4K2NA

Crystal structure of an enoyl-coa hydratase/ carnithine racemase from magnetospirillum magneticum
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
267
Chain Sequence
GTENLYFQSMDVIQLVREGAIATVTLNRPDRMNALNLPMWRGLAEAFETISADRSIHVVILRGAGTKAFAPGADIEEFDTLRANAEQAKAYDLVMRKALDTVRACPQPVIAAIWGPCVGGGLELACCCDIRLSAKSGKFGVPINKISVVMAYPELAQIRRVAGPAAALEILLEGRIMDADEAAAKRLVNRVVEDDAMDAEVAATAKRIAAGAPLANRWHKAFIARLDDPTPVSEAELDECYRFLDTKDYAEGLAAFRAKRKPVFTAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enoyl-CoA hydratase/ carnithine racemase from Magnetospirillum magneticum
rcsb
source organism Magnetospirillum magneticum
molecule tags Isomerase
molecule keywords Enoyl-CoA hydratase/carnithine racemase
total genus 90
structure length 267
sequence length 268
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4k2nA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4k2nA01
3HP0A 5KDRA 4L8KA 3M6MA 1Q52A 4ZDEA 4WZ8B 3NJBA 3TDCA 3QXIA 1W2XA 5DL1A 4WCZA 1O8UA 5INIA 3FDUA 4ELXA 1DCIA 5IKLB 4OMRA 4U0HA 3GKBA 4MOUA 3TVUA 5CTCA 4QFEA 3N6RB 5DKPA 3H0JA 4FZWC 4JYJA 5DUCA 1XX4A 3Q0JA 3KTGA 2FZSA 3BPPA 3V5EA 3KTJA 2VSUE 1WDKA 3QREA 4OG1A 1X0UA 4RCNA 1UYTA 4GHNA 2Q2XA 3ST9A 3QWDA 4ZDCA 4QIJA 1ON9A 5INFA 2BZRA 3ZWCA 1RJNA 1YG8A 3LAOA 4Q0GA 2ZL3A 3GLMA 1J7XA 3QMJA 3IBBA 4JFCA 3KTIA 5MGBA 1XNYA 1EF9A 1EY3A 1FC9A 4ZU2A 2DEOA 3Q0GA 5FIFA 1WDMA 3TT6A 3H0UA 3QK8A 3IB9A 4B3HA 1ON3A 4JVTA 5DZKA 2J5SA 2ZL4A 2Q34A 1XNVA 1HZDA 4FN8A 4FNBA 2VX2A 3OMEA 3T3WA 2J5II 3QKAA 2CBYA 1UYRA 3ZWBA 3OC7A 4NNQA 3RRVA 4HNKA 4JCTA 1K39A 5G1SA 4JWVA 2ZQRA 4ZDDA 4LK5A 5JBXA 1NZYA 2QQ3A 4EMLA 2F9IA 3T89A 3TT7A 4IZCA 3R9QA 4DI1A 3G64A 1EF8A 3U9SB 1N6EA 4JYLA 3DJAA 4ELWA 4WYOB 4GM2A 4K3WA 3FF6A 3PGQA 4MXIA 2UZFA 1OD4A 3MYBA 3IAVA 1SG4A 1VRGA 1XO6A 3STAA 4JCQA 2FBMA 4FJWD 5G1RA 5E0NX 3H0SA 2Q35A 1UIYA 3TRRA 3HINA 1Y7OA 4U1AA 4K29A 3Q1TA 4L6WA 4ELSA 4FB8A 4OLQA 3R9TA 2X24A 4IZBA 3GMAA 1FC6A 1UYVA 3U9TB 1YG6A 5G1QA 2X58A 3T8AA 4Z0MA 3RSTA 3P85A 1HNUA 2C8TA 5DZKH 4Q1IA 3ZWAA 2F6IA 3L3SA 5FUSA 4I52A 3OT6A 2J5IA 1N6DA 3HRXA 5E0SH 4KNPA 3RSIA 3ZW8A 3MFMA 2D3TA 2PG8A 4K2NA 3VIVA 3KQFA 1PJHA 4U0GH 2F6QA 3R9SA 3T88A 5KJPA 4RYFH 3LKEA 1FCFA 3GF7A 2HW5A 2EJ5A 1SZOA 1Q51A 