OGSA 4WSOA 3NBXX 3ZGVA 4CQNA 3IAS1 1XGKA 4OIFA 1J8QA 1E2EA 2MCFA 1WS6A 1FP1D 4AN4A 5KYWB 1GZ3A 4XB6B 3UH0A 2E87A 2NXWA 1ZNWA 1GA1A 3AJRA 5JPDA 3ADCA 2GESA 3TLGB 3KQNA 1NLYA 1C1XB 1G2OA 3FVVA 2O3TA 3EZFA 4Q21A 1U80A 4S04A 4GSKA 5A1JA 1LSJA 1HNZB 5HKBA 3LRTA 3CRVA 1EDDA 1CUEA 4TMKA 5AKIA 2VT3A 1IY9A 3SC2A 2ETVA 5A5EA 5C7IO 3FHCB 4INPA 4GL2A 2ONZA 4NPCA 1RE0A 1S01A 2ZG6A 4FDMA 3D0OA 3W8DA 3DT9A 3EAQA 4GZMA 5AVUA 3CUKA 2C3MA 3ERCA 2X76A 1B8PA 1S7CA 1T26A 1SU7A 3PKZA 5FL7A 1SRRA 1QFJA 1X7YA 4PAGA 3QEAZ 1XZEA 1FX1A 5IZCA 4CF4A 4W4TA 4KKXB 1QM5A 2JIOA 1QCDA 2Z4RA 3KHKA 4FK8A 4Y18A 5FWXA 4BE9A 4NZMA 2P2ZA 4CG0A 1Y8CA 5LZ2A 2NTYC 3VV3A 4AJ1A 4LX0A 3WQRA 3PRYA 4YO7A 4ALIA 4PIPA 2JAXA 1ZONA 1JJ7A 2G07A 5A3JA 3GYBA 1OTYA 5B1DA 2RHOA 2IYFA 3O3NB 1BN6A 3PITA 3KQWA 5IYZB 3AY6A 3WA7A 3G7UA 1XTZA 1K8ZB 1ZXXA 4D7AA 2DG2A 3VYSB 2IDJA 3ILHA 4P81A 2IYTA 1P4AA 4IKPA 5TV2A 2ZJ6A 3TL6A 4Q9AA 1OH6A 1U2EA 4C01A 1KZGB 3L6CA 1YQTA 3NO4A 4B3IA 4E7OA 2BY4A 3BMQB 1FP4A 4RQBA 2LKCA 3HCEA 1YO6A 1BEUB 4E31A 1QPGA 2P9ZA 3MJ4A 4LDJA 5G40A 3H2ZA 2QWXA 4N5IX 5CB4F 3HJGA 1XAGA 2I80A 2VK4A 3O8OA 4ONEA 4D2IA 3TTUA 5JVDA 4B6JA 5KNBH 2IXAA 3BBPA 5J47A 1KETA 4Z3KA 4NYMR 1S2NA 4KC0A 1PK7A 3UMVA 4NNOA 3OAAA 5T4EA 1RRKA 3VTAA 3A10A 1I30A 4ARIA 1ZCFA 2BFEA 5I4KA 4W5RA 2WIAA 1NURA 5TVKA 4NNJA 3OPYB 4LHVA 4XSHA 5A6SA 2O8BB 2Z5GA 4EJMA 3EGXB 1VIMA 5AHXA 1ISJA 5EXDA 3M5DA 5AIAA 3BHMA 4C4RA 3ZWBA 1RADA 4MQFA 5HFAA 1QYVA 1HSOA 1QE5A 2IXDA 3K94A 2GNOA 4PO3X 1AURA 2GERA 2VRCD 4FBGA 5FA6A 4D9KA 1BD4A 3ELYA 5CRIA 1U8CB 3KTAB 1XNJA 2GVNA 3PEVA 3P45A 4Y2SA 4DB4A 2Y71A 2YXDA 2ZWIA 1IAVA 1MV5A 1RXSA 2QQ0A 4BFSA 1X77A 4OGFA 3AG6A 3B8EA 4DJTA 2I7CA 2AOTA 2SNIE 3FDZA 4UZEA 2OL4A 3D4LA 4CDMA 2G70A 2AX3A 2PBZA 2B8TA 4BO2A 4EJ6A 2YXPX 1GR1A 2V4UA 5EZ5A 1N77A 3IQEA 4NFYA 4XQ0A 1X80B 4EB8A 1CDOA 2UYCA 4B31A 4UEJA 1CB0A 5JO0A 3FPGA 1QAQA 4KZKA 4A23A 3TG8A 1Z7WA 1ISHA 3B51X 3DVRX 2NU7B 4NYIQ 5IN4A 621PA 2P9GA 2PWPA 4LOJA 2ZDHA 2XNHA 4H6PA 4M0DA 3MINB 4XB1A 3RRBA 4BVAA 2XMSA 5GAJA 3DBIA 4RTPA 4GKVA 4O4JA 3UENA 3I23A 2JJ2A 3SIPA 2ATVA 3TD2A 1WXHA 1JW9B 2J6HA 3GW8A 1BO6A 3CISA 1X9HA 2O2GA 3HADA 3N2GB 1CUDA 4RFVA 3T38A 3W7BA 2FZEA 1TL7C 3AVQA 3EUEA 1UIRA 4XEUA 3IBYA 3H5IA 3LUHA 2WVAA 4N6NA 3DPSA 3EUAA 3ADBA 1WMEA 1I6MA 3ZV7A 4K03A 1QIGA 1ZK4A 3TRHA 3TMAA 3IPXA 4ROTA 4OBBA 3G0IA 5AYVA 5J40A 4G8JA 2VYVA 4HPWA 5EIEA 4DCCA 2RARA 3L1UA 3A4LA 4UATA 3VAAA 4FB5A 1WQ1R 3DMFA 5TT1A 3UJCA 1Y0BA 2DXIA 4EY8A 1ZU5A 2YRXA 3I39X 4GYKA 4M8KA 4US2R 4JP3A 3ZHVA 3ZBTA 2E5WA 3VOSA 5LQNA 2ZSIA 3U44B 2PSJA 3HRHA 2B92A 4M9RA 1WCIA 2JJQA 2Q5EA 4EVRA 3IOYA 2O52A 2VJKA 3FX2A 4FCCA 4WZAB 5LZ8A 5LQKA 4U7JA 2NUTA 2XAAA 2D0OB 3IKTA 4QAJA 3AFNA 1S8NA 3DBRA 2J0UB 3IDQA 3WKAA 3E7WA 1LRLA 3UEOA 3IT3A 1Y6GA 5LBIA 3O6VA 2P9CA 3NWBA 2FA9A 1OA1A 2X5XA 3BFPA 2OWEA 2Q5IA 2XPCA 4O2AA 5TQ0A 2W2VA 4Y7CA 3OIYA 4U2CA 2WWFA 5LWQA 3T3OA 1MABA 1T8TA 2DBZA 2VSYA 4ZVLA 2HPZA 5JXGA 2H4YA 3A3YA 2H8KA 5IDWA 1YRHA 1T8UA 1ZSNA 3F6BX 1XTRA 1P8JA 2C8VA 4D45A 5IJWA 4EUSA 5JY1A 1HT3A 1WP9A 1UBGA 1QRSA 1FVOA 2BFWA 1XRRA 2YZGA 1KDZA 2ZJOA 2PUDA 3U40A 3VZCA 2Z2ZA 3EYWA 3SHVA 3RVQA 4XQEA 3L7DA 4OL0A 5FL7D 1QQ6A 1A5BB 1EJ2A 3EIWA 4R7ZA 4Y3UA 5T57A 3RU2A 4DIOA 4DLXA 3PFBA 1Y3IA 1MOSA 5A4AA 3MAAC 4NICA 3PXXA 2AN5A 1CZRA 1XU9A 1Z4IA 5EJ4A 4X97A 4COKA 4JI4B 1CFZA 1FQJA 4BRZA 4GHWA 4PFSA 2PUHA 3WGOA 3NP9A 1G9XA 1I3LA 4ZJUA 4YR9A 2BISA 4K87A 3AZOA 4IIEA 5CYFA 4R4JA 1C8LA 1ZA2A 2ORYA 1EFHA 3MQFA 1JI0A 1TW2A 3UWSA 2IYOA 4KXVA 5BQ3A 2ZIGA 4TYNA 3LOQA 4MIEA 1NUTA 1XWFA 3FIJA 1C9EA 1YFKA 4WCVA 2AN4A 3OPYI 4O0LA 1CHDA 1OAAA 3RC2A 1MVOA 2AMJA 1PR3A 1NR5A 1B0UA 1ZJJA 2I2DA 3AFGA 3BA1A 5JATA 1YDMA 3VISA 2RGNC 4TMTA 3K09C 4NMMA 2YFHA 4AIIA 4D3FA 1UM9B 4LHXA 2CXXA 4JGBA 1JVBA 2A7XA 1YU6A 3GGOA 5ES4B 2Y4NA 2YXEA 3EMBA 3P96A 4TLMB 4X66B 4ZMSA 5CVVA 3TW0A 4EHHA 5C80A 1C9YA 5EXEA 3RYFA 2VRNA 4B84A 4U9UA 3JARA 1YJ8A 2FPWA 4KW7A 3ZGZA 3NEYA 5DX0A 4C07A 5JD3A 4BMYA 1A7UA 3K16A 2BZ0A 3IHLA 3QSYA 1B26A 1W5AA 2Q3CA 1AK1A 3KQOA 3PCRB 4QGFA 1VHJA 5AVJA 4CG1A 2NX2A 2F1OA 2PKQO 1V4BA 1OQAA 4H7FA 4Z0TA 4DMFA 4GNRA 1NLFA 3DLAA 1RBQA 4W7HA 1ZH8A 3GT3A 1N7GA 1NA5A 1NRXA 4U8HA 3QU2A 5FPSA 1D0SA 1A3CA 4M8NE 5CNMA 1ZG3A 1NVUQ 1X7XA 4QBKA 3HU5A 2EEPA 2JANA 3E9MA 3N0XA 1L8XA 2EL9A 4FHCA 1LX7A 4BX3A 1GRCA 4ZVSA 1L7AA 5HMLA 4DUZB 4IXDA 2V45A 1MC1A 3NC0C 4W8GA 1FEZA 1SURA 3FTPA 3ZZNA 3BE5A 4Z86A 1SOMA 2IIQA 1V11A 1NVVR 3LQKA 3SSAA 3B1YA 1Q0QA 3P26A 3U3MA 3LX4A 4X7BA 4HAIA 3ZY6A 2FEKA 5LMZA 2CVZA 3IAFA 4LTNA 3WOHA 1T9CA 1UBTS 4Q6WA 3T15A 1Q7CA 2VH1A 1TK9A 4GWKA 3ZVLA 3L7AA 3INNA 5T8KC 2WHRA 2H5EA 4TWAA 3NDIA 3U9LA 1X80A 5HW0A 