4K2NA

Crystal structure of an enoyl-coa hydratase/ carnithine racemase from magnetospirillum magneticum
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
267
Chain Sequence
b'GTENLYFQSMDVIQLVREGAIATVTLNRPDRMNALNLPMWRGLAEAFETISADRSIHVVILRGAGTKAFAPGADIEEFDTLRANAEQAKAYDLVMRKALDTVRACPQPVIAAIWGPCVGGGLELACCCDIRLSAKSGKFGVPINKISVVMAYPELAQIRRVAGPAAALEILLEGRIMDADEAAAKRLVNRVVEDDAMDAEVAATAKRIAAGAPLANRWHKAFIARLDDPTPVSEAELDECYRFLDTKDYAEGLAAFRAKRKPVFTAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase/carnithine racemase
publication title Crystal structure of an enoyl-CoA hydratase/ carnithine racemase from Magnetospirillum magneticum
rcsb
source organism Magnetospirillum magneticum
molecule tags Isomerase
total genus 90
structure length 267
sequence length 268
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4k2nA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4k2nA01
4Z0MA 3M6MA 3TDCA 4F47A 5INFA 2VSUE 4OMRA 3L3SA 4KNPA 3ZW8A 5CTCA 2ZQRA 4YLHA 4ELXA 1SZOA 2W3PA 4JYJA 4QFEA 2DEOA 4NEKA 4NNQA 4WCZA 4JFCA 3KTKA 4IZBA 3STAA 4U0GH 5KJPA 1FC9A 1DCIA 3BEZA 4RCNA 5E0SH 3H0JA 5FUSA 4KWBA 4FN7A 4DI1A 3K50A 4JWVA 1XNWA 4EMLA 4G2RA 2J5IB 3PZKA 3U9SB 4KPKA 3MT6A 3ISAA 2J5SA 1OD2A 2VX2A 3OMEA 5DU4A 4I42A 5JBWA 5INIA 3LKEA 4JCTA 4ZDCA 2VSSE 2GTRA 1FC6A 2J5IA 3KTHA 4MI2A 3KTIA 4WYOB 2X58A 4ZDDA 5DZKA 3TVWA 2PBPA 1UYVA 5DL1A 3MYBA 4GM2A 3Q7HA 4OLQA 1K39A 3FF6A 1EF8A 1XNYA 2PG8A 3R0OA 5DUFA 3V5EA 2D3TA 4ELWA 4EMPA 4EMMA 4ELSA 1ON9A 3VIVA 4IZCA 3OC7A 1W2XA 1N6EA 3Q0GA 3KTGA 1Q52A 4JCSA 3GLMA 1PIXA 4ZU2A 1O8UA 2F9YB 3RRVA 1TG6A 5DKPA 5E0NX 3Q0JA 3U9RB 2F9IB 3T89A 3RSTA 4IZDA 4I52A 3QREA 1NZYB 3QK8A 4JJTA 1UYSA 2FBMA 3DORA 3M6NA 2Q2XA 1J7XA 4JOTA 2Q35A 3P85A 4Q1IA 5JBXA 2WTBA 3ZWCA 1WDKA 3ZWAA 3PGQA 1X0UA 5G1QA 2C8TA 5C90A 1FC7A 3ST9A 3FDUA 3BF0A 3JU1A 3V5IA 5DZKH 2BZRA 1PJHA 3H81A 3NJDA 3H0UA 1EY3A 1Q51A 2A7SA 4JVTA 4FJWD 3SWXA 1Y7OA 5KDRB 4HC8A 4U0HA 4FNDA 3GMAA 3WG5A 5DU8A 4U19A 2DUBA 4Q0GA 3SLLA 2VSUF 4FNBA 2ZL3A 4U1AA 4LK5A 3T3WA 5G1SA 4WZ8B 2A81A 2EJ5A 1XNVA 3H0QA 4GHNA 5KDRA 3T8AA 5C9GA 3Q1TA 2CBYA 5E0SA 4OG1A 1UYTA 4L8KA 1RJNA 1UIYA 5IKLB 4MXIA 3QYRA 2F6QA 4QIIA 4JSBA 2VREA 4ZDBA 3TZ3A 2J5GA 1N6FA 3TT6A 1UYRA 