4G2RA 2J5GA 2VREA 3V5IA 4JJTA 4U19A 4YLHA 2VSSA 4JOTA 2PBPA 2F9YA 2IEXA 2ZQQA 2A81A 4KPKA 2FW2A 4ASIA 1XNWA 3ZW9A 2J5GD 3MT6A 3NJDA 3WG5A 3H02A 3U9RB 2DUBA 4HC8A 1K32A 4I4ZA 3TLFA 1UYSA 2VSUA 5KDRB 1FC7A 4FZWA 4I42A 1WDLA 3SLLA 1TG6A 2J5IB 4IZDA 5E0SA 2PPYA 1N6FA 3T8BA 3ISAA 3DORA 4F47A 4EMPA 1DUBA 5DU4A 3PZKA 2WTBA 4MI2A 2F9IB 2ZL2A 3K50A 4RYFA 1NZYB 2GTRA 4B3IA 3P5MA 3TZ3A 3BF0A 5DTPA 1TYFA 2CE3A 4ZDBA 5DUFA 3R0OA 4B3JA 3H81A 2F9YB 2ZL0A 4KD6A 3BEZA 1PIXA 4U18A 5JBWA 5DU6A 1JXZA 5DTWA 2A7SA 1RJMA 2VSUC 3Q7HA 3PEAA 1WZ8A 3KTKA 3P2LA 4FNDA 2NP9A 2VSSE 5C90A 3KTHA 3QYRA 4JSBA 4EMMA 3TV5A 2W3PA 5INGA 5CTBA 3SWXA 4ZDFA 2A7KA 3GF3A 4FN7A 4JCRA 4QIIA 3QXZA 3PE8A 3TVWA 1OD2A 1MJ3A 2VSUF 3MOYA 5DU8A 3M6NA 3HLN1 3I47A 4JCSA 5C9GA 3K8XA 3JU1A 3R6HA 4U0GA 3H0QA 4NEKA 2VSSF 3HE2A 4KWBA 1HNOA
chains in the Genus database with same CATH superfamily
3HP0A 5KDRA 4L8KA 3A4MA 3M6MA 1Q52A 4ZDEA 4WZ8B 3NJBA 3TDCA 3QXIA 1W2XA 5DL1A 4WCZA 1O8UA 5INIA 3FDUA 3W8IB 4ELXA 1DCIA 5IKLB 3RQGA 4OMRA 4U0HA 3GKBA 1Y64B 4MOUA 3TVUA 3RQEA 5CTCA 4QFEA 3N6RB 5DKPA 3H0JA 4FZWC 4JYJA 5DUCA 1XX4A 3Q0JA 5HUQA 3KTGA 2FZSA 3BPPA 3V5EA 3KTJA 2VSUE 1WDKA 3QREA 4OG1A 1X0UA 4RCNA 1UYTA 4GHNA 2Q2XA 3AM1A 3ST9A 3QWDA 4ZDCA 4QIJA 1ON9A 3AJMA 3IRBA 5INFA 2BZRA 3ZWCA 1RJNA 2YJGA 1YG8A 3LAOA 4Q0GA 2ZL3A 3GLMA 1J7XA 3RQFA 3QMJA 3IBBA 4JFCA 3KTIA 5MGBA 1XNYA 1EF9A 1EY3A 1FC9A 4ZU2A 2DEOA 3Q0GA 5FIFA 1WDMA 3TT6A 3ADCA 3H0UA 3QK8A 3IB9A 4B3HA 3W8HB 1ON3A 4JVTA 5DZKA 2J5SA 2ZL4A 2Q34A 1XNVA 1HZDA 4FN8A 4FNBA 2VX2A 3OMEA 3T3WA 2J5II 3QKAA 2CBYA 1UYRA 3ZWBA 3OC7A 4NNQA 3RRVA 4HNKA 4JCTA 1UX4A 1K39A 5G1SA 4JWVA 3BPTA 4HDTA 2ZQRA 4ZDDA 4LK5A 5JBXA 1NZYA 2QQ3A 4EMLA 2F9IA 3T89A 3TT7A 4IZCA 3R9QA 4DI1A 3G64A 1EF8A 3U9SB 1N6EA 4JYLA 3DJAA 4ELWA 4WYOB 1UX5A 4GM2A 4K3WA 3FF6A 3PGQA 4MXIA 2UZFA 1OD4A 3MYBA 3IAVA 1SG4A 1VRGA 1XO6A 3STAA 4JCQA 2FBMA 4FJWD 5G1RA 5E0NX 3H0SA 2Q35A 1UIYA 3TRRA 3HINA 1Y7OA 4U1AA 4K29A 3Q1TA 4L6WA 4GEHB 4ELSA 4FB8A 4OLQA 3R9TA 2X24A 4IZBA 3GMAA 1FC6A 1UYVA 3U9TB 1YG6A 3L8JA 5G1QA 2X58A 3T8AA 4Z0MA 3RSTA 4J2UA 3P85A 4NARA 1HNUA 2C8TA 5DZKH 4Q1IA 3ZWAA 2F6IA 3L3SA 5FUSA 4I52A 3OT6A 2J5IA 1N6DA 3HRXA 5E0SH 4KNPA 3RSIA 3ZW8A 3MFMA 2D3TA 3ADDA 4K2NA 