4K2RA

Structural basis for activation of zap-70 by phosphorylation of the sh2-kinase linker
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
613
structure length
551
Chain Sequence
b'PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDFGLSWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSGLEVLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ZAP-70
publication title Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 162
structure length 551
sequence length 613
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4k2rA05
1.10.930.10 Mainly Alpha Orthogonal Bundle Syk Kinase; Chain A, domain 2 Syk Kinase; Chain A, domain 2 4k2rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4k2rA04
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4k2rA03
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4k2rA01
4QP7A 2V7AA 5DI1A 3R8PA 2JIUA 4I21A 4XEYA 4DG3E 1TCEA 2H5KA 3MSSA 4EHGA 1ZZ2A 1P13A 3KFJA 4D9TA 2UUEA 4ZZMA 2X6EA 3SLSA 2B54A 4LV8A 4B4LA 4XV3A 3QD4A 1HCLA 4BIEA 4YZMA 3I60A 2CKOA 5M44A 4QD6A 4BKZA 4UXQA 5KKRB 2VGPA 2IG7A 3N51A 4CCUA 3GFEA 2X2MA 5FTOA 3R7YA 2KULA 3OWPA 3MFRA 2X8DA 1AB2A 3F3VA 3ZS5A 4MHAA 5FRIA 5EH0A 2L4KA 2PVJA 4R7BA 3RM6A 1WMKA 2CI9A 5DR9A 1MRVA 4N57A 4E68A 2A0CX 4TT7A 4XJ0A 5I9ZA 1LUMA 1Q8TA 4X6RA 1QPCA 2QMSA 5DRBA 3TJDA 3CXLA 5KMIA 4OTDA 2BAJA 2PVRA 1O6YA 3BGPA 4JBVA 4WRSA 1SPRA 3FJQE 4D4VA 2QOHA 4D2VA 5BUIA 4HVHA 1AYCA 4Y72A 4NK9A 5C8NA 1WZYA 4MF1A 4RT7A 3WZUA 3KA0A 2ZAZA 4WWQA 5CF8A 4RLLA 3FKLA 4U8ZA 5BUJA 3QX4A 5AAEA 4AZWA 2VTLA 2ZM3A 3OG7A 4AN3A 3VRNA 3TDWA 5JH6A 2XCKA 1W7HA 2F9GA 3DTWA 3LCOA 5ICPA 4J53A 5L8LA 3DZOA 3E3BX 2CCHA 3PA3A 1BM2A 3QTIA 3FZPA 1S9JA 3HUCA 5EHLA 3ID6C 3QC4A 2ECDA 3FDNA 4IXPA 5IG1A 2RFDA 2R3NA 2R3KA 2J7TA 3FQHA 4ZJIA 5D7AA 3QQKA 4MXXA 2Y6MA 4OBQA 2OZAB 3LFNA 5A3XA 5M57A 1JKKA 4JGHA 3JVSA 3F3ZA 2IVVA 3GU8A 4NFNA 4FKPA 5M55A 3W10A 3U6IA 5EEQA 3E64A 4DHFA 4MBIA 2JKOA 4ANQA 2XNMA 1O4HA 3FZTA 3F3WA 4HVDA 1RJBA 4C62A 4J1RA 1OMWA 3O2MA 4QQCA 4EQCA 1BL7A 1ZYJA 3PSBA 4FOCA 5E8TA 3WE4A 2LGCA 3V6SA 3MH2A 2FB8A 4EHZA 2OXXA 1OKWA 3CY2A 3WARA 3MAZA 2YFXA 2ITWA 4ANNA 5A54A 1JLUE 4BF2A 1KOAA 4QTDA 4WT6A 2YM8A 2OQ1A 3DK7A 2XIYA 4O7VA 4H34A 2HYYA 2XNOA 4ZJJA 3ZZWA 1R1WA 3WF9A 5E8YA 1DAWA 1FVRA 1CKPA 4R1VA 5AP6A 4ZSLA 3R2YA 2CI8A 4L3PA 4MNEA 2UZOA 5CU6A 4BYIA 2O65A 2CS0A 5KMLA 3QRIA 5AIRA 4A7CA 1BG1A 1BFIA 4UMQA 3P0MA 3BEAA 3DNEA 4O22A 4APPA 1GZKA 4LOOA 4NWGA 1XKKA 3DAKA 4O27B 2XZSA 4PMTA 2QODA 4KRCA 4DLIA 3GQIB 1KE6A 4I22A 3BYMA 2F4JA 4FKOA 3BCEA 4G3CA 5C8KA 5KBRA 5FXSA 4AN2A 1M7NA 3UDBA 5J9LA 3C7QA 3I81A 5T6KA 3NRMA 3VS1A 3NYVA 4HGTA 3BGQA 3QXPA 3W2PA 4X2FA 3POZA 5EHPA 4F4PA 3S8LA 3QTXA 4ZY5A 3R8MA 3ZC5A 5AP5A 2GHGA 3RAWA 3OT8A 4DGOA 5EHRA 2JDRA 1YDTE 3EL8A 2NRUA 2YAAA 4FIHA 1OGUA 4HNFA 4YGAA 4E20A 5FBNC 3A60A 2I40A 3R21A 3QZIA 3WF6A 4D2WA 3HNGA 4BKJA 4NCTA 4UALA 3V8SA 5CEKA 3U6HA 2YWPA 4IADA 3T9IA 4MF0A 4DLJA 4ALUA 4PP9A 2C4GA 2UZWE 1U4DA 2UW6A 4YC3A 3QALE 3LAUA 3UIUA 4XHKB 5CALA 3QGWA 4P5QA 3RKBA 2V7OA 4AX8A 4UYAA 4V05A 3TZ9A 3ZYAA 4KUJA 4QTEA 3UNJA 2Y9QA 3ORKA 4W9XA 4E1ZA 2JKKA 2VTRA 2Y3AB 4QP2A 1YWNA 5CF5A 2MK2A 4K6ZA 4AOJA 2FO0A 4ALVA 5J5TA 4A9TA 4AN9A 2ZV9A 4PDOA 3KN6A 2PE0A 2XKCA 3O8TA 5AIKA 5D12A 3PLFB 2J9MA 3PUPA 3Q4UA 5I0BA 3DXNA 2QG5A 2OF4A 4F1MA 4NCTC 3TV4A 3BYUA 2R7BA 3LMGA 3R1QA 4MH7A 3OF0A 4FIFA 3PYYA 5CQUA 1JKTA 1RE8A 3LCKA 2QOLA 5I3OA 5BX0A 4TYGA 2GNGA 4F0IA 3ATSA 5GNKA 4EJ7A 2X9FA 4AA5A 3ENHA 3LM0A 4FV7A 4FYNA 2C0IA 1PXJA 4BL1A 5HG9A 3FPMA 4MCVA 2GNJA 3D7TA 5J8IA 1Q8UA 2QOOA 3LCTA 5CZIA 2XM9A 1JSVA 1SZMA 3R7EA 2ETKA 3QF9A 3OCSA 4N4SA 3UVPA 5FDPA 4USEA 3F2RA 4GK3A 4WA9A 2OZOA 2PHKA 5E8SA 2EXEA 5JFWA 2GTNA 4CMTA 4KINA 2GPHA 3DBEA 4B8MA 4FKUA 2VWUA 5JGBA 4G5JA 4GMYA 5BYZA 2DM0A 4TZIA 2OG8A 3WBLA 4F9YA 2DWBA 3DQXA 