3PE8A 2A7KA 4RYFA 3ZWBA 3IBBA 4MOUA 2VSUA 2PPYA 1TYFA 3HE2A 1N6DA 4ZDFA 2J5II 4K29A 3GF7A 1HNOA 3KQFA 1FCFA 1VRGA 2VSSF 1RJMA 4U18A 2F9YA 1HNUA 1XX4A 1DUBA 3IB9A 3N6RB 4B3IA 1YG8A 2FZSA 1XO6A 2F9IA 3HRXA 3LAOA 5DTPA 4KD6A 3DJAA 1NZYA 4FN8A 3TRRA 2X24A 4JYLA 3RSIA 2VSUC 4K2NA 3PEAA 2QQ3A 5DTWA 1K32A 3OT6A 1YG6A 2ZL4A 1HZDA 3IAVA 2VSSA 3GKBA 5MGBA 2NP9A 1WDMA 3R9QA 3P2LA 4JCRA 1MJ3A 4ZDEA 3H0SA 3TLFA 2CE3A 1SG4A 2IEXA 3R9TA 2HW5A 4U0GA 3T8BA 1ON3A 2ZL0A 4FZWA 2F6IA 5DUCA 4QIJA 4RYFH 3G64A 3QXIA 2UZFA 3P5MA 5INGA 5FIFA 3TT7A 3BPPA 3K8XA 5G1RA 2ZQQA 3ZW9A 3GF3A 4K3WA 2ZL2A 3R6HA 3R9SA 5DU6A 4FB8A 4B3JA 3MFMA 3NJBA 1WDLA 4ASIA 3TVUA 1EF9A 4JCQA 3I47A 3QWDA 3QKAA 1WZ8A 3HP0A 4B3HA 4I4ZA 2J5GD 3TV5A 3HINA 3U9TB 4L6WA 1JXZA 4FZWC 3MOYA 3HLN1 3H02A 3QXZA 2Q34A 1OD4A 3T88A 2FW2A 4HNKA 3KTJA 5CTBA 3QMJA
chains in the Genus database with same CATH superfamily
3BPTA 4Z0MA 3M6MA 3TDCA 4F47A 5INFA 2VSUE 4OMRA 3L3SA 4KNPA 3ZW8A 5CTCA 2ZQRA 4YLHA 4ELXA 1SZOA 2W3PA 4JYJA 1UX5A 4QFEA 2DEOA 4NEKA 4NNQA 3RQFA 4WCZA 4JFCA 3KTKA 5HUQA 4IZBA 3STAA 4U0GH 5KJPA 1FC9A 1DCIA 3BEZA 4RCNA 5E0SH 3H0JA 5FUSA 4KWBA 4FN7A 2P63A 4DI1A 3K50A 4NARA 4JWVA 1XNWA 4EMLA 4G2RA 2J5IB 3PZKA 3U9SB 4KPKA 3MT6A 3ISAA 2J5SA 1OD2A 2VX2A 3OMEA 5DU4A 4I42A 5JBWA 5INIA 3LKEA 4JCTA 3W8IB 4ZDCA 2VSSE 2GTRA 1FC6A 2J5IA 3KTHA 4MI2A 3KTIA 4WYOB 2X58A 4ZDDA 5DZKA 3TVWA 2PBPA 1UYVA 5DL1A 3MYBA 4GM2A 3Q7HA 4OLQA 1K39A 3FF6A 1EF8A 1XNYA 2PG8A 3R0OA 4HDTA 5DUFA 3V5EA 2D3TA 4ELWA 4EMPA 4EMMA 4ELSA 1ON9A 3VIVA 4IZCA 3OC7A 1W2XA 1N6EA 3Q0GA 3RQEA 3KTGA 1Q52A 4JCSA 3GLMA 1PIXA 4ZU2A 1O8UA 2F9YB 3RRVA 1TG6A 5DKPA 5E0NX 3Q0JA 3U9RB 2F9IB 3T89A 3RSTA 4IZDA 4I52A 3ADDA 3QREA 1NZYB 3QK8A 4JJTA 1UYSA 2FBMA 3DORA 3M6NA 2Q2XA 1J7XA 4JOTA 2Q35A 3P85A 4Q1IA 5JBXA 2WTBA 3ZWCA 1WDKA 3ZWAA 3PGQA 1X0UA 5G1QA 2C8TA 5C90A 1FC7A 3ST9A 3FDUA 3BF0A 3JU1A 3V5IA 5DZKH 2BZRA 1PJHA 3H81A 3NJDA 3H0UA 1EY3A 1Q51A 3AM1A 2A7SA 4JVTA 4FJWD 3W8HB 3SWXA 1Y7OA 5KDRB 4HC8A 4U0HA 4FNDA 3GMAA 3WG5A 5DU8A 4U19A 2DUBA 4Q0GA 3SLLA 4J2UA 2VSUF 3RQGA 4FNBA 2ZL3A 4U1AA 4LK5A 3T3WA 5G1SA 4WZ8B 2A81A 2EJ5A 1XNVA 3H0QA 4GHNA 5KDRA 3T8AA 5C9GA 3Q1TA 2CBYA 5E0SA 4OG1A 1UYTA 4L8KA 1RJNA 1UIYA 5IKLB 4MXIA 3QYRA 2F6QA 