2PG8A 3KQFA 1PJHA 4U0GH 3VIVA 2F6QA 3R9SA 3T88A 2P63A 5KJPA 4RYFH 3LKEA 1FCFA 3GF7A 2HW5A 2EJ5A 1SZOA 1Q51A 4G2RA 2J5GA 2VREA 3V5IA 4JJTA 4U19A 4YLHA 2VSSA 4JOTA 2PBPA 2F9YA 2IEXA 2ZQQA 2A81A 4KPKA 2FW2A 1XNWA 4ASIA 3ZW9A 2J5GD 3MT6A 3NJDA 3WG5A 3H02A 3L8IA 3U9RB 2DUBA 4HC8A 3O4XE 1K32A 4I4ZA 3TLFA 1UYSA 2VSUA 5KDRB 1FC7A 4FZWA 4I42A 1WDLA 3SLLA 1TG6A 2J5IB 4IZDA 5E0SA 2PPYA 1N6FA 3T8BA 3ISAA 3DORA 4F47A 3ADBA 1DUBA 4EMPA 5DU4A 3PZKA 2WTBA 4MI2A 2F9IB 2ZL2A 3K50A 4RYFA 1NZYB 2GTRA 4B3IA 3P5MA 3TZ3A 3BF0A 5DTPA 1TYFA 2CE3A 4ZDBA 5DUFA 3R0OA 4B3JA 3H81A 2F9YB 2ZL0A 4KD6A 3BEZA 1PIXA 4U18A 5JBWA 5DU6A 1JXZA 5DTWA 2A7SA 1RJMA 2VSUC 3Q7HA 3PEAA 1WZ8A 3KTKA 3A4LA 3P2LA 4FNDA 2NP9A 2VSSE 5C90A 3KTHA 3QYRA 4JSBA 4EMMA 3TV5A 2W3PA 5INGA 5CTBA 3A4NA 3SWXA 4ZDFA 2A7KA 3GF3A 4JCRA 4FN7A 4QIIA 3QXZA 3PE8A 3TVWA 1OD2A 1MJ3A 2VSUF 3MOYA 5DU8A 3M6NA 3HLN1 3I47A 4JCSA 5C9GA 3K8XA 3JU1A 3R6HA 4U0GA 3H0QA 4NEKA 2VSSF 3HE2A 4KWBA 1HNOA
chains in the Genus database with same CATH topology
3HP0A 5KDRA 4L8KA 3M6MA 1Q52A 4ZDEA 4WZ8B 3NJBA 3TDCA 3QXIA 1W2XA 5DL1A 4WCZA 1O8UA 5INIA 3FDUA 4ELXA 1DCIA 5IKLB 4OMRA 4U0HA 3GKBA 4MOUA 3TVUA 5CTCA 4QFEA 3N6RB 5DKPA 3H0JA 4FZWC 4JYJA 5DUCA 1XX4A 3Q0JA 5HUQA 3KTGA 2FZSA 3BPPA 3V5EA 3KTJA 2VSUE 1WDKA 3QREA 4OG1A 1X0UA 4RCNA 1UYTA 4GHNA 2Q2XA 3ST9A 3QWDA 4ZDCA 4QIJA 1ON9A 5INFA 2BZRA 3ZWCA 1RJNA 2YJGA 1YG8A 3LAOA 4Q0GA 2ZL3A 3GLMA 1J7XA 3QMJA 3IBBA 4JFCA 3KTIA 5MGBA 1XNYA 1EF9A 1EY3A 1FC9A 4ZU2A 2DEOA 3Q0GA 5FIFA 1WDMA 3TT6A 3H0UA 3QK8A 3IB9A 4B3HA 1ON3A 4JVTA 5DZKA 2J5SA 2ZL4A 2Q34A 1XNVA 1HZDA 4FN8A 4FNBA 2VX2A 3OMEA 3T3WA 2J5II 3QKAA 2CBYA 1UYRA 3ZWBA 3OC7A 4NNQA 3RRVA 4HNKA 4JCTA 1K39A 5G1SA 4JWVA 3BPTA 4HDTA 2ZQRA 4ZDDA 4LK5A 5JBXA 1NZYA 2QQ3A 4EMLA 2F9IA 3T89A 3TT7A 4IZCA 3R9QA 4DI1A 3G64A 1EF8A 3U9SB 1N6EA 4JYLA 3DJAA 4ELWA 4WYOB 4GM2A 4K3WA 3FF6A 3PGQA 4MXIA 2UZFA 1OD4A 3MYBA 3IAVA 1SG4A 1VRGA 1XO6A 3STAA 4JCQA 2FBMA 4FJWD 5G1RA 5E0NX 3H0SA 2Q35A 1UIYA 3TRRA 3HINA 1Y7OA 4U1AA 4K29A 3Q1TA 4L6WA 4ELSA 4FB8A 4OLQA 3R9TA 2X24A 4IZBA 3GMAA 1FC6A 1UYVA 3U9TB 1YG6A 5G1QA 2X58A 3T8AA 4Z0MA 3RSTA 4J2UA 3P85A 4NARA 1HNUA 2C8TA 5DZKH 4Q1IA 3ZWAA 2F6IA 3L3SA 5FUSA 4I52A 3OT6A 2J5IA 1N6DA 3HRXA 