4K2RA

Structural basis for activation of zap-70 by phosphorylation of the sh2-kinase linker
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
613
structure length
551
Chain Sequence
PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDFGLSWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ZAP-70
publication title Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 162
structure length 551
sequence length 613
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4k2rA05
1.10.930.10 Mainly Alpha Orthogonal Bundle Syk Kinase; Chain A, domain 2 Syk Kinase; Chain A, domain 2 4k2rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4k2rA04
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4k2rA03
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4k2rA01
4KABA 4F9AA 1FBVA 3BX5A 3UTOA 1YXSA 2ABLA 3MY1A 3Q52A 2Y8OA 3PJPA 3L9MA 2BUJA 3IKAA 2JAMA 2B1PA 5E8UA 2ECDA 3IMJA 3E87A 2ITWA 1B39A 1Y6AA 4XG6A 3GC9A 2CGVA 4ZXTA 4FV4A 3NLBA 3PG1A 3Q96A 5E91A 2RFDA 1IG1A 2XVDA 2BAKA 3NDMA 3TTJA 2W1EA 2VTHA 1Z5MA 2ZJWA 3HV5A 4YO4A 1UURA 2DX0A 1JWHA 2QR8A 3C0GA 3I4BA 3KN6A 3DAEA 4JT3A 3RMFA 1P13A 2VTPA 2V7AA 4E4MA 4JDHA 5LQFA 3VW6A 2IVTA 3BHTA 3CXLA 3PSKA 2DWBA 3C4CA 4P5ZA 4M7IA 4BBMA 5CSVA 2CLQA 5J5SA 3P0MA 3CJGA 3W2CA 2I40A 3KF4A 5H8EA 3ATTA 4CFNA 1G8SA 4EIHA 1LEWA 2B9HA 4QYHA 4D55A 1YI3A 4LMNA 3EWHA 2BTRA 3QZFA 5HZNA 4ZY6A 3I5NA 4GH2A 4FKPA 4XYFA 5I3OA 4EC8A 5FDXA 4HYUA 4JEGA 4RC3A 1BMBA 4TWPA 4PF4A 5FWKK 1URWA 3QCQA 4J99A 3UOKA 5EYDA 3VUHA 3G5DA 2X1NA 3NMUF 3GU5A 1BHFA 4O82A 5JN2A 2QQ7A 5HO8A 3Q4TA 2X8EA 2QVSE 2ITYA 5C8KA 4S34A 3GFEA 3UZPA 2VWUA 3V01A 2ZM3A 3CTQA 4A4OA 4RMZA 4NM5A 1XH4A 5CU4A 4ZMEA 4BDEA 1SM2A 2C6LA 4PP9A 4E73A 1A1CA 4J96A 4A9UA 1AOTF 3TIYA 2C5OA 3D83A 5LCKA 2YJSA 2XBJA 3PXZA 2QU6A 5E8TA 1UU9A 4HGLA 3LCKA 3NEWA 5H8GA 2YDIA 1BM2A 4JNWA 5ANKA 4KRCA 2F57A 3IDCA 4TPTA 3WARA 2XB7A 4XP2A 4YHTA 4D2TA 4DT9A 4RX5A 5J95A 4S2ZA 4BCIA 3WF9A 1H9OA 1AYAA 4GVJA 4KS7A 2QOIA 4O21A 4ANMA 3BHUA 3MDYA 2R3FA 5CXZA 3AT4A 5DT4A 2R3RA 4IVCA 3FY0A 3BU5A 4IDTA 1FGIA 4PDOA 1MRYA 2QD9A 5IQFA 4U43A 5DF6A 3HP5A 5E7RA 3RPSA 3E3BX 3UODA 4ROJA 2I1MA 3THBA 3QRTA 4IVAA 4F6WA 1B38A 1WBNA 2JDSA 2UUEA 3B2WA 5CQWA 5KMLA 3OBJA 1NVRA 3I81A 3FY2A 4GVAA 3ULIA 4E8AA 5DMZA 5JFVA 3A2CA 3ZFXA 4LMUA 4ENXA 4TNDA 4GWFA 1DI8A 4A4BA 5DEYA 2SHPA 3HRCA 3PS5A 3ERKA 2XNOA 3IOKA 3LFAA 2GNJA 2KULA 2E2BA 2OJJA 3A7HA 4Q9SA 4BIDA 4EK6A 2RSYA 3MS9A 3C4XA 5FLFA 4B8LA 2WHBA 3MFRA 4F9BA 4JQEA 4K33A 5FTQA 2C6OA 1BG1A 2YERA 4U9AA 4C4GA 3EQCA 3COHA 2XP2A 4EK5A 2ZB0A 5DA3A 3JY9A 3AQVA 5HGIA 5GJHA 2WMAA 4G6LA 3R21A 4MNEA 2BIYA 3GVUA 3U9CA 2WTDA 4X2FA 3QYZA 2UZBA 1FVRA 1WQUA 1OITA 5DWRA 4JRNA 2Q83A 1Q61A 2WTKB 4IZYA 4PY1A 3LXNA 3BKBA 1G8AA 1GZ8A 4ZTMA 5LMKA 1JSTA 1YW2A 4FL1A 2CGUA 4CFMA 4I6BA 1W98A 4O6LA 4QNYA 5CZHA 2J0LA 5DH3A 2VTLA 3U6IA 1OKYA 4XLVA 1SYKA 5CEOA 3SXFA 2JFLA 2WU7A 4IC7A 1PKDA 2GHGA 3P7CA 3BIZA 4F9CA 3UZTA 4R7IA 2HCKA 2OFUA 2PVRA 3PJ2A 2CI9A 5EHYA 4KIKA 4BRXA 1QMZA 1MQ4A 1IASA 3FSFA 3OCTA 2VTQA 3BGPA 3FQHA 3IDBA 2PZYA 5L2SA 4OTHA 4ZLOA 3EN5A 3IW8A 4FL3A 3G15A 3JR1A 5IU2A 5HNGA 5ACBC 4ZTHA 2VGPA 5CASA 3HNGA 4FV1A 2BRHA 4NH1A 5IEVA 1G83A 3OCSA 4CZYB 5BVEA 2NPQA 4CMTA 4XOZA 3ZO3A 3IGGA 1JKSA 2OH4A 5GHVA 4L44A 3P08A 4FZAB 2JDTA 3EFJA 3LHJA 4P5QA 3CR0A 3HP2A 4M68A 4BYIA 5IH4A 2XNPA 2F2CB 3CP9A 4XG9A 3U87A 2OGVA 4DEHA 3TL0A 1ERKA 2QOCA 4O91A 3LCOA 4WUNA 4A9YA 4BVUA 4BZOA 4MTAA 3VRZA 4I6FA 2WEVA 3OOGA 4FA2A 1A9UA 3PTGA 4FTRA 1YI6A 5H8BA 3ZHPC 4C8BA 3NVKI 4XH6A 1ND4A 4QQTA 1QPJA 4DEAA 4BCMA 4K0YA 3MB6A 1GNGA 3PYYA 3ZZWA 1H0WA 4QTDA 5L8LA 4QMQA 3PLAE 3DJ7A 1JKTA 4KSQA 4NFNA 3FXWA 4KIQA 4C3FA 3MESA 2XNNA 2F4JA 3LCSA 1ZYSA 2VUWA 1LCKA 2B9IA 3HA8A 2WTJA 3S1HA 3RBWA 1YHSA 4AGDA 2XM8A 2E9NA 1JOWB 3CQUA 3DS6A 2JIVA 3FKNA 2HWOA 2CGWA 4RVTA 3MH3A 1A09A 4X2JA 4DGNA 4IJ9A 4O84A 2EL8A 3LFFA 1EH4A 1ZAOA 4CRSA 2OU7A 2OJ9A 4OTQA 4PWNA 1VZOA 3HECA 4J1RA 4KB8A 4Y5HA 5M55A 3G51A 1KOAA 4GU9A 2WZJA 3QCXA 3KFAA 5B0XA 4BI2A 3CY3A 4EOLA 1YOLA 1JAMA 3II5A 1PHKA 5CLPA 3A60A 5EDQA 1YI4A 5DC9A 3V5TA 1LUKA 4R77A 3IOPA 3ZCLA 2DCRA 3KY2A 5M4IA 3DXPA 3BE2A 5EOBA 4QTEA 4RG0A 4FVPA 5HX6A 3KRLA 3V5QA 2UZWE 1OI9A 2PE2A 1NZLA 4YJUA 3R7GA 3FI8A 1Y8YA 5CAPA 5HD7A 4ACGA 3AC8A 3WZJA 2R7IA 4U79A 2I7QA 5CVGA 3WZDA 5IF1A 4HYSA 1AD5A 2WXVA 4QP9A 3UNZA 3MWUA 4O0UA 3RTPA 3TNHA 2GS7A 2W4JA 3Q9ZA 2X8IA 4YJPA 4HVIA 1AQ1A 2GS2A 4RWKA 1O4JA 3SRVB 2GNHA 2XNBA 3QKMA 1MRVA 5DLSA 4IWPA 4NYEA 3DLSA 4ZSEA 3JVRA 3ZMMA 2P2HA 1VJYA 3L9NA 3IONA 4Z7GA 5AP5A 2MRKA 3QBNA 1FVTA 2QO7A 2JD5A 5D41A 2EU0A 3OB1B 4AZSA 1LUFA 4L7FA 4RQVA 4RRVA 1WAKA 3PVWA 1LEZA 2JDRA 1NZVA 4W9WA 1XO2B 4K1BA 3RNYA 4UBAA 2FCIA 4XG3A 4ZSAA 5HNBA 4RFYA 3EL7A 5E8ZA 3VVHA 5DC0B 4BGQA 3OEFX 1MP8A 3US4A 2IZSA 5A6NA 3CY2A 3WF6A 3R1QA 3CLYA 4BKYA 1UNLA 4FV8A 4BTMA 5LXMA 2GU8A 3VF9A 4E26A 5CF5A 3GT8A 3TT0A 1SKJA 3TNPC 3LE6A 3UIMA 2WMSA 2BHEA 4QQCA 2BHHA 4BDBA 4XG2A 3DJ5A 1Z3KA 2JIUA 3VS6A 3QD4A 4USDA 4ZMFA 2OZAB 2UVZA 2VTTA 1QPCA 4RJ4A 4YJOA 4EWQA 4G5PA 4J8MA 5J8IA 5JFWA 5CTPA 3F3WA 4F99A 1PXIA 3FWQA 