4QIIA 4JSBA 2VREA 4ZDBA 3TZ3A 2J5GA 1N6FA 3TT6A 1UYRA 3IRBA 3PE8A 2A7KA 4RYFA 3ZWBA 3IBBA 4MOUA 2VSUA 2PPYA 1TYFA 3HE2A 1N6DA 4ZDFA 2J5II 4K29A 3GF7A 3A4LA 1HNOA 3KQFA 1FCFA 1VRGA 2VSSF 1RJMA 4U18A 2F9YA 1HNUA 1XX4A 1DUBA 3IB9A 3N6RB 4B3IA 1YG8A 2FZSA 1XO6A 2F9IA 3HRXA 3LAOA 5DTPA 4KD6A 3AJMA 3DJAA 1NZYA 4FN8A 3TRRA 2X24A 3L8JA 4JYLA 3RSIA 2VSUC 4K2NA 3PEAA 2QQ3A 5DTWA 1K32A 3OT6A 1YG6A 1UX4A 2ZL4A 1HZDA 3IAVA 2VSSA 3GKBA 5MGBA 2NP9A 1WDMA 3A4NA 1Y64B 3R9QA 3P2LA 4JCRA 4GEHB 1MJ3A 4ZDEA 3H0SA 3TLFA 2CE3A 1SG4A 2IEXA 3R9TA 2HW5A 4U0GA 3T8BA 3O4XE 1ON3A 2ZL0A 4FZWA 2F6IA 5DUCA 3ADBA 4QIJA 4RYFH 3G64A 3QXIA 2UZFA 3P5MA 5INGA 5FIFA 3TT7A 3BPPA 3K8XA 5G1RA 2ZQQA 2YJGA 3ZW9A 3GF3A 4K3WA 2ZL2A 3R6HA 3R9SA 5DU6A 4FB8A 4B3JA 3MFMA 3NJBA 3A4MA 1WDLA 4ASIA 3TVUA 1EF9A 3ADCA 4JCQA 3I47A 3QWDA 3QKAA 3L8IA 1WZ8A 3HP0A 4B3HA 4I4ZA 2J5GD 3TV5A 3HINA 3U9TB 4L6WA 1JXZA 4FZWC 3MOYA 3HLN1 3H02A 3QXZA 2Q34A 1OD4A 3T88A 2FW2A 4HNKA 3KTJA 5CTBA 3QMJA
chains in the Genus database with same CATH topology
3BPTA 4Z0MA 3M6MA 3TDCA 4F47A 5INFA 2VSUE 4OMRA 3L3SA 4KNPA 3ZW8A 5CTCA 2ZQRA 4YLHA 4ELXA 1SZOA 2W3PA 4JYJA 4QFEA 2DEOA 4NEKA 4NNQA 4WCZA 4JFCA 3KTKA 5HUQA 4IZBA 3STAA 4U0GH 5KJPA 1FC9A 1DCIA 3BEZA 4RCNA 5E0SH 3H0JA 5FUSA 4KWBA 4FN7A 4DI1A 3K50A 4NARA 4JWVA 1XNWA 4EMLA 4G2RA 2J5IB 3PZKA 3U9SB 4KPKA 3MT6A 3ISAA 2J5SA 1OD2A 2VX2A 3OMEA 5DU4A 4I42A 5JBWA 5INIA 3LKEA 4JCTA 4ZDCA 2VSSE 2GTRA 1FC6A 2J5IA 3KTHA 4MI2A 3KTIA 4WYOB 2X58A 4ZDDA 5DZKA 3TVWA 2PBPA 1UYVA 5DL1A 3MYBA 4GM2A 3Q7HA 4OLQA 1K39A 3FF6A 1EF8A 1XNYA 2PG8A 3R0OA 4HDTA 5DUFA 3V5EA 2D3TA 4ELWA 4EMPA 4EMMA 4ELSA 1ON9A 3VIVA 4IZCA 3OC7A 1W2XA 1N6EA 3Q0GA 3KTGA 1Q52A 4JCSA 3GLMA 1PIXA 4ZU2A 1O8UA 2F9YB 3RRVA 1TG6A 5DKPA 5E0NX 3Q0JA 3U9RB 2F9IB 3T89A 3RSTA 4IZDA 4I52A 3QREA 1NZYB 3QK8A 4JJTA 1UYSA 2FBMA 3DORA 3M6NA 2Q2XA 1J7XA 4JOTA 2Q35A 3P85A 4Q1IA 5JBXA 2WTBA 3ZWCA 1WDKA 3ZWAA 3PGQA 1X0UA 5G1QA 2C8TA 5C90A 1FC7A 3ST9A 3FDUA 3BF0A 3JU1A 3V5IA 5DZKH 2BZRA 1PJHA 3H81A 3NJDA 3H0UA 1EY3A 1Q51A 2A7SA 4JVTA 4FJWD 3SWXA 1Y7OA 5KDRB 4HC8A 4U0HA 4FNDA 3GMAA 3WG5A 5DU8A 4U19A 2DUBA 4Q0GA 3SLLA 4J2UA 2VSUF 4FNBA 2ZL3A 4U1AA 4LK5A 3T3WA 5G1SA 4WZ8B 2A81A 2EJ5A 1XNVA 3H0QA 4GHNA 5KDRA 3T8AA 