4R78A 3AD5A 4J99A 4PPCA 5HX8A 4PL5A 5F94A 3LLTA 2Z60A 4FBXA 4FKRA 3EQBA 4AGUA 2ERKA 3CCNA 1M14A 3ZFXA 2JYQA 2J0LA 3QUEA 4RX5A 5EW3A 2EB2A 1PXOA 4U7ZA 3VQUA 3DNDA 5HCYA 1AOUF 1YXSA 3R73A 1D1ZA 5D9HA 3HV4A 2F2UA 2EYVA 4UYNA 2RG6A 2EO6A 2BHEA 5AV0A 1O47A 3F66A 3EH9A 4ZSAA 4O7LA 1FPUA 3KRLA 2BAKA 2AC5A 4ORKA 3EQGA 4Z7GA 2JAVA 3JS2A 3BUXB 3MJ2A 5TOZA 1R3CA 4FT3A 3CQWA 3EYGA 3GU6A 2F7ZE 3P7CA 3QCQA 5E8XA 5EK7A 3ZBXA 1Q8ZA 1BI8A 2PUIA 1TZEE 4M12A 4C36A 2YDKA 3T04A 1XWSA 3W8QA 2P2IA 1SHAA 4IZYA 1RQQA 2X8EA 4DEBA 4ZS0A 2QHMA 1IRKA 4DGLC 3B8QA 4AZTA 4EY0A 3UZPA 3DKGA 4QOXA 2VWZA 4EUTA 5KHWA 1BKMA 2UV2A 3TWJA 4AOIA 4N0SA 4JDHA 4IAKA 4TXCA 4XG2A 5FBOA 4BI1A 1A1AA 4UMRA 2CLQA 1LCKA 1M7QA 3C4XA 2W1CA 4TN6A 4IDTA 4G5PA 5CYIA 5FM2A 2QOCA 4GVAA 2E2BA 2WTDA 5ANJA 5FEEA 1E1XA 2VAGA 5TO8A 4C58A 4TL0A 1O46A 5LMKA 4U43A 3GCVA 3S8NA 4YJTA 1R0PA 1URWA 4BKYA 2BUJA 2XK6A 2YM7A 4X2NA 2GU8A 3KXNA 3PXRA 3NW5A 3C0GA 3B2WA 2QU6A 4QYYA 5H8EA 1RQQC 5H2UA 3Q4ZA 4K33A 4WUNA 1XH6A 5FD2A 3SQQA 4RMZA 2HCKA 4C4JA 1OKZA 3IDBA 1AOTF 2WXVA 4F7JA 3U54A 3CY3A 4MD8E 3VAPA 4MXOA 1XJDA 3NS9A 3TN8A 4KRDA 4E6CA 4F99A 1WCCA 3R9NA 4IAIA 4JQ8A 2HOGA 3NUPA 4ACHA 2C0TA 1P4FA 1OL5A 4RZVA 5HQ0A 3PWDA 3FC1X 5LMKC 4RC4A 2R9SA 3UPZA 2YABA 5JFXA 3NUXA 3ZSIA 3L8PA 4FZAB 4JDJA 4C2VA 1OIYA 4G2FA 1IA8A 4LMNA 3BUWB 4YBKA 4PNIA 3OCTA 2OW3A 3P7BA 3ZZEA 4ANOA 1I3ZA 4KSPA 4DC2A 1BFJA 1VEBA 4QMOA 2EU0A 3QUDA 3M11A 2QOKA 2H46E 1OPJA 2PSQA 3UYSA 3PSCA 1YVHA 1ZWSA 5CEQA 1UNHA 3HL7A 5L2IA 3KU2A 2C6KA 4IM0A 4YZDA 4XLIA 3G0EA 4FT0A 4FV8A 2IUIA 1YXVA 1SNXA 3MFUA 3CXWA 4M67A 1LEZA 3GCQA 4NH1A 4IWDA 3TNQB 3ITZA 1UNLA 4PDPA 4QMTA 4IZ5A 4TY1A 2SRCA 5BUEA 3V3VA 4F9AA 3H10A 5BVFA 2IJMA 3L8XA 3VF9A 3TL0A 3E8DA 4AT4A 4CKRA 4FGRA 1T46A 3C4WA 4DBXA 2MRKA 4AACA 1GZNA 5C01A 5K5XA 3FQEA 4U3ZA 3Q9WA 4CT1A 3MY0A 2BRMA 1GIHA 2X7OA 5IQCA 3ZH8A 4DCEA 4A9SA 3C5UA 3UODA 4W4YA 4X2JA 2RORA 2RL5A 1XH9A 1SMHA 4I6BA 4QNAA 2HXQA 2WNTA 4BDKA 4H3PA 2BALA 4NL0A 5BPYA 3D94A 3QA0A 3V04A 2R64A 3RGFA 4ZTQA 3UMWA 4GSBA 4ACCA 4CLIA 4DCAA 1BUHA 4FG9A 2HDXA 2HDVA 3F5UA 4AGWA 3IECA 2F7EE 4AA0A 3EZVA 3KK9A 4IB1A 2WU6A 5KMJA 4FV0A 3CTHA 3S1HA 2FCIA 2W1EA 2OICA 4UV0A 4WKQA 1M17A 3MV5A 2R3FA 3OY3A 4MNEB 4QNYA 5DT3A 3TZ7A 5L6PA 1NY3A 3Q2MA 3G0FA 3IG7A 1OI9A 1CTPE 1P2AA 3I6WA 3ORNA 3RVGA 5FP5A 3WF5A 4D2RA 4ITHA 1A1CA 5AR2A 3FMEA 4EH2A 3LOKA 1D4TA 3QYZA 2VO0A 3ULIA 4DGMA 2E9PA 5L8KA 2PLEA 2C3LA 3MA3A 3KQ7A 2GFCA 2GS6A 3EFLA 4EQUA 4YU2A 5LQFA 4RVTA 4KS8A 3UYOA 1FQ1B 3LJ2A 3TKIA 2YA9A 3GC9A 3I7BA 4IM2A 5GZ9A 3ZLSA 5IA3A 1IS0A 4DGNA 3MPMA 3TNWA 1A07A 3KRJA 4YUQA 1JAMA 4EH9A 2XH5A 2Z7SA 3WI6A 4YC8A 3WZKA 4KIPA 4RJ4A 4FVPA 1OITA 3TM0A 3LPBA 4TWNA 5IQFA 1G83A 3VHKA 1YVJA 2XMYA 2CGWA 3LFDA 4UMTA 3WE8A 4C3RA 4DAWA 2XIRA 1KC2A 4FL3A 2YCQA 4G16A 2UVYA 4JAIA 3FMMA 3QA8A 4RFMA 4RC2A 5F9EA 4GCJA 3HA8A 2BR1A 2DLZA 4EOJA 3MXCA 1NZVA 3LXNA 5D7VA 3DOGA 1PRYA 3C13A 3K3JA 3LFCA 3UYTA 4GV1A 4YJVA 3FLYA 4G6OA 4C3PA 5JZJA 3LJ0A 3LQ8A 4JIAA 4HPTE 4QMSA 3Q9ZA 3E8NA 3GBZA 4QP4A 3KXMA 4QMWA 3VULA 2VV9A 1SKJA 1I09A 3HV3A 4BZNA 4XNEA 1JSUA 2W1FA 3AD6A 3HKOA 4YJOA 3T8OA 1FHSA 2R3MA 3HHMB 4XBUA 2XIKA 4RA4A 4EC9A 4G6NA 4USDA 4YNOA 3W32A 4BBEA 3DU8A 3OHTA 4QP3A 2PU8A 3B8RA 4C8BA 5CX9A 2CKEA 4FV2A 4QO9A 3D0EA 2RIOA 3IOKA 3D14A 4P90A 2A19B 4XZ0A 3PLSA 1O4KA 4F64A 2XB7A 2RF9A 1O4NA 2Y8OA 5E4HA 1MUOA 5L6WL 1FYRA 3R9OA 3FMNA 5EYMA 4G3FA 4QMYA 4ASXA 3LMHA 3THBA 2DS1A 3ALNA 5F95A 5AR3A 3V5TA 5EW9A 3HDNA 3SRVA 3V8WA 4DE4A 1FMKA 2WFYA 2VZ6A 2YIWA 4XCUA 2DX0A 1UU8A 5JZNA 2HK5A 3VRZA 4Y83A 4M7IA 2C6DA 2VO7A 3A4OX 2R3GA 4CFXA 2Q83A 1QADA 1YDRE 3DLSA 3DBDA 3SHEA 1YWRA 3ZDIA 3CGOA 1GZ8A 3FLZA 5KUPA 4NJ3A 4L42A 4DA5A 2WPAA 4D0XA 4XG6A 5D41A 3KMWA 3MIYA 1WBNA 2AOAA 4FNXA 5DC0B 2GDOA 4MNFA 4IWOA 2K79B 1YI4A 4PDYA 3DS6A 3GQLA 3QZGA 1O44A 4ANMA 3TZMA 