3PDTA 3DZQA 3GCVA 2O64A 2VX0A 4M13A 1O4QA 2ZM4A 1H8FA 3R2YA 1UU7A 4KRDA 5J1VA 1F3MC 2C0OA 2CLXA 5HE0A 4DBNA 3OVVA 4G2FA 3QWJA 1OIRA 3VBVA 2DVJA 3KA0A 4FTTA 4I0TA 4O7LA 5TR6A 4HVHA 4JI9A 5BYZA 4CKJA 2YIQA 2J4ZA 2XNGA 3QZIA 5HG5A 4II5A 3WBLA 1JYUA 4LGHA 3N7YA 1T45A 3ZSHA 4FKTA 2CR4A 4ONAA 4DF3A 2OZAA 4ERWA 3R1SA 3O8UA 4NWFA 2JIIA 4BDFA 3ZONA 3FBVA 4RC4A 3HV4A 4FIIA 2H5KA 3BWJA 1OM1A 2YIWA 4C4FA 3H9FA 3R9HA 3RKBA 3DXQA 5IH5A 3PVGA 1PJKA 2EU9A 2WELA 4FK6A 2Y0AA 3Q32A 4ZK5A 4RPVA 3VJOA 2EXCX 2Z7QA 3BGZA 4TKSA 4HYIA 3C5UA 3Q4CA 4N0SA 3W1FA 2BCJA 2VTOA 2YWPA 4FTIA 1PXNA 3DFCB 5L8JA 3WZUA 5HVYA 5AM7A 3AD5A 1LP4A 3NNVA 2YITA 3ZH8A 4I23A 4KS8A 2CHLA 4MXYA 2PULA 4H39A 3U8WA 2ETZA 3L8VA 4BZNA 5CT7A 5KMMA 4U5JA 2YZAA 4FV5A 5ETAA 2WQBA 4YC8A 1X0NA 2GCDA 3ZDIA 1H01A 4WBBB 4K2RA 5IA2A 3PJCA 4UMPA 2EYVA 1U59A 2ZVAA 4YJRA 2QKWB 2C5YA 2RFEA 2WQNA 1GIHA 5JEBA 4GW8A 4LM5A 3KULA 3LCTA 2Y7JA 4AN2A 2HZNA 1DM2A 2XJ0A 5CAUA 3TZMA 4XZ1A 3R00A 4J98A 3TNWA 2ITNA 3MYGA 1U54A 1OB3A 2XH5A 2X9EA 4FL2A 4LV8A 4YNOA 2OIBA 5EYKA 3UF4A 4MH7A 4JS8A 4WKQA 3C51A 2ITQA 4LYNA 4PQNA 2EYYA 1ZMVA 4YLLA 2UW3A 3MVLA 5JGDA 5HTCA 3NYVA 4L52A 1U5RA 4ZSLA 2H6DA 5AR2A 4BCGA 4B4LA 2IZUA 5M07A 1JYRA 3JS2A 3DK6A 5I9WA 4TT7A 1YDRE 3G6HA 5IQEA 5A54A 3WYYA 3ZSIA 4FTNA 3LJ0A 3RJCA 2GNIA 3ATSA 1LUNA 2V22A 1NXKA 4I5HA 4ALVA 3SHEA 4F63A 4HW7A 3LJ1A 2RVFA 4F4PA 5F95A 4EBVA 4B6LA 4LL5A 1YXTA 2W1ZA 3QRKA 3TKUA 5HNIX 1O49A 3PQZA 4DH5A 3A8WA 4I22A 4FBNA 3NUXA 3MVMA 2R7BA 2REIA 4JDJA 4BTKA 4CFUA 2GHMA 5K4JA 1QL6A 4L53A 3VN9A 4ZS0A 3C5IA 3E7VA 3LXLA 2WMRA 3FJQE 3Q5IA 4IE9A 4UWBA 1SVHA 3C4WA 4YNEA 4MEDA 3NUNA 4LL0A 2EXMA 4MXAA 4XG4A 3R8VA 3ZTXA 4E5WA 3U54A 4DGPA 4DH7A 4YPDA 3PXKA 3TUBA 3DOGA 3ORIA 4CZUA 3MPAA 4FKOA 4K8AA 5ANJA 5B2LA 4JBQA 3VS1A 4IBMA 2RGPA 1H24A 4G9RA 4IEBA 2YABA 3C9WA 4RC2A 1O4IA 5EM6A 3C4FA 3MH0A 4NCTA 5FM2A 4EKKA 3EN4A 5HU3A 4M12A 4F65A 4AZVA 3KREA 2HENA 1OVEA 4R1YA 2VO7A 5GNKA 5I9UA 1TQMA 1KOBA 2QC6A 3KF7A 2PVNA 3TNIA 3GBZA 2FSTX 2CCIA 3HKOA 5GJFA 4F1OA 4CKRA 4EJ7A 3S8OA 4J8NA 3NYOA 4FKGA 3BYMA 2XCKA 3UYOA 4EH8A 5F94A 5FBNC 3ZRKA 3MA6A 3FMNA 4OUCA 4W8EA 5KMOA 4RX9A 3UIUA 2IJMA 4D4RA 5C01A 3DTWA 1M7QA 3ET7A 5K4IA 1BHHA 5AFVA 1STCE 3FMEA 5AP0A 3PSDA 3UP7A 4JBOA 1J91A 5CF6A 5KHXA 1X27A 3E7OA 3GUBA 3R73A 4HGEA 2PMOX 2QR7A 4JAIA 2W1CA 2XJ1A 3W2QA 3ZOSA 4BDIA 2R4BA 2WMXA 3GQIB 3HLLA 2VX1A 4IM2A 5FXQA 4QPSA 4AA4A 1MW4A 1H4LA 2B55A 5T68A 1FGKA 3DU8A 2W1HA 4MNFA 4FVRA 1YVHA 3ZUUA 3KRWA 3VUDA 2ZV2A 3PZEA 3C7QA 3I6UA 2XKDA 3PIZA 1NW1A 2J0MB 4YUQA 3PLFB 5HICA 1UU8A 4D2WA 1O4CA 3WIKA 4XLIA 4DBXA 2XIZA 4OT6A 3NIEA 4HCTA 5D9HA 2ONLA 4W9XA 4Z16A 1PY5A 2YCQA 4UY9A 4YTIA 4ORKA 5DNRA 5AMNA 2W7XA 3H0YA 5AV4A 4IMYA 4DEIA 2EVAA 4X21A 1J7UA 2GSFA 2Y4IC 1R3CA 3R7YA 4X2GA 4QMNA 2FUMA 3KRJA 3DQWA 5ETIA 2R64A 2R3IA 3ZFYA 1KE7A 4ZS4A 3QTWA 5FTGA 5IZFA 2NRYA 4QQ5A 1UUSA 2YDKA 2XEYA 3GU6A 4FTMA 3GQIA 4FC0A 4NCTC 4MXOA 1H28A 5M4CA 3QL8A 2JBOA 1A81A 3RAHA 4N6YA 2W1GA 3AXWA 5BVNA 1GAGA 3ORZA 2BFXA 3SG8A 5DR6A 4DEEA 2W06A 1SPSA 3MBLA 5A14A 4X3FB 5IA4A 2JKKA 4BB4A 4F08A 3ZC6A 3CS9A 5CQUA 3W2RA 3BUOB 3UZRA 1FQ1B 3EFWA 5LVNA 4QMWA 3QD2B 4K45A 4XV9A 3FYJX 2LNXA 2CCHA 1M17A 3PPJA 2XKFA 4EOSA 4H3PA 2OJIA 3DV3A 2WMVA 1R1PA 4GPLB 5AULA 2UZUE 4C62A 4WSYA 3BEAA 4D4SA 1O4BA 3CD8A 2YM3A 1TZEE 4QP8A 1TVOA 1XH8A 3RAIA 1WMKA 3V5JA 3OOMA 4AOIA 4D5HA 3UOHA 1A48A 2I6LA 4TZRA 5LMBA 4OTDA 3BYUA 1Q4LA 2XZSA 3IN8A 2WQOA 1REJA 3O0GA 5AIKA 5DC4A 4CSVA 3LPBA 1MUOA 4XBUA 2YLEA 2G2HA 2XNMA 4XV2A 4E4NA 3FI3A 4UEUA 4X3FA 4QP2A 1RDQE 3ORXA 4G6OA 4IC8A 4HZRA 4DGXA 4IB0A 1H1SA 2ONLC 2UZLA 4G5JA 3WILA 3K5UA 3OT3A 3ZEWA 1OUYA 1O4NA 2IUGA 2XK3A 1FOTA 3VUMA 3UMXA 3BEGA 2XEZA 4U3ZA 1M7NA 4HCVA 4X0MA 4E68A 1YWVA 3PXYA 1M61A 3FYKX 4NSTA 3ZS5A 3TM0A 5E92A 1YXXA 1ZARA 4A06A 1Y1UA 3GC7A 3LVPA 4HPUE 2KTYA 4XCUA 3ODYX 4FSRA 3ZLYA 5IEYA 4WT6A 3ZRMA 1BKXA 2RMXA 4DFXE 2WQMA 5CENA 4CYIA 1OZ1A 1WFCA 4F0GA 3DCVA 3NNUA 2XIYA 4L46A 5A46A 2VD5A 4NW6A 3W2OA 3QA0A 3KK8A 3IQ7A 2JAVA 5CYIA 3C0HA 4ZTSA 4NWGA 5HG9A 3QFVA 4ERKA 2R2PA 3N4TA 1RW8A 5DVRA 1OPLA 3PJ3A 3BQCA 2UW5A 3HV6A 4YLKA 4C4EA 2VTRA 3S2PA 4GK2A 2WNTA 4N4SA 4CG8A 1H1RA 1IEPA 4IHPA 4E4LA 5FDPA 4RIXB 5L6PA 2WTCA 3F6XA 1V0OA 3IW6A 4OGRA 1W7HA 4TNBA 5CNOA 3ZZEA 1F5QA 4AF3A 3NZ0A 4OAUC 4GU6A 2XA4A 3VGOA 3AMBA 2BRGA 1Q62A 4DA5A 4XBRA 5CEQA 1HCTB 3V04A 2BILB 3MVJA 3O17A 1XH7A 2OI4X 2WMUA 4FSNA 4DEGA 1LKKA 2J0KA 2ACXA 4WBOA 4F1TA 1XKKA 3W8QA 3C4ZA 4E6QA 4O1OA 2BFYA 2RKUA 3Q4UA 4PPAA 5CS6A 2F49A 2PVMA 2PVKA 3LFBA 4EOMA 2WMWA 4BDCA 3BUMB 4GEOA 4NTSA 5BMMA 5KZIA 4X3JA 4CRLA 4X3FC 3GCUA 4IZAA 4DHFA 3QTQA 4DFNA 3D15A 4FR4A 1IJRA 2C1AA 4QMLA 2QOLA 1OO3A 3GOKA 3AC3A 3DBCA 4RIXA 5M08A 5B2KA 3V8WA 3RGFA 1XR1A 4B0GA 4X2KA 1V0BA 4E7WA 4AS0A 3HYHA 3BBTB 3SLSA 1AYCA 1V1KA 4NK9A 4MVFA 4BL1A 5A9UA 2C6KA 3BWFA 3H30A 5I9ZA 5IBSA 2F7XE 3KQ7A 2AOAA 5L6OA 2QODA 5EK7A 3RCDA 5AUTA 3R9NA 4C57A 4ZEGA 4QMXA 3VO3A 3R7UA 1V0PA 2ITUA 3HAMA 3WF7A 3IPHA 1IA9A 4BDJA 1OIQA 2XYNA 3LFNA 3VAPA 1OL7A 4D2VA 3UG2A 4IX3A 3TNQB 2X6DA 2VWZA 5IDNA 3IO7A 3EQGA 1SHBA 2YA9A 3RWPA 1W84A 