5C9GA 3Q1TA 2CBYA 5E0SA 4OG1A 1UYTA 4L8KA 1RJNA 1UIYA 5IKLB 4MXIA 3QYRA 2F6QA 4QIIA 4JSBA 2VREA 4ZDBA 3TZ3A 2J5GA 1N6FA 3TT6A 1UYRA 3PE8A 2A7KA 4RYFA 3ZWBA 3IBBA 4MOUA 2VSUA 2PPYA 1TYFA 3HE2A 1N6DA 4ZDFA 2J5II 4K29A 3GF7A 1HNOA 3KQFA 1FCFA 1VRGA 2VSSF 1RJMA 4U18A 2F9YA 1HNUA 1XX4A 1DUBA 3IB9A 3N6RB 4B3IA 1YG8A 2FZSA 1XO6A 2F9IA 3HRXA 3LAOA 5DTPA 4KD6A 3DJAA 1NZYA 4FN8A 3TRRA 2X24A 4JYLA 3RSIA 2VSUC 4K2NA 3PEAA 2QQ3A 5DTWA 1K32A 3OT6A 1YG6A 2ZL4A 1HZDA 3IAVA 2VSSA 3GKBA 5MGBA 2NP9A 1WDMA 3R9QA 3P2LA 4JCRA 1MJ3A 4ZDEA 3H0SA 3TLFA 2CE3A 1SG4A 2IEXA 3R9TA 2HW5A 4U0GA 3T8BA 1ON3A 2ZL0A 4FZWA 2F6IA 5DUCA 4QIJA 4RYFH 3G64A 3QXIA 2UZFA 3P5MA 5INGA 5FIFA 3TT7A 3BPPA 3K8XA 5G1RA 2ZQQA 2YJGA 3ZW9A 3GF3A 4K3WA 2ZL2A 3R6HA 3R9SA 5DU6A 4FB8A 4B3JA 3MFMA 3NJBA 1WDLA 4ASIA 3TVUA 1EF9A 4JCQA 3I47A 3QWDA 3QKAA 1WZ8A 3HP0A 4B3HA 4I4ZA 2J5GD 3TV5A 3HINA 3U9TB 4L6WA 1JXZA 4FZWC 3MOYA 3HLN1 3H02A 3QXZA 2Q34A 1OD4A 3T88A 2FW2A 4HNKA 3KTJA 5CTBA 3QMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0M A;  3M6M A;  3TDC A;  4F47 A;  5INF A;  2VSU E;  4OMR A;  3L3S A;  4KNP A;  3ZW8 A;  5CTC A;  2ZQR A;  4YLH A;  4ELX A;  1SZO A;  2W3P A;  4JYJ A;  4QFE A;  2DEO A;  4NEK A;  4NNQ A;  4WCZ A;  4JFC A;  3KTK A;  4IZB A;  3STA A;  4U0G H;  5KJP A;  1FC9 A;  1DCI A;  3BEZ A;  4RCN A;  5E0S H;  3H0J A;  5FUS A;  4KWB A;  4FN7 A;  4DI1 A;  3K50 A;  4JWV A;  1XNW A;  4EML A;  4G2R A;  2J5I B;  3PZK A;  3U9S B;  4KPK A;  3MT6 A;  3ISA A;  2J5S A;  1OD2 A;  2VX2 A;  3OME A;  5DU4 A;  4I42 A;  5JBW A;  5INI A;  3LKE A;  4JCT A;  4ZDC A;  2VSS E;  2GTR A;  1FC6 A;  2J5I A;  3KTH A;  4MI2 A;  3KTI A;  4WYO B;  2X58 A;  4ZDD A;  5DZK A;  3TVW A;  2PBP A;  1UYV A;  5DL1 A;  3MYB A;  4GM2 A;  3Q7H A;  4OLQ A;  1K39 A;  3FF6 A;  1EF8 A;  1XNY A;  2PG8 A;  3R0O A;  5DUF A;  3V5E A;  2D3T A;  4ELW A;  4EMP A;  4EMM A;  4ELS A;  1ON9 A;  3VIV A;  4IZC A;  3OC7 A;  1W2X A;  1N6E A;  3Q0G A;  3KTG A;  1Q52 A;  4JCS A;  3GLM A;  1PIX A;  4ZU2 A;  1O8U A;  2F9Y B;  3RRV A;  1TG6 A;  5DKP A;  5E0N X;  3Q0J A;  3U9R B;  2F9I B;  3T89 A;  3RST A;  4IZD A;  4I52 A;  3QRE A;  1NZY B;  3QK8 A;  4JJT A;  1UYS A;  2FBM A;  3DOR A;  3M6N A;  2Q2X A;  1J7X A;  