1CQXA 1NW7A 2EJVA 3SQWA 3ZWDA 4AJ9A 5IKMA 1QONA 1SB8A 1UEXC 2NT3A 1AXGA 4UC0A 1JMYA 3T7CA 1P0MA 1UWVA 3GEBA 4CM1A 4J07A 3CW9A 4JJGA 5GVSA 4J4HA 1KDOA 1TU0A 4DCTA 4DM4A 5IUJC 2YOGA 1E5LA 2VUHB 3R0IA 1IULA 4Q3NA 3LHDA 2AFVA 3Q6NA 4JJIA 2ADFA 3UMGA 1OW3B 3QHAA 1L7BA 3V1MA 2CVPA 2DOKA 5GWXA 4B48A 1TIKA 4BIMA 2CB0A 2A0UA 4NFSA 4U7DA 1IVSA 4JC4A 2A4MA 1XO1A 4TTTS 4XYEA 3S2EA 1RJGA 1OPXA 4Y9RA 5JAZA 5MDHA 3EGXA 5FO0A 2JL1A 3RFCA 1SQSA 2F43B 2E48A 1ADFA 2H9YA 4FQ7A 1FW8A 1J56A 1ZUWA 3NJRA 4JOQA 1I4DD 4TL7A 5I8ZA 4TV8A 3T0FA 3THYA 1SXGA 2C7GA 1OI2A 3GYGA 4YRSA 2JRLA 4KQ1A 4AROA 1FVHA 4CR8A 4ZYVA 2HSDA 3JVEA 2A5LA 4K0RA 2AD5A 2IYYA 3Q5GA 4KXQA 4N6GA 1B41A 4NLLA 2IEYA 3O8OB 3FMVA 4MCJA 3V7FA 1WCYA 1IMJA 2JIDA 1D4AA 1TVMA 1U1GA 3WMRA 2XOKD 1V1RA 5TNXA 4ID3A 2Q3JA 4H77A 3B89A 2DPXA 3RJZA 1XF1A 1RJ9A 3Q8WA 1EM8B 2H63A 1K6XA 1PFVA 3KPUA 2D6FA 2EX0A 4NY1A 3WYDA 1D2GA 2IOFA 3GJ8A 2BGKA 1LJUA 3BD7A 2FJUA 2C5AA 3JD4A 3PBKA 4AF7A 4CM9A 4F71A 5LKRA 2CNWA 4LVCA 3IAM6 2CHEA 4DADA 3FPLA 1NV9A 3GJ3A 4IIJA 4K6GA 5U4QA 1NT4A 3PEUA 1GQQA 4KDFA 4YRPA 4YYZA 2Q62A 3MILA 4D56A 5CFOA 2ZXEA 1A95A 3LCUA 4HYQA 1BNCA 3KPVA 3FNFA 1RBMA 3GPCA 3WGTA 2O2CA 5EJMA 3ZHOA 2DM6A 3IC5A 2OHGA 2IXEA 3MWLA 3RKUA 3FPJA 1ZCAA 4BNNA 2E4WA 3HXLA 3PZRA 3ZD8A 4DZTA 2VZ0A 3N7AA 3CSSA 1ABBA 1PZMA 3DBLA 3DZFA 3FR8A 2XCRB 3GJXC 4QFCA 3LPCA 4QA9A 5IAKA 3FHJA 2JASA 4AT1A 1N6IA 4NE9A 4EKEA 1GLGA 1HH4A 1J2UA 2X22A 1TLLA 1TJYA 3DWEX 3PJFA 5DGTA 1FQKA 3WJ1A 2P9JA 3GN2A 5KVVA 5LP6F 4JK3A 4WKPA 1GZ6A 1I5OA 2EX1A 1EFVB 3SYTA 3V6LA 2AMFA 4WX2B 4ZT6A 2D5CA 1E9SA 1J1ZA 1O96B 1P1JA 5ITSA 5IMBA 1XTQA 1XJCA 4U3JA 3SX0A 3L0IB 1ZAYA 3ITDA 1C1XA 1CUUA 1MBZA 2C83A 2WD8A 2WLTA 2C3PA 3MBKA 3CTPA 4H7IA 4OVKA 5D3KA 1T5OA 3K32A 3O9MA 2ZWPA 1KWKA 4GMFA 3U62A 3R3ZA 1W4CA 4W5JA 1MIOA 3N0RA 1I5EA 2BGGA 2CJXA 3JVVA 1A76A 1GITA 1NRJB 1CUHA 2BMWA 4HLDA 4JQZA 4D4MA 2PV0A 3ILSA 4Q4CA 1AUOA 1GHTA 4DC1A 1Q1AA 2C4WA 3P9SA 4CXMA 1OWPA 1GU0A 3QUCA 3QVTA 4YP0A 4LVUA 5EZYA 4PG4A 4HWPA 2HQOA 1WZIA 4GH5A 1ZJWA 1OB5A 2P62A 2VDJA 3EVFA 4ZOLF 1E4VA 1UKZA 1VLVA 3QVJA 5K2MA 1F17A 1WABA 4HS9A 4ES6A 1XU4A 2A0KA 2PA3A 5GJWC 3RG2A 3HR7A 2CDCA 2HIAA 2X14A 3I76A 1RCFA 3MS7A 5BSUA 4ALKA 3W5AA 2G0NA 3M3PA 2FWAA 1DAKA 3I0NA 1FOEB 1ORDA 4X92A 3HWWA 2JG3A 1LLDA 3PQ4A 3I01A 1GILA 3V7WA 1HRDA 1QKIA 1V3UA 2FV8A 4OI4A 4MI6A 3ZHTA 4BP8A 5AVZA 1ZMBA 3MYYA 3WYEA 3D6MA 2JB9A 2JJYA 4FHGA 3AINA 1DZ3A 4WTOA 4YXWD 4D3ZA 4PYLA 4YFVA 4N7RA 1KSJA 3GLUA 3N8IA 4RTNA 1ZUNA 1IZ8A 1ZWLA 1I2DA 1R2QA 4RVDA 3IP3A 1R16A 3T9DA 1IQPA 2EGUA 3NBKA 3G8BA 3SEAA 3ZDEA 3RANA 3LUCA 1Z83A 4G9BA 5HX7A 5K9ZA 2YWXA 5AR1A 4DT1B 1L4FA 1U8FO 5ICGA 1FLDA 1F5NA 3LPMA 4UW9A 1K2VN 1RSZA 3LQQA 1GNQA 2GEKA 2H1VA 3E1SA 1FNNA 4K6OA 4E33A 4KSBA 2Q5QA 1L1QA 4YJHB 4LNUB 3VNSA 1SUPA 1W46A 1J2RA 3C74A 5JZVA 3K8YA 3CG0A 1OIVA 3PUVA 3BMNB 4JXKA 1JKJB 4E5DA 4OTZA 2XMZA 3EG9B 1L5WA 3SX2A 4WNAB 4L27A 2PPLA 2G5GX 2PUTA 1L4HA 2QY6A 1Y5NA 5AWFC 3SHOA 3VQTA 3A8TA 3EIQA 2HGSA 5DGXA 2FUCA 2J3MA 3IJRA 3L0DA 3A6EA 4FFVA 3Q4GA 4M37A 3WL7A 4UM9B 4OQFA 5KJCA 3DBHB 2GZ1A 4PZAA 1QP7A 1L5ZA 2DPHA 4YAJA 5DX8A 5CM2Z 5GIOE 1YI1A 2PPVA 4HX2A 2P8SA 1COWA 3CZRA 4C7MA 3AVUA 2V58A 3TEJA 1PJ8A 2RHMA 3KV1A 1L8OA 1E2IA 4OU5A 5K0GA 4MW9A 1LNZA 2GARA 3KQQA 1UJNA 3UW3A 2ZT8A 3RYIB 3DEZA 4ND4A 4KX3A 2O54A 1O9BA 3RS0A 2C31A 1SCKA 2DECA 1YE8A 3DR3A 3NT2A 4OP2A 5TSDA 4ZK6A 2GFHA 3VPCA 2UZAA 1QH0A 3IULA 3HUFA 5HM8A 3C6QA 1X7WA 4FN5A 3I2IA 1MOPA 1TYDE 4D43A 1UC4B 2EP7A 1GA4A 3FCCA 1NBME 4FZVA 5TEWA 3TNYA 4D5EA 2V7PA 2XCSB 4I4TB 2ZROA 3WRYC 5JC1A 2AFIE 1OCEA 5KQRA 2FP3A 1UMBB 3I9JA 3HJTA 4C0SA 3BHJA 2GXSA 1FFWA 2QHXA 3IHKA 3R6LA 3W3AA 5B3JA 5SYAA 3HXPA 3PNKA 3G88A 4HNRA 5E1MA 3FYTA 1BKYA 4I55B 1W44A 1RXWA 1DJOA 2XNJA 3PR1A 3KU1A 5J4VA 2F67A 1QHSA 4NE7A 2A67A 2I65A 4UBMA 3ZQUA 4BWVA 4UQLA 4INJA 1Z8NA 4MWCA 5F1OA 4JB0A 4ZPJA 1N2CE 3DTYA 3H2IA 2X7HA 4OFXA 5DNCA 1XDSA 3F0TA 1QTRA 4Q4HB 2E18A 2OILA 1H66A 1GDTA 5LOVF 3AUKA 4FJ2A 5GMOA 5IG2A 2GWRA 3PX7A 1ZEMA 5CA1B 1XEFA 2QORA 1UT8A 2RMKA 3EOZA 4M9QA 4ZMBA 1KO8A 4IWYA 2XXBA 1KH1A 4RHFA 2V7UA 4DLLA 4L8VA 2OD7A 1ODFA 1U0EA 1ZX1A 3AETB 3N6RA 4RMNA 1SG0A 4B1FA 5F7OA 4Z4GA 1XNRB 5EHXA 1EBFA 1G7RA 5AXBA 5FA8A 4N5HX 2ZULA 1R0BA 2I6GA 2WJYA 5ALPA 4L6CA 2C82A 2P9TA 4RENA 3L4JA 3PA8A 2H4WA 2ZS8A 3NS7A 1IE3A 3SI7A 4CEJA 3UB4A 3C7AA 2KB0A 1IZ0A 1W2WB 4RKYA 1E4EB 2YV2A 2AN3A 3NM6B 3L7IA 5JH7B 3UUWA 1FPQA 2FW9A 4HUQB 4GBMA 2WTBA 4KWIA 1SKAA 1U0GA 2VQEB 2QYHA 3MWFA 5FULA 3ZH2A 3VVLA 2JVJA 4KO1S 4FFRA 2Q4EA 3ZE7A 4QATA 2WV7A 5DX1A 1JNYA 1EHCA 1Q0ZA 2LD4A 4YUWA 3RTDA 3FYSA 5E2AA 1NJFA 1M1YA 3RVBA 1TAQA 1X70A 4KAAA 1Y9ZA 2D1SA 3GJ6A 