5T6KA 4I93A 4OBQA 4NIFB 2BDJA 5EELA 1GJOA 2V5QA 3OXIA 4F64A 3D7ZA 3S3IA 2UW9A 5IA5A 2C69A 4RIYB 1SHAA 1Q3WA 2R3KA 2XJ2A 4PMTA 4R3PA 4PL5A 3MJ2A 1YDTE 4ARKA 2HZIA 3BELA 4IXPA 5K0KA 4E1ZA 5LVOA 2YIXA 1IS0A 5HLPA 3N84A 4F5BA 4Y72A 3A7JA 3D94A 4DCEA 4Z9LA 3DAKA 5BVKA 5FXSA 1O4MA 5GJGA 3ZU7A 3RINA 4AW1A 4H1MA 2ERKA 2CGXA 2OW3A 4R5SA 1BLXA 3LLTA 3NNWA 5HCZA 4IADA 3OW4A 3EHAA 5DT0A 4CFFA 5DPVA 2W4OA 2OWBA 4RWLA 3TKZA 3EFKA 4WNOA 2XIRA 1PXJA 4JOAA 4FZDB 2CNQA 1SVGA 4DTBA 1UNGA 2ZV9A 4E93A 1YXUA 2WD1A 4PTGA 4B7TA 2DYLA 1JBPE 1PYEA 2PVYA 3LZBA 3OP0A 1F2FA 3FZSA 4KA3A 3F66A 2J90A 3EAZA 5AADA 4C38A 2V55A 3PA3A 4DH8A 5EKNA 2QOHA 4FNYA 3QZGA 2Q0BA 3VBWA 4GKHA 3I1AA 2WAJA 4IAFA 1X6CA 4MF1A 4ZTRA 4I92A 2VWYA 4DTKA 4DG0E 4FT5A 3O23A 2J9MA 4D4YA 4MD7E 4WO5A 1PW2A 4FKIA 3ALOA 3VIDA 4DGGA 3ZXTA 2YJRA 2PUPA 4JX7A 2GTNA 4N6ZA 4PMMA 3WZKA 4EWHA 2BR1A 1APME 3REPA 5EG3B 3NCGA 3AMAA 3ZUTA 4I21A 3E8DA 4TRLA 3VNTA 4NJ3A 4RVMA 4AZEA 4FNWA 3ZM4A 4C59A 4CT2A 1D4TA 5AR3A 2B9JA 4LG4A 3IW4A 3HCKA 1JYQA 1GY3A 2GNLA 2PMLX 4IWOA 4QMZA 3IECA 4DINA 4V05A 3DLZA 3T04A 3EH9A 5F20A 1O48A 2OFVA 4I5PA 3G6GA 4AFEA 4GCJA 3QQLA 3PZHA 5L6WL 3EMGA 1PF8A 2HXQA 3FC1X 3D7TB 3GXLA 1UVRA 3R7VA 3T3UA 3PPKA 4I0SA 2EXEA 4I6HA 4EOJA 4L42A 4D1XA 1O4HA 2K7AB 3G0EA 3H4JA 2XK8A 5EDRA 5L8KA 1WBVA 2W05A 3HRFA 4MK0A 3QLGA 4RJ7A 4G3EA 3ZEPA 2W0JA 2R3HA 2YEXA 1BKMA 4O81A 2YM4A 1PMEA 2JBPA 2W9ZB 1ZY5A 5EG3A 3FL5A 4O0SA 3F88A 5GZAA 2VNWA 1PMUA 3O8TA 5DR2A 1I09A 4ZTNA 4YSJA 5FP6A 3GU4A 1YWRA 5I5ZA 2VO0A 4EHGA 2A4LA 4AW0A 4QMTA 3F3TA 4RJ3A 3KB7A 4AOJA 3BV3A 4QYGA 5IBMA 2L6KA 2QO9A 3QTUA 2QOBA 1JKLA 4APCA 3IS5A 4CZTA 1ZYCA 2J5FA 2CNVA 5EI2A 2HW7A 4KBCA 2B4SB 4HVSA 3UO4A 2C5VA 4FTCA 5KMNA 3D2IA 3UGCA 5JZNA 1OKWA 3QZHA 1KC2A 2I0VA 4F1MA 1OL5A 4YMJA 2YACA 5HD4A 1H0VA 3FHIA 5H2UA 4E3CA 4RQKA 4Y95A 4BWPA 5CSHA 4USFA 2UZTA 1JPAA 3G90X 1H1QA 1R1SA 3QTRA 4IM3A 4CEGA 3VJNA 3ETAA 5ICPA 1O6KA 2JFMA 2PMNX 5AP1A 4RJ8A 5AP7A 3V5LA 4BCKA 4BCPA 4BWXA 3HMNA 3SD0A 4A9RA 1ZOGA 4O22A 4ANBA 1O46A 2R9SA 3NRMA 3DBDA 4AQCA 2AOBA 2UV2A 5A4QA 3ORNA 1KE9A 5TO8A 1PKGA 5GZ8A 4FSTA 2UZOA 4OLIA 3RALA 1Y91A 2BZJA 3PLSA 4MXCA 4O0RA 4ASDA 3GNIB 4C2WA 5C26A 5M57A 5J87A 3R22A 1GHUA 4G31A 1CWDL 4F70A 4FSUA 5I9VA 3P78A 4RLLA 5I0BA 4R7BA 5FRIA 4AOTA 5G1XA 5HG7A 2H46E 2YLFA 3D0EA 4D4VA 3UC3A 5CU2A 3UC4A 3UOLA 5IDPA 2WQEA 3SVVA 4J97A 4BGGA 4ACCA 4YJNA 4APPA 5FTOA 4R3RA 3TCPA 4DAWA 1RJBA 5CAOA 4JG7A 4DFLA 4TL0A 5IISA 4AG8A 4GIIA 3NS9A 1OL6A 4O0VA 1GZKA 1BFJA 3OB2B 4BKZA 4R3CA 4H3QA 3NUPA 4Q5HA 1Q24A 4JIAA 3M42A 3ZRLA 1TQPA 3AD6A 3QXPA 4J52A 5HE3A 2OQ1A 3DNDA 4KIOA 2HOGA 1WVWA 4KUJA 5IQBA 4JQ8A 4GYIA 3LQ5A 2Z60A 1ZWSA 3WZEA 4C4HA 3DTCA 4C35A 2LGCA 2H9VA 1CKIA 3GI3A 3BZ3A 3FZRA 4JG6A 3EQPA 5DT3A 5AV3A 4ZLYA 4O1PA 2VN9A 5DI1A 3LMHA 4IW0A 5CXHA 4BWKA 2CKOA 4O7SA 3UPXA 5FQDC 3K3JA 1Q8ZA 1ZYDA 4AAAA 2PUNA 3CTJA 4QP3A 5LMKC 3OD6X 2FSOX 1TQIA 5IG1A 4JAJA 2QOKA 3N51A 3Q6UA 3TACA 4F7JA 3R04A 1E9HA 2GHLA 4OT5A 4RA5A 4U97A 4YBJA 5E8VA 1ZMWA 3R9OA 3WI6A 2E9OA 2OF4A 4IAAA 1UWJA 1R1QA 4M67A 3RM6A 3K3IA 5KHWA 5HO6A 5EI8A 4FMQA 4WUAA 5D10A 4E5AX 2OF2A 3PY1A 2IO6A 4EOKA 2XCHA 4FEUA 2Y1NA 5EQEA 3HMOA 1A1BA 2G15A 1JSUA 2XK9A 4JQ7A 3UO6A 5HKMA 4ANOA 4CFXA 4EQUA 2DQ7X 3D9VA 3MIYA 2W1DA 4UWCA 2EB2A 2W9FB 2WTKC 4LI5A 5CANA 2O65A 3I7BA 2RF9A 5KBQA 4EHEA 3VRYA 1VYWA 2YCFA 3HZTA 3LOKA 4MCVA 4DE4A 2HELA 4NUSA 3CE3A 1P4OA 5KBRA 3EZVA 5DHJA 3VULA 5LWNA 4GG5A 2DUVA 1H25A 4FK3A 5M4FA 1O4AA 2A19B 3ACKA 3VF8A 4QP7A 4C61A 4LFIA 4XMOA 4V0GB 1AYBA 5IH6A 3E8NA 4HNFA 3DBFA 5EH0A 5HOAA 3LXPA 4YGAA 3ROYA 4Z7HA 5HO7A 3EQDA 5KKRB 2OH0E 3HEGA 4F7LA 1PXLA 1YWNA 3TV6A 2PL0A 4Y83A 5D1JA 3BYVA 5AX3A 1Y6BA 4W4XA 3WF8A 4CLJA 1Q8YA 3MB7A 4TYHB 4EK8A 1AYDA 1W0XC 3QUDA 5H3QA 4FT9A 2G2IA 1WBOA 2RL5A 2EO6A 2PY3A 4GT3A 2FB8A 3MPMA 4ENYA 1BX6A 4Y73A 4EI4A 2DLYA 1M2RA 2VWXA 4PDPA 3M1SA 1GIJA 2ZDUA 4QYEA 4WRSA 4M3QA 1O4EA 4OTRA 5E90A 3KCKA 4L43A 4ZY4A 5JKGA 5L2TA 4AT5A 5CEKA 4O0YA 3B2TA 5D7AA 3R01A 4FTAA 4S32A 2ITTA 3RK7A 5J1WA 4WG3A 2QCSA 4KBAA 5KO1A 3SRVA 3AG9A 3NNXA 2V0DA 5E1SA 4BHZA 3SOAA 1O4FA 3MTFA 5A4CA 1R1WA 3PA5A 5DRBA 3RPYA 4WG5A 3NUAA 4FEWA 3RHKA 4GYGA 4AT3A 4C4JA 4U8ZA 4V04A 3FKOA 3LM5A 4RIOA 3PFVA 2XUUA 3WE8A 2WIPA 2IVUA 4NT4A 4TXCA 3JPVA 3KXGA 1T46A 3DB6A 4TYIA 3HL7A 4YURA 1FHSA 3S00A 2JC6A 2J0JA 3PWDA 5HHWA 2UZEA 2PVLA 3QALE 2VTNA 2LQNA 5FBOA 3PSCA 5I9XA 3RK5A 3NSZA 3CQEA 3R8LA 4M14A 2QOFA 3PPZA 2BAQA 3NGAA 4FT0A 4HGTA 4O0WA 5D12A 3VHKA 4JE4A 3F5GA 1NVSA 2HWPA 3OP5A 2WMTA 4FIEA 3TJDA 4RZVA 2VO3A 1LUIA 2WMBA 3AT3A 4D0WA 5IQHA 4K6ZA 4GFOA 1CM8A 1VEBA 3KEXA 4H3BA 3R71A 5ANGA 4UYNA 1S9IA 3FMJA 4FSZA 4WA9A 1Z57A 2QNJA 4FSYA 4J95A 5CAQA 4MXZA 4I3ZA 3ZUVA 3FLZA 3NYNA 1OIUA 2B9FA 2VAGA 2YCSA 4QP4A 2BZHB 5AR5A 1YOMA 3OUKA 4QT1A 3OS3A 5BYYA 4BC6A 1TKIA 2CMWA 4CKIA 1DAYA 1HOWA 2W17A 1CDKA 3QTZA 1H00A 2WKMA 3VS2A 4EOOA 5IQDA 2QLUA 3UG1A 3VS4A 3DZOA 3MN3A 5HIBA 4BTJA 4KAOA 1IA8A 5BNJA 3CXWA 4CV8A 4LOQA 3P23A 2BRMA 4IB1A 2ZV8A 5KKRC 4QTCA 4CT1A 2BDWA 3ORKA 4V01A 5DE2A 2P0CA 1BFIA 3IW7A 2WO6A 3G9LX 4QD6A 3NW5A 5CWZA 2PNAA 