5E0SH 4KNPA 3RSIA 3ZW8A 3MFMA 2D3TA 2PG8A 4K2NA 3VIVA 3KQFA 1PJHA 4U0GH 2F6QA 3R9SA 3T88A 5KJPA 4RYFH 3LKEA 1FCFA 3GF7A 2HW5A 2EJ5A 1SZOA 1Q51A 4G2RA 2J5GA 2VREA 3V5IA 4JJTA 4U19A 4YLHA 2VSSA 4JOTA 2PBPA 2F9YA 2IEXA 2ZQQA 2A81A 4KPKA 2FW2A 4ASIA 1XNWA 3ZW9A 2J5GD 3MT6A 3NJDA 3WG5A 3H02A 3U9RB 2DUBA 4HC8A 1K32A 4I4ZA 3TLFA 1UYSA 2VSUA 5KDRB 1FC7A 4FZWA 4I42A 1WDLA 3SLLA 1TG6A 2J5IB 4IZDA 5E0SA 2PPYA 1N6FA 3T8BA 3ISAA 3DORA 4F47A 4EMPA 1DUBA 5DU4A 3PZKA 2WTBA 4MI2A 2F9IB 2ZL2A 3K50A 4RYFA 1NZYB 2GTRA 4B3IA 3P5MA 3TZ3A 3BF0A 5DTPA 1TYFA 2CE3A 4ZDBA 5DUFA 3R0OA 4B3JA 3H81A 2F9YB 2ZL0A 4KD6A 3BEZA 1PIXA 4U18A 5JBWA 5DU6A 1JXZA 5DTWA 2A7SA 1RJMA 2VSUC 3Q7HA 3PEAA 1WZ8A 3KTKA 3P2LA 4FNDA 2NP9A 2VSSE 5C90A 3KTHA 3QYRA 4JSBA 4EMMA 3TV5A 2W3PA 5INGA 5CTBA 3SWXA 4ZDFA 2A7KA 3GF3A 4JCRA 4FN7A 4QIIA 3QXZA 3PE8A 3TVWA 1OD2A 1MJ3A 2VSUF 3MOYA 5DU8A 3M6NA 3HLN1 3I47A 4JCSA 5C9GA 3K8XA 3JU1A 3R6HA 4U0GA 3H0QA 4NEKA 2VSSF 3HE2A 4KWBA 1HNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HP0 A;  5KDR A;  4L8K A;  3M6M A;  1Q52 A;  4ZDE A;  4WZ8 B;  3NJB A;  3TDC A;  3QXI A;  1W2X A;  5DL1 A;  4WCZ A;  1O8U A;  5INI A;  3FDU A;  4ELX A;  1DCI A;  5IKL B;  4OMR A;  4U0H A;  3GKB A;  4MOU A;  3TVU A;  5CTC A;  4QFE A;  3N6R B;  5DKP A;  3H0J A;  4FZW C;  4JYJ A;  5DUC A;  1XX4 A;  3Q0J A;  3KTG A;  2FZS A;  3BPP A;  3V5E A;  3KTJ A;  2VSU E;  1WDK A;  3QRE A;  4OG1 A;  1X0U A;  4RCN A;  1UYT A;  4GHN A;  2Q2X A;  3ST9 A;  3QWD A;  4ZDC A;  4QIJ A;  1ON9 A;  5INF A;  2BZR A;  3ZWC A;  1RJN A;  1YG8 A;  3LAO A;  4Q0G A;  2ZL3 A;  3GLM A;  1J7X A;  3QMJ A;  3IBB A;  4JFC A;  3KTI A;  5MGB A;  1XNY A;  1EF9 A;  1EY3 A;  1FC9 A;  4ZU2 A;  2DEO A;  3Q0G A;  5FIF A;  1WDM A;  3TT6 A;  3H0U A;  3QK8 A;  3IB9 A;  4B3H A;  1ON3 A;  4JVT A;  5DZK A;  2J5S A;  2ZL4 A;  2Q34 A;  1XNV A;  1HZD A;  4FN8 A;  4FNB A;  2VX2 A;  3OME A;  3T3W A;  2J5I I;  3QKA A;  2CBY A;  1UYR A;  3ZWB A;  3OC7 A;  4NNQ A;  3RRV A;  4HNK A;  4JCT A;  1K39 A;  5G1S A;  4JWV A;  2ZQR A;  4ZDD A;  4LK5 A;  5JBX A;  1NZY A;  2QQ3 A;  4EML A;  2F9I A;  3T89 A;  3TT7 A;  4IZC A;  3R9Q A;  4DI1 A;  3G64 A;  1EF8 A;  3U9S B;  1N6E A;  4JYL A;  3DJA A;  4ELW A;  4WYO