4NW6A 4QP1A 2F49A 5KMMA 2JEDA 1ERKA 2QLUA 4X21A 3TV7A 2R4BA 5I9UA 2WAJA 2WQMA 2X81A 4O7NA 4ACGA 4C2WA 5AEPA 1BKLA 1PICA 5F20A 4LM5A 4X3JA 1OL6A 4EH6A 2VTPA 4IIRA 5CU2A 5AP0A 1YI6A 4BTFA 4M0ZA 3O8PA 3H3CA 4LL0A 3D83A 1RW8A 4W4XA 5DH3A 5CU0A 3PXQA 2ITVA 1U5RA 2WMAA 3DDPA 3HCKA 3MGYA 4L00A 3RWQA 2WMBA 3VJOA 4EOQA 5AAGA 4PL3A 3VROA 2HUWA 4Y85A 3VNTA 2QO7A 1H28A 5AV1A 4ITIA 2CNVA 3OVEA 5GJHA 2G01A 5KAZA 4FIEA 4IVDA 3RJCA 4BVUA 3K5VA 3BRBA 3O7LB 3WOWA 3ATTA 1WBPA 1PMEA 3GQIA 5L6OA 3EQHA 5EM6A 3GXWA 2PVNA 4PV0A 1LR4A 4L52A 4QQTA 3CSVA 2PYWA 3DAJA 4OW8A 4G34A 2IO6A 4EBVA 3KULB 4QMMA 3V5WA 5L4QA 4D5HA 2Q0BA 5GINE 3ORIA 2ABLA 4L68A 4S33A 5HVYA 4ANSA 3RZFA 5JK3A 4FV4A 4OTGA 5DGZA 5LVNA 1JOWB 4FSYA 1O43A 1O4RA 3LVPA 2J90A 4YJUA 5HICA 1FBNA 2WTWA 4YJNA 2ZM1A 4BWXA 4AGCA 5AULA 1WBOA 4JG8A 2ITNA 2AUGA 2IWIA 2OH0E 1W0XC 1ZZLA 2VTSA 4FUXA 4JR3A 2BAQA 4U41A 1PF8A 4ANBA 1KOBA 3DA6A 3ELJA 5FEQA 3RALA 4LOQA 1M2PA 1SHBA 3BBTB 2X2KA 1V0OA 4D58A 3ZLWA 4D2TA 3BU3A 4C37A 5D10A 2GMXA 5EOLA 2W4KA 3AXWA 3GU7A 3ORLA 4ZTRA 3VUHA 1PXIA 2ITUA 2REIA 1HOWA 2ZMDA 4L43A 1YHWA 3FLWA 3FE3A 4PUZA 1YOMA 4OAVB 2I6LA 4I41A 2V55A 3A8WA 2PWLA 3BYOA 3IGOA 3NIEA 3C1XA 3QU0A 4FIGA 4RG0A 4KBCA 3R9RA 4JAJA 2XYUA 3II5A 4D1XA 3LXPA 4F6SA 2JIIA 4KKHA 4CQEA 4OHLA 3MFSA 3UIXA 4CFMA 4A06A 2ZDUA 3B2TA 2VTIA 3ORXA 5HIBA 3UVRA 3IQ7A 1ZYSA 5LVMA 4PRJA 1G8SA 5CLPA 3DK6A 4JQEA 1LEWA 4YO6A 4CKIA 2C5OA 2KTYA 3IONA 1WBTA 3GENA 3QYWA 4FSQA 4TWCA 3SW4A 4EH8A 4OAUC 4RA5A 2GSBA 3TKUA 4F5BA 1L3RE 4MD7E 4O83A 4ZXTA 5A6NA 2GQGA 2XK4A 4EK4A 5AFVA 2VTOA 3R8ZA 3REPA 2X2LA 4FTQA 1GOLA 5IMXA 5C4LA 1OPLA 2GHMA 4LV5A 1BYGA 4FOBA 5A14A 2OFVA 3QKKA 4YTIA 2ZJWA 4RC3A 2QONA 3MJ1A 4K9YA 5CEOA 3O7LD 4I6FA 1SM2A 2CGVA 1AYBA 2Y4IB 4ACDA 1UVRA 4LYNA 4FTOA 4BDCA 4V01A 2O0UA 3I6UA 4EHEA 2GNHA 3BGZA 4IX6A 4CT2A 3UZRA 4UX9A 3QD3A 3ROCA 5C03A 2CLXA 2PMIA 2JDTA 3Q6WA 4GFGA 4XG7A 5DFPA 1E1VA 1OECA 5AP1A 4DTBA 3FKOA 3O96A 2WTJA 3H0ZA 5IQIA 2YIRA 5HKYA 5AM6A 5ANEA 3CPBA 2OJGA 3CGFA 3RK5A 3A62A 5E8WA 2JDSA 5EI8A 4EORA 1H1WA 5AV4A 5AXIA 5C27A 4DT9A 4DG0E 4CVAA 5HE1A 4D4RA 2JC6A 3GC7A 4GYIA 4DITA 1F5QA 2GQSA 5M06A 4XG3A 3MVLA 2JFMA 2P2HA 3UTOA 2DVJA 3TKHA 3W18A 4MXAA 2GS2A 4E73A 3DBQA 4G3EA 4G9CA 5FWKK 4Y5HA 5GJGA 3BYSA 4ASEA 3Q2JA 2O3PA 3P86A 3A7GA 3FMDA 4R6VA 5EOBA 3LMIA 3GB2A 3EYHA 3Q9YA 4O0YA 3R8VA 2XJ1A 3AC4A 3QTSA 3FEGA 4FNYA 3HUBA 1PYEA 4MBLA 2PUNA 4F0GA 5HO8A 4G3DA 2HWOA 5CVGA 4BTMA 5DR6A 2GQRA 2AOBA 3IN7A 2V0DA 2JFLA 2VWBA 2O5KA 3BU5A 3OCBA 4TYJA 5AUTA 3KMMA 3ANRA 3FC2A 5AX3A 3VUGA 3U87A 3UBDA 3TG1A 1NW1A 2PNBA 4IX4A 2I0HA 3E7VA 5HBJA 2MRJA 1PKDA 4DGGA 3P7AA 4ASZA 3NUAA 4FK3A 5EYDA 3S4QA 4FSUA 4XBRA 3R7UA 5KE0A 5J1VA 4TYHA 3F7WA 2UW7A 3C5IA 2Q0NA 3VUDA 3UPXA 5IA1A 2JITA 4FV9A 5DIAA 3ZXZA 2W06A 2WKMA 3MY5A 3MVMA 4YLJA 2VGOA 3LKMA 3GCSA 1YXUA 3LFQA 5LWNA 3D2IA 3NR9A 5H8GA 3PP0A 1NT2A 4L67A 3UIBA 5ETFA 3RPSA 5JRSA 4BRXA 2GNFA 4FICA 4IANA 3AMYA 4ZIMA 3ANQA 5HBHA 2PNAA 5B2LA 1CMKE 1BLXA 1O4QA 2EXMA 3MVHA 4OHHA 1H00A 1MQBA 3EFJA 2G1TA 3I5NA 4KS7A 2P3GX 4FKGA 1OB3A 4FV1A 3ORPA 5HNGA 1BX6A 4DFYA 4IC8A 5M4UA 5HE0A 5IDNA 1Q3WA 4L3LA 2WQNA 3W33A 2V62A 3CJGA 1TQMA 1K9AA 4ZOGA 1GNGA 1MRYA 4AW1A 4U45A 4LOPA 1UNGA 2BRGA 5EW8A 1JYRA 3ZDUA 4YMJA 4Z3VA 3RK9A 4H39A 1A9UA 3CPCA 3NVKI 1LP4A 5ANKA 3SRVB 4S34A 5HTCA 3Q32A 3RM7A 1GRIA 5E7RA 3DFAA 2RFSA 1FU5A 4K45A 3UNKA 4ZY6A 5E8ZA 3EKKA 3ZO2A 4KIQA 3VW8A 5FEDA 2HAKA 2R5TA 4YSMA 4ZEGA 1J3HA 3D2KA 3PQZA 4D2SA 5EELA 3VBXA 2BVAA 1XO2B 3WZJA 1O4PA 3IKAA 4L7SA 4KKEA 5HCXA 5KBQA 2RG5A 4EL9A 2RVFA 3VBTA 3AOXA 3TT0A 1E9HA 4LUEA 4F59A 1QL6A 1WAKA 4RBLA 5JGAA 1ZY4A 2PK9A 2YISA 4CV9A 3ZRMA 4U17A 2J51A 1LCJA 3DPKA 4GFOA 4I0RA 2ERZE 1ZOHA 4JJRA 3D5VA 3R02A 5A4CA 4O6EA 4NYEA 4QT1A 4JVGA 4DEGA 1SVEA 4TTHB 4XX9A 2IW9A 1AD5A 1CKIA 3CS9A 4I6QA 4IZ7A 4RLKA 4E3CA 