2UW4A 1ZMUA 3PXFA 3QC9A 1ZZLA 2CN5A 4UYAA 2ITPA 2QKRA 4IAYA 4DYMA 1QCFA 3HAVA 3SXRA 1UWHA 3QD0A 3ID6C 4O83A 4FVQA 2UW6A 2C5XA 5HKWA 3MTLA 1PXPA 3VQHA 3R83A 1ZFPE 3OG7A 5B7VA 1Y57A 4G17A 4D2PA 3AC5A 3PG3A 1OL2A 1XH9A 3K2LA 3ZFMA 4MWIA 3ORPA 5IMEA 1H07A 3S8NA 1R39A 4FZ7A 4H34A 2JEDA 4IIRA 4GSBA 5ANEA 4BCHA 3R63A 3FEGA 3EQBA 5JGBA 5EW3A 4GS6A 4WNMA 3GEQA 4AWIA 2BTSA 2EYZA 4IX6A 3M2WA 3OWJA 4GUBA 1O9UA 4XZ0A 2HYYA 4U17A 4UALA 2OIQA 2XF0A 4L7SA 2W1IA 3O50A 1FBNA 4UWYA 4UV0A 4FV6A 4QTBA 2OLCA 5C1QB 5KMKA 1NRVA 4UMRA 3F5XA 5AA9A 3IDPA 4HPTE 2VGOA 5BX0A 2RFNA 3EQFA 3OY3A 4PMPA 4FV7A 2IPXA 1A1AA 4GUEA 2BDFA 1RE8A 2P33A 3DJ6A 4GKIA 4AGWA 2VWIA 3BV2A 3KMMA 3VQUA 2C6MA 3WOWA 3KU2A 5J79A 2YU7A 2A2AA 4RFMA 2CN8A 2IG7A 2CS0A 3DKOA 5TT7A 2WB8A 4CG9A 3QX4A 3EN9A 4EHVA 4CTCA 3OROA 1XH5A 4K44A 4NM7A 5CAVA 1R0EA 5AUUA 1U46A 1OPJA 4PL4A 4QMMA 2HK5A 3QGYA 3LFEA 1J3HA 1IRKA 3MY0A 1H08A 4GV1A 4QPAA 4YBKA 3T8OA 4YTCA 4QMOA 3EN6A 1XJDA 1O42A 4O2PA 4YZ9A 2VTMA 2W5BA 4Q5EA 4M4ZA 4FI1A 2PZ5A 4DFBA 3OWLA 3PA4A 2B7AA 4FOCA 3R1NA 1AGWA 3QHWA 3TZ9A 2Y1MA 4JR3A 4BCJA 4XV1A 4YR8A 3OVEA 3TJCA 3SA0A 4XX9A 2NO3A 3A99A 5ETCA 3SGCA 4L3LA 5CSXA 5CEIA 4AE9A 3VRNA 4PMSA 2WOUA 3WF5A 5DGZA 3TEIA 5AA8A 4ZSJA 3W55A 4QMYA 4RFZA 3SQQA 4OTIA 2YAKA 3P86A 4UMUA 4ZJIA 1PYXA 2PHKA 4C4IA 1R0PA 1W83A 5C4KA 4UZDA 2A0CX 2BROA 3O2MA 3W2SA 1SNXA 1Z9XA 3CIKA 3VUIA 3ZO2A 5JQ5A 2GQSA 2C5NA 2ITVA 3F3VA 3Q9XA 4EOPA 5EHRA 1QPDA 5F1ZA 4U40A 3SV0A 4ZZNA 4RX7A 3VUTA 3KMUA 1GZNA 4PDSA 4OBPA 2J2IB 5EM8A 4F09A 4XJ0A 3L8SA 3H9OA 4IZ7A 1U5QA 2BRBA 2ZOQA 3IGOA 5A3XA 1FU5A 2GQGA 5LMAA 4O7VA 2IW9A 2ITXA 3RHXA 3B8RA 4D9TA 1K3AA 2MQIA 3QUPA 4BZDA 4DFUA 2H96A 2HZ4A 4OBOA 3EQIA 4BFMA 3CQWA 1OO4A 4NM0A 4D1SA 2DS1A 4LGDA 2MRJA 4EH7A 3ZYAA 3I60A 3JUHA 2WTWA 3ORTA 3EIDA 5AV0A 4U1PA 5FEQA 2GTMA 4O7TA 1WVYA 3Q04A 3W2PA 5EDPA 5AAEA 4X2NA 5H9BA 3GCQA 5CU3A 3IN7A 1Q41A 4IB3A 4TW9A 5LVMA 2Z02A 2HMHA 2RFSA 3NIZA 1WCCA 1Q5KA 2X2MA 3KXMA 2IW6A 5LVLA 2UVYA 4IVDA 3VS7A 3A8XA 2LAVA 3MXYA 2CIAA 2PVHA 3T9TA 1KSWA 2C6EA 3HMPA 5LARA 3LQ8A 4DT8A 3ZNIA 4MYGA 3I6WA 5GJIA 4L6QA 4QMVA 3M7FA 2OZOA 4P9VA 2VX3A 3R2BA 4LOOA 4FKQA 3QUEA 3FUPA 3HUBA 3R0TA 2X7FA 3D5XA 2O3PA 3KKVA 3F3UA 4KIPA 2J50A 4ZOGA 4TTHB 4HOKA 4AXAA 3UIXA 3Q53A 5JT2A 3QCYA 3QF9A 3C4EA 3BHVA 5FXRA 5JZJA 3V51A 4EORA 3POZA 3GENA 5GJDA 2X6EA 4DLJA 1B6CB 2QO2A 2XKEA 2AUGA 3CPBA 4FEQA 4QP6A 4YPSA 4CLIA 4M69B 4NWMA 4F9WA 4NW5A 4RBLA 2IW8A 5FD2A 2OXXA 2XM9A 2P3GX 3QTIA 5ANIA 4PL3A 4PPCA 4BCQA 3R8MA 5BVOA 3NWWA 2XK6A 3VBYA 5J9YA 3POOA 2R3NA 4FUXA 1L8TA 4FKSA 3CGOA 1IAHA 4Y46A 4RGJA 4YO6A 5C4LA 2YIRA 3MSSA 2LCTA 4A9TA 3MH2A 3QRJA 1OKVA 1YHWA 2C3JA 3QU0A 2X7OA 4DITA 1B47A 4TN6A 3Q2MA 3A62A 1CSNA 3ELJA 4JLCA 1F1WA 1KV2A 3HVCA 4CV9A 4CNHA 2XYUA 3LXKA 4GFMA 5KNJA 4WNKA 3LFCA 4UMQA 4YZNA 3PXQA 2E9PA 3COIA 4AU8A 3PSBA 2CBLA 1XBCA 3G2FA 3L9PA 4GK3A 5AM6A 5EYMA 3VW8A 5M44A 3VHEA 1FYRA 2CJMA 1H26A 2F9GA 4ZSGA 5HCYA 1O43A 5J7HA 2YCRA 1SHDA 3GXXA 4QQJA 1FINA 4M69A 4EJNA 5CEMA 4BIBA 3EFLA 4FOBA 4I20A 4QMUA 4FKUA 4K11A 2JKMA 3U4WA 4EUUA 2O63A 4USEA 1KE5A 2UW7A 3PWYA 5JGAA 2MC1A 3SC1A 4AE6A 3BGQA 3MI9A 4BDHA 3R30A 1BI8A 4J7BA 1PXMA 2E9UA 4H05A 3DA6A 2C4GA 3F5UA 4WWQA 3FI4A 3MVHA 3F2RA 4F0IA 1MILA 1M14A 2WPAA 3DBQA 3OW3A 3N9XA 3DK3A 4GJ2A 3P1AA 5C8NA 2W96B 4L01A 4PPBA 3TZ8A 3MW1A 4ASZA 5KUPA 2OJFE 4CYJA 4EH9A 2OIDA 2MK2A 4DLIA 3JXWA 4ZAUA 2GPHA 5EEQA 4AUAA 1CSYA 4L45A 3PVUA 4MD8E 4YTHA 2EB3A 3TTIA 1ZZ2A 3QRUA 4WOVA 1VYZA 3FLQA 4C3RA 2B52A 2O0UA 1BMKA 2R3JA 4YZDA 1LCJA 4EH5A 4OHHA 3TN8A 1OL1A 2VIFA 3FZPA 1BKLA 2VWWA 4RA4A 2IZTA 4ZLZA 2F7ZE 1F0QA 5C27A 4JL9A 4O0XA 4CD0A 4UMTA 3ZXZA 4CGAA 4YP8A 4E5BA 3AC1A 4LRKA 5CSPA 4GIHA 5TF9A 3UE4A 4PTCA 3MFTA 4A07A 2F2UA 4HGSA 3K2MA 4ITIA 2X4ZA 1MRUA 1WBTA 3PIXA 4AZFA 3ZBFA 3N4UA 4FYNA 4CMUA 2P55A 5AR7A 4I94A 4DN5A 2V62A 4KSPA 5LWMA 3VWAA 2OSCA 3O7LB 2C6IA 3FDNA 5HIDA 4OHEA 5CDWA 3QGWA 4F7SA 2EO3A 2C68A 1YVJA 1NT2A 3IMDA 4FKWA 3EQHA 2YWVA 2CPKE 3EYGA 3IW5A 1OUKA 3JY0A 4C37A 5IQGA 3A7IA 3EB0A 1KA7A 2HXLA 2C0IA 5FGKA 3EACA 4X6SA 4QMPA 1ZXEA 3G9NA 1FVVA 3MIAA 4EZ3A 3HDNA 5M06A 1RJAA 3U6HA 3D5VA 3S4QA 2R3LA 4OTGA 4LGGA 4HYHA 2C30A 2Z7RA 2XMYA 4DH3A 2RORA 2ETRA 4HZSA 2LNWA 1M52A 3HV7A 3TV4A 4E6AA 1DAWA 2ZDTA 3FLWA 3UPZA 1ZOEA 2CKEA 1ZYJA 4U41A 5I4NA 5LVPA 3KXZA 3OCBA 1L3RE 3QKLA 4WIHA 1K9AA 2BMCA 3QQGA 4XV3A 2PMIA 4R5YA 3EKNA 4L3PA 4YHJA 5AR8A 5C03A 2PK9A 1LKLA 1UNHA 1OECA 3A7GA 2RIOA 3U9NA 4NU1A 4C36A 5L4QA 4RVKA 3ULZA 2X9FA 4ZTLA 1O6LA 4DGMA 2XK7A 3OTVA 4M97A 3KVWA 1JQHA 4EH3A 3UNKA 1SZMA 4XHKB 2C9WA 4L8MA 4NIFA 5CVFA 3TDWA 5HBEA 4EH6A 4QNAA 2QLQA 4BBFA 2R0UA 2X7GA 3GQLA 1JKKA 4PTEA 4ZP5A 4QSYA 3H3CA 3PY3A 3DPKA 4RIYA 4YZMA 2VZ6A 3CD3A 3Q9YA 4ITJA 2XS0A 4HCUA 1URCA 3CKXA 4XUFA 3RZBA 4AW2A 1YOJA 3LFQA 5M4UA 5M56A 5I6VA 3FAAA 2C0TA 3QKKA 4FEVA 4O7RA 3DY7A 5HBHA 4JR7A 3K5VA 4O27B 3BUNB 1H1WA 3BYSA 2X0GA 4XP0A 4AA0A 5I3RA 1FU6A 4BCNA 4U45A 4ZJJA 2J0IA 5IUHA 1TCEA 3H0ZA 4I24A 3S95A 4IJPA 3OUNB 3FMMA 2YM8A 3GFWA 4FT3A 3UYTA 4ALWA 4YU2A 5EKOA 5LJJA 2BKZA 3SAYA 3S8LA 3O8PA 2XNEA 3A4PA 2JGZA 