4JOT A;  2Q35 A;  3P85 A;  4Q1I A;  5JBX A;  2WTB A;  3ZWC A;  1WDK A;  3ZWA A;  3PGQ A;  1X0U A;  5G1Q A;  2C8T A;  5C90 A;  1FC7 A;  3ST9 A;  3FDU A;  3BF0 A;  3JU1 A;  3V5I A;  5DZK H;  2BZR A;  1PJH A;  3H81 A;  3NJD A;  3H0U A;  1EY3 A;  1Q51 A;  2A7S A;  4JVT A;  4FJW D;  3SWX A;  1Y7O A;  5KDR B;  4HC8 A;  4U0H A;  4FND A;  3GMA A;  3WG5 A;  5DU8 A;  4U19 A;  2DUB A;  4Q0G A;  3SLL A;  2VSU F;  4FNB A;  2ZL3 A;  4U1A A;  4LK5 A;  3T3W A;  5G1S A;  4WZ8 B;  2A81 A;  2EJ5 A;  1XNV A;  3H0Q A;  4GHN A;  5KDR A;  3T8A A;  5C9G A;  3Q1T A;  2CBY A;  5E0S A;  4OG1 A;  1UYT A;  4L8K A;  1RJN A;  1UIY A;  5IKL B;  4MXI A;  3QYR A;  2F6Q A;  4QII A;  4JSB A;  2VRE A;  4ZDB A;  3TZ3 A;  2J5G A;  1N6F A;  3TT6 A;  1UYR A;  3PE8 A;  2A7K A;  4RYF A;  3ZWB A;  3IBB A;  4MOU A;  2VSU A;  2PPY A;  1TYF A;  3HE2 A;  1N6D A;  4ZDF A;  2J5I I;  4K29 A;  3GF7 A;  1HNO A;  3KQF A;  1FCF A;  1VRG A;  2VSS F;  1RJM A;  4U18 A;  2F9Y A;  1HNU A;  1XX4 A;  1DUB A;  3IB9 A;  3N6R B;  4B3I A;  1YG8 A;  2FZS A;  1XO6 A;  2F9I A;  3HRX A;  3LAO A;  5DTP A;  4KD6 A;  3DJA A;  1NZY A;  4FN8 A;  3TRR A;  2X24 A;  4JYL A;  3RSI A;  2VSU C;  4K2N A;  3PEA A;  2QQ3 A;  5DTW A;  1K32 A;  3OT6 A;  1YG6 A;  2ZL4 A;  1HZD A;  3IAV A;  2VSS A;  3GKB A;  5MGB A;  2NP9 A;  1WDM A;  3R9Q A;  3P2L A;  4JCR A;  1MJ3 A;  4ZDE A;  3H0S A;  3TLF A;  2CE3 A;  1SG4 A;  2IEX A;  3R9T A;  2HW5 A;  4U0G A;  3T8B A;  1ON3 A;  2ZL0 A;  4FZW A;  2F6I A;  5DUC A;  4QIJ A;  4RYF H;  3G64 A;  3QXI A;  2UZF A;  3P5M A;  5ING A;  5FIF A;  3TT7 A;  3BPP A;  3K8X A;  5G1R A;  2ZQQ A;  3ZW9 A;  3GF3 A;  4K3W A;  2ZL2 A;  3R6H A;  3R9S A;  5DU6 A;  4FB8 A;  4B3J A;  3MFM A;  3NJB A;  1WDL A;  4ASI A;  3TVU A;  1EF9 A;  4JCQ A;  3I47 A;  3QWD A;  3QKA A;  1WZ8 A;  3HP0 A;  4B3H A;  4I4Z A;  2J5G D;  3TV5 A;  3HIN A;  3U9T B;  4L6W A;  1JXZ A;  4FZW C;  3MOY A;  3HLN 1;  3H02 A;  3QXZ A;  2Q34 A;  1OD4 A;  3T88 A;  2FW2 A;  4HNK A;  3KTJ A;  5CTB A;  3QMJ A; 
#chains in the Genus database with same CATH topology