3NHZA 1PFYA 1Q91A 4HMPA 1E62A 5DHFA 3U13A 4DC0A 4DIEA 1IJEA 1JG1A 1W48A 2G9UA 4HNTA 3IBTA 4Q9LA 4JLVA 4M1MA 2OR3A 1QJ4A 3UWDA 5KYTA 1AKYA 3S8EA 3DCIA 4PE5B 4AZVA 3PJEA 1R4NA 3HGMA 4JXJA 4BUCA 4BFCA 3IQZA 4QRHA 4TSRA 2W9XA 3RYHB 4CM3A 4GI1A 4OFWA 4U7FA 2E7ZA 1E3LA 1LBSA 1Z0IA 2B4YA 2HX1A 3ASVA 4FNAA 3FE2A 3WMEA 2G82A 1FTSA 1N2HA 4HXYA 5ECGC 4Q48A 2G83A 1SOVA 1KAOA 4FUTA 1NNSA 4E70A 4ZGBA 1M1ZA 5FLEX 1W7AA 4HR7A 2PRKA 2OTCA 5FD8A 2XOEA 5JW6A 4R7GA 4BNHA 4QUKA 3KLPX 3RAJA 2O1WA 1PDOA 3SR0A 3RIYA 4H7KA 2MINB 1HO3A 5D3MA 2IT1A 2R7MA 4IKEA 1VI2A 4CKYA 5C8DA 3RVSA 1OX4B 4WK6A 5LQRA 3DOUA 3LUGA 2ET6A 3G2JA 1MJGA 1BJTA 3K4QA 2GN2A 1AKQA 1DUVG 3P9ZA 2VR1A 2Q1XA 3V8MA 1T2CA 2IGTA 4ID9A 4F86A 1ZIOA 3R6TA 4FGKA 5D6OA 2F6RA 3OUUA 4ENWA 1TKCA 3HB5X 2Q27A 2PXHA 4A8TA 4Z2YA 3PDCA 4JT8A 3HYSA 3R75A 2JA2A 2Y1LA 5PNTA 1G1MA 1JH9A 2AI2A 2XYHA 3GRKA 3HV2A 1UKBA 3G7SA 4P3PA 2WJGA 3LOUA 5HF5A 1MRNA 1IG0A 5AKGA 4OM8A 4PQYA 4HGYA 1WOYA 1VFPA 4F7DA 1P2GA 3E05A 1WSBA 1YA8A 5FLYA 4N54A 2WE7A 1B0ZA 1QYWA 3AFOA 1MLDA 2ZB7A 1CF2O 1HZJA 2Z30A 4RPIA 5CVEA 3V8VA 2WMOB 3NKFA 5L3SA 2WVJA 4AF6A 1NQTA 5KYNA 1JFTA 3TIGA 3C3DA 4KAJA 4BLUA 1K9SA 1N9GA 4FKBA 4F8JA 5EJ8A 1P72A 4Z3DA 4FOLA 3S2UA 1K0UA 1VKNA 3LDUA 4X7MA 1MH9A 3UM9A 1UQTA 3C5EA 3IIJA 1GNSA 1SCUA 1PUXA 5C8YB 2ZJZA 1P61B 2PRYA 4Z9XA 1CY7A 3FUVA 1CW2B 5D00A 1FFDA 3ZWCA 1QS0B 5EUMA 3MCAA 1D5WA 1TYBE 4ZP1A 2ODBA 5DULA 5FYQA 1SXJC 1EUCB 3NNNA 2G0AA 5F1PA 3UUEA 4YCBA 1U4OA 1QIIA 2WYOA 3E3OA 3OA2A 3NHSA 3HUEA 5LP6B 1Z6YA 2XSZD 1JHOA 1Y1SA 3WHIA 3PNBA 5TPZD 4CMGA 2JCBA 1FB5A 3IAM1 4G0MA 4JROA 3ZHRA 1QCYA 3TTWA 1AX9A 1Z62A 3FFXA 3IE0A 3HNPA 3ZDYB 1QRTA 3EPHA 4ADSG 2Q1SA 2RI1A 2WWHA 3DA8A 1CX9B 1JLLB 1RM0A 3A9WA 4Q6BA 1BMFD 4FNMA 4QULA 1XPOA 5B4VA 2FUKA 5E38A 4Z0PA 2WAMA 2FR1A 1LFAA 2AZMA 2NACA 4PICA 4POAA 4OATA 3UKJA 4O08A 1MPXA 2GYYA 3EPKA 1EVEA 2I99A 3PDHA 2C8JA 1YGPA 5K5EA 2Y1FA 3IELA 3CRZA 2YN4A 3OTHA 3FVRA 3PGMA 2WU0A 3BRWA 3OQBA 4M88A 4Y6SA 3UA4A 2V6FA 5EP1A 2NMVA 5HMMA 2YJ5A 1TGVA 3IKMB 1P4JA 4JQSA 3RTGA 4ZHQF 2H29A 5IJ0B 1QU3A 1DAIA 1LBIA 1OR8A 4R0VA 1QGED 2IPAB 3F74A 4P4NA 4PXSA 5KOYA 4URYR 3QEBZ 1LV8A 3TNLA 5NULA 3GEMA 1I13A 3H5RA 1G2QA 2H48A 4RFSA 3OECA 3QXHA 4OYYA 2AKAB 1V9CA 1YF3A 3IV6A 1X8KA 1XA0A 2R96A 4M53A 3W5IA 4WCDA 1XZKA 3SJUA 4P36A 3RT9A 3ABQB 4LDZA 2PD6A 3EGDA 3KXDA 4HUTA 3GAAA 4BVBA 5K8LA 4Y2XA 3ZVMA 4AO6A 1KEUA 4PSUA 2R6FA 5IK2A 5T6BA 2AA3A 4GVLA 3AR3A 4M1QA 4HXFB 4TSKA 1KBZA 5DIZA 2HK8A 2P9YA 4OU4A 4UBIA 5EXTA 3G2LA 3IOEA 3PZBA 4TTJA 1NQXA 1E63A 5CTAA 3EWAA 1ONBA 3QGMA 3E9ZA 3U56A 4GLOA 1AUVA 1V11B 2C29D 4IBOA 5EKSA 2JIPA 4DCOA 2J48A 3M1LA 4OQDA 4XWYA 2PT6A 4CMJA 2C2WA 1M9NA 1G8MA 2KS6A 1NU6A 2RFLA 5IAAA 3I9MA 3PA6A 3S40A 1UXHA 1XC7A 3OEED 3NWOA 2ON6A 4IXTA 3P20A 4FQ8A 4AG3A 1JX6A 2H1WA 3PDIA 1QK4A 3TW6A 1QAOA 3CLSC 1TZCA 1GPWB 5C7LO 2XJ9A 1G7TA 3QH4A 3TRFA 1X7XB 5GTDA 4UHKA 5AJTA 2RHLA 1VIAA 2I7DA 1W1WA 3G02A 3OLVA 4IGKA 3T5MA 2OV3A 4NWIA 1KKUA 3V4LA 2O2HA 3HUTA 4PSKA 4GDMA 2YIMA 5JC8A 2H0RA 2X8JB 4CMBA 2CVFA 4ETWA 2XRMA 1ZC3A 4GT1A 2VTBA 4NDAA 4DNQA 2J3QA 2E4UA 5HJ5A 4NF2A 5EJEA 3PDUA 1LTHR 4WJZA 3P52A 3MBIA 5LNK1 3HO8A 2DSNA 4E4RA 2P9HA 4WBXC 4OXQA 4ILEA 5TJ9A 1CR6A 4FDUA 1YQUA 3VBEA 4E08A 1Z2DA 1ZQ1A 2E4YA 1DQYA 1UCFA 3V1TC 3MS2A 5J1TB 4L4YA 1MO3A 3EBOA 1PNQA 1QH1A 3W6ZA 4H7HA 4HLNA 3LVFO 2YTZA 5AI9A 4ETMA 1EWTA 2FRDA 1ETUA 1OWLA 1KTIA 3W4JA 1RWNA 2OC4A 2UVQA 5DNEA 2YZMA 5DWDA 5BW6B 4UE3S 3BJIC 3MC1A 5TS3A 3R8FA 5G0VA 5SY9A 4KP7A 1N5LA 1DO2A 1NAIA 4IG9A 2O57A 2OSVA 2D59A 1RWOA 1UJBA 4L5AA 1YRYE 2V03A 2YJNA 2AV6A 1SUAA 2V7VA 1EFTA 1XKQA 3C4QA 4IYRA 4QFDA 4BNIA 1L7VC 1HY3A 1Q1ZA 4JCCA 1MN6A 4RPLA 3V2IA 3UV7A 1PEKE 4TUYA 4DILA 5C8ZA 5CHEA 3T9CA 1ISGA 1T4GA 1XHEA 5EEGA 4B79A 4XUDA 4PCUA 8OHMA 2PWBA 1EGVB 2ANBA 2BEKA 3L7KA 3PDIB 3VR4H 3IA7A 3P9PA 3DT6A 3LX8A 5AI6A 5KHLB 2WMDA 2H4ZA 3R9KA 5I3ZA 1TECE 1QE0A 1R6BX 1ANKA 1ORWA 1UC8A 2WD7A 2Q0HA 3FUXA 1YULA 4GOXA 5LMUB 1AGPA 3RSOA 3UJ3X 4B7XA 4KRYA 2CXNA 2BM8A 1X94A 3D8RA 2FQQA 4XOUA 3FBGA 5T4HA 4RL4A 1PZNA 4EL0A 4D8WA 3P9YA 1LPPA 2X13A 2EBFX 3QRWA 4D9FA 1DZIA 3KYDB 3OESA 2GZ2A 2VYND 3KE8A 1MTOA 2AJTA 4A27A 4J9UE 4NV3A 4XJTA 3NJ4A 2Z5FA 2OENG 2EW1A 2F62A 3B7GA 4X00A 2QSJA 2IE8A 4NAHA 4P32A 4CMAA 2G08A 1N2GA 3S70A 3F6PA 1OX5A 3EGDB 2BGTA 3VMMA 3NV7A 1W4BA 4DHEA 5DHRA 2OHOA 2GJ8A 2REQA 4KMRA 3QYJA 4XVHA 4K28A 4JLJA 3GZJA 1ND5A 3IO5A 5REQB 4XIYA 4ZREA 1R12A 4JC5A 4CW7A 3BRWD 4E4YA 1ZISA 1SUDA 2NO0A 1JYFA 4IDFA 3ZS8A 1WTAA 4ZXPA 1N8NA 3WYGA 1EJ6A 2VPTA 1M7HA 5IJ0A 1DE0A 4H6WA 1N32B 4NJMA 2WMNB 3OY2A 2JLBA 3HUUA 4NS4A 3TXXA 1U9YA 1XMOB 1GP2A 1RLTA 4BAGA 1OSNA 2EQBA 5IEBA 