B;  4GM2 A;  4K3W A;  3FF6 A;  3PGQ A;  4MXI A;  2UZF A;  1OD4 A;  3MYB A;  3IAV A;  1SG4 A;  1VRG A;  1XO6 A;  3STA A;  4JCQ A;  2FBM A;  4FJW D;  5G1R A;  5E0N X;  3H0S A;  2Q35 A;  1UIY A;  3TRR A;  3HIN A;  1Y7O A;  4U1A A;  4K29 A;  3Q1T A;  4L6W A;  4ELS A;  4FB8 A;  4OLQ A;  3R9T A;  2X24 A;  4IZB A;  3GMA A;  1FC6 A;  1UYV A;  3U9T B;  1YG6 A;  5G1Q A;  2X58 A;  3T8A A;  4Z0M A;  3RST A;  3P85 A;  1HNU A;  2C8T A;  5DZK H;  4Q1I A;  3ZWA A;  2F6I A;  3L3S A;  5FUS A;  4I52 A;  3OT6 A;  2J5I A;  1N6D A;  3HRX A;  5E0S H;  4KNP A;  3RSI A;  3ZW8 A;  3MFM A;  2D3T A;  2PG8 A;  4K2N A;  3VIV A;  3KQF A;  1PJH A;  4U0G H;  2F6Q A;  3R9S A;  3T88 A;  5KJP A;  4RYF H;  3LKE A;  1FCF A;  3GF7 A;  2HW5 A;  2EJ5 A;  1SZO A;  1Q51 A;  4G2R A;  2J5G A;  2VRE A;  3V5I A;  4JJT A;  4U19 A;  4YLH A;  2VSS A;  4JOT A;  2PBP A;  2F9Y A;  2IEX A;  2ZQQ A;  2A81 A;  4KPK A;  2FW2 A;  4ASI A;  1XNW A;  3ZW9 A;  2J5G D;  3MT6 A;  3NJD A;  3WG5 A;  3H02 A;  3U9R B;  2DUB A;  4HC8 A;  1K32 A;  4I4Z A;  3TLF A;  1UYS A;  2VSU A;  5KDR B;  1FC7 A;  4FZW A;  4I42 A;  1WDL A;  3SLL A;  1TG6 A;  2J5I B;  4IZD A;  5E0S A;  2PPY A;  1N6F A;  3T8B A;  3ISA A;  3DOR A;  4F47 A;  4EMP A;  1DUB A;  5DU4 A;  3PZK A;  2WTB A;  4MI2 A;  2F9I B;  2ZL2 A;  3K50 A;  4RYF A;  1NZY B;  2GTR A;  4B3I A;  3P5M A;  3TZ3 A;  3BF0 A;  5DTP A;  1TYF A;  2CE3 A;  4ZDB A;  5DUF A;  3R0O A;  4B3J A;  3H81 A;  2F9Y B;  2ZL0 A;  4KD6 A;  3BEZ A;  1PIX A;  4U18 A;  5JBW A;  5DU6 A;  1JXZ A;  5DTW A;  2A7S A;  1RJM A;  2VSU C;  3Q7H A;  3PEA A;  1WZ8 A;  3KTK A;  3P2L A;  4FND A;  2NP9 A;  2VSS E;  5C90 A;  3KTH A;  3QYR A;  4JSB A;  4EMM A;  3TV5 A;  2W3P A;  5ING A;  5CTB A;  3SWX A;  4ZDF A;  2A7K A;  3GF3 A;  4FN7 A;  4JCR A;  4QII A;  3QXZ A;  3PE8 A;  3TVW A;  1OD2 A;  1MJ3 A;  2VSU F;  3MOY A;  5DU8 A;  3M6N A;  3HLN 1;  3I47 A;  4JCS A;  5C9G A;  3K8X A;  3JU1 A;  3R6H A;  4U0G A;  3H0Q A;  4NEK A;  2VSS F;  3HE2 A;  4KWB A;  1HNO A; 
#chains in the Genus database with same CATH topology