 3BPT A;  4Z0M A;  3M6M A;  3TDC A;  4F47 A;  5INF A;  2VSU E;  4OMR A;  3L3S A;  4KNP A;  3ZW8 A;  5CTC A;  2ZQR A;  4YLH A;  4ELX A;  1SZO A;  2W3P A;  4JYJ A;  1UX5 A;  4QFE A;  2DEO A;  4NEK A;  4NNQ A;  3RQF A;  4WCZ A;  4JFC A;  3KTK A;  5HUQ A;  4IZB A;  3STA A;  4U0G H;  5KJP A;  1FC9 A;  1DCI A;  3BEZ A;  4RCN A;  5E0S H;  3H0J A;  5FUS A;  4KWB A;  4FN7 A;  2P63 A;  4DI1 A;  3K50 A;  4NAR A;  4JWV A;  1XNW A;  4EML A;  4G2R A;  2J5I B;  3PZK A;  3U9S B;  4KPK A;  3MT6 A;  3ISA A;  2J5S A;  1OD2 A;  2VX2 A;  3OME A;  5DU4 A;  4I42 A;  5JBW A;  5INI A;  3LKE A;  4JCT A;  3W8I B;  4ZDC A;  2VSS E;  2GTR A;  1FC6 A;  2J5I A;  3KTH A;  4MI2 A;  3KTI A;  4WYO B;  2X58 A;  4ZDD A;  5DZK A;  3TVW A;  2PBP A;  1UYV A;  5DL1 A;  3MYB A;  4GM2 A;  3Q7H A;  4OLQ A;  1K39 A;  3FF6 A;  1EF8 A;  1XNY A;  2PG8 A;  3R0O A;  4HDT A;  5DUF A;  3V5E A;  2D3T A;  4ELW A;  4EMP A;  4EMM A;  4ELS A;  1ON9 A;  3VIV A;  4IZC A;  3OC7 A;  1W2X A;  1N6E A;  3Q0G A;  3RQE A;  3KTG A;  1Q52 A;  4JCS A;  3GLM A;  1PIX A;  4ZU2 A;  1O8U A;  2F9Y B;  3RRV A;  1TG6 A;  5DKP A;  5E0N X;  3Q0J A;  3U9R B;  2F9I B;  3T89 A;  3RST A;  4IZD A;  4I52 A;  3ADD A;  3QRE A;  1NZY B;  3QK8 A;  4JJT A;  1UYS A;  2FBM A;  3DOR A;  3M6N A;  2Q2X A;  1J7X A;  4JOT A;  2Q35 A;  3P85 A;  4Q1I A;  5JBX A;  2WTB A;  3ZWC A;  1WDK A;  3ZWA A;  3PGQ A;  1X0U A;  5G1Q A;  2C8T A;  5C90 A;  1FC7 A;  3ST9 A;  3FDU A;  3BF0 A;  3JU1 A;  3V5I A;  5DZK H;  2BZR A;  1PJH A;  3H81 A;  3NJD A;  3H0U A;  1EY3 A;  1Q51 A;  3AM1 A;  2A7S A;  4JVT A;  4FJW D;  3W8H B;  3SWX A;  1Y7O A;  5KDR B;  4HC8 A;  4U0H A;  4FND A;  3GMA A;  3WG5 A;  5DU8 A;  4U19 A;  2DUB A;  4Q0G A;  3SLL A;  4J2U A;  2VSU F;  3RQG A;  4FNB A;  2ZL3 A;  4U1A A;  4LK5 A;  3T3W A;  5G1S A;  4WZ8 B;  2A81 A;  2EJ5 A;  1XNV A;  3H0Q A;  4GHN A;  5KDR A;  3T8A A;  5C9G A;  3Q1T A;  2CBY A;  5E0S A;  4OG1 A;  1UYT A;  4L8K A;  1RJN A;  1UIY A;  5IKL B;  4MXI A;  3QYR A;  2F6Q A;  4QII A;  4JSB A;  2VRE A;  4ZDB A;  3TZ3 A;  2J5G A;  1N6F A;  3TT6 A;  1UYR A;  3IRB A;  3PE8 A;  2A7K A;  4RYF A;  3ZWB A;  3IBB A;  4MOU A;  2VSU A;  2PPY A;  1TYF A;  3HE2 A;  1N6D A;  4ZDF A;  2J5I I;  4K29 A;  3GF7 A;  3A4L A;  1HNO A;  3KQF A;  1FCF A;  1VRG A;  2VSS F;  1RJM A;  4U18 A;  2F9Y A;  1HNU A;  1XX4 A;  1DUB A;  3IB9 A;  3N6R B;  4B3I A;  1YG8 A;  2FZS