1T0UA 1HZZA 1DX6A 2R3SA 4FD2A 3ZQ4A 2BYTA 1KAMA 1C50A 2H08A 3SN6A 1JDUA 1E2JA 3AT1A 3QPDA 4MZXA 2EP5A 1KMQA 1RD4A 3TD9A 2CJFA 3A4YA 4DXHA 4E5PA 1IN8A 1G8KA 4G85A 1HE8B 1TCCA 1MIHA 1I32A 3K0FA 3AUTA 4ARUA 5KYUB 3T1HB 2P8JA 4CKXA 3N39C 3F9CA 5JJLA 3G2MA 4XTRA 3UY4A 2QZPA 3IVMA 3RC8A 1XP8A 2KQUA 3BICA 2OEPA 3QUQA 3K5PA 2WWWA 3UMSA 3WGHA 1X13A 1Z74A 4LY9A 4OHOA 4TKLA 2R6JA 1GCIA 2GFQA 1JU3A 3WAKA 5KNBA 2HZBA 4X45A 1J8YF 2YJ6A 2QA5A 4MJXA 2GBLC 1ULUA 4ISCA 1XP5A 2ZUTA 3TGLA 3DM9B 4IG4A 3GCXA 4TYMA 4ALMA 1KZ4A 3RYCA 1MX1A 1QS0A 5HUJA 1ESCA 2XB8A 2ZJ0A 2O6LA 5DPMA 5EJIA 2INGX 3VR0A 4Z1OA 2JPDA 3AEXA 2ZBGA 3FMPB 3MMPA 3V4FA 3VR6H 3O2QB 2KHZA 2QGZA 3L06A 5FCDA 4ETIA 2G06A 5CDSA 4BNTA 2BMEA 3TTYA 2QU7A 3GLRA 2I87A 2P69A 2QT1A 2CLKB 3VRHA 1CSEE 1EK1A 1W6UA 4PAWA 1RZUA 1C7FA 1FQOA 3IUEA 2C58A 1I6WA 1ZUIA 5ALEA 2FSVA 5G1PA 2E37A 1V8ZA 2EBWA 3VYRB 1KXJA 1ZIDA 1B2LA 3ZH9B 5L3SB 4H59A 2ZBFA 2DWCA 1WCXA 1OA0A 2AOTB 2ZVJA 2X5OA 2QVCA 3K6RA 1QZZA 2C0CA 5HQ3B 4YI5A 5I8PA 3VC3A 2WWGA 3ETGA 3H13A 4H31A 1Q0LA 2ZWAA 2Y1EA 2AKYA 2R1UA 3U3XA 4FC7A 1NVMB 5F3RA 3NHWA 1FTWA 3UOWA 2GN6A 3I34X 3W6OA 4CLOA 1UK9A 3A26A 4UXJA 4EY3A 2QR5A 1ZM7A 3OAAD 3RT1A 4UPVA 3INYA 4QOGA 4KODA 5L4SA 3IE1A 3CMMA 3TDMA 3BFKA 1GSAA 2FW8A 3T52A 5EHIA 1GAWA 1VYUA 4C4TA 2OBMA 2QRKA 2ZBUA 3ML1A 4R5HA 3RFVA 3IR5A 3N05A 3FTNA 3ULKA 4C87A 5KTOA 5ETJA 2EZ8A 3O93A 4U5QA 2JJ1A 4QTTB 3JALA 3R3VA 3KLBA 4N49A 2AFIB 2I4TA 3GXOA 3ZD7A 3S0JA 1NX9A 4ROSA 4TWIA 3ANSA 4QBIA 1M5RA 4C3VA 2UZ4A 2BIFA 1JAHA 1H5NA 5BOVA 3B3FA 5D3MB 3H2GA 1ZD8A 2PJUA 4JJKA 3VNRA 1HR0B 1YJQA 4G6ZA 2Z6AA 5LP6C 2JDID 4FNOA 3E7FA 2CL0X 3BMQA 3DR5A 5IVPA 1RZ3A 3UUGA 2FX2A 4CV3A 2RGYA 3U4DA 1UKAA 3BXOA 1D7AA 1Q16A 5EE0A 1NXQA 4H9GA 2CWDA 3BE4A 3BC1A 4D92A 3K1AB 1L4KA 2IYZA 1V3VA 2WC1A 2JI4A 3CB2A 3ZDDA 5LA6F 3HZZA 2C5EA 3E9CA 2IS4A 4LOLA 4BBAA 4BMZA 4EYSA 1TD1A 3NRBA 3ROXA 4FS8A 3LUPA 4PGAA 4DTCA 1P39A 5AQ1A 4OJQA 1QO7A 3IBSA 3ZQJA 1DAOA 3PYXA 4CEHB 3T3IA 2A78A 2P3SA 2QQGA 2XMBA 1E89A 2CFTA 3ICVA 3RUFA 4AZ0B 3CF4A 3GRRA 4KVFA 2ZCJA 2XZLA 2M1XA 4RZIA 1F48A 4K9KA 2GD6A 3L40A 1Y5RA 3OIFA 1WSWA 4OM7A 4WNCA 5DOZA 5JY6A 3KUKA 4HEA1 2QV7A 4AJKA 5KOJB 1VE3A 1DDGA 3V32A 3X1KA 3LLCA 4RSMA 3ZX5A 3DVAB 2EIHA 3GUYA 1PR9A 4Q7QA 4WFJA 3FJ1A 4RKEA 3EZ6A 4BB6A 3WS7A 1ECJA 2VRWA 3B9QA 2GSDA 5J43A 5BT9A 3C2QA 3GPIA 1U3CA 3ZGXA 2EWMA 2PX4A 3PXBA 5J2UF 3HXOA 1NPTO 1PL8A 2GX6A 3T7DA 4BO3A 1SXPA 3K9HA 1QV6A 3NWPA 2OXTA 1FFBA 5IYZF 5C8XA 3F5MA 4GPBA 1T0PA 3DE5X 1RAEA 3LKBA 1T5DX 1V41E 5HF6A 4EHIA 3AWDA 1JEYA 4LUCA 2WPDA 3KEQA 1NF9A 1SNYA 2Q8PA 4RK6A 4Q9IA 5F2NA 3RVJA 1HLDA 4IFBA 5A5VA 2CK3D 3GO4A 4I6JA 3HB7A 3JQ8B 4PYMA 3C7KA 4TTAA 4IJUA 3HM9A 3UOAB 2BSXA 4YO8A 4Q9NA 4X0EA 3RS8A 3RSCA 1S89A 2CNKA 2BGLA 1JIUA 4K6KA 1NQ5A 5FF9A 4E5NA 2A6PA 2ANCA 1F8XA 3EOAI 4KFSA 3AQ4A 3OLYA 3OZ7A 2TYSB 3Q3GE 4GUAA 1WHSA 4MUAA 4BQPA 1KQFA 4Q1BA 3V33A 3WLLA 1B7GO 1JPUA 2X8LA 5HK9A 1VYVA 4GX2A 3H2KA 4AMZA 2P2YA 3D6NB 1KI6B 4HB2A 5FI1B 5I47A 4WINA 2NW6A 3K5HA 2HZ7A 5EKUA 1GUDA 1JH8A 1NN0A 3E81A 3D6VA 3BJZA 3NAMA 3AHEA 3AKZA 2W71A 2EFDB 4RV9A 2VDUE 1EDOA 3JSAA 4JSYA 4E09A 4BO0A 1QNFA 3O4JA 2O2JA 2WI8A 3OX4A 5FFFA 3ZNOA 3PUZA 5FV4A 5LU9A 3AGPA 3HVHA 4EB3A 3HDQA 4NZZA 4EFNA 1E96A 2D1YA 2EARA 1RHJA 3OTWA 4AURA 2R68A 1N78A 5A05A 2O2DA 2M6LA 4TMFA 2FETA 5F5XA 1Z6QA 2MYUA 3KL4A 5H4HA 2D2XA 5G0WA 3TH5A 2W43A 1U8TA 1GKUB 3O9VA 4MDYA 4R51A 5I3CA 3E8MA 3LBFA 2CLDX 2IF0A 1G8PA 1V39A 1NULA 2IEDA 4UOZA 4PQEA 4OHKA 2JGEA 3KKNA 2Y77A 1T3LA 2R5FA 2ZB2A 1UOEA 3NAZA 2I3BA 4LRTB 4LSWA 2PVPA 3QOYA 1L5LA 2FLWA 4P0PB 4OIMA 2MTBA 1MQ9A 4XEHA 4N03A 5KUTA 2PY6A 4JWKA 5DLEA 1AU9A 3AGQA 5DN9A 1KIAA 5ESXA 1NW6A 2FPLA 4CLHA 1X3LA 1OXVA 3CVJA 4RLQA 3PLAE 3GQVA 4QFBA 2AI1A 5HVNA 2QN6A 1ECGA 3T1QA 4QUHA 4CEIA 5JJIA 4JR0A 4KLCA 3BMNA 3V1KA 3GRFA 5LNK6 3P2OA 1GUZA 4FJ0A 2OM2A 1N3IA 3JRXA 3LHKA 5IKOA 4EHDA 4LIPD 2JKYA 1M6VB 6REQB 4UUBA 4NZ9A 3HP7A 4I4CA 2QYTA 2ZJAA 3EC1A 3HJCA 3FCSB 2WPDD 4RVSA 3NBZC 4UCWA 1A5AB 3REQA 2R6AA 3SMVA 3WWDA 4Z0NA 5FAXA 5B2FA 1XALA 3VR5H 3DE6X 3U49A 3ZIUA 3RG8A 2HXYA 3GG9A 2NVUA 4R9NA 3Q7PA 2FEWB 2XD4A 1ZUNB 1IJFA 3C8DA 5BP7A 3NUZA 2KE5A 2WA2A 2N47A 2BC9A 4TN5A 5JNLA 3S2SA 1RAFA 5DRTA 4KQ6A 3REOA 2A3NA 2QKYA 4XVQA 1WR8A 5IJZA 4FMDF 4U7GA 2IU6A 5FUXA 1I51A 1GGNA 2D54A 4XGQA 2WQ6A 4ARCA 2JKZA 5KKAA 1YR7A 1K2WA 1QRAA 5C5EA 3BM5A 5C8YF 1VCMA 4Q7LA 4F04A 4KQXA 1KZ6A 3VTFA 5IDQA 2ERCA 4FDLA 2RH5A 2IPMA 3KB8A 3OUZA 1NI4A 2NT4A 4IDQA 5DRYA 2JLUA 2QRPA 4RQUA 2C9CA 3BFJA 4LC9A 2O4CA 5FUMA 1K86A 1TTPB 2ZRBA 3WRXC 4EDFA 2QVLA 3AESB 5LBTA 2CL6X 2I66A 2ZT6A 2Z56A 3KT8A 4JR2A 1JT9A 4NG5A 4PZ9A 3ZI0A 1L1EA 1QK5A 