 3HP0 A;  5KDR A;  4L8K A;  3A4M A;  3M6M A;  1Q52 A;  4ZDE A;  4WZ8 B;  3NJB A;  3TDC A;  3QXI A;  1W2X A;  5DL1 A;  4WCZ A;  1O8U A;  5INI A;  3FDU A;  3W8I B;  4ELX A;  1DCI A;  5IKL B;  3RQG A;  4OMR A;  4U0H A;  3GKB A;  1Y64 B;  4MOU A;  3TVU A;  3RQE A;  5CTC A;  4QFE A;  3N6R B;  5DKP A;  3H0J A;  4FZW C;  4JYJ A;  5DUC A;  1XX4 A;  3Q0J A;  5HUQ A;  3KTG A;  2FZS A;  3BPP A;  3V5E A;  3KTJ A;  2VSU E;  1WDK A;  3QRE A;  4OG1 A;  1X0U A;  4RCN A;  1UYT A;  4GHN A;  2Q2X A;  3AM1 A;  3ST9 A;  3QWD A;  4ZDC A;  4QIJ A;  1ON9 A;  3AJM A;  3IRB A;  5INF A;  2BZR A;  3ZWC A;  1RJN A;  2YJG A;  1YG8 A;  3LAO A;  4Q0G A;  2ZL3 A;  3GLM A;  1J7X A;  3RQF A;  3QMJ A;  3IBB A;  4JFC A;  3KTI A;  5MGB A;  1XNY A;  1EF9 A;  1EY3 A;  1FC9 A;  4ZU2 A;  2DEO A;  3Q0G A;  5FIF A;  1WDM A;  3TT6 A;  3ADC A;  3H0U A;  3QK8 A;  3IB9 A;  4B3H A;  3W8H B;  1ON3 A;  4JVT A;  5DZK A;  2J5S A;  2ZL4 A;  2Q34 A;  1XNV A;  1HZD A;  4FN8 A;  4FNB A;  2VX2 A;  3OME A;  3T3W A;  2J5I I;  3QKA A;  2CBY A;  1UYR A;  3ZWB A;  3OC7 A;  4NNQ A;  3RRV A;  4HNK A;  4JCT A;  1UX4 A;  1K39 A;  5G1S A;  4JWV A;  3BPT A;  4HDT A;  2ZQR A;  4ZDD A;  4LK5 A;  5JBX A;  1NZY A;  2QQ3 A;  4EML A;  2F9I A;  3T89 A;  3TT7 A;  4IZC A;  3R9Q A;  4DI1 A;  3G64 A;  1EF8 A;  3U9S B;  1N6E A;  4JYL A;  3DJA A;  4ELW A;  4WYO B;  1UX5 A;  4GM2 A;  4K3W A;  3FF6 A;  3PGQ A;  4MXI A;  2UZF A;  1OD4 A;  3MYB A;  3IAV A;  1SG4 A;  1VRG A;  1XO6 A;  3STA A;  4JCQ A;  2FBM A;  4FJW D;  5G1R A;  5E0N X;  3H0S A;  2Q35 A;  1UIY A;  3TRR A;  3HIN A;  1Y7O A;  4U1A A;  4K29 A;  3Q1T A;  4L6W A;  4GEH B;  4ELS A;  4FB8 A;  4OLQ A;  3R9T A;  2X24 A;  4IZB A;  3GMA A;  1FC6 A;  1UYV A;  3U9T B;  1YG6 A;  3L8J A;  5G1Q A;  2X58 A;  3T8A A;  4Z0M A;  3RST A;  4J2U A;  3P85 A;  4NAR A;  1HNU A;  2C8T A;  5DZK H;  4Q1I A;  3ZWA A;  2F6I A;  3L3S A;  5FUS A;  4I52 A;  3OT6 A;  2J5I A;  1N6D A;  3HRX A;  5E0S H;  4KNP A;  3RSI A;  3ZW8 A;  3MFM A;  2D3T A;  3ADD A;  4K2N A;  2PG8 A;  3KQF A;  1PJH A;  4U0G H;  3VIV A;  2F6Q A;  3R9S A;  3T88 A;  2P63 A;  5KJP A;  4RYF H;  3LKE A;  1FCF A;  3GF7 A;  2HW5 A;  2EJ5 A;  1SZO A;  1Q51 A;  4G2R A;  2J5G A;  2VRE A;  3V5I A;  4JJT A;  4U19 A;  4YLH A;  2VSS A;  4JOT A;  2PBP A;  2F9Y A;  2IEX A;  2ZQQ A;  2A81 A;  4KPK A;  2FW2 A;  1XNW A;  4ASI A;  3ZW9 A;  2J5G D;  3MT6 A;  3NJD