2PZ5A 5HHWA 4AGDA 3LQ3A 3QAME 5CT7A 2YERA 3H30A 1IEPA 2VWVA 4D28A 5LCJA 3R8LA 2PMNX 3ERKA 5DG5A 3RAHA 1WBSA 4ROJA 5AP3A 1O4AA 3KREA 1O4BA 4ARKA 1Q8WA 3CKWA 4I4FA 4B9DA 4UN0C 4PNKA 2ETZA 1UU7A 4QMUA 4JX3A 3RWPA 4CSVA 3GGFA 4FKQA 3Q60A 4DG2E 2HZ0A 3KY2A 4F7LA 3TACA 3H9RA 4PTCA 4YPSA 4K1BA 1X8BA 4O1PA 3V5PA 4HVSA 4H58A 3LCDA 3OUNB 4HVGA 4GPLB 3UZTA 1QMZA 3BLQA 3EB0A 4D8KA 3IPHA 1O4LA 4A9YA 4CMOA 4O86A 1FBZA 4MXZA 2XKFA 2VX0A 4EOSA 3HMNA 4B8LA 4YURA 1H8FA 4EONA 4BYJA 3BHTA 4C33A 4LL5A 5LVPA 2P0CA 3HVCA 4M84A 2IW8A 1CDKA 2X39A 5GJDA 1B6CB 1WVWA 3FI4A 3EHAA 4JBPA 1U59A 4XRLA 3OW4A 3OCGA 1PJKA 3LFAA 4AT3A 4R77A 1Q41A 1GAGA 4K18A 4RJ7A 3KVWA 1YRPA 5IUGA 3BV2A 1DI8A 1KWPA 1XHAA 1KE7A 3SOCA 3RPVA 2ZVAA 4D5KA 4QRCA 5GIPE 2VTMA 1JKLA 4HJOA 4P9ZA 3QRJA 5HO7A 3QWJA 3E92A 4CFNA 1CWDL 1REJA 3H9FA 2R3RA 3PVUA 4OLIA 4RX7A 4PY1A 4YC6A 4BZDA 3BHVA 2R3QA 5IUIA 3PFQA 2IZTA 4CQGA 1RDQE 3Q6UA 5K0XA 2W0JA 1OUYA 4OTPA 2DCRA 4TZRA 4FEVA 4R5YA 4XV9A 4R8QA 1YHVA 5IQHA 3MWUA 4FTJA 4Q9ZA 2W5AA 5ANGA 4CG9A 3C9WA 2XNBA 4DEAA 1QPEA 3PY3A 3VS6A 4A4XA 4BIDA 2C6TA 3DLZA 3QQGA 4IEBA 3ZEPA 4EI4A 4NM0A 1IA9A 1BL6A 4O81A 4XYFA 4JRNA 4V04A 4OTHA 4WNPA 5DWRA 2C6IA 2W17A 3GOPA 5EFQA 5AV3A 1K2PA 4PTEA 4AOTA 4BCPA 3DJ6A 3MPAA 1ZY5A 2JAMA 4XP0A 5J95A 4H1JA 2PL0A 4J8NA 3QQHA 3ENMA 4IMYA 2EU9A 3PPZA 4TWOA 4BIBA 1NXKA 4D4SA 2RGPA 4JBOA 5IH4A 4F6WA 3CE3A 4MWHA 4FTRA 2W1HA 2BZHB 5E90A 3TTJA 1BLKA 4ANLA 1YQJA 3NW7A 2OIBA 3CBLA 2VUWA 4UWBA 2E9OA 4AU8A 2YCFA 3S2PA 5AUWA 4NIFB 5D0JA 3TZ8A 3OTVA 4JI9A 3UMXA 1FINA 3HMMA 3ALOA 2B0QA 5KMNA 4Y46A 1YVLA 3E62A 4AE6A 3PXZA 4RIOA 3OB1B 3D7ZA 3EFKA 4YO4A 2UW0A 4MEDA 3QZHA 3WF8A 1YXXA 3DDQA 2EYZA 1SVHA 3AT3A 4PPBA 5TT7A 5CF6A 4AAAA 4ZSJA 3L9NA 2EOBA 5AUYA 4R7HA 3FLQA 5IEVA 4O7YA 4H1MA 4E7WA 1UWHA 2VNWA 3EN4A 2EUFB 2UW8A 3Q52A 4X2GA 4BBFA 2JBPA 4FA2A 1QCFA 3KXZA 3OFMA 3N4VA 4JX7A 4FNZA 1BMBA 5IH6A 2VO6A 4FF8A 4KBKA 1Y8GA 3UJGA 3ZMMA 3JY0A 3NW6A 1Q5KA 3FI8A 3ORTA 2VU3A 3PTGA 4QPSA 5B7VA 4IE9A 5IQDA 2HMHA 3KULA 1NRVA 4IHPA 5BMSA 4D2PA 2XEZA 2IN6A 1MW4A 4O38A 3OOGA 5KX8A 4FSTA 3W16A 3E8CA 1UV5A 4LGGA 5A46A 3R71A 3QD2B 4QP9A 1KSWA 4NTTA 1QG1E 1Y91A 3G6GA 2CSNA 4WG5A 4ZTSA 1GHUA 4J7BA 4QP8A 1YOLA 5DEYA 3A7JA 2WQEA 3HV5A 3MH3A 3MW1A 5IPJA 1H9OA 5DC9A 1MRUA 3HV7A 3CIKA 5LMAA 3EQCA 2W4OA 3NUSA 1FOTA 4RX8A 3COMA 1PHKA 5J87A 4GG7A 5AR7A 3NGAA 5IUHA 5AUVA 3U51A 2OJFE 4QMLA 3SVVA 3ODZX 3NPCA 3PG3A 2XM8A 4YZ9A 2PE1A 4B0GA 4DFNA 2B9JA 2YIXA 3FL4A 4Y95A 3DXQA 1Z3KA 4C59A 3Q4TA 4WD5A 2XVDA 4EK3A 4A9UA 3UC4A 5E92A 2UVXA 4DFLA 4TYHB 3FI3A 5BNJA 2XK7A 3HGKA 2IZRA 3VS3A 2FVDA 5HX6A 4GWFA 4XOZA 3CD8A 2BCJA 4FSWA 4L8MA 2OJIA 1XH4A 4J71A 3AQVA 3F61A 4RJ3A 5I3RA 4HPUE 1NVQA 2WTIA 1P4OA 2XKDA 4RFYA 4MQ2A 5AP2A 1O9UA 4HCTA 3DBFA 3H0YA 3OS3A 2ITOA 4OBPA 3SG9A 3UQGA 3OP0A 4WBOA 5J5SA 3RZBA 2RFNA 3E93A 3I5ZA 1ZAOA 4XV1A 4O7WA 4M13A 1PMVA 4EEVA 5BYYA 3WIGA 3U4WA 5JQ5A 2K7AB 2X9EA 1P5EA 3LIJA 4L45A 4S32A 2C5VA 3BYVA 3KXHA 2UW5A 4IQ6A 4FE2A 3RCDA 3RINA 3COIA 5HD7A 3AC1A 4BDGA 4DH3A 1DM2A 4OTRA 3HMPA 5DEWA 3V5LA 2R0IA 2X4ZA 3AC3A 1WQUA 4J8MA 4UZDA 4II5A 3OROA 2L3TA 3EIDA 4UZHA 3I0QA 4UB7A 2DLYA 4R5SA 5EM8A 5EHOA 4BDBA 2PMLX 3F2NA 3R1NA 4FKJA 4AP7A 2PE2A 3UO6A 1TQIA 2H96A 3R28A 2Z8CA 3NLBA 4RZWA 1R39A 1YHSA 1QPDA 4Z7HA 5IU2A 4O7TA 4KWPA 3ZUTA 5CAVA 4BCOA 3PWYA 1S9IA 4HOKA 4AFJA 4ALWA 1OO4A 3QBNA 4IDVA 4M15A 3DBCA 3R0TA 4M14A 2QO9A 3HDMA 4O2ZA 1OUKA 4TPTA 5D1JA 5E8UA 4E6AA 3ZRKA 1ND4A 1NZLA 4F63A 4PMSA 3ODYX 4FSRA 4F1OA 4FV3A 3U8WA 4EYJA 4XG9A 5M08A 5J7HA 4P2KA 5F1ZA 2LCTA 2HENA 4DEHA 3F88A 5JSMA 4J95A 2J0IA 2UZUE 3ZU7A 2BDJA 2DQ7X 3D15A 2QLQA 4PDSA 2YM5A 2GNIA 2J0JA 4DEIA 1A08A 2Y4IC 2ZM4A 2QC6A 5HEZA 5EDQA 3ZLXA 2RFEA 3BWJA 3EFWA 3UO5A 4FBNA 1YKRA 4BCHA 3FZSA 5GZAA 4CTBA 3F6XA 3NZ0A 4IVAA 4XS2A 1TVOA 2OF2A 1STCE 5ANIA 4AG8A 