3UVRA 2H34A 2ZB1A 4IM0A 4G3GA 4YJTA 4L9IA 2C6DA 3QTXA 1J7LA 1UKHA 2NP8A 1O4LA 3E3PA 3ZO4A 5A4LA 3A61A 4CFWA 1Q97A 4ZIMA 4XRLA 2ZYBA 3OZ6A 4RVLA 1O4PA 4RIWB 3OC1A 5KMIA 1GZOA 2W5AA 2YISA 3KCFA 5HE1A 3ZSGA 1O45A 5HKYA 1M2PA 1OIYA 4ANLA 2X2LA 2PZPA 2VO6A 4EHZA 4DTAA 4HVDA 3AMYA 3ANQA 4KKHA 5FEEA 4G3DA 4KNBA 2PE1A 1J7IA 1FMKA 3NUUA 2GFCA 3EZRA 5GIOE 4ZZOA 4F5AA 4GL9E 4BGHA 2GS6A 3FLSA 4BI1A 3W33A 2AC5A 2UZVA 2VTIA 4QO9A 3VUKA 3COMA 4RX8A 5IMXA 3P7AA 4P4CA 2R3OA 3E8EA 4PDYA 4XEYA 3RAWA 4BN1A 3ZO1A 5E1EA 4Z55A 4EL9A 4CFVA 2Y9QA 4ITHA 4MQ1A 2Y6OA 4FX3A 3E88A 4RIWA 5CEPA 3VROA 1XA6A 2AYPA 3FLNC 3H9RA 4IFCA 3R1YA 3CSVA 4YZCA 5AEPA 1R78A 2J6MA 4IDVA 5TE0A 3D7TA 3RAKA 4DCAA 1ZYLA 4ID7A 1Q8TA 4MNEB 4F6UA 4U42A 5HORA 2GDOA 3DBEA 2BZKB 3BBWA 3TV7A 2PVJA 2Q0NA 2YDJA 3RVGA 5HEZA 5E9EA 3RZFA 3RCJA 1JLUE 5LOHA 5IPJA 4BBEA 5CALA 1ZOHA 4RLKA 5HVKA 5EFQA 4UZHA 1KE6A 3NAXA 4D58A 1U4DA 3ACJA 3NW7A 3D5WA 4H1JA 5DEWA 3R02A 1JNKA 1W82A 4UXLA 4DC2A 3FPMA 3W18A 1A1EA 2JDVA 1KWPA 2YHVA 3L1SA 3Q3BA 4WNPA 4BKJA 2PUIA 2DLZA 4JGHA 4S31A 5KZ0A 2IZVA 2BPMA 4S30A 4KIKB 4FKLA 4AACA 3CTHA 3FI2A 4IVBA 3I7CA 1P14A 3KXHA 3OY1A 3C1XA 4M15A 3KGAA 2YAAA 4H1OA 4WD5A 4QTAA 2BBUA 4P90A 4Y5QA 4FTQA 4FZ6A 4TYJA 4AT4A 2PTKA 4O2ZA 2HDXA 1O44A 2GQRA 4FTJA 4MHAA 2ZMDA 4IX5A 4D8KA 4LRJA 5F9EA 3VRQA 4OTFA 3OFMA 4FT7A 4MBIA 4K77A 4WHZA 2O5KA 1JU5A 3VBXA 4ASXA 2C3LA 4GJ3A 1S9JA 4IWQA 5HG8A 3NAYA 2W5HA 2JDOA 3ALNA 3BLHA 3RPOA 4ZY5A 2KK6A 4AGCA 3PUPA 3DQXA 4B8MA 1E1XA 1NA7A 5HU9A 2H8HA 3HX4A 4IFGA 3KFJA 5KX8A 4FTKA 4M66A 4AN3A 2J51A 1D1ZA 4TYEA 3ZC5A 3K54A 4I4FA 3SG9A 4D1ZA 1YKRA 3TKIA 2YZLA 4FEXA 4TZIA 2WTIA 5HLNA 3V3VA 5AV1A 2VTJA 4FIJA 2QU5A 2CKPA 3R7IA 2KNOA 3NPCA 4FKRA 4R7HA 4G9CA 4YC6A 4O7YA 5EQPA 5HKZA 3UNJA 2QMSA 2WTVA 1QADA 4CXAA 4MBLA 5GZ9A 5FEDA 2PU8A 2PPQA 5BYLA 3I5ZA 1RPYA 1MQBA 3FMDA 5DOSA 3U4UA 3MGYA 4FZFB 3KXXA 3QC4A 3N4VA 4FTUA 4YZBA 5HTIA 5AXIA 3ORMA 4W4YA 3C50A 3FHRA 4MAOA 2C1BA 3TG1A 3UP2A 5I9YA 5JFSA 4L67A 3G33A 4O7NA 2EWAA 3R8UA 4A4CA 1Q99A 2XKCA 5IUGA 3OT8A 3DDPA 3PP0A 4PV0A 3GGFA 3QCSA 4FICA 2PZRA 4FIGA 4AGUA 1WBPA 2QONA 5ITAA 3MY5A 3QRIA 4M84A 4NJDA 5EM5A 3UOJA 3V6RA 4XOYA 3BCEA 4ZTQA 4UN0C 4B9DA 4AZTA 2PUUA 3FQSA 3FMKA 4L1BB 1WBSA 4RWJA 1P2AA 4D5KA 3UO5A 1CSZA 5DR9A 2HW6A 3DKFA 1NY3A 3FZTA 4DEDA 2WFYA 5BO4A 3C0IA 4FF8A 2GFSA 4JG8A 5IQCA 1CWEA 4J53A 4U3YA 3ZBXA 3SDJA 2UZNA 4X6RA 3BE9A 5BPYA 1P4FA 3SW7A 3BPRA 5AIRA 3MXCA 3ZDUA 2HAKA 1YXVA 2EOBA 3BU6A 5AUXA 2RG6A 5DRDA 4FTOA 5EHLA 3WE4A 3VRPA 1YRPA 2FA2A 1YDSE 2FSMX 2PSQA 2IVSA 2X2KA 3HMIA 3KXNA 4QMSA 5AV2A 3UMWA 4O7WA 3PP1A 2ZMCA 3DKGA 2C3KA 4IZ5A 1XBAA 3VRRA 3Q5ZA 3SX9A 2FGIA 3EQRA 1CMKE 1JVPP 5DYJA 2G9XA 5D0JA 3HIZB 1OPKA 4JJRA 2OICA 2RSVA 4YC3A 4OTPA 5CZIA 2B0QA 2W1FA 2BRNA 5E8SA 2XRUA 5L2QA 2R3MA 2I0YA 3DDQA 4FV0A 3NUYA 4D0XA 4BIEA 3CEKA 1O4GA 2YM5A 5K9IA 1HCKA 3BYOA 4FV3A 3KVXA 1H27A 2FVDA 4EONA 3CBLA 2BKKA 1JSVA 4G34A 3CCNA 4F0FA 4IACA 4W8DA 5BVFA 1ZY4A 5AP6A 3CPCA 2YSXA 4KD1A 4ACMA 5BVDA 3ITZA 3QQHA 4YJQA 5DIAA 4C2VA 1G3NA 3FC2A 2QG7A 4PNKA 5L3AA 5FUTA 3RM7A 2ITOA 3DAJA 3I0OA 3BHHA 5HVJA 5EHPA 4DFZE 1LUMA 2GNGA 2R5TA 5CY3A 2IUHA 1SVEA 3LMIA 2L4KA 1GIIA 4PX6A 3R8ZA 3LCDA 4V0GA 3A7FA 4LUEA 3S9KA 4OAVB 2GSBA 4A4XA 3BHYA 1IAJA 4NEUA 4BTFA 4G3FA 4I6QA 1BI7A 2B54A 5CF4A 4FGRA 3E5AA 3QWXX 3OWPA 3Q60A 3AD4A 4IH8A 3R7OA 2VU3A 3OCGA 3ENMA 4KBKA 5AAGA 3GP0A 2QOQA 2JLDA 3LM0A 4BHNA 1KV1A 3QAME 4TYHA 1PMVA 4CQGA 3LIJA 1W8CA 3Q6WA 3V5PA 1M27A 3TXOA 4DG2E 4CCBA 4GK4A 1HCLA 3HUCA 4Z3VA 2OJGA 1XH6A 5J9LA 2HY0A 4M0YA 1Q8WA 3C13A 4O7ZA 2UW0A 2BALA 3IG7A 4E6DA 5HX8A 1HCSB 1O4KA 3UJGA 2CI8A 4FV9A 5E8XA 5ACKA 5IA3A 1UV5A 4AFJA 2PE0A 3MAZA 4BDKA 1KUTA 4E6CA 5JRSA 3COKA 3KRXA 2ERZE 3GC0A 3Q4ZA 3SXSA 5K5NA 1KA6A 1NVQA 4ACHA 3HA6A 5HESA 3LFDA 3QA8A 3FPQA 3D2KA 2L3TA 1XWSA 3LKMA 2YM7A 3RI1A 3ZM9A 5M51A 3GXWA 4HNIA 5GINE 2I0HA 4UB7A 3BRBA 3SW4A 1O47A 2BZIB 3HMMA 4DGLC 3O96A 1PMNA 3EOCA 4Y85A 3OWKA 4E4XA 3JYAA 4EH2A 3O7LD 3NHNA 1Q3DA 3L8XA 3OTUA 3WYXA 4GL9A 4EEVA 1XQZA 5TOZA 3GC8A 5B2MA 2HUWA 4O96A 4BCOA 3P5KA 1K2PA 4TWCA 5EQYA 4AP7A 5G6VA 1PXKA 1X8BA 3M11A 1KE8A 2WGJA 4GT5A 3MPTA 2AC3A 5CI7A 1RQQA 4UXQA 5CX9A 3W16A 4BY9E 3C7IA 1Q8UA 3FE3A 5C9CA 2A27A 3P7BA 2VV9A 3DK7A 2QURA 3OBGA 4MBJA 3QTSA 4BCFA 5AUWA 2Y3AB 4OHIA 5HTBA 1XHAA 2OXDA 2WEIA 4G1WA 2X4FA 2ETMA 3KULB 3RPVA 3AC2A 4NKSA 2IUIA 2K79B 2BIKB 3ZLWA 3VUGA 1FBZA 1QG1E 1PRYA 3PFQA 5F4NA 2Y4PA 4EH4A 4ZZMA 3R28A 2IZRA 2CSNA 4F6SA 4NTTA 3U55A 1U54B 5LCJA 4ANNA 4P2KA 3VS0A 3QWYA 3F2AA 2G01A 3LMGA 3OMVA 3QX2A 4EQCA 4AZWA 4BDDA 3NCZA 4D2RA 4AA5A 2YIYA 4JDKA 5AWMA 3P79A 4RWIA 4XNEA 1BUHA 5AP4A 4U80A 3KK9A 3D4QA 5AP3A 3UQGA 3RPRA 3DNEA 5IEXA 4OHLA 3GOPA 1H1PA 1O4DA 5CVHA 4A7CA 5TKDA 3AT2A 4JXFA 4C0TA 3CC6A 4TWOA 3HV3A 4N70A 3OXZA 4U0IA 5J3XA 5AUVA 3BUWB 3TKHA 3AGMA 5AUZA 4A9SA 5ETFA 4KWPA 3W10A 3ODZX 3V8SA 4TY1A 4I5CA 1P5EA 4G3CA 4BR3A 4O38A 4IX4A 4ANSA 1G5SA 2HY81 2G2FA 4MF0A 2ESMA 5BUIA 2QI8A 1LR4A 1AB2A 3MFUA 4U44A 3FZOA 4OTWA 3LFSA 5GIPE 2CRHA 2UVXA 1A06A 3AOXA 3FSKA 3LQ3A 3DXNA 2XBAA 1VR2A 3HDMA 4I1ZA 3UQFA 