A;  3WG5 A;  3H02 A;  3L8I A;  3U9R B;  2DUB A;  4HC8 A;  3O4X E;  1K32 A;  4I4Z A;  3TLF A;  1UYS A;  2VSU A;  5KDR B;  1FC7 A;  4FZW A;  4I42 A;  1WDL A;  3SLL A;  1TG6 A;  2J5I B;  4IZD A;  5E0S A;  2PPY A;  1N6F A;  3T8B A;  3ISA A;  3DOR A;  4F47 A;  3ADB A;  1DUB A;  4EMP A;  5DU4 A;  3PZK A;  2WTB A;  4MI2 A;  2F9I B;  2ZL2 A;  3K50 A;  4RYF A;  1NZY B;  2GTR A;  4B3I A;  3P5M A;  3TZ3 A;  3BF0 A;  5DTP A;  1TYF A;  2CE3 A;  4ZDB A;  5DUF A;  3R0O A;  4B3J A;  3H81 A;  2F9Y B;  2ZL0 A;  4KD6 A;  3BEZ A;  1PIX A;  4U18 A;  5JBW A;  5DU6 A;  1JXZ A;  5DTW A;  2A7S A;  1RJM A;  2VSU C;  3Q7H A;  3PEA A;  1WZ8 A;  3KTK A;  3A4L A;  3P2L A;  4FND A;  2NP9 A;  2VSS E;  5C90 A;  3KTH A;  3QYR A;  4JSB A;  4EMM A;  3TV5 A;  2W3P A;  5ING A;  5CTB A;  3A4N A;  3SWX A;  4ZDF A;  2A7K A;  3GF3 A;  4JCR A;  4FN7 A;  4QII A;  3QXZ A;  3PE8 A;  3TVW A;  1OD2 A;  1MJ3 A;  2VSU F;  3MOY A;  5DU8 A;  3M6N A;  3HLN 1;  3I47 A;  4JCS A;  5C9G A;  3K8X A;  3JU1 A;  3R6H A;  4U0G A;  3H0Q A;  4NEK A;  2VSS F;  3HE2 A;  4KWB A;  1HNO A; 
#chains in the Genus database with same CATH homology
 3HP0 A;  5KDR A;  4L8K A;  3M6M A;  1Q52 A;  4ZDE A;  4WZ8 B;  3NJB A;  3TDC A;  3QXI A;  1W2X A;  5DL1 A;  4WCZ A;  1O8U A;  5INI A;  3FDU A;  4ELX A;  1DCI A;  5IKL B;  4OMR A;  4U0H A;  3GKB A;  4MOU A;  3TVU A;  5CTC A;  4QFE A;  3N6R B;  5DKP A;  3H0J A;  4FZW C;  4JYJ A;  5DUC A;  1XX4 A;  3Q0J A;  5HUQ A;  3KTG A;  2FZS A;  3BPP A;  3V5E A;  3KTJ A;  2VSU E;  1WDK A;  3QRE A;  4OG1 A;  1X0U A;  4RCN A;  1UYT A;  4GHN A;  2Q2X A;  3ST9 A;  3QWD A;  4ZDC A;  4QIJ A;  1ON9 A;  5INF A;  2BZR A;  3ZWC A;  1RJN A;  2YJG A;  1YG8 A;  3LAO A;  4Q0G A;  2ZL3 A;  3GLM A;  1J7X A;  3QMJ A;  3IBB A;  4JFC A;  3KTI A;  5MGB A;  1XNY A;  1EF9 A;  1EY3 A;  1FC9 A;  4ZU2 A;  2DEO A;  3Q0G A;  5FIF A;  1WDM A;  3TT6 A;  3H0U A;  3QK8 A;  3IB9 A;  4B3H A;  1ON3 A;  4JVT A;  5DZK A;  2J5S A;  2ZL4 A;  2Q34 A;  1XNV A;  1HZD A;  4FN8 A;  4FNB A;  2VX2 A;  3OME A;  3T3W A;  2J5I I;  3QKA A;  2CBY A;  1UYR A;  3ZWB A;  3OC7 A;  4NNQ A;  3RRV A;  4HNK A;  4JCT A;  1K39 A;  5G1S A;  4JWV A;  3BPT A;  4HDT A;  2ZQR A;  4ZDD A;  4LK5 A;  5JBX A;  1NZY