4HW7A 5IMEA 3JUHA 2PY3A 4CNHA 3TDVA 4H3BA 1OM1A 3R7IA 4QTBA 3F3TA 4BDJA 4BZOA 3KGAA 1G5SA 1O49A 1LUKA 4GJ2A 4ERKA 3MXYA 3GU4A 1O4FA 5KO1A 4BWPA 3F2AA 3DZQA 5CEIA 3L9PA 3QRKA 4JRVA 4WNOA 3KL8A 4AQCA 2C69A 2NO3A 3MS9A 5M53A 4OT6A 3WIKA 5AR8A 5HVKA 4RRVA 3KEXA 1R78A 5EKOA 5E9EA 2VO3A 4TW9A 1NVSA 3BU6A 1MP8A 3IK3A 2CNUA 4QMZA 4IW0A 3PZHA 4F9BA 3O51A 2B9FA 5CNOA 4D1SA 4EZ7A 4HVIA 1ZMUA 4C38A 1UKIA 1JNKA 2YM3A 5CAPA 2H9VA 4TYEA 1JBPE 2OJJA 4TNDA 2RKUA 5HBEA 3HP5A 4I6HA 4E8AA 4EH7A 3NCGA 1H24A 1Q99A 3C0HA 4GUEA 5AMNA 4FK6A 5E91A 4AZFA 4Y8DA 4K2RA 3PDTA 4C4GA 3G90X 5DE2A 2O8YA 2PVMA 3FXXA 3Q5ZA 4YLKA 4RJ6A 3EN5A 3SW7A 3HP2A 3PJ8A 3NYOA 4FKIA 4XMOA 4BCQA 5J1WA 3ORZA 4L46A 5FQDC 5KHXA 2QNJA 3VRPA 2YACA 1R0EA 3PRFA 5EQPA 3S0OA 3R22A 5KZ0A 1H1SA 2G9XA 5CVHA 3PVWA 1Q4LA 2CMWA 2C68A 4HNIA 4HYHA 2E9NA 3A99A 4R3PA 4RJ8A 4TWPA 4NKSA 2G2HA 2BPMA 1UWJA 2W96B 4GG5A 4FEXA 2VWIA 5AJQA 3PIXA 2VX1A 2SHPA 3RPOA 3NEWA 5HKZA 5LXMA 1R1PA 4YHTA 2VNYA 4JE4A 3HLLA 3VBYA 2BZKB 3FI2A 4O82A 3QQLA 2ITXA 5IA0A 5CF4A 1Q24A 4FTIA 2X7GA 4GK2A 2EO3A 2J2IB 5IKWA 1G8AA 3EACA 4J98A 4U40A 3EQIA 3G15A 4CXAA 1VJYA 1XA6A 3QQUA 3F3UA 5T3QA 5CZHA 3OB2B 4BCFA 1A06A 4FNWA 2W4JA 4HGSA 4I5HA 4RWKA 4EQMA 1W84A 2I0VA 3BHYA 5AP4A 1IASA 3AD4A 4RIXB 3T3UA 1GJOA 3GFWA 4FUYA 3NYXA 2WMQA 3AT2A 1Z9XA 3OP5A 2Y7JA 4CFUA 4EKLA 4EIHA 4C02A 3GU5A 4CGAA 3TEIA 3W1FA 4A4OA 2YWVA 4E4LA 4EH5A 4YTFA 5CNNA 4FODA 2XBJA 2CN5A 3VQHA 5HVJA 3UOKA 4MVFA 2NRYA 1CM8A 3I79A 3OY1A 3QX2A 4WSYA 3TJCA 3TKZA 4IVCA 2VX3A 2C5YA 3DK3A 5EI2A 4FEUA 5CTPA 1K3AA 5I9XA 3GNIB 4FTMA 2F57A 4OTWA 5DA3A 1OPKA 4I23A 2UZLA 4XG4A 4ZLOA 3FMHA 3IW5A 1QPJA 4I5PA 4GT5A 3GCPA 2QD9A 5K4JA 3LFSA 3OXZA 4FSZA 2C3IB 3IMDA 1NVRA 4OUCA 3FKNA 4ZAUA 2O64A 1A81A 2A27A 5HCZA 5JQ8A 4DTAA 5L8JA 5B2MA 2HWPA 5G1XA 3NNWA 5EYCA 3PLAE 3MI9A 3KB7A 4BHZA 3NUNA 2E9VA 2W9FB 2YN8A 1JVPP 3L8VA 2I7QA 3DB6A 3S9KA 1O4OA 2GE9A 3QCXA 3FHRA 3A7FA 4G17A 3ET7A 4K0YA 1CSZA 2YU7A 4F70A 3BUMB 3ZM9A 5E8VA 2YLEA 2DUVA 3ACKA 3CLYA 3PSDA 1APME 3VS0A 4CRSA 2HZIA 3DJ7A 4ZMEA 4FEQA 3TI1A 1AQ1A 2R3JA 3KCFA 4NJDA 3BE9A 4LGDA 3GC8A 4CG8A 1XH8A 2H6DA 2GCDA 4U79A 5M07A 4CZUA 1JPAA 1U46A 2C6LA 3PFVA 3MTLA 4QMVA 4FX3A 3HAMA 2UW4A 5HESA 5C4KA 2P4IA 4OHEA 2YEXA 5FXRA 5EM7A 2ONLA 4FI1A 4FL1A 2V5QA 3FAAA 4Z55A 3A8XA 5IDPA 4JEGA 3ZXTA 2X6DA 4H36A 2C1BA 2W1IA 4QYEA 1OBDA 1JWHA 5BVDA 2LQWA 2JD5A 3EZRA 4FIJA 3DV3A 1BHHA 5AUXA 2GTMA 2A4LA 2V22A 2VN9A 3HMIA 4EJNA 4NWMA 4R7IA 3HZTA 1OL7A 2YDIA 2OO8X 4PQNA 3UO4A 4MX9A 3PIZA 5D11A 2C3KA 4ZY4A 2OFUA 3HX4A 2PUUA 4BCIA 5LARA 3F69A 5CDWA 4IB5A 4BC6A 3HECA 4NT4A 4X6SA 2J4ZA 4LRJA 3WZDA 3OXIA 2B9HA 2Y1MA 4NM7A 4O21A 3BUNB 3FY2A 2WMVA 3NX8A 3G51A 3JXWA 5KCVA 3DQWA 3QKMA 4RSSA 2ONLC 3QTWA 2KK6A 3MN3A 4USFA 3PVGA 4GL9A 2AC3A 1PXNA 5AA8A 4GS6A 1YDSE 3DT1A 3A7IA 1J7LA 3SAYA 4HYIA 3HA6A 1IR3A 4DH1A 3I4BA 1H08A 1REKA 3QTUA 3OZ6A 4PL4A 4YPDA 4AE9A 1BHFA 3U9CA 2CBLA 3AC8A 3LXKA 1URCA 1HCKA 2X7FA 3DY7A 3FY0A 4I0SA 3BEGA 3E7OA 3VF8A 5JFVA 3R8UA 5M51A 3QTQA 1UUSA 4GUBA 1KE8A 4Q9SA 3W2SA 4EC8A 4M66A 2O63A 1LKKA 1X27A 1W98A 3RI1A 5HG5A 3VBQA 3PJ3A 2WTVA 5G6VA 5HG7A 3IMJA 4KBAA 1XR1A 2HW7A 2ZOQA 2W99B 4WBBB 4E5AX 2R3PA 4J96A 3BV3A 2G2FA 4S30A 4IM3A 4NIFA 4QYGA 3W2QA 1M2QA 4W8DA 4L9IA 3PA4A 2W5HA 4DH8A 2WMTA 4GFMA 3COHA 5C8MA 4OR5A 3KF4A 1U54B 3LZBA 3KC3A 3RTPA 5KMKA 3BPRA 3SGCA 2VTQA 3GT8A 3BE2A 2XNGA 3OVVA 1O4MA 2W1ZA 4AF3A 4ZZOA 4I0TA 5M4CA 2OKRA 3CTJA 4F9WA 4QPMA 3RNIA 2EKXA 4HCUA 4FKWA 3TIYA 3FYKX 4AUAA 4EBWA 2BRNA 4CZYB 4RIYB 4FMQA 4BDEA 3OUKA 2B1PA 4TKSA 3AMBA 3KXXA 4FV5A 5BVOA 4A9RA 1H0VA 5DHJA 3T3VA 3KK8A 4LUDA 4MD9E 4GKIA 4LGHA 2W5BA 3EN7A 5DN3A 5I5ZA 3NUYA 1Q61A 3E3PA 3H9OA 1O41A 4L3JA 3BELA 3IN8A 1CSYA 5HI2A 3N7YA 3VGOA 5A6OA 2JKMA 4X2KA 4BCJA 4EZ5A 5IQGA 2IZVA 2RMXA 4DGPA 2XP2A 2OI4X 1O6LA 1Y6AA 5EG3A 2VWYA 