1FSGA 3EMKA 3T3PB 2UUAB 3ZCRA 4CFYA 2AE1A 2CUNA 1HDXA 4HWKA 2OUKA 2ZKIA 5FPYA 1MGPA 2IIVA 4GQIA 3WISA 3KOWA 3KKPA 3DB1A 4F1JA 5AHOA 5EYPB 3UTDA 1VE7A 2OZVA 1L7EA 2YUTA 3CRMA 5J5VA 3VKWA 3WNCA 1HG0A 3HKEB 4XM2A 3V8PA 4IIJF 4PYJA 1NASA 3EFHA 3I2FA 2P4HX 4ECEA 3PPWA 3DDNA 5DMHA 2WHPA 1WKBA 1EVYA 1KEZA 1KI8A 4CMEA 3FDIA 5TIIA 1EK5A 5K51A 3BRCA 4PGGA 4PYIA 1OI3A 4YNBA 1EFVA 3V6MA 2VJBA 3FF4A 4EW1A 2QX6A 4ZN6A 3FLMA 3KBOA 2G5PA 3BQNB 1NUQA 3JASA 4RPHA 3QX3A 2GKSA 3B2NA 3A27A 4HSGA 2PV7A 2IY7A 2OG2A 3QEMA 4QGGA 1PFUA 2CDNA 5J9FA 3CWCA 2ZCVA 4U8GA 3VYTB 3LBIA 4DDMA 4BKPA 1GCAA 1TKRA 2CXTA 3BGDA 3CB4A 5HOEA 4DA0A 5KQSA 5DXFA 3O7MA 3SZ3A 1F4VA 1XMJA 4PHGA 2VDNB 3S99A 2HM7A 3M34A 2GKGA 1SOAA 4GFDA 1UMDB 3QUBA 4LFBB 3FDXA 1Q7BA 2QPTA 4JEUA 3FKJA 4AJIA 1R6XA 2ONKA 2I2WA 2WU3A 3BIXA 2ZJYA 4OLBA 4NIMA 3V7UA 1DKQA 3LWZA 2H2DA 3VHRA 1LS6A 4JUDX 2V0GA 1AE1A 2CXHA 2EKLA 3PVCA 4WLOA 1IUNA 3NWJA 4R3NA 3W78A 3ZV5A 3COPA 4X85A 1J90A 1J99A 4IIJB 2Q1TA 2PMWB 3IUYA 3L93A 3HBAA 3TPCA 5BR8B 4A8JB 1WA5A 1WE2A 2LCFA 3D2CA 3OP1A 1GKKA 2JK1A 1GL7A 1NI3A 3GG2A 4LJ4A 2PGLA 1GDDA 2PSSA 4IQFA 3UF0A 1NOKA 4J0GA 3A9RA 5BSKA 1EE2A 4DAEA 4IX9A 2VDPB 1NQVA 2ZS7A 3TZ6A 1UBOS 8MHTA 3JSXA 1J00A 4MIYA 3RH0A 4BNZA 1NR7A 5JFGA 1X7HA 5JEDA 3QV1A 4FP9A 3L07A 1PF7E 2PHZA 1N0WA 2QL5A 2WILA 3A4NA 3AW9A 4D4HA 2WSBA 2QJWA 4HRAA 5JBNA 3AKDA 4JYMA 4L51A 2E6KA 8LDHA 2Z8YA 3FCAA 3M8KA 4R1PA 4C7OA 1DAEA 1K8QA 2HV8A 2IHJA 5AVYA 1ODCA 2HOQA 1G20B 3QA3E 3OD5A 4ZO8A 2XGJA 3EZNA 2V0CA 1E0JA 4C4OA 3PUXA 3HI6A 2F43A 3VR3A 1JWAB 2EBUA 2I4NA 3O4VA 1NVKA 1N36B 4GSYA 3H04A 3ZW9A 5CT9A 1W0JA 1QUEA 1XQVA 2NV0A 3HB9A 4COOA 3TEMA 1T43A 2ZJ3A 3VYVA 4IZ6A 1Z15A 5DYNA 3KELA 2ZLBA 4R1UA 2A14A 1C3JA 3GLHB 2EJTA 1JQEA 1CIVA 1XTVA 2J9FB 4HN9A 3RRFA 1AB5A 4J43A 5EWJB 3DMDA 1NTRA 2XUDA 3EZ7A 2GS9A 3ETLA 4E94A 1SBZA 4ND7A 3I3OA 2QL7A 1WBBA 2C1ZA 5CNIA 2WNHA 2FFHA 2B6NA 3QJGA 2CFOA 4HNAB 2XMQA 2I1WA 2ZB8A 2QVYX 3VC2A 2DY1A 2FN4A 2BAGA 4PGMA 2R1TB 3O03A 4DW8A 2BDEA 3M81A 2ZTMA 2ICAA 4MUBA 5D5PA 3OOEA 4Q9JA 3GOQA 1FNDA 2WSMA 4XVRA 3JVDA 4DMCA 1BVYF 1JFRA 1EJ0A 2ZPUA 3F2IA 1PL7A 2R5NA 3V46A 1XZHA 1VG0B 2BMVA 2VHXA 2ERYA 3DFUA 2J4DA 5HDBB 1G38A 4JL8A 5C3MA 2C9DA 3O31A 3IBCA 1VC2A 2EZ4A 1YTLA 1TQ8A 1A8HA 3K9FC 1OZAA 1RC0A 5AHRA 1A9OA 2O8EA 1C7JA 2N0SA 3WRVA 5B3KA 1BRTA 1NVXQ 3OC0A 3O26A 4ZI7F 1GTRA 5B58T 2NP6A 1JR2A 4PC6A 3ZW8A 4K0KB 4B5KA 3L4BC 2XCTB 3CIFA 3PFNA 3O4GA 2ATIA 3SJBA 2P4SA 1CCWA 3MQ4A 1S1CA 1E98A 3NALA 2BFOA 3VR5A 4EPTA 4DR2B 2WSYB 3CT6A 1XVLA 3V9PA 3CEJA 5EAIA 4MRMA 4I81A 2VHQA 4N9QA 4PU0A 2HR1A 2VUTA 521PA 3HJRA 1CUZA 1M2OB 2EKDA 5CUQA 1KP9A 4LEIA 5D7NA 5JS2A 4CL2A 3RS7A 1XEXB 4QUEA 2OCGA 2OFWA 4LMPA 5FRDA 3ZPXA 1BCRB 2A94A 2WHEA 4XUEA 5KYVA 4L57A 4EFLA 1I7SB 2O8CB 1R0RE 1BWPA 2IGBA 4DZRA 1ZK2A 1LF0A 3ORSA 2BH9A 4DQLA 3V4SA 1KTVA 3AF3A 2HMSA 4GXNA 2RCYA 2JIZD 3WK4A 1T9KA 5C7YA 3M4XA 2NPOA 5AJVB 3FPCA 4P7FA 2H5LA 3PENA 3WVNA 2QJFA 4LBWA 4JMPA 3TTTA 2HRRA 1IFXA 2VAWA 2OYSA 2EHDA 5DHAA 4U00A 1DDIA 1T3HA 1FXSA 3HBNA 1U5CA 3QQ5A 4Z3OA 3PTZA 4XSVA 3RJTA 3SBOA 4AYXA 3EVBA 4S35A 2C2MA 3H3FA 3NHYA 3ZCUA 4LFAB 3BL6A 2WM3A 3M6IA 4RW0A 3N28A 1MOZA 1UXKA 4JLKA 5IBPA 2FFQA 4UMDA 1RJWA 2A9OA 3DONA 1EM6A 4LE0A 5ENDA 3PHCA 2NUAA 5FWAA 4AN1A 2DBYA 2BR4A 1Z29A 3AK4A 5EN4A 2VK8A 4DUGA 1C1DA 3KP1A 4JVLA 4P4LA 3HZHA 1E69A 5LBUA 3WNZA 2LNDA 1R8JA 3L7CA 3RADC 1P9RA 1F0KA 1Z0AA 4LXQA 4Z1MA 3G0BA 3GLKA 1LK7A 2B4KA 3A6LA 3HBMA 2FZKA 2GZ3A 4EO9A 1Y8ZA 1E3WB 1PGQA 3U39A 2AB0A 4EHKA 1ONSA 1WDKA 3CNBA 3I53A 1C3OB 1LUAA 2JLCA 1SFRA 2Q3LA 4YQZA 3GARA 3EXHB 2Y1DA 1YJ5A 4F9GA 1H1DA 1JEJA 4WI1A 2HNBA 4MHOA 4MS3B 4ZXFA 1RJDA 3VAZA 4DC9A 2OCBA 1MDBA 2JZCA 1JNXX 1Q21A 4TRNA 1Y3BE 2JFOA 1NMQA 2IHTA 3U4AA 2VUIB 4BX8A 4BNJA 4HDSB 1YFJA 4DRYA 2H9AA 4EY7A 1A50B 2J0UA 3CCFA 3T06B 4V03A 5AVKA 3NWEA 1U2QA 3SOZA 1TCAA 5G2OA 4XCXA 3EK2A 4YJGB 1QF7A 4OK5A 4GXQA 3F71A 1Q7GA 2V3WA 5FFNA 3ZXXA 2HK6A 4ZCLA 5CP8A 3EGIA 2F17A 3AY3A 1PJSA 3KHTA 4JKOA 3L41A 3UT0A 4JV5B 2C0PA 4OUKX 4WA7A 3B78A 2C3UA 4G07A 1F7VA 2IPNA 1RDFA 2VHCA 3JQBA 4EITA 4JHXA 1NNLA 4FHFA 2OB2A 3PE3A 4GR5A 3PQ5A 1E2HA 3IEVA 3VX3A 2ERXA 3H4VA 1F6BA 5LP1A 3RHZA 3A28A 2Z8XA 1PR4A 2FNAA 3QVSA 2O5EA 2FFBA 2I6UA 2YRFA 3AOEA 3P0EA 1V5FA 2MSNA 3JQAA 4WZ6A 3AKEA 1JPVA 3EE6A 3EZLA 3NEPX 4BQIA 1G4HA 5B36A 2RONA 1K7XB 1EVKA 2XMPA 1QFSA 2VCYA 3RUIA 4HWSA 3E7PA 3G89A 2WIFA 1I0ZA 2XNSA 1A9YA 1U8YA 2AOWA 2NAFA 4XR4A 3TBHA 5JTUA 1D6NA 1DCTA 3HRIA 1N2OA 1XRNA 2X86A 4B5LA 4DBLC 3EGEA 1WDTA 2YJ4A 4NATA 4R2WA 4KXFB 4QFMA 2ZR0A 4UQPA 3U4GA 2MIIA 3PFHA 1C9NA 1I7LA 2XX3A 2H54A 3DE7X 5CHYA 3CPSA 5F2EA 1WW3A 1O77A 1WW2A 1Y80A 2FEPA 