A;  2QQ3 A;  4EML A;  2F9I A;  3T89 A;  3TT7 A;  4IZC A;  3R9Q A;  4DI1 A;  3G64 A;  1EF8 A;  3U9S B;  1N6E A;  4JYL A;  3DJA A;  4ELW A;  4WYO B;  4GM2 A;  4K3W A;  3FF6 A;  3PGQ A;  4MXI A;  2UZF A;  1OD4 A;  3MYB A;  3IAV A;  1SG4 A;  1VRG A;  1XO6 A;  3STA A;  4JCQ A;  2FBM A;  4FJW D;  5G1R A;  5E0N X;  3H0S A;  2Q35 A;  1UIY A;  3TRR A;  3HIN A;  1Y7O A;  4U1A A;  4K29 A;  3Q1T A;  4L6W A;  4ELS A;  4FB8 A;  4OLQ A;  3R9T A;  2X24 A;  4IZB A;  3GMA A;  1FC6 A;  1UYV A;  3U9T B;  1YG6 A;  5G1Q A;  2X58 A;  3T8A A;  4Z0M A;  3RST A;  4J2U A;  3P85 A;  4NAR A;  1HNU A;  2C8T A;  5DZK H;  4Q1I A;  3ZWA A;  2F6I A;  3L3S A;  5FUS A;  4I52 A;  3OT6 A;  2J5I A;  1N6D A;  3HRX A;  5E0S H;  4KNP A;  3RSI A;  3ZW8 A;  3MFM A;  2D3T A;  2PG8 A;  4K2N A;  3VIV A;  3KQF A;  1PJH A;  4U0G H;  2F6Q A;  3R9S A;  3T88 A;  5KJP A;  4RYF H;  3LKE A;  1FCF A;  3GF7 A;  2HW5 A;  2EJ5 A;  1SZO A;  1Q51 A;  4G2R A;  2J5G A;  2VRE A;  3V5I A;  4JJT A;  4U19 A;  4YLH A;  2VSS A;  4JOT A;  2PBP A;  2F9Y A;  2IEX A;  2ZQQ A;  2A81 A;  4KPK A;  2FW2 A;  4ASI A;  1XNW A;  3ZW9 A;  2J5G D;  3MT6 A;  3NJD A;  3WG5 A;  3H02 A;  3U9R B;  2DUB A;  4HC8 A;  1K32 A;  4I4Z A;  3TLF A;  1UYS A;  2VSU A;  5KDR B;  1FC7 A;  4FZW A;  4I42 A;  1WDL A;  3SLL A;  1TG6 A;  2J5I B;  4IZD A;  5E0S A;  2PPY A;  1N6F A;  3T8B A;  3ISA A;  3DOR A;  4F47 A;  4EMP A;  1DUB A;  5DU4 A;  3PZK A;  2WTB A;  4MI2 A;  2F9I B;  2ZL2 A;  3K50 A;  4RYF A;  1NZY B;  2GTR A;  4B3I A;  3P5M A;  3TZ3 A;  3BF0 A;  5DTP A;  1TYF A;  2CE3 A;  4ZDB A;  5DUF A;  3R0O A;  4B3J A;  3H81 A;  2F9Y B;  2ZL0 A;  4KD6 A;  3BEZ A;  1PIX A;  4U18 A;  5JBW A;  5DU6 A;  1JXZ A;  5DTW A;  2A7S A;  1RJM A;  2VSU C;  3Q7H A;  3PEA A;  1WZ8 A;  3KTK A;  3P2L A;  4FND A;  2NP9 A;  2VSS E;  5C90 A;  3KTH A;  3QYR A;  4JSB A;  4EMM A;  3TV5 A;  2W3P A;  5ING A;  5CTB A;  3SWX A;  4ZDF A;  2A7K A;  3GF3 A;  4JCR A;  4FN7 A;  4QII A;  3QXZ A;  3PE8 A;  3TVW A;  1OD2 A;  1MJ3 A;  2VSU F;  3MOY A;  5DU8 A;  3M6N A;  3HLN 1;  3I47 A;  4JCS A;  5C9G A;  3K8X A;  3JU1 A;  3R6H A;  4U0G A;  3H0Q A;  4NEK A;  2VSS F;  3HE2 A;  4KWB A;  1HNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...