5HLWA 2Y6MA 5EI6A 1DS5A 4MKCA 5IUIA 4D28A 2Y4IB 5HCXA 3NR9A 5DFPA 2NNWB 3A4OX 2WU6A 4QRCA 1SNUA 4NZWB 1CJ1A 2A1AB 3B8QA 3PRFA 3QQKA 3TIZA 4EZ7A 1RQQC 3I0QA 3FLYA 3OEZA 4M8TA 2UZDA 4I4EA 4O86A 4F9YA 4JX3A 2QG5A 3P4KA 1FMOE 3RP9A 3V8TA 3QLFA 4EOIA 5DBXA 5KE0A 3V6SA 5IA1A 3AC4A 2Z8CA 5JFXA 3NW6A 2WIHA 2CKQA 4FNZA 3FV8A 2DM0A 2Z2WA 2OK1A 4FUYA 3TL8A 4G16A 4YJVA 3KN5A 3T3VA 3RWQA 4BF2A 4CCUA 1CKJA 1LPUA 1BL6A 3TI1A 5CT0A 4C7TA 3PVBA 2O8YA 1OBDA 1ATPE 4IQ6A 2XIXA 2SRCA 5DN3A 1A08A 4ASEA 3O71A 4FKJA 4D2SA 2IVVA 1BHHB 3PJ1A 2OBJA 3CGFA 3GCPA 3R6XA 4XS2A 2B3OA 1OMWA 1WVXA 2P2IA 3CKWA 3MJ1A 4X6QC 4NL0A 3PIYA 4JBPA 3TZ7A 2PWLA 5E4HA 1YHVA 2VTSA 1OGUA 2PZIA 4GRBA 4CTBA 2WMQA 2JKQA 5J5TA 3H10A 3QD3A 4L00A 3QWKA 3NYXA 5CSWA 5IA0A 5HE2A 3CJFA 4GMYA 4YJSA 1PICA 3FXXA 5C8MA 4F59A 3KL8A 4P7EA 4I0RA 4JIKA 3S0OA 1BL7A 1UU3A 5AX9A 2X81A 2XRWA 4M0ZA 4TWNA 2JKOA 4QP1A 3N8MA 3OHTA 2YFXA 4FSQA 1J1CA 4H36A 3SOCA 4EK3A 4RZWA 4WRGA 4FIFA 5JQ8A 2XIKA 5L2IA 5E8WA 2UW8A 3NVMB 3UYSA 4RJ6A 5JMSA 3TUDA 4PNIA 5EYCA 5KAZA 3L8PA 4EKLA 3TWJA 2OO8X 3BI6A 3WA4A 4L3JA 4C02A 3E92A 2FYSA 4IWDA 3LJ2A 4EYJA 4ANQA 1O4RA 2EUFB 5BMSA 4DG3E 2OXYA 3GB2A 5AJQA 2EKXA 3VBTA 2FH9A 4Q2AA 3R9DA 2AUHA 2F7EE 4FSWA 3MV5A 4KKEA 3QYWA 4WG4A 5M09A 4QYYA 4E20A 5J9ZA 2E9VA 3KMWA 3U51A 2JITA 5AAFA 3FZ1A 4LV5A 3VC4A 3VBQA 4D9UA 4XG7A 3EL8A 3UQCA 4FIHA 3BQRA 2VTAA 5EW8A 4BI0A 1E1VA 2WOTA 4EYMA 1CTPE 5BVWA 2X8DA 5CU0A 1A07A 3EKKA 4XRJA 5HIEA 5T3QA 1FPUA 4CMOA 3E93A 1OBGA 2VNYA 3UDBA 5E8YA 4K9YA 4N57A 5AUYA 5FP5A 4I41A 4BDAA 3DKCA 3MH1A 5EM7A 3R8PA 4YSMA 4EZ5A 4ACDA 2VWVA 2ZM1A 3MFSA 4FG9A 4EOQA 2P4IA 4Q9ZA 1SPRA 2C6TA 1D4WA 1BLKA 3ORLA 3DT1A 3F61A 1IR3A 1GOLA 4YTFA 1ZRZA 4FODA 4NKAA 4U7ZA 4XP3A 3GCSA 4W4VA 3T9IA 1PXOA 3TDVA 3WIGA 2RG5A 4O0TA 1AOUF 4FE2A 1O6YA 1I3ZA 4DH1A 5ANOA 4EK4A 4FTLA 1SMHA 2PLEA 1Y8GA 4F7NA 4LUDA 5IQIA 2I0EA 3GU7A 4IAZA 2R3QA 5A4TA 3LAUA 4FV2A 4FYOA 4ALUA 2C47A 2FSLX 3EN7A 4R1VA 4J71A 2GNFA 4BDGA 4EQMA 2XP1A 5CI6A 3VS3A 4X7QA 3FXZA 3FMLA 3DB8A 3KC3A 3AGLA 2ZV7A 2W99B 4OR5A 4W4WA 4A4LA 3QQFA 3MA3A 5ANDA 4RSSA 4EBWA 5CF8A 5JK3A 3OV1A 2R3GA 2CNUA 2YN8A 3E64A 1I44A 5FG8A 2VWBA 4JBVA 4O6EA 2PNBA 2QHMA 3G0FA 4I5MA 4IANA 5KMJA 3V5WA 4U6RA 3E8CA 2BVAA 4CVAA 3ENHA 2B53A 4UX9A 3PJ8A 5D7VA 2YM6A 4FKVA 2X39A 2IN6A 1UA2A 5BQ0A 4WSQA 4IAIA 4PUZA 4KINA 3I79A 3QQUA 1YVLA 4QYFA 4BYJA 2GMXA 4GG7A 3QQJA 4FG8A 3D14A 4KKGA 4HJOA 2QHNA 4G6NA 3HHMB 4JRVA 3O51A 5HQ0A 4FGBA 3LW0A 4MX9A 3PE2A 1JWOA 3U6JA 4EC9A 4MQ2A 4JVGA 3Q2JA 4TYGA 4L68A 2IWIA 4LRMA 2CDZA 3Q9WA 4FBXA 3D5UA 3BLRA 5IKWA 3FKLA 4XG8A 4MWHA 1CKPA 3L9LA 4YHFA 3F69A 5FM3A 3CWGA 2Z7LA 4ZJVA 3RK9A 4HVGA 1REKA 1J1BA 5HI2A 1YQJA 5BUJA 4DEBA 3FMHA 5CNNA 5IQAA 3QXOA 5D11A 5AR4A 5K0XA 2W4KA 5JH6A 4AX8A 3F9NA 4QPMA 4FSMA 4H58A 3UVPA 4C34A 3F3ZA 3EJ1A 3TUCA 4DFYA 3OXTA 1GRIA 4OW8A 3F5PA 3VS5A 2HZ0A 5EHOA 3LLAA 4AW5A 1UKIA 3ZLSA 2NRUA 4IB5A 5M53A 3EYHA 4GT4A 4RJ5A 4C3PA 1M2QA 5AP2A 1O41A 3BUXB 5A6OA 5HBJA 3ANRA 3IK3A 1XBBA 5JRQA 4EY0A 2PVFA 1O4OA 2G1TA 5EW9A 3R9RA 4R8QA 3W32A 3UIBA 4JDIA 1BYGA 2C3IB 2ETKA 3F2NA 3GU8A 3PXRA 4BICA 4CQEA 1BF5A 3NUSA 4K18A 1QPEA 3QHRA 2QOOA 5K3YA 1BLJA 4MD9E 3ZLXA 3F7WA 2OG8A 4PP7A 5DG5A 4B99A 2JYQA 1ZLTA 2ZAZA 3JVSA 4RT7A 3BLQA 4YLJA 4LQMA 3DFAA 5J7BA 2GE9A 3HGKA 2R3PA 4QOXA 5EOLA 3RNIA 2PYWA 3E63A 2LQWA 2HIWA 4DGOA 2FO0A 4FNXA 5A4EA 4C58A 3HRBA 3P9JA 2HDVA 4C33A 4P9ZA 1WZYA 2J7TA 4AN9A 3KRRA 5JSMA 3FL4A 4EUTA 3F82A 3R7EA 4PRJA 1WBWA 2V7OA 4OHDA 5KCVA 2BAJA 3SKCA 4MXXA 5L2WA 3BU3A 3NX8A 1DI9A 4Y8DA 5CU6A 3PRIA 4LOPA 4R6VA 5K5XA 3PY0A 2Z7SA 4FG7A 3UVQA 2ITZA 3FQEA 4NFMA 2OKRA 3UBDA 3PSJA 3W8LA 3OF0A 2R0IA 2VRXA 2PLDA 4R78A 4U81A 4NM3A 1OKZA 2XK4A 3E62A 4S33A 2J5EA 4GFGA 3DGKA 3F7ZA 5BUEA 2O2UA 3ROCA 4IAKA 3PE1A
chains in the Genus database with same CATH superfamily
4KABA 4F9AA 1FBVA 3BX5A 3UTOA 1YXSA 2ABLA 3MY1A 3Q52A 4DDIA 2Y8OA 3PJPA 3L9MA 2BUJA 3IKAA 2JAMA 2B1PA 5E8UA 2ECDA 3IMJA 3E87A 2ITWA 1B39A 1Y6AA 4XG6A 3GC9A 2CGVA 4ZXTA 4FV4A 3NLBA 3PG1A 3Q96A 5E91A 2RFDA 1IG1A 2XVDA 2BAKA 3NDMA 3TTJA 2W1EA 2VTHA 1Z5MA 2ZJWA 3HV5A 4YO4A 1UURA 2DX0A 1JWHA 2QR8A 3C0GA 3I4BA 3KN6A 3DAEA 4JT3A 3RMFA 1P13A 2VTPA 2V7AA 4E4MA 4JDHA 5LQFA 3VW6A 2IVTA 3BHTA 3CXLA 3PSKA 2DWBA 3C4CA 4P5ZA 4M7IA 4BBMA 5CSVA 2CLQA 5J5SA 3P0MA 3CJGA 3W2CA 2I40A 3KF4A 5H8EA 3ATTA 4CFNA 1G8SA 4EIHA 1LEWA 2B9HA 4QYHA 4D55A 1YI3A 4LMNA 3EWHA 2BTRA 3QZFA 5HZNA 4ZY6A 3I5NA 4GH2A 4FKPA 4XYFA 5I3OA 4EC8A 5FDXA 4HYUA 4JEGA 4RC3A 1BMBA 4TWPA 4PF4A 5FWKK 1URWA 3QCQA 4J99A 3UOKA 5EYDA 3VUHA 3G5DA 3PUFC 4AQKA 2X1NA 3NMUF 3GU5A 1BHFA 4O82A 5JN2A 2QQ7A 5HO8A 3Q4TA 2X8EA 2QVSE 2ITYA 5C8KA 4S34A 3GFEA 3UZPA 2VWUA 3V01A 2ZM3A 3CTQA 4A4OA 4RMZA 4NM5A 1XH4A 5CU4A 4ZMEA 4BDEA 1SM2A 2C6LA 4PP9A 4E73A 1A1CA 4J96A 4A9UA 1AOTF 3TIYA 2C5OA 3D83A 5LCKA 2YJSA 2XBJA 3PXZA 2QU6A 5E8TA 1UU9A 4HGLA 3LCKA 3NEWA 5H8GA 2YDIA 1BM2A 4JNWA 5ANKA 4KRCA 2F57A 3IDCA 4TPTA 3WARA 4QEBA 2XB7A 4XP2A 4YHTA 4D2TA 4DT9A 4RX5A 5J95A 4S2ZA 4BCIA 3WF9A 1H9OA 1AYAA 4GVJA 4KS7A 2QOIA 4O21A 4ANMA 3BHUA 3MDYA 2R3FA 5CXZA 3AT4A 5DT4A 