A;  1XO6 A;  2F9I A;  3HRX A;  3LAO A;  5DTP A;  4KD6 A;  3AJM A;  3DJA A;  1NZY A;  4FN8 A;  3TRR A;  2X24 A;  3L8J A;  4JYL A;  3RSI A;  2VSU C;  4K2N A;  3PEA A;  2QQ3 A;  5DTW A;  1K32 A;  3OT6 A;  1YG6 A;  1UX4 A;  2ZL4 A;  1HZD A;  3IAV A;  2VSS A;  3GKB A;  5MGB A;  2NP9 A;  1WDM A;  3A4N A;  1Y64 B;  3R9Q A;  3P2L A;  4JCR A;  4GEH B;  1MJ3 A;  4ZDE A;  3H0S A;  3TLF A;  2CE3 A;  1SG4 A;  2IEX A;  3R9T A;  2HW5 A;  4U0G A;  3T8B A;  3O4X E;  1ON3 A;  2ZL0 A;  4FZW A;  2F6I A;  5DUC A;  3ADB A;  4QIJ A;  4RYF H;  3G64 A;  3QXI A;  2UZF A;  3P5M A;  5ING A;  5FIF A;  3TT7 A;  3BPP A;  3K8X A;  5G1R A;  2ZQQ A;  2YJG A;  3ZW9 A;  3GF3 A;  4K3W A;  2ZL2 A;  3R6H A;  3R9S A;  5DU6 A;  4FB8 A;  4B3J A;  3MFM A;  3NJB A;  3A4M A;  1WDL A;  4ASI A;  3TVU A;  1EF9 A;  3ADC A;  4JCQ A;  3I47 A;  3QWD A;  3QKA A;  3L8I A;  1WZ8 A;  3HP0 A;  4B3H A;  4I4Z A;  2J5G D;  3TV5 A;  3HIN A;  3U9T B;  4L6W A;  1JXZ A;  4FZW C;  3MOY A;  3HLN 1;  3H02 A;  3QXZ A;  2Q34 A;  1OD4 A;  3T88 A;  2FW2 A;  4HNK A;  3KTJ A;  5CTB A;  3QMJ A; 
#chains in the Genus database with same CATH homology
 3BPT A;  4Z0M A;  3M6M A;  3TDC A;  4F47 A;  5INF A;  2VSU E;  4OMR A;  3L3S A;  4KNP A;  3ZW8 A;  5CTC A;  2ZQR A;  4YLH A;  4ELX A;  1SZO A;  2W3P A;  4JYJ A;  4QFE A;  2DEO A;  4NEK A;  4NNQ A;  4WCZ A;  4JFC A;  3KTK A;  5HUQ A;  4IZB A;  3STA A;  4U0G H;  5KJP A;  1FC9 A;  1DCI A;  3BEZ A;  4RCN A;  5E0S H;  3H0J A;  5FUS A;  4KWB A;  4FN7 A;  4DI1 A;  3K50 A;  4NAR A;  4JWV A;  1XNW A;  4EML A;  4G2R A;  2J5I B;  3PZK A;  3U9S B;  4KPK A;  3MT6 A;  3ISA A;  2J5S A;  1OD2 A;  2VX2 A;  3OME A;  5DU4 A;  4I42 A;  5JBW A;  5INI A;  3LKE A;  4JCT A;  4ZDC A;  2VSS E;  2GTR A;  1FC6 A;  2J5I A;  3KTH A;  4MI2 A;  3KTI A;  4WYO B;  2X58 A;  4ZDD A;  5DZK A;  3TVW A;  2PBP A;  1UYV A;  5DL1 A;  3MYB A;  4GM2 A;  3Q7H A;  4OLQ A;  1K39 A;  3FF6 A;  1EF8 A;  1XNY A;  2PG8 A;  3R0O A;  4HDT A;  5DUF A;  3V5E A;  2D3T A;  4ELW A;  4EMP A;  4EMM A;  4ELS A;  1ON9 A;  3VIV A;  4IZC A;  3OC7 A;  1W2X A;  1N6E A;  3Q0G A;  3KTG A;  1Q52 A;  4JCS A;  3GLM A;  1PIX A;  4ZU2 A;  1O8U A;  2F9Y B;  3RRV A;  1TG6 A;  5DKP A;  5E0N X;  3Q0J A;  3U9R