4EK6A 1BMKA 3VJNA 4U44A 4HZSA 4KNBA 3CQEA 4DT8A 3AGMA 1NA7A 4IAFA 4JL9A 4KIOA 1IAHA 1ZOEA 4RQKA 5J79A 4YZNA 4FZ7A 4YLLA 4JLCA 3GI3A 5M4IA 3M1SA 2ESMA 3ZLYA 5I6VA 4CEGA 2XUUA 3G2FA 4X0MA 4AFEA 4BDDA 4I5MA 2OXYA 3VBVA 3VUIA 5K4IA 1H25A 1SNUA 2BFXA 2PVLA 4M4ZA 1U5QA 1V0BA 3P79A 3MBLA 1G3NA 3ZOSA 1A1BA 2C9WA 4EWHA 3QQJA 3FLNC 4IWQA 4L6QA 2FSLX 2H34A 3H4JA 3FMLA 3WILA 5GHVA 4YTCA 5GIOE 2YIQA 3JY9A 4JS8A 4ZSEA 2FYSA 1XH7A 4U42A 5GJFA 2CKQA 3JR1A 3FZRA 1Y6BA 4Z16A 1J1BA 4QMPA 2ITZA 3ORMA 4ASDA 1H26A 5EI6A 5ACKA 3GXLA 3IGGA 3IO7A 4X3FA 4EOLA 5E1EA 5HOAA 4UWYA 3RBWA 1I44A 4NWFA 2I1MA 3A2CA 2PZYA 2F2CB 2XYNA 4B6LA 4YJPA 1Q3DA 2XIXA 2QURA 2QI8A 3N8MA 4BY9E 3ZFYA 2QKRA 2XEYA 1OIRA 3S95A 4LRMA 1VR2A 4HZRA 4PX6A 4A4BA 4ZTNA 1O4DA 5IBMA 2WQOA 3PJ2A 2XIZA 3MIAA 5IQBA 4O0UA 3LXLA 1WBVA 1V0PA 4G3GA 4MK0A 4OBOA 4PP7A 5GJIA 5LJJA 1PXPA 5DOSA 3UP7A 4APCA 4XZ1A 3M7FA 3VUKA 2QG7A 3EOCA 4AXAA 4H05A 1PY5A 4OTFA 5JMSA 3SD0A 3FV8A 2IVSA 1OO3A 4HGLA 4PMMA 3G9NA 3R1SA 2OK1A 4BFMA 5C1QB 4A4CA 3CTQA 4X3FC 3O71A 5HE3A 4D0WA 4F9CA 5K9IA 1J7UA 1GIIA 2UZBA 3P23A 1LUIA 4DFBA 4Q5EA 3RAKA 3ZHPC 4C61A 4O2PA 2JDOA 2Y0AA 2VTJA 1JYUA 2PVHA 4E4XA 3FMKA 3G9LX 4M68A 4KIKA 4AS0A 2OLCA 3R30A 2PTKA 2Y4PA 4QMNA 2CNQA 1F0QA 2IVUA 2Y1NA 4NM5A 1YXTA 3QHRA 4HYUA 1KV1A 3KMUA 3OBJA 4GU9A 5TR6A 4YTHA 1TQPA 2UZEA 3FWQA 4QYHA 2BTRA 4W4VA 3R00A 4BDFA 4J97A 4PPAA 2ITPA 4QQ5A 2C1AA 4ZSGA 4DINA 4KD1A 1PXMA 3R7VA 3UNZA 2IUHA 4TNBA 4ID7A 4CFVA 2IZSA 3EN6A 3P9JA 3COKA 1LUNA 2WTKC 1KA6A 1LUFA 4R3RA 4L53A 3RMFA 5JN2A 1OKVA 4YZCA 2WIHA 3V8TA 2L6KA 5LMBA 4O0RA 3CD3A 2IW6A 3ZONA 4FL2A 4QMQA 4YHJA 4BDIA 3OC1A 4JOAA 4U5JA 5A4LA 4J52A 3UQCA 1RPYA 2W7XA 3RCJA 2JDVA 2BHHA 3UOLA 3PVBA 3VC4A 2VWXA 3QTZA 1GIJA 3AT4A 1O48A 3BQCA 3GXXA 2OIQA 3PS5A 4ITJA 2FGIA 2VRXA 4FTLA 4I92A 5ITAA 2C5XA 2YZLA 2Z7LA 4O0TA 2XNPA 3Q53A 4B7TA 2HIWA 2JGZA 2OWBA 3ZTXA 4AA4A 3TXOA 2A2AA 3NCZA 5HLWA 3PJPA 5BVEA 3JYAA 3QLFA 3TL8A 5KMOA 3FXWA 4K11A 1M61A 4BN1A 2NNWB 1PXLA 2BDWA 3C4ZA 4FTNA 2HY81 1PXKA 4YHFA 4YR8A 4DN5A 3W2CA 2X1NA 2UW9A 5HKWA 1OBGA 1GZOA 4NKAA 4BGQA 3KRWA 4FG8A 3POOA 4NSTA 3ZC6A 2OU7A 3F9NA 4IACA 3WYXA 2OIDA 4M97A 4CZTA 1ZYLA 4AWIA 2QU5A 2BIKB 4CCBA 3UQFA 3SG8A 5ANOA 3JVRA 2W1GA 3R2BA 4FSMA 2WMRA 4QYFA 3IDCA 4P4CA 5AR4A 3W55A 1SPSA 5J9ZA 3EQRA 4ZTMA 3EL7A 2OGVA 3WF7A 2GNLA 4UMPA 5GZ8A 3PSJA 4ACMA 5L2SA 4N70A 3O23A 4M69B 3G5DA 4G1WA 4I94A 3UGCA 3OW3A 4R1YA 1BHHB 3D9VA 1PKGA 2YLFA 3IS5A 5DR2A 5CSVA 1KUTA 3KVXA 3I7CA 4JR7A 5FG8A 3ZM4A 3KXGA 2WB8A 2ITQA 2CN8A 3MPTA 2BFYA 4GH2A 1ZMVA 4NZWB 2R0UA 2ZV7A 1PYXA 4BCMA 1YOJA 2I0EA 3D5XA 3GVUA 1O4GA 3MESA 1VZOA 1OKYA 3G33A 3FXZA 5CAQA 2GHLA 4DFXE 3UG2A 5AV2A 4FGBA 3RK7A 3ZFMA 3FHIA 4DF3A 1FBVA 2CGUA 5CSHA 3ZBFA 4E93A 3PRIA 3N9XA 5FLFA 3TNPC 4QTAA 2A1AB 4BDAA 4CFFA 1B47A 3ZSGA 4EOMA 2LNWA 5DC4A 2HZNA 3C4FA 4I4EA 2JKQA 3R7GA 4XRJA 4M0YA 3TNIA 4D55A 4KKGA 4MQ1A 5AX9A 1SYKA 4YBJA 4EHVA 3ZNIA 2WD1A 4JG7A 4LFIA 4RIXA 5A4QA 5I9YA 4W9WA 4FR4A 1F3MC 5FM3A 4H1OA 4GIHA 5J3XA 3PA5A 2B3OA 1X6CA 3RP9A 3QWYA 3PE1A 5FDXA 1A1EA 3OBGA 4U97A 2PZRA 5ACBC 2C6EA 2F7XE 4E5WA 2WEVA 2BRBA 4IAZA 5HLPA 5TKDA 3WA4A 1BKXA 4ZTLA 5DRDA 3FLSA 5K3YA 4DTKA 3K2MA 1O6KA 3RHKA 1Z5MA 4C4IA 1TKIA 2FA2A 3VW6A 5CVFA 1FVTA 2BBUA 4E4MA 3WZEA 2OBJA 2VWWA 3FBVA 2G2IA 2Z7RA 3GC0A 2FSTX 4LRKA 3SDJA 4CFWA 4CYJA 5HD4A 2PPQA 2IUGA 4O96A 2CPKE 1O45A 2Z7QA 2R3LA 1ZOGA 3D5UA 3DKOA 2XCHA 2ZYBA 2G15A 4O0XA 1FGIA 3E88A 4FTCA 3EWHA 4BDHA 5IEXA 4AW5A 3QWXX 4FT5A 3LCSA 5CWZA 4GKHA 1R1QA 4L01A 2B55A 4O91A 2ZDTA 1F2FA 1HCSB 1FGKA 2XK8A 2X8IA 3CQUA 2R2PA 3NDMA 5A9UA 1H01A 5IQEA 3HEGA 1XBBA 3R1YA 3IW4A 4O7SA 4K8AA 4FTUA 5IA4A 2MC1A 3IW8A 2YSXA 3LQ5A 3L8SA 5DBXA 5ETCA 4EK5A 3QHWA 4UWCA 2J5EA 5M56A 1X0NA 3TIZA 4HYSA 2YJRA 4D9UA 3DKCA 1KA7A 4FVRA 1JKSA 2FUMA 4WSQA 4IB3A 5HNIX 2B9IA 1XQZA 4E4NA 