2R3RA 4IVCA 3FY0A 3BU5A 4IDTA 1FGIA 4PDOA 1MRYA 2QD9A 5IQFA 4U43A 5DF6A 3HP5A 5E7RA 3RPSA 3E3BX 3UODA 4ROJA 2I1MA 3THBA 3QRTA 4IVAA 4F6WA 1B38A 1WBNA 2JDSA 2UUEA 3B2WA 5CQWA 5KMLA 3OBJA 1NVRA 3I81A 3FY2A 4GVAA 3ULIA 4E8AA 5DMZA 5JFVA 3A2CA 3ZFXA 4LMUA 4ENXA 4TNDA 4GWFA 1DI8A 4A4BA 5DEYA 2SHPA 3HRCA 3PS5A 3ERKA 2XNOA 3IOKA 3LFAA 2GNJA 2KULA 2E2BA 2OJJA 3A7HA 4Q9SA 4BIDA 4EK6A 2RSYA 3MS9A 3C4XA 5FLFA 4B8LA 2WHBA 3MFRA 4F9BA 4JQEA 4K33A 5FTQA 2C6OA 1BG1A 2YERA 4U9AA 4C4GA 3EQCA 3COHA 2XP2A 4EK5A 2ZB0A 5DA3A 3JY9A 3AQVA 5HGIA 5GJHA 2WMAA 4G6LA 3R21A 4MNEA 2BIYA 3GVUA 3U9CA 2WTDA 4X2FA 3QYZA 2UZBA 1FVRA 1WQUA 1OITA 5DWRA 4JRNA 2Q83A 1Q61A 2WTKB 4IZYA 4PY1A 3LXNA 3BKBA 1G8AA 1GZ8A 4ZTMA 5LMKA 1JSTA 1YW2A 4FL1A 2CGUA 4CFMA 4I6BA 1W98A 4O6LA 4QNYA 5CZHA 2J0LA 5DH3A 2VTLA 3U6IA 1OKYA 4XLVA 1SYKA 5CEOA 3SXFA 2JFLA 2WU7A 4IC7A 1PKDA 2GHGA 3P7CA 3BIZA 4F9CA 3UZTA 4R7IA 2HCKA 2OFUA 2PVRA 3PJ2A 2CI9A 5EHYA 4KIKA 4BRXA 1QMZA 1MQ4A 1IASA 3FSFA 3OCTA 2VTQA 3BGPA 3FQHA 3IDBA 2PZYA 5L2SA 4OTHA 4ZLOA 3EN5A 3IW8A 4FL3A 3G15A 3JR1A 5IU2A 5HNGA 5ACBC 4ZTHA 2VGPA 5CASA 3HNGA 4FV1A 2BRHA 4NH1A 5IEVA 1G83A 3OCSA 4CZYB 5BVEA 2NPQA 4CMTA 4XOZA 3ZO3A 3IGGA 1JKSA 2OH4A 5GHVA 4L44A 3P08A 4FZAB 2JDTA 3EFJA 3LHJA 4P5QA 3CR0A 3HP2A 4M68A 4BYIA 5IH4A 2XNPA 2F2CB 3CP9A 4XG9A 3U87A 2OGVA 4DEHA 3TL0A 1ERKA 2QOCA 4O91A 3LCOA 4WUNA 4A9YA 4BVUA 4BZOA 4MTAA 3VRZA 4I6FA 2WEVA 3OOGA 4FA2A 1A9UA 3PTGA 4FTRA 1YI6A 5H8BA 3ZHPC 4C8BA 3NVKI 4XH6A 1ND4A 4QQTA 1QPJA 4DEAA 4BCMA 4K0YA 3MB6A 1GNGA 3PYYA 3ZZWA 1H0WA 4QTDA 5L8LA 4QMQA 3PLAE 3DJ7A 1JKTA 4KSQA 4NFNA 3FXWA 4KIQA 4C3FA 3MESA 2XNNA 2F4JA 3LCSA 1ZYSA 2VUWA 1LCKA 2B9IA 3HA8A 2WTJA 3S1HA 3RBWA 1YHSA 4AGDA 2XM8A 2E9NA 4O4BB 1JOWB 3CQUA 4BJJB 3DS6A 2JIVA 3FKNA 2HWOA 2CGWA 4RVTA 3MH3A 1A09A 4X2JA 4DGNA 4IJ9A 4O84A 3TMOA 2EL8A 3LFFA 1EH4A 1ZAOA 4CRSA 2OU7A 2OJ9A 4OTQA 4PWNA 1VZOA 3HECA 4J1RA 4KB8A 4Y5HA 5M55A 3G51A 1KOAA 4GU9A 1XMLA 2WZJA 3QCXA 3KFAA 5B0XA 4BI2A 3CY3A 4EOLA 1YOLA 1JAMA 3II5A 1PHKA 5CLPA 3A60A 5EDQA 1YI4A 5DC9A 3V5TA 1LUKA 4MUQA 4R77A 3IOPA 3ZCLA 2DCRA 3KY2A 5M4IA 3DXPA 3BE2A 5EOBA 4QTEA 4RG0A 4FVPA 5HX6A 3KRLA 3V5QA 2UZWE 1OI9A 2PE2A 1NZLA 4YJUA 3R7GA 3FI8A 1Y8YA 5CAPA 5HD7A 4ACGA 3AC8A 3WZJA 2R7IA 4U79A 2I7QA 5CVGA 3WZDA 5IF1A 4HYSA 1AD5A 2WXVA 4QP9A 3UNZA 3MWUA 4O0UA 3RTPA 3TNHA 2GS7A 2W4JA 3Q9ZA 2X8IA 3KIOC 4YJPA 4HVIA 1AQ1A 2GS2A 4RWKA 1O4JA 3SRVB 2GNHA 2XNBA 3QKMA 1MRVA 5DLSA 4IWPA 4NYEA 3DLSA 4ZSEA 3JVRA 3ZMMA 2P2HA 1VJYA 3L9NA 3IONA 4Z7GA 5AP5A 2MRKA 3QBNA 1FVTA 2QO7A 2JD5A 5D41A 2EU0A 3OB1B 4AZSA 1LUFA 4L7FA 4RQVA 4RRVA 1WAKA 3PVWA 1LEZA 2JDRA 1NZVA 4W9WA 1XO2B 4K1BA 3RNYA 4UBAA 2FCIA 4XG3A 4ZSAA 5HNBA 4RFYA 3EL7A 5E8ZA 3VVHA 5DC0B 4BGQA 3OEFX 1MP8A 3US4A 2IZSA 5A6NA 3CY2A 3WF6A 3R1QA 3CLYA 4BKYA 1UNLA 4FV8A 4BTMA 5LXMA 2GU8A 3VF9A 4E26A 5CF5A 3GT8A 3TT0A 1SKJA 3TNPC 3LE6A 3UIMA 2WMSA 2BHEA 4QQCA 2BHHA 4BDBA 4XG2A 3DJ5A 1Z3KA 2JIUA 3VS6A 3QD4A 4USDA 4ZMFA 2OZAB 2UVZA 2VTTA 1QPCA 4RJ4A 4YJOA 4EWQA 4G5PA 4J8MA 5J8IA 5JFWA 5CTPA 3F3WA 4F99A 1PXIA 3FWQA 3PDTA 3DZQA 3GCVA 2O64A 2VX0A 4M13A 1O4QA 2ZM4A 1H8FA 3R2YA 1UU7A 4KRDA 5J1VA 3BL7A 1F3MC 2C0OA 2CLXA 5HE0A 4DBNA 3OVVA 4G2FA 3QWJA 1OIRA 3VBVA 2DVJA 3KA0A 4FTTA 4I0TA 4O7LA 5TR6A 4HVHA 4JI9A 5BYZA 4CKJA 2YIQA 2J4ZA 2XNGA 3QZIA 5HG5A 4II5A 3WBLA 1JYUA 4LGHA 3N7YA 1T45A 3ZSHA 4FKTA 2CR4A 4ONAA 4DF3A 2OZAA 4ERWA 3R1SA 3O8UA 4NWFA 2JIIA 4BDFA 3ZONA 3FBVA 4RC4A 3HV4A 4FIIA 2H5KA 3BWJA 1OM1A 2YIWA 4C4FA 3H9FA 3R9HA 3RKBA 3DXQA 5IH5A 3PVGA 1PJKA 2EU9A 2WELA 4FK6A 2Y0AA 3Q32A 4ZK5A 4RPVA 3VJOA 2EXCX 2Z7QA 3BGZA 4TKSA 4HYIA 3C5UA 3Q4CA 4N0SA 3W1FA 2BCJA 2VTOA 2YWPA 4FTIA 1PXNA 3DFCB 5L8JA 3WZUA 5HVYA 5AM7A 3AD5A 1LP4A 3NNVA 2YITA 3ZH8A 4I23A 4KS8A 2CHLA 4MXYA 2PULA 4H39A 3U8WA 2ETZA 3L8VA 4BZNA 5CT7A 5KMMA 4U5JA 2YZAA 4FV5A 5ETAA 2WQBA 4YC8A 1X0NA 2GCDA 3ZDIA 1ST4A 1H01A 4WBBB 4K2RA 5IA2A 3PJCA 4UMPA 2EYVA 1U59A 2ZVAA 4YJRA 2QKWB 2C5YA 2RFEA 2WQNA 1GIHA 5JEBA 4GW8A 4LM5A 3KULA 3LCTA 2Y7JA 4AN2A 2HZNA 1DM2A 2XJ0A 5CAUA 3TZMA 4XZ1A 3R00A 4J98A 3TNWA 2ITNA 3MYGA 1U54A 1OB3A 2XH5A 2X9EA 4FL2A 4LV8A 4YNOA 2OIBA 5EYKA 3UF4A 4MH7A 4JS8A 4WKQA 3C51A 2ITQA 4LYNA 4PQNA 2EYYA 1ZMVA 4YLLA 3O5AA 2UW3A 3MVLA 5JGDA 5HTCA 3NYVA 4L52A 1U5RA 4ZSLA 2H6DA 5AR2A 4BCGA 4B4LA 2IZUA 5M07A 1JYRA 3JS2A 3DK6A 5I9WA 4TT7A 1YDRE 3G6HA 5IQEA 5A54A 3WYYA 3ZSIA 4FTNA 3LJ0A 3RJCA 2GNIA 3ATSA 1LUNA 2V22A 1NXKA 4I5HA 4ALVA 3SHEA 4F63A 4HW7A 3LJ1A 2RVFA 4F4PA 5F95A 4EBVA 4B6LA 4LL5A 1YXTA 2W1ZA 3QRKA 3TKUA 5HNIX 1O49A 3PQZA 4DH5A 3A8WA 4I22A 4FBNA 3NUXA 3MVMA 2R7BA 2REIA 4JDJA 4BTKA 4CFUA 2GHMA 5K4JA 1QL6A 4L53A 3VN9A 4ZS0A 3C5IA 3E7VA 3LXLA 2WMRA 3FJQE 3Q5IA 4IE9A 4UWBA 1SVHA 3C4WA 4YNEA 4MEDA 3NUNA 4LL0A 2EXMA 4MXAA 4XG4A 3R8VA 3ZTXA 4E5WA 3U54A 4DGPA 4DH7A 4YPDA 3PXKA 3TUBA 3DOGA 3ORIA 4CZUA 3MPAA 4FKOA 4K8AA 5ANJA 5B2LA 4JBQA 3VS1A 4IBMA 2RGPA 1H24A 4G9RA 4IEBA 2YABA 3C9WA 4RC2A 1O4IA 5EM6A 3C4FA 3MH0A 4NCTA 5FM2A 4EKKA 3EN4A 5HU3A 4M12A 4F65A 4AZVA 3KREA 2HENA 1OVEA 4R1YA 2VO7A 5GNKA 5I9UA 1TQMA 1KOBA 2QC6A 3KF7A 2PVNA 3TNIA 