1CZUA 3GP5A 1P7YA 3W79A 4CGZA 1OXUA 3AUAA 4J49A 2RCNA 2O0MA 4IOKA 4RACA 1Y1RA 1ODJA 4PZDA 5G1OA 4GAEA 3S5JA 4LC0A 4QT0A 3SM9A 3EX7C 1O97D 4G1BA 3T3DA 3F1KA 2HHAA 1ST3A 5LB4A 2BEVB 1VJRA 3O92A 3SBXA 1M1UA 4FI3F 2YFKA 3LPDA 2CHUA 2J07A 5U4XA 3ICOA 1SIOA 3OC6A 5C51B 1VLMA 1XTKA 2HMUA 3I6IA 3ONWA 4KWHA 4PBRA 1RRMA 4GP6A 4XD7D 3ZHBA 3DZJA 1WUIS 4EPXA 3R9XA 3Q6MA 4IV8A 4MWDA 3TIXB 4E6PA 1ONOA 3OPVA 4EP1A 4R69A 1P1KA 2AK3A 3WYBA 3VNVA 3IUQA 2RGWA 1X8LA 1ESNA 1YQDA 2ZUCA 4UU8A 2PLRA 4MMXB 2WB4A 1RWWA 2CMKA 4JODA 4LHWA 3VPAA 3RSSA 3VKGA 2OMKA 3KTOA 2XH8A 5GZ6A 3JVIA 4FJ1A 1YONA 1E9FA 2FUG1 1DV1A 4Q02A 3H5TA 4DNPA 3KJQA 4ZT5A 1DIAA 5M7EA 3KL2A 1ZQ9A 5GM1A 5JVDB 5JNUA 1IQRA 4WLUA 1K7CA 3BWCA 3PRKE 4J1SA 5D86A 3ROFA 5ER9A 1O6GA 2H7YA 3R7SA 5EEHA 3TGPA 1PZEA 3INGA 4LJKA 4YACA 1BS2A 4DLRA 1FNCA 2GLTA 2V7QA 2XJ4A 2B0JA 3H1FA 1M2VA 1T36A 4PZPA 3A3KA 3AEQB 1I94B 3FROA 4L4UA 2VLIA 3O3OB 3CQ9A 3MJFA 4MINA 2L19A 2FOIA 4KJZA 1FP7A 1QORA 1THTA 1V8PA 3WL3A 2XZOA 1Q19A 3JYOA 5IYZA 3V8BA 3M70A 1WUTA 4ZT3A 3GI1A 3H5LA 5JCPA 5F9FA 1OWOA 3WKDA 5K6TA 3PXCX 3PC6A 2WKQA 3DV0B 4Q1VA 1S2MA 5F73A 1F3LA 1TK3A 2TSYB 2DX7A 3A4MA 1UIMA 1ZH6A 3PSAA 4EB0A 4G0PA 3X1DA 2PD3A 3Q7SA 4G0NA 1OWMA 3E9QA 3LXUX 4B74A 3EXIB 2IYRA 4X6LA 1Q6YA 3CUEF 4E5YA 4FXOA 3TRJA 1EIWA 3ZBPA 1DT3A 1YZLA 3P2IA 4G84A 1RCUA 1REQB 1XCPA 2YDYA 2B3DA 3ZCTA 3MT0A 4JVSB 1S2OA 3PUYA 3VJRA 4IUCS 4PSVA 2X2OA 2IXTA 2YQZA 4M1TA 2XYVA 2ZJBA 2HH9A 3D6AA 2H65A 1RYMA 3ET4A 3H86A 3L01A 4NAVA 5ALHA 3RREA 1PD0A 1TAHA 5EWMB 3IKVA 3N0WA 1SC3A 2ETXA 4ZRNA 4UARA 2II6A 1Y3HA 3DP7A 3FETA 2XUAA 1XU7A 1GTSA 2ZIXA 4YMGA 3F73A 1ZIPA 3W4IA 1F9AA 1V45E 1CDZA 4M0MA 1HKUA 1KERA 4O3FA 4PGHA 5IJ9B 3FHTA 1U7ZA 4P5PA 1GFWA 5DHUA 5LA6A 4JVMA 3TCXB 4BCBA 4CV0A 1E20A 2C2BA 3DHEA 4AL4A 4D6PA 4ZRDA 3FUCA 3MOIA 2YASA 4QOJA 4AJ2A 2YQ4A 4MO9A 3HDHA 3HO6A 10MHA 2ZE6A 5B7PA 4OXRA 4RD1A 4V0OA 4Z4QA 4EEXA 2CCJA 1U2SA 2ZYUX 4YMIA 1Q7EA 1VKHA 1YNOA 1O9GA 2A0WA 2C5BA 2VYFA 1B23P 4MAFA 3SYRA 4BP1A 2BTEA 3IL2A 2VHVA 1KOGA 3WO0A 3G3EA 2Y6UA 3GRVA 4XPZA 4A9AA 1G16A 2Y1KA 4HKTA 1R5OA 1RXEA 2WWRA 1U7UA 5DTJA 3GA5A 4GD3Q 4GU5A 2BHTA 3TSAA 2VH2A 4RABA 2GK4A 1T1RA 3GPDG 4BNWA 4E5UA 4L5JA 3VYUB 4G4JA 3BOSA 3P71T 3HS3A 4KJXA 3T6KA 1BDHA 1PHRA 1BKDR 1WXEA 1L7NA 3RNLA 5CX4A 3KT3A 1X0VA 3N6XA 5BPHA 3HKCB 1D2NA 3LUAA 4S12A 1UAGA 3GIDA 1LWNA 1VL2A 4G26A 4X5OA 3GP3A 1PV2A 5HRCA 3Q9SA 2FE1A 1CUCA 1XVUA 2GEJA 1VG8A 1NU8A 2FK8A 1YSCA 2C95A 2H4XA 3A0UA 5LXTB 4RSGA 5ICMA 5HZGA 2NZXA 4XGIA 1JFVA 3R7WB 5HYVA 1VZ3A 2AG5A 5CDUA 3LY5A 3OFNA 1Q6ZA 3G0GA 5CCDA 4HF7A 1U2PA 4HEA6 2PD4A 5CM9C 1TEXA 5DLDA 2XVMA 3W34A 1M34A 2I2BA 2XMDA 3D1VA 1HT1E 4HMOA 3A70A 4JP2A 2P1RA 2B30A 2FF7A 2LCQA 3NHJA 3Q5EA 3I1YA 4J3NA 2HDHA 3PDWA 1NVBA 3Q12A 2XW6A 2QE7D 4GM4A 4BKQA 4OQXA 4D81A 2FPUA 2QMHA 4YR7A 3PC7A 2ZIFA 1IBLB 1XJ5A 4GYYA 1RYYA 3TSCA 4G56A 5E0OA 3TLYA 4Y8VA 4CF5A 4DLAA 3GQBA 4N3AA 5BQPA 3F90A 2QE6A 3KYCB 3RIMA 3TM4A 2VNAA 2B1IA 2W4QA 4ENQA 4AK9A 4WXEA 2UUPA 2NU6B 4ZEXA 4H35A 5KKNB 5P21A 1TKBA 1N0HA 2HDNB 5IAOA 2JIBA 5IABA 4CDNA 1PKXA 4KR2A 4MWGA 1UBUS 2BEWA 1P81A 5A3RA 1I9CA 2SKDA 3CV3A 4OA5A 3FI0A 4NK4A 4JEMA 2E49A 1XZ8A 3ESAA 1K6MA 2AS0A 3A1UA 3ESRA 3IAUA 2VXYA 3MB8A 4G2NA 4IS2A 2QG4A 2WIJA 3QIVA 4X91A 2PH5A 3VR1A 1C0LA 1C2TA 2IPLA 4GBED 5ANRB 3VTKA 1XZBA 3SXUA 4BQNA 1BDJA 4GC9A 2I3AA 1SUWA 1W73A 4B6OA 2JFBA 3TL3A 4JP8A 3B38A 1BHSA 3OTQA 4DIDA 4O2LA 4BE4A 1N8SA 1BJRE 2JD0A 2NNLD 1ZIXA 1XRPA 4X8HA 1E1QA 3CRW1 2WSLA 4Q4DA 1XRSB 4QGHA 4UAVA 4ENTA 3L0ZA 3V7NA 3LL4A 1VLHA 3E3LA 2C2OA 1ZW6A 1A9TA 3AI7A 1LNQA 2NYAA 4D0NA 2NO4A 4GKBA 1OFGA 2IQIA 4GPIB 2R0QC 3IQFA 1HEIA 2QW8A 1Z56C 1IEWA 3ANLA 4ZC1A 3MSCA 4EO4A 4IDNA 3HMKA 3LC1O 1JT2A 1OIWA 3KQPA 4XX0A 2X4IA 1YE3A 3HXKA 4DCJA 1RPTA 4F21A 3LWNA 1POXA 1PGPA 4IV5A 4KMSA 3FN4A 1EBUA 4MVJM 5EUQB 5FP0A 5AW4A 5K99A 5A9SA 2W2KA 2Y92A 5E6RB 3RS2A 3MCZA 3FOWA 3U60B 1GRVA 2RG7A 2X9NA 5LB2A 1PVDA 1QSGA 2XBUA 4NMLA 1B3RA 5DWVA 3A6FA 1XPUA 2BFCA 3HNOA 4QKQA 4P3XA 2HC9A 5JWHA 2QS9A 3KEFA 1PFKA 1NXWA 4KEAA 2QUJA 1R0KA 4ZVPA 2LV8A 5F12A 3DAYA 5CEJA 1N5RA 2YN2A 1MR3F 2WOOA 2R8YA 2GM3A 2IU4A 1WMFA 4M0PA 2Z6VA 4YJFB 2DY0A 3D2BA 2BGRA 3LA8A 3N8GA 4JIGA 3GUUA 3JQCA 2ZAIA 4UM8B 4BLTA 4CMCA 5J58A 4OFZA 3T7KA 5FBQB 2JRCA 221PA 2PLAA 3C70A 3ESZA 2H7CA 3PI7A 3QP9A 1EGAA 4FFBB 4KN6A 4TQUS 3TX6A 4BATA 3QQPA 4L76A 4JJ6A 3AHIA 1ZWKA 4CKBB 2NZ2A 3VPGA 1PLLA 1PS9A 1SKQA 3NC1C 3W5BA 1IG3A 2XVXA 2DUJA 4TZ0A 1PGOA 3FNGA 3C1OA 1UDCA 5C3UA 1V95A 3RHTA 3UJ8A 3LSYA 3TDKA 1VP9A 2GCGA 2HA4A 1U2RA 1PWYE 3ND9A 4NRDA 4KI7A 1Y3FE 3KQVA 3LRPA 3TZLA 1PKEA 3BXFA 1BZYA 3CH4B 3I37X 4KYVA 4YT2A 3AEKA 3I45A 