3NMUF 2GS7A 5EG3B 1BI7A 2XJ2A 1VYWA 2WOTA 2IZUA 1UURA 4GT4A 4GYGA 3DXPA 1YW2A 5BYLA 1CJ1A 3QQFA 2QOBA 4RQVA 3TNHA 4OGRA 5CI7A 3MH1A 2WMUA 3AGLA 3P78A 2NPQA 4WNKA 4YJQA 5CQWA 1LKLA 5B2KA 4BBMA 4QTCA 1Q8YA 2FH9A 5CANA 3OT3A 4LG4A 3R6XA 3IDPA 5CSPA 4O7ZA 3O0GA 3VS4A 4CMUA 5TF9A 2UZNA 1WVXA 1Y8YA 3A4PA 5JEBA 4BCGA 4I20A 3NHNA 4DH5A 2UZVA 4F5AA 4DFUA 3QCYA 4FC0A 4GEOA 1Q97A 4UXLA 3KN5A 2BTSA 4WIHA 5CI6A 2J6MA 2QR8A 5CSWA 5BVWA 1XH5A 4AZVA 3QRTA 1F1WA 1JU5A 4FT7A 2PLDA 1H1PA 3OOMA 4IJ9A 5CU3A 3SOAA 1Y57A 3OWLA 4I5CA 2HELA 4O84A 1W8CA 3R83A 3F7ZA 1H4LA 4I3ZA 4W4WA 4C0TA 4ZMFA 3OEZA 1A09A 4FKTA 4X3FB 1KV2A 5EYKA 5HORA 3K3IA 4N6YA 4E26A 4C3FA 2ZMCA 4O1OA 4IH8A 4RWIA 3ZCLA 4BTKA 2BRHA 5CAUA 1ZFPE 3PP1A 3PJCA 3QRUA 3N4TA 4CV8A 2YCRA 3O50A 5FP6A 5CS6A 3R01A 2ITYA 3FYJX 2YZAA 3R7OA 2H8HA 2HY0A 3L1SA 3ETAA 4JQ7A 3PXKA 5JGDA 5A4EA 3NVMB 1OZ1A 4DGXA 3DB8A 3MTFA 1JYQA 3P08A 4EZ3A 1ZRZA 5M4FA 2WEIA 4WO5A 2VIFA 5ETIA 5TE0A 3ZSHA 3HV6A 4WG4A 4C57A 3UF4A 4ZLZA 1ZXEA 5CEPA 2J0MB 5H3QA 3PG1A 1B39A 3LFEA 4R3CA 3FZ1A 3KF7A 4AZSA 2CCIA 2XP1A 2R3IA 4CTCA 4E5BA 1MILA 1BLJA 3V6RA 5BMMA 4P5ZA 4BB4A 2QOQA 2YITA 2WTKB 2WIPA 4I24A 2QOIA 2PZIA 3C4CA 4IZAA 3R9DA 3RPYA 3VRRA 1HCTB 4V0GA 4DYMA 3BBWA 4NEUA 3I0OA 3L9MA 5AR5A 3DJ5A 2OXDA 4YNEA 3VS5A 2Y6OA 3FSKA 4U81A 4AT5A 4C4EA 4KIKB 3Q04A 3ULZA 2E9UA 1U54A 5LVOA 5F4NA 1J1CA 2WZJA 5AUZA 2EVAA 1OL2A 4CRLA 1VYZA 4I1ZA 3HRCA 4EOPA 3EAZA 1H1RA 3BX5A 4L7FA 2C0OA 3WYYA 4BI0A 4FVQA 4D1ZA 5AP7A 2C5NA 1JSTA 4LMUA 5B0XA 4RIYA 1EH4A 3C51A 4EKKA 2XNEA 1D4WA 4E6QA 3I1AA 3NUUA 2EWAA 2R3OA 4JDKA 4JNWA 3LLAA 5BQ0A 3UOJA 3TTIA 2WGJA 1PMNA 1O4JA 2BROA 2PULA 2CIAA 3A61A 5AAFA 4K77A 5JFSA 1H0WA 3NIZA 5IA2A 1AYDA 2PMOX 3SX9A 3F82A 1FU6A 3U6JA 1M27A 2YDJA 4WG3A 5M09A 4UMUA 2OH4A 3E8EA 3VBWA 2ITTA 3NSZA 3S8OA 3EMGA 3MY1A 4JDIA 4IAAA 3LW0A 5HGIA 4ZJVA 2EXCX 4ZTHA 2QQ7A 4GT3A 2WU7A 1J7IA 1PMUA 1UU9A 4OHIA 4F7NA 2W05A 4EK8A 4RFZA 1DAYA 3BZ3A 5EQYA 3G6HA 3ROYA 3RNYA 5J9YA 3GEQA 4C34A 4QP6A 3CR0A 4BI2A 2C47A 2QVSE 2EL8A 1ZLTA 2CR4A 4IC7A 3CP9A 4H3QA 4OT5A 2HW6A 3MVJA 3P1AA 5EHYA 5EM5A 4RGJA 5J7BA 3LE6A 3S00A 3FSFA 3VN9A 3VVHA 4OTIA 4RIWA 4Y73A 3V01A 3MFTA 4BICA 4S31A 3BLHA 4O6LA 3AC5A 3PE2A 5HIEA 1KE5A 1M2RA 4FIIA 2UZDA 5BVNA 4DBNA 4JIKA 2UW3A 3Q4CA 3FUPA 4YSJA 2VTNA 2ZB0A 1V1KA 5CY3A 4FTKA 1CKJA 4F65A 4GVJA 4ZZNA 4MXYA 4CKJA 1IAJA 2J0KA 3ZO3A 3FQSA 5IF1A 3GUBA 3U4UA 3A7HA 2O2UA 2C6OA 2BMCA 3PPJA 5IA5A 5BVKA 3LM5A 3VHEA 1MQ4A 4S2ZA 5HG8A 3TUBA 4MKCA 3BQRA 4RWLA 3C4EA 4FZFB 4U0IA 3BI6A 1OIUA 1JQHA 3MA6A 4FKLA 4GW8A 2XNNA 3L9LA 4JG6A 5ETAA 5IH5A 2ZV8A 4DEEA 4GK4A 2LQNA 2J50A 2QR7A 4XH6A 5L3AA 3PY0A 5LCKA 4X6QC 2PUPA 2BKZA 4QPAA 2Z2WA 2QHNA 2ACXA 4FYOA 2YAKA 3PIYA 3PY1A 4NW5A 3DGKA 2XBAA 2UVZA 3GOKA 3HRFA 5KNJA 4PWNA 2KNOA 2C6MA 2PZPA 2JIVA 3NAYA 4Z9LA 4EH4A 1ATPE 5K0KA 3CKXA 2WO6A 1OVEA 4IAYA 4OHDA 3E5AA 5IBSA 1FVVA 1H1QA 4FZ6A 4LI5A 5LVLA 4RVMA 4PMPA 2XK9A 2J5FA 3M42A 2YM6A 1H07A 2YCSA 4IVBA 4IWPA 5AWMA 3VRYA 5CXZA 4IX5A 2WMWA 4FKSA 5FGKA 4F0FA 1L8TA 4KSQA 5EQEA 2XK3A 5AM7A 4WOVA 2CRHA 4P7EA 3BLRA 5DPVA 3UVQA 2ZV2A 3AMAA 3DKFA 5KKRC 1FMOE 3VUMA 5IQAA 1WBWA 4YJRA 1GY3A 3VRQA 3PZEA 3QGYA 3D4QA 3MH0A 4QSYA 3UOHA 4KAOA 5DF6A 3RAIA 3VWAA 5HLNA 3QKLA 4FTAA 5H8BA 2VTAA 4GL9E 2WTCA 2RSVA 3LHJA 4MAOA 2R7IA 4O0WA 2B53A 4E6DA 4XOYA 3HRBA 2LNXA 2YHVA 4A4LA 4NU1A 4AZEA 5IEYA 4FT9A 3U9NA 1Q62A 3AG9A 5IISA 4W8EA 3EQDA 2B7AA 2GFSA 4FV6A 2OZAA 4RX9A 3RPRA 2OJ9A 2YM4A 3AC2A 4QMXA 3JPVA 3IW6A 3KRRA 4G9RA 4F1TA 3D7TB 4TYIA 4U9AA 4D4YA 3EQFA 2GSFA 3W2RA 5JT2A 1Y1UA 4IJPA 2XRWA 5DNRA 3NWWA 4EUUA 2ZB1A 2PVFA 4O0SA 2QCSA 5DLSA 5C9CA 3SC1A 4XG8A 3ZUVA 1T45A 2VTTA 4MWIA 3UE4A 3MDYA 4Q2AA 4G6LA 3UG1A 3C7IA 3FL5A 4XV2A 4YZBA 3TUCA 4IFCA 3SXRA 4F7SA 4OTQA 3V51A 2B52A 5L2TA 3CWGA 3QFVA 3Q5IA 2WHBA 4ONAA 2UZTA 4ZP5A 3EJ1A 