3GBZA 2FSTX 2CCIA 3HKOA 5GJFA 4F1OA 4CKRA 4EJ7A 3S8OA 4J8NA 3NYOA 4FKGA 3BYMA 2XCKA 3UYOA 4EH8A 5F94A 5FBNC 3ZRKA 3MA6A 3FMNA 4OUCA 4W8EA 5KMOA 4RX9A 3UIUA 2IJMA 4D4RA 5C01A 3DTWA 1M7QA 3ET7A 5K4IA 1BHHA 5AFVA 1STCE 3FMEA 5AP0A 3PSDA 3UP7A 4JBOA 1J91A 5CF6A 5KHXA 1X27A 3E7OA 3GUBA 3R73A 4HGEA 2PMOX 2QR7A 4JAIA 2W1CA 2XJ1A 3W2QA 3ZOSA 4BDIA 2R4BA 2WMXA 3GQIB 3HLLA 2VX1A 4IM2A 5FXQA 4QPSA 4AA4A 1MW4A 1H4LA 2B55A 5T68A 1FGKA 3DU8A 2W1HA 4MNFA 4FVRA 1YVHA 3ZUUA 3KRWA 3VUDA 2ZV2A 3PZEA 3C7QA 3I6UA 2XKDA 3PIZA 1NW1A 2J0MB 4YUQA 3PLFB 5HICA 1UU8A 4D2WA 1O4CA 3WIKA 4XLIA 4DBXA 2XIZA 4OT6A 3NIEA 4HCTA 5D9HA 2ONLA 4W9XA 4Z16A 1PY5A 2YCQA 4UY9A 4YTIA 4ORKA 5DNRA 5AMNA 2W7XA 3H0YA 5AV4A 4IMYA 4DEIA 2EVAA 4X21A 1J7UA 2GSFA 2Y4IC 1R3CA 3R7YA 4X2GA 4QMNA 2FUMA 3KRJA 3DQWA 5ETIA 2R64A 2R3IA 3ZFYA 1KE7A 4ZS4A 3QTWA 5FTGA 5IZFA 2NRYA 4QQ5A 1UUSA 2YDKA 2XEYA 3GU6A 4FTMA 3GQIA 4FC0A 4NCTC 4MXOA 1H28A 5M4CA 3QL8A 2JBOA 1A81A 3RAHA 4N6YA 2W1GA 3AXWA 5BVNA 1GAGA 4I6LA 3ORZA 2BFXA 3SG8A 5DR6A 4DEEA 2W06A 1SPSA 3MBLA 5A14A 4X3FB 5IA4A 2JKKA 4BB4A 4F08A 3ZC6A 3CS9A 5CQUA 3W2RA 3BUOB 3UZRA 1FQ1B 3EFWA 5LVNA 4QMWA 3QD2B 4K45A 4XV9A 3FYJX 2LNXA 2CCHA 3W0OA 1M17A 3PPJA 2XKFA 4EOSA 4H3PA 2OJIA 3DV3A 2WMVA 1R1PA 4GPLB 5AULA 2UZUE 4C62A 4WSYA 3BEAA 4D4SA 1O4BA 3CD8A 2YM3A 1TZEE 4QP8A 1TVOA 1XH8A 3RAIA 1WMKA 3V5JA 3OOMA 4AOIA 4D5HA 3UOHA 1A48A 2I6LA 4TZRA 5LMBA 4OTDA 3BYUA 1Q4LA 2XZSA 3IN8A 2WQOA 1REJA 3O0GA 5AIKA 5DC4A 4CSVA 3LPBA 1MUOA 4XBUA 2YLEA 2G2HA 2XNMA 4XV2A 4E4NA 3FI3A 4UEUA 4X3FA 4QP2A 1RDQE 3ORXA 4G6OA 4IC8A 4HZRA 4DGXA 4IB0A 1H1SA 2ONLC 2UZLA 4G5JA 3WILA 3K5UA 3OT3A 3ZEWA 1OUYA 1O4NA 2IUGA 2XK3A 1FOTA 3VUMA 3UMXA 3BEGA 2XEZA 4U3ZA 1M7NA 4HCVA 4X0MA 4E68A 1YWVA 3PXYA 1M61A 3FYKX 4NSTA 3ZS5A 3TM0A 5E92A 1YXXA 1ZARA 4A06A 1Y1UA 3GC7A 3LVPA 4HPUE 2KTYA 4XCUA 3ODYX 4FSRA 3ZLYA 5IEYA 4WT6A 3ZRMA 1BKXA 2RMXA 4DFXE 2WQMA 5CENA 4CYIA 1OZ1A 1WFCA 4F0GA 3DCVA 3NNUA 2XIYA 4L46A 5A46A 2VD5A 4NW6A 3W2OA 3QA0A 3KK8A 3IQ7A 2JAVA 5CYIA 3C0HA 4ZTSA 4NWGA 5HG9A 3QFVA 4ERKA 2R2PA 3N4TA 1RW8A 5DVRA 1OPLA 3PJ3A 3BQCA 2UW5A 3HV6A 4YLKA 4C4EA 2VTRA 3S2PA 4GK2A 2WNTA 4N4SA 3AKJA 1H1RA 4CG8A 1IEPA 4IHPA 4E4LA 5FDPA 4RIXB 5L6PA 2WTCA 3F6XA 1V0OA 3IW6A 4OGRA 1W7HA 4TNBA 5CNOA 3ZZEA 1F5QA 4AF3A 3NZ0A 4OAUC 4AAYA 4GU6A 2XA4A 3VGOA 3AMBA 2BRGA 1Q62A 4DA5A 4XBRA 5CEQA 1HCTB 3V04A 2BILB 3MVJA 3O17A 1XH7A 2OI4X 2WMUA 4FSNA 4DEGA 1LKKA 2J0KA 2ACXA 4WBOA 4F1TA 1XKKA 3W8QA 3C4ZA 4E6QA 4O1OA 2BFYA 2RKUA 3Q4UA 4PPAA 5CS6A 2F49A 2PVMA 2PVKA 3LFBA 4EOMA 2WMWA 4BDCA 3BUMB 4GEOA 4NTSA 5BMMA 5KZIA 4X3JA 4CRLA 4X3FC 3GCUA 4IZAA 4DHFA 3QTQA 4DFNA 3D15A 4FR4A 1IJRA 2C1AA 4QMLA 2QOLA 1OO3A 3GOKA 3AC3A 3DBCA 4RIXA 5M08A 5B2KA 3V8WA 3RGFA 1XR1A 4B0GA 4X2KA 1V0BA 4E7WA 4AS0A 3HYHA 3BBTB 3SLSA 1AYCA 1V1KA 4NK9A 4MVFA 4BL1A 5A9UA 2C6KA 3BWFA 3H30A 5I9ZA 5IBSA 2F7XE 3KQ7A 2AOAA 5L6OA 2QODA 5EK7A 3RCDA 5AUTA 3R9NA 1TFFA 4C57A 4ZEGA 4QMXA 3VO3A 3R7UA 1V0PA 2ITUA 3HAMA 3WF7A 3IPHA 1IA9A 4BDJA 3AKKA 1OIQA 2XYNA 3LFNA 3VAPA 1OL7A 4D2VA 3UG2A 4IX3A 3TNQB 2X6DA 2VWZA 5IDNA 3IO7A 3EQGA 1SHBA 2YA9A 3RWPA 1W84A 5T6KA 4I93A 4DHIB 4OBQA 4NIFB 2BDJA 5EELA 1GJOA 2V5QA 3LYVA 3OXIA 4F64A 3D7ZA 3S3IA 2UW9A 5IA5A 2C69A 4RIYB 1SHAA 1Q3WA 2R3KA 2XJ2A 4PMTA 4R3PA 4PL5A 3MJ2A 1YDTE 4ARKA 2HZIA 3BELA 4IXPA 5K0KA 4E1ZA 5LVOA 2YIXA 1IS0A 5HLPA 3N84A 4F5BA 4Y72A 3A7JA 3D94A 4DCEA 2AEGA 4Z9LA 3DAKA 5BVKA 5FXSA 1O4MA 5GJGA 3ZU7A 3RINA 4AW1A 4H1MA 2ERKA 2CGXA 2OW3A 4R5SA 1BLXA 3LLTA 3NNWA 5HCZA 4IADA 3OW4A 3EHAA 5DT0A 4CFFA 2AQXA 5DPVA 2W4OA 2OWBA 4RWLA 3TKZA 3EFKA 4WNOA 2XIRA 1PXJA 4JOAA 4FZDB 2CNQA 1SVGA 4DTBA 1UNGA 2ZV9A 4E93A 1YXUA 2WD1A 4PTGA 4B7TA 2DYLA 1JBPE 1PYEA 2PVYA 3LZBA 3OP0A 1F2FA 3FZSA 4KA3A 3F66A 2J90A 3EAZA 5AADA 4C38A 2V55A 3PA3A 4DH8A 5EKNA 2QOHA 4FNYA 3QZGA 2Q0BA 3VBWA 4GKHA 3I1AA 2WAJA 4IAFA 1VLRA 4F78A 1X6CA 4MF1A 4ZTRA 4I92A 2VWYA 4DTKA 4DG0E 4FT5A 3O23A 2J9MA 4D4YA 4MD7E 4WO5A 1PW2A 4FKIA 3ALOA 3VIDA 4DGGA 3ZXTA 2YJRA 2PUPA 4JX7A 2GTNA 4N6ZA 4PMMA 3WZKA 4EWHA 2XANA 2BR1A 1APME 3REPA 5EG3B 3NCGA 3AMAA 3ZUTA 4I21A 3E8DA 4TRLA 3VNTA 4NJ3A 4RVMA 4AZEA 4FNWA 3ZM4A 4C59A 4CT2A 1D4TA 5AR3A 2B9JA 4LG4A 3IW4A 3HCKA 1JYQA 1GY3A 2GNLA 2PMLX 4IWOA 4QMZA 2X0OA 3IECA 4DINA 4V05A 3DLZA 3T04A 3EH9A 5F20A 1O48A 2OFVA 4I5PA 3G6GA 4AFEA 4GCJA 3QQLA 3PZHA 5L6WL 3EMGA 1PF8A 2HXQA 3FC1X 3D7TB 3GXLA 1UVRA 3R7VA 3T3UA 3PPKA 4I0SA 2EXEA 4I6HA 4EOJA 4L42A 4D1XA 1O4HA 2K7AB 3G0EA 3H4JA 2XK8A 5EDRA 5L8KA 1WBVA 2W05A 3HRFA 4MK0A 3QLGA 4RJ7A 4G3EA 3ZEPA 2W0JA 2R3HA 2YEXA 1BKMA 4O81A 2YM4A 1PMEA 2JBPA 2W9ZB 1ZY5A 5EG3A 3FL5A 4O0SA 3F88A 5GZAA 3PFYA 2VNWA 1PMUA 3O8TA 5DR2A 1I09A 4ZTNA 4YSJA 5FP6A 3GU4A 1YWRA 5I5ZA 2VO0A 4EHGA 2A4LA 3W0SA 4AW0A 4QMTA 3F3TA 4RJ3A 3KB7A 4AOJA 3BV3A 4QYGA 5IBMA 2L6KA 2QO9A 3QTUA 2QOBA 1JKLA 4APCA 3IS5A 4CZTA 1ZYCA 2J5FA 2CNVA 5EI2A 2HW7A 4KBCA 2B4SB 4HVSA 3UO4A 2C5VA 3TYKA 4FTCA 5KMNA 3D2IA 3UGCA 5JZNA 1OKWA 3QZHA 1KC2A 2I0VA 4F1MA 1OL5A 4YMJA 2YACA 5HD4A 1H0VA 3FHIA 5H2UA 4E3CA 4RQKA 4Y95A 4BWPA 5CSHA 4USFA 2UZTA 1JPAA 3G90X 1H1QA