1P80A 2HSZA 2QMEA 3WV5A 4BFTA 1MF7A 1B8OA 4OHZA 4QJ3A 5DP1A 1DTEA 3WJ7A 3KOXA 4BFUA 4C05A 3IAAA 2NPFA 4MVJD 2JLSA 5K0EA 4A6PA 1U5BB 2YMPA 3CW2A 3SZLA 4GEGA 3ZV6A 4HBZA 2ZJFA 4TX1A 5JZ9A 1HDRA 1JDSA 1QGZA 3T7JA 3ZIDA 2H92A 3QJ5A 1H2FA 1GRNA 4OQQA 4OK3A 4CM9D 5AH0A 3BZUA 5EMHA 3VU9B 1JECA 2FR8A 5FDFA 3GEIA 4KZPA 4G24A 5EJAA 3FI9A 5H3CA 2ZATA 2X0RA 3FVTA 3M2TA 4P3YA 1ZD5A 3CX8A 3ICPA 4JDPA 3P2MA 4O2BA 5LUBA 1GCGA 3OD1A 3BHNA 3AERB 2VSFA 3HSKA 3ZWYA 2DFLA 4F1KA 2MR6A 3ASZA 2XUHA 3BGOS 3KAJA 2JI8A 5BV0A 3RSZA 2VP3A 2FPRA 4KPUA 3HI4A 1H5UA 3AUJB 3DEHA 4N7BA 1JDTA 2QTNA 2G9VA 4QELA 1QF6A 5C4GB 3H65A 4HTFA 1WZ2A 3AZPA 2L69A 1KS2A 1SXJA 1QQ5A 2QRVA 3DEIA 1YQEA 3NTOA 3QYPA 4OG2A 5CK5A 1VE1A 2QD1A 1BDIA 1Y4ZA 1TJ4A 3H9GA 4C5AA 1W4ZA 1NF3A 1Z7EA 4DRXB 1C30B 5G1NA 5FTLA 3RODA 3H9QA 2AFRA 5C32A 3S4YA 4UUQA 3KOOA 1A82A 3CT4A 2GPJA 1QWOA 5DM1A 1KI7A 1SXIA 3CVYA 1G21B 1CYEA 3ENQA 2RKOA 1W0KD 4PLHA 4GBGA 4U63A 1NI5A 2PZJA 4LXUA 4EMUA 1N57A 4URUR 4KR3A 3ABIA 1BYIA 3WHLA 1RACA 2J8ZA 3OX2A 1X1EA 3FOBA 3PC8A 1JG6A 3DBVO 3K92A 1BHO1 1MXHA 3FFAA 3FYDA 1NP7A 1M6HA 4PINA 2CLCX 1ISPA 3DVLA 4K9RA 4PG6A 5ADVA 3DTTA 2R1VA 4HDCA 2A9FA 1UOQA 3W2HA 3ISJA 2MU1A 5TF4A 1M1XB 2ACKA 2BELA 4K05A 1T0IA 4RLHA 4EVIA 4ASUA 2WF9A 2FU5C 3DNFA 2VHWA 2FMTA 2VCEA 1EWQA 2Y2UA 3KAKA 1F8YA 3ZGOA 2ZWMA 3AV0B 1EXMA 3R44A 1PS8A 2DCMA 4EKGA 3NVAA 5K0ZA 1XZJA 2GCPA 3KXLA 2ZB3A 1KFJB 4OEHA 1KI1A 2BTQA 1GU7A 2CE7A 4BLWA 5B1YA 3ZC3A 5JXWA 2AXEA 4RTMA 3B6KA 4JYCA 5IBRA 2HA7A 3OPQA 3EQ8A 5AVVA 4UMEA 1Z4NA 1XT6A 2I2CA 2X4GA 3U16A 3N9IA 2Q6KA 1T0HB 1P0IA 2E21A 2ST1A 3BGWA 4RIHA 2H1SA 2ZRQA 2YL2A 3G79A 2IHKA 4L3VA 3THOA 3ZWOA 4V3BA 2XGSA 1I3NA 2BTOA 3SSNA 4GKJB 1DCKA 1BVRA 2NP7A 4M1WA 1XCLA 2G9NA 4LY0A 4X6YA 3Q3JB 4P0QB 4YASA 5AMXA 5TF0A 1N5DA 2QT0A 3K9CA 1OLUB 3MM4A 4N7JA 4TV9B 4U6NA 1E5QA 2XT9A 4IS3A 5EVJA 1RM3A 2DTXA 3DLCA 2AC4A 5LD2C 1RYZA 3H5AA 1D0VA 1TC2A 5JPCA 1YFZA 2PGDA 4CGYA 5A0FA 2WW8A 1NVGA 2XUFA 3QY0A 2J9ZB 2Z98A 4QHTA 1FUKA 4NBTA 4X63A 1YKGA 3QEOA 4X8LA 3KKZA 3M5WA 4DTIA 3NM5A 1TQ6A 1Y1QA 4EAAA 2PN1A 3RVRA 3H18A 4B7CA 3HLTA 4ZKEA 1H2WA 3OBIA 4X6UA 1MEOA 1E5VA 1U9IA 2N75A 1J9ZA 3BMCA 3R41A 2G63A 3EW7A 4OF4A 4DXDA 3SYMA 5EIAA 3GLIB 4JD5A 3N2LA 1S3IA 1PJAA 4CCWA 4DF3A 1A8PA 1G7SA 4F2WA 2AJLI 4KBYA 4ZTBA 3G9UA 4YP6A 3F5QA 3GFQA 3FUUA 1BEEA 3OZIA 4HVLA 1J6UA 4NJEA 1NV8A 5CFRA 1HE2A 1D2RA 2G6TA 4DCMA 5B1EA 3R5XA 4HCJA 4R6WA 3ZU4A 1A2KC 4BAUA 4FOTA 4WXRA 2R6CA 3KLNA 4H0CA 1HDIA 4C1BA 3H9UA 4LVOA 1CIPA 2GD1O 1L5GB 5TMEA 2PYDA 2FG7C 3GK3A 3PD7A 1W19A 4QAQA 3WWZA 2O14A 3KR0A 1QQTA 2OSBA 3FUWA 1NC1A 2RGRA 3WWYA 3AYXB 5TS2A 4BV3A 1MDFA 1D9ZA 4ITRC 1NVTA 3BAFA 3IUBA 4KPFC 4XIFA 4FR0A 2GBIA 3SQOA 3GFVA 4H1TA 5TQ2B 3OQMA 1CS0A 1HFJA 1UP6A 2ADMA 4NYMQ 2XCQA 4LSMA 5WRFA 4BKRA 1NNI1 1EQAA 2A2ZA 5EXPA 4MW5A 3CS3A 1GNLA 1EG7A 4KE8A 4Y7DA 4UBKA 4QDUA 3FKQA 1QP0A 3GLIE 3I6BA 1H2BA 3H11A 2JGKA 4QRIA 4YMLA 3THXA 3CX6A 1IZ7A 3HPQA 2A5JA 4DLPA 3TINA 4NX2A 1NKVA 1XNQB 4WEQA 4FEGA 4DA7A 4DV1B 5EC8A 1SPBS 3T3HA 4J0DA 4C2UA 4IHQA 3O95A 3F6CA 4FR2A 4NG4A 1L5KA 4KLZA 4NCAA 3S1AA 1S8AA 4X41A 1N0VC 3MJEA 5HA5A 4D0GA 2JH8A 4EG1A 3SVTA 2CLHB 4GOKA 4LDQA 2QRQA 4BNUA 4L2IB 1EEHA 1ZXBA 3WRYA 5IFKA 5KTSA 2OHVA 3CY6A 3GP8A 4MW0A 1PEDA 2X4LA 4FM9A 3N86A 4ZDWA 3FOCA 4DL9A 4KNYA 4ZAYA 4CL8A 2O0JA 4Q1AA 1W85B 1QIEA 3CIOA 4J7CA 4XDHA 5CBPB 4D26A 3HCPA 3EODA 2OCYC 3INTA 4MQ4A 2BMJA 4QYIA 4D57A 2A7QA 2EG9A 4LHSA 4Y9DA 1GZVA 1W0CA 1TMYA 2JATA 1WMAA 4Q15A 1X9GA 1ML3A 4WFQA 2C88A 4LF8B 2ZBPA 4RS4A 2LZ0A 3TIVA 4CQLA 4MITA 3EWSA 2PG3A 2ZRIA 3HKBB 3LFUA 4HO1X 4JMLA 5EE3A 1OYVA 4E03A 2VTEA 3UT5B 3SDZA 4G4GA 4MUEA 3WK9A 1MRZA 1CEEA 4HFMA 5EHGA 4NJOA 2PRJA 5DNWA 1MAVA 2J0EA 3WLKX 3AIOA 4CR6A 2X9GA 4G1UC 4M3NA 1D4ZA 2D1RA 3DLIA 1UJMA 3HCBA 1PT8A 1E5XA 1M6YA 1Y8RB 3NJ8A 1UZUA 4EATA 3SF0A 2IHBA 1GCUA 1Q0HA 5JE8A 3MRTA 2PLNA 4WK2B 3I92A 2GN8A 1TTQB 3PPXA 5IMSA 5SZIA 2DB3A 4Q4JA 4UVDA 3WIOA 1XSEA 1ZH4A 2GR9A 3QOFA 2R84A 4G86A 4QXOA 5EGSA 3RIGA 1Q92A 2GXQA 1KR2A 4HH3C 3AJ9A 4LHEA 5TC4A 2Z6UA 4MZDA 3PQDA 1XQYA 5CW2A 1GTVA 4C4YA 3SDBA 3BB4A 1BS1A 1GGHA 3H2JA 3CNNA 1L7DA 2W6OA 3DOHA 4URZR 3UHPA 3CGGA 2DUMA 4FKMA 2YQ5A 1AA6A 2H7XA 1GGFA 1KQ3A 2F8SA 3BMXA 4TT8A 2QI9C 4NL4H 2QTVA 3RM3A 3GZ4A 3DKPA 4D4LA 4PNEA 1C5KA 3AB3A 5D1NA 2AHRA 4JJAA 5KDOA 3WSTA 5LDGA 4XDYA 3T1TA 2UU9B 3AU8A 3TRIA 3D7KA 3PPVA 1SVUA 3OFND 1U7TA 3UBMA 4C4ZA 3PV0A 1ZSVA 2FI1A 3DZCA 3OI7A 4B7AA 3FNRA 2D1QA 1ESMA 4YN3A 3OT5A 2IU0A 2XKJE 4EJ2A 1NJ6A 4HLUC 3TR0A 1QGYA 1P3JA 3TOSA 3WDKA 3W3AD 1X14A 2FPXA 4F6RA 4DGQA 5LYJB 4ALNA 3KDAA 2PTGA 2Q9CA 3FBWA 5LR6A 4CN9A 5IM4A 3IUJA 1Y1PA 5C1DA 2KLBA 4IH4A 