B;  2F9I B;  3T89 A;  3RST A;  4IZD A;  4I52 A;  3QRE A;  1NZY B;  3QK8 A;  4JJT A;  1UYS A;  2FBM A;  3DOR A;  3M6N A;  2Q2X A;  1J7X A;  4JOT A;  2Q35 A;  3P85 A;  4Q1I A;  5JBX A;  2WTB A;  3ZWC A;  1WDK A;  3ZWA A;  3PGQ A;  1X0U A;  5G1Q A;  2C8T A;  5C90 A;  1FC7 A;  3ST9 A;  3FDU A;  3BF0 A;  3JU1 A;  3V5I A;  5DZK H;  2BZR A;  1PJH A;  3H81 A;  3NJD A;  3H0U A;  1EY3 A;  1Q51 A;  2A7S A;  4JVT A;  4FJW D;  3SWX A;  1Y7O A;  5KDR B;  4HC8 A;  4U0H A;  4FND A;  3GMA A;  3WG5 A;  5DU8 A;  4U19 A;  2DUB A;  4Q0G A;  3SLL A;  4J2U A;  2VSU F;  4FNB A;  2ZL3 A;  4U1A A;  4LK5 A;  3T3W A;  5G1S A;  4WZ8 B;  2A81 A;  2EJ5 A;  1XNV A;  3H0Q A;  4GHN A;  5KDR A;  3T8A A;  5C9G A;  3Q1T A;  2CBY A;  5E0S A;  4OG1 A;  1UYT A;  4L8K A;  1RJN A;  1UIY A;  5IKL B;  4MXI A;  3QYR A;  2F6Q A;  4QII A;  4JSB A;  2VRE A;  4ZDB A;  3TZ3 A;  2J5G A;  1N6F A;  3TT6 A;  1UYR A;  3PE8 A;  2A7K A;  4RYF A;  3ZWB A;  3IBB A;  4MOU A;  2VSU A;  2PPY A;  1TYF A;  3HE2 A;  1N6D A;  4ZDF A;  2J5I I;  4K29 A;  3GF7 A;  1HNO A;  3KQF A;  1FCF A;  1VRG A;  2VSS F;  1RJM A;  4U18 A;  2F9Y A;  1HNU A;  1XX4 A;  1DUB A;  3IB9 A;  3N6R B;  4B3I A;  1YG8 A;  2FZS A;  1XO6 A;  2F9I A;  3HRX A;  3LAO A;  5DTP A;  4KD6 A;  3DJA A;  1NZY A;  4FN8 A;  3TRR A;  2X24 A;  4JYL A;  3RSI A;  2VSU C;  4K2N A;  3PEA A;  2QQ3 A;  5DTW A;  1K32 A;  3OT6 A;  1YG6 A;  2ZL4 A;  1HZD A;  3IAV A;  2VSS A;  3GKB A;  5MGB A;  2NP9 A;  1WDM A;  3R9Q A;  3P2L A;  4JCR A;  1MJ3 A;  4ZDE A;  3H0S A;  3TLF A;  2CE3 A;  1SG4 A;  2IEX A;  3R9T A;  2HW5 A;  4U0G A;  3T8B A;  1ON3 A;  2ZL0 A;  4FZW A;  2F6I A;  5DUC A;  4QIJ A;  4RYF H;  3G64 A;  3QXI A;  2UZF A;  3P5M A;  5ING A;  5FIF A;  3TT7 A;  3BPP A;  3K8X A;  5G1R A;  2ZQQ A;  2YJG A;  3ZW9 A;  3GF3 A;  4K3W A;  2ZL2 A;  3R6H A;  3R9S A;  5DU6 A;  4FB8 A;  4B3J A;  3MFM A;  3NJB A;  1WDL A;  4ASI A;  3TVU A;  1EF9 A;  4JCQ A;  3I47 A;  3QWD A;  3QKA A;  1WZ8 A;  3HP0 A;  4B3H A;  4I4Z A;  2J5G D;  3TV5 A;  3HIN A;  3U9T B;  4L6W A;  1JXZ A;  4FZW C;  3MOY A;  3HLN 1;  3H02 A;  3QXZ A;  2Q34 A;  1OD4 A;  3T88 A;  2FW2 A;  4HNK A;  3KTJ A;  5CTB A;  3QMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...