1VI5A 4E22A 2IHYA 4PCAA 3SS7X 3UWKA 4YRZA 5FADA 1CRZA 4L5BA 3ROKA 1SC4A 1PT5A 2YJTD 3SQMA 5JRJA 1ZVVA 2AJDA 3UMRA 1GXSA 2CSUA 1GZ7A 2IHZA 3NHPA 4UNIA 4BFWA 3HXQA 3CNOA 3VPHA 3ZWVA 5K6RA 3L1JA 2FEXA 4CI0B 3PYMA 4K5QA 3T4UA 4K9SA 5JNSA 3E6AA 2GHIA 2XBMA 3LKZA 3EXEA 2SBTA 2A1UA 3I9V1 4LCJA 1Y5LA 3CH5A 3MJHA 3E5HA 4HNGA 1ZYUA 4CCSA 2OCIA 1N5OX 1NE7A 4KDCA 4OUDB 3K6SA 1Y42X 1NE2A 3OU2A 4NULA 4ME6A 5SY6A 1Y9JA 2PX5A 3RF7A 4ISBA 4B82A 2VTKA 1WG8A 3B2EA 2CNWD 4R8VA 3M4ZA 3ZE9A 2IVFA 3UGJA 3K70D 1FFYA 2ABWA 1AH2A 1R64A 4B4DA 3R8CA 3WGZA 1MHPA 3O94A 4Q9HA 1AGXA 4WCFA 1W87A 1XNHA 4JSTA 1DXOA 3E84A 3LQRA 2BKAA 1JA0A 1UK8A 2VWGA 3IX7A 5BYJA 1DC5A 1KVSA 1N1EA 4N0QA 5IJXA 4CF7A 1TUGA 2YOFA 4OI1A 2CC2A 1CE8B 4BBJA 3FSEA 1EDZA 1XFDA 5AK6A 4DDUA 4WECA 1LC3A 2NQ8A 4ZAGA 2AFHE 3QEJA 1V16A 3REFA 4DM7A 3R2JA 2BCGY 4MR7A 1S5PA 5GONA 4M2LA 3EF1A 3PHGA 4KITB 2I6FA 3CLRC 2W4MA 4OGWA 4REQB 5GV7A 2H1LA 2YV1A 1PTJA 3L02A 5EUCA 5AJZA 2CD7A 2YVQA 1EAMA 1YVPA 2WTUA 3RBAA 3QKUA 4XW2A 1MTZA 1QP4A 1WXIA 3LHIA 1UBCA 3GCZA 1B16A 2VC2B 3DOFA 3EQ7A 3NNDA 4PPGA 1Q1QA 2BV3A 5H3HA 3IR6A 3R77A 1YVUA 4TWZA 5K8TA 3TZHA 2J6IA 3D7LA 3QVMA 3D4OA 3TLEA 3WLJA 1QC5B 2Z1NA 3PE4A 4B3SB 1EG2A 1Y3AA 1SEVA 4EQ6A 4RJIA 2TRSB 2HTFA 5ELLA 2YYYA 3BJMA 3CJQA 5FA5A 1BRMA 1DBWA 3PQFA 4YJDA 1CUIA 1KA9H 4XM0A 4G5YA 2WPNA 1KYWA 3VJKA 2C4NA 3FVQA 5FBLB 3ACCA 4IP0A 4LKRA 4AQYB 1GNVA 3WGKA 4XZ3A 3IEPA 3KBBA 3M9WA 3LYHA 3NAGA 4URVR 2R8EA 4M7WA 3TEFA 3QVLA 4HBGA 4OHPA 3IEMA 3ZKWB 3W9YA 3X0DA 2J45A 4GEKA 4Q66C 2NVOA 2D2FA 3OHMA 4IUBS 4ZCPA 3ZGNA 1B6GA 1TUBB 2RK3A 2V9ZA 1KVRA 4DSTA 1NFRA 1RTTA 2FAXA 4FDVA 4LWQA 3RSGA 1JKXA 3NEJA 3QY9A 3ED1A 3ZBUA 2B1QA 4UVGA 2DLNA 3KOZA 1KVTA 3V34A 3V8EA 4V0RA 4ZOLA 1FSFA 4QC2A 1PLJA 1ULZA 4BN0A 4PN7A 1X42A 1V8BA 3IBFA 2CL5A 2X6QA 1P44A 1ONPA 4JJ4A 2C97A 3BK2A 2VI5A 4S0ZA 1YK1A 1G3RA 4S1VA 1UT5A 1FFXB 2OVBA 1H0SA 5F5LA 3BWVA 1UANA 2AVNA 1WB4A 4ZQBA 2DT5A 3NVKI 1HT0A 3AJ8A 3ZIAD 4K9QA 5E4FA 4KQFA 4UREA 5CLGA 1JIVA 2B8EA 2JCGA 5DLPA 3V1UA 3PWKA 3S6JA 1ES9A 1O58A 4DJEC 1WRBA 4PHFA 5JSZB 4NV1A 4KO2S 1N5KA 2BLLA 3ZDQA 4MARA 4HDKB 3T3EA 4II3A 2F4VB 4EA9A 2Q8QA 1U11A 4CLRA 3ZD6A 4HDNB 4BP9A 4D1YA 2XCIA 3ICEA 2ADOA 3MCWA 2M6SA 1SHJA 4PC1A 2VDKB 3C14C 3OO0A 4FKZA 1O95D 4B0PA 4W5HA 4C3ZA 4KPYA 1GEEA 1Y98A 3LDHA 3PFIA 1OLXB 1U0HC 4M76B 2XTMA 3AEUA 1G66A 1OU4A 3QOWA 1X9IA 3I9KA 2B9EA 2QMYA 4GIBA 4ARZA 1NJ1A 3E9DA 4F2PA 1UZLA 4LW8A 5AI4A 4NMHA 4AO7A 4AX8A 2NO7A 4F97A 2F3UA 1FUUA 5C37A 2NO6A 1BOFA 3O8BA 3ENVA 5M5BA 1F12A 2HHHB 2BF7A 5K0TA 2OV6A 3RU3A 1XXLA 4TTRA 4QLBA 1C9KA 1MX5A 1QMPA 2WSSD 1PHPA 2R85A 4V2UA 5JSFA 1XYVA 4LMRA 4IGAA 3LP6A 4MGYR 1UQUA 2PA0A 3AP2A 4FLFA 4HQNA 4ND2A 3UFXB 2ZRDA 3FCUB 4JP1A 3TR5A 4CKCA 3WDLA 4WLNA 2JHGA 3JAKB 2V7BA 3F47A 1NBEA 3F7NA 5JMTA 5KX5B 2EFYA 5K3DA 4G5GA 1Y8QB 2GK6A 3K0AB 5DYTA 3E1GA 2P4QA 4BMPB 3NPMA 4F4HA 2ZIUB 1ZOIA 3O74A 3AIMA 3JQBC 2ZM6B 1FJGB 2ZTHA 2JEOA 1QIFA 1NX6A 3A3NA 3F2VA 4JP5A 4PC3A 3W5HA 3RQSA 5KC8A 1W75A 1QE3A 2UYGA 3DZ8A 3JX9A 3N2IA 5JT1A 5HIAA 4LRYA 2NSJA 3RSQA 1E1RD 4TT3D 1QVZA 1Z33A 3DMTA 4D9GA 1Y7IA 2PNFA 2AMLA 1TLTA 2Q6LA 1YACA 2I8AA 3A1FA 1KKLA 1TU4A 2RGNA 4YP7A 1FX0A 1L2TA 1NBAA 1XXHA 2FOXA 2IYXA 1LJ8A 2OK7A 4FXPA 3N2YA 2CNOA 4I4LA 2W37A 1TRKA 2GNPA 2QD3A 4AZ3B 3EARA 4HNUA 4HGPA 1YAJA 4EIWA 1W2HA 4WV3A 3SJCA 1D2CA 4DMUB 3IP6A 1U0SY 2HIHA 3CZQA 3NYIA 2QD4A 2W48A 1H9AA 4PIMA 1XELA 2FPPB 1D07A 3IDAA 1KJJA 4JSRA 5F7JA 3U6KA 4EG5A 4PN3A 5FR1A 1AXEA 3KETA 1FDSA 2Q2WA 1IPHA 1X39A 4MVJE 4P7KA 2C9MA 3G85A 1WZUA 3A6KA 2WKRA 3WLQA 2Z1MA 5BXQC 5HXAA 4Z53A 1OTXA 4BNKA 4R71A 4BHTA 1NXXA 1USVA 4YJ2B 3HFJA 1WPQA 1XZNA 3SU8A 2DWUA 1KPGA 1WVIA 1MRSA 2X42A 3DV9A 4PAQA 4XGNA 3STTA 1AHHA 2WKPA 3QKIA 4FHDA 3OCUA 4TQAA 1OFIA 4RD2A 3SFTA 4DLUA 1RAGA 1SUEA 3DMYA 1DADA 4URWR 4J0CA 2WJHA 4C6RA 1U7OA 1N3BA 2Y76A 2WF5A 4Q01A 2I5PO 2GYVA 3WGUA 3JU3A 1JAXA 5F64A 4FZRA 5JADA 4E1AA 5FJIA 2P4EA 5D87A 4PYKA 2Q3HA 4IIBA 4KK3A 2RH8A 2W2TA 1TUIA 3K0CA 4GOOD 4AJOA 3U37A 1CY6A 3EJWA 5FOSA 1D8TA 2FP4B 3CKKA 3K35A 3LLVA 1JP7A 4PFJA 3ER9A 2ODAA 1QIHA 1R8YA 1FRVA 1UFOA 5K0FA 1OBCA 2P67A 4I2NA 1VMIA 5DNVA 3UIEA 1FYWA 1TO1E 4JBXA 4MB0A 1XXHB 3W05A 1KO7A 1KJ9A 3HV0A 3OOYA 4OHUA 2ZI7A 3R6DA 4NSNA 2V1UA 1HDEA 1T9HA 2LGJA 1DVRA 3WLSA 2YV4A 5LMCA 2HSGA 3UXHA 1F2TA 2VSNA 1Z2PX 4TYQA 5K3SA 3RIEA 4F72A 4WRRA 1GL9B 5DCYA 4FBMA 2E4VA 4CI9A 1FE8A 1GAXA 1HORA 3E03A 4LJ6A 1BXZA 2DZDA 4Q7EA 5L3QA 2H11A 2OORA 5C53B 2PKEA 3KAPA 3BQMB 2QENA 3DFIA 2C98A 4GICA 4P8RA 4PRZA 3QOXA 3K0AA 1JJAA 4KIUA 4QTXA 2RHTA 3TXAA 3NT5A 5M29A 3FYCA 3KAQA 3EIUA 1VCHA 4DA8A 4FUQA 5DBHX 4ZZ1A 3JAKA 3OEHA 1VXOA 1VL1A 3KJNA 3B6I