5LWMA 5FUTA 1ZYDA 5EDPA 4L44A 3ZO1A 1UU3A 3QL8A 1AGWA 2CJMA 4QQJA 3SXFA 4MTAA 3ZUUA 3V5QA 2EYYA 1B38A 5A4TA 2BIYA 2VTHA 3R04A 1SHDA 3Q96A 3PSKA 4BGGA 5HKMA 4M3QA 1P14A 2ETRA 4CYIA 4UBAA 2BDFA 1WVYA 4FZDB 1JWOA 5DYJA 5FTQA 3CEKA 4XP3A 3OMVA 5DVRA 2LAVA 4BHNA 3QTRA 2XA4A 1ZARA 3NYNA 1OIQA 2HZ4A 3KFAA 2CDZA 2PVKA 3LFFA 3BIZA 2X0GA 5L2QA 3BWFA 5I4NA 4KA3A 4NM3A 5L2WA 4WNMA 4LQMA 3KCKA 3KRXA 3T9TA 2Z02A 3HAVA 4PF4A 3DCVA 4M69A 2EB3A 1XBCA 4NTSA 1DI9A 4C35A 2JLDA 3BHHA 4FTTA 2B4SB 1O4CA 4UY9A 5K5NA 5HIDA 4FKVA 4RJ5A 3M2WA 3E87A 4C4HA 3R9HA 2BZIB 2RSYA 4EWQA 5T68A 3HYHA 1UKHA 4X7QA 5AADA 2XKEA 4BWKA 3Q9XA 1A48A 4L1BB 3NNUA 1J91A 3TUDA 2AYPA 3P5KA 4RVKA 2YJSA 4EOOA 3OV1A 1RJAA 4O0VA 1ZMWA 4U1PA 3K54A 2FSMX 4U3YA 5E1SA 3LJ1A 2C3JA 3QLGA 5EDRA 3TV6A 3N4UA 1IG1A 3F5PA 3QZFA 2XJ0A 4B99A 2YIYA 5CASA 4N6ZA 3PPKA 5HU9A 3IOPA 2R3HA 4G31A 5CENA 4IFGA 4C4FA 4ZK5A 1ZYCA 2AUHA 3OTUA 4U80A 2XF0A 3QC9A 4BCKA 4IBMA 5JRQA 5DT4A 4JXFA 3UIMA 4A07A 3QD0A 5HZNA 5EKNA 3MB6A 4P9VA 3PXFA 5HE2A 3PJ1A 3UP2A 2QO2A 4EOKA 5C26A 2QKWB 5I9WA 3DTCA 3SKCA 4U6RA 3BKBA 4FSNA 2WQBA 4XP2A 4ENXA 3D5WA 5CEMA 2VD5A 3IW7A 4ENYA 2P55A 2MQIA 1Z57A 3QWKA 5I9VA 4NFMA 4CD0A 1O4IA 3SA0A 4YP8A 1DS5A 2BKKA 3OWJA 5DT0A 4JT3A 3P4KA 2QOFA 4V0GB 3OXTA 2FSOX 2NP8A 4WUAA 4YJSA 2WMSA 3PXYA 4AW2A 4FG7A 3QUPA 4DH7A 4FEWA 3EN9A 2IVTA 3V5JA 3OWKA 2BILB 3NAXA 3W2OA 2BZJA 4GU6A 4M8TA 4UEUA 3MYGA 3OEFX 3FPQA 3VS7A 3FMJA 4NUSA 4EH3A 2IPXA 4K44A 3VO3A 4Q5HA 3ZEWA 3O17A 3QXOA 3QCSA 3GP0A 5FXQA 5DMZA 2X4FA 4ZLYA 1AYAA 3LFBA 5HTBA 2P33A 4HGEA 2XS0A 4TRLA 4XLVA 4WRGA 1LPUA 1O4EA 3RHXA 3NNXA 3NNVA 2CHLA 1XBAA 4I93A 3TCPA 3C0IA 1M52A 3F5XA 4BCNA 3SV0A 2CGXA 4ZS4A 4EOIA 3R63A 3S3IA 5HNBA 5KZIA 4JBQA 5H9BA 3ZRLA 5FTGA 4MBJA 3W8LA 3MB7A 5AA9A 2XRUA 3BUOB 1WFCA 3DAEA 1KE9A 3KKVA 2W9ZB 4MXCA 5CSXA 3SXSA 4WHZA 3UC3A 3N84A 4BR3A 5HU3A 3US4A 1W83A 2I0YA 3K5UA 4F6UA 3K2LA 1O42A 4HCVA 1PW2A 2JBOA 1W82A 4RPVA 4PTGA 4Y5QA 3U55A 3HMOA 3VS2A 4F08A 2C30A 2OSCA 1YI3A 4RVLA 4C7TA 4ERWA 3VUTA 4EYMA 3O8UA 5HO6A 5BO4A 5JKGA 1CSNA 3HIZB 3C50A 3DFCB 1UA2A 1CWEA 4F09A 3ACJA 3FZOA 4KB8A 5CU4A 4CLJA 3OD6X 4BGHA 4XUFA 4RWJA 5AUUA 3VIDA 4IX3A 3BHUA 3CC6A 3ZO4A 3CJFA 2HXLA 5IZFA 3EKNA 1R1SA 5CAOA 4RIWB 2DYLA 4IB0A 2ETMA 3E63A 2WELA 3GCUA 1H27A 2WMXA 1SVGA 2PVYA 4GIIA 5CXHA 4GJ3A 5ANDA 4KABA 5HTIA 2WOUA 4O7RA 3EQPA 5LOHA 1YWVA 1BF5A 2W1DA 4MYGA 4AW0A 4DFZE 1OL1A 3F5GA 1IJRA 2CKPA 3Q3BA 4GRBA 5CT0A 4BTJA 4DEDA
chains in the Genus database with same CATH superfamily
4QP7A 2V7AA 5DI1A 3R8PA 2JIUA 4I21A 4XEYA 4DG3E 1TCEA 2H5KA 3MSSA 4EHGA 1ZZ2A 1P13A 3KFJA 4D9TA 2UUEA 4ZZMA 2X6EA 3SLSA 2B54A 4LV8A 4B4LA 4XV3A 3QD4A 1HCLA 4BIEA 4YZMA 3I60A 2CKOA 5M44A 4QD6A 4BKZA 4UXQA 5KKRB 2VGPA 2IG7A 3N51A 4CCUA 3GFEA 2X2MA 5FTOA 3R7YA 2KULA 3OWPA 3MFRA 2X8DA 1AB2A 3F3VA 3ZS5A 4MHAA 5FRIA 5EH0A 3UDTA 2PVJA 2L4KA 4R7BA 3RM6A 1WMKA 2CI9A 5DR9A 1MRVA 4N57A 4E68A 2A0CX 4TT7A 4XJ0A 5I9ZA 1LUMA 1Q8TA 4X6RA 1QPCA 2QMSA 5DRBA 3TJDA 3CXLA 5KMIA 4OTDA 2BAJA 2PVRA 1O6YA 3BGPA 4JBVA 4WRSA 1SPRA 3FJQE 4D4VA 2QOHA 4D2VA 5BUIA 4HVHA 1AYCA 4Y72A 4NK9A 5C8NA 1WZYA 4MF1A 4RT7A 3WZUA 3KA0A 2ZAZA 4WWQA 5CF8A 4RLLA 3FKLA 4U8ZA 5BUJA 3QX4A 5AAEA 4AZWA 2VTLA 2ZM3A 3OG7A 4AN3A 3VRNA 3TDWA 5JH6A 2XCKA 1W7HA 2F9GA 3DTWA 3LCOA 5ICPA 4J53A 5L8LA 3DZOA 3E3BX 2CCHA 3PA3A 1BM2A 3QTIA 3FZPA 1S9JA 3HUCA 5EHLA 3ID6C 3QC4A 2ECDA 3FDNA 4IXPA 5IG1A 2RFDA 2R3NA 2R3KA 2J7TA 3FQHA 4ZJIA 5D7AA 3QQKA 4MXXA 2Y6MA 4OBQA 2OZAB 3LFNA 5A3XA 5M57A 1JKKA 3BL7A 4JGHA 3JVSA 3F3ZA 2IVVA 3GU8A 4NFNA 4FKPA 5M55A 3W10A 3U6IA 5EEQA 3E64A 4DHFA 4MBIA 2JKOA 4ANQA 2XNMA 1O4HA 3FZTA 3F3WA 4HVDA 1RJBA 4C62A 4J1RA 1OMWA 3O2MA 4QQCA 4EQCA 1BL7A 1ZYJA 3PSBA 4FOCA 5E8TA 3WE4A 2LGCA 3V6SA 3MH2A 2FB8A 4EHZA 2OXXA 1OKWA 3CY2A 3WARA 3MAZA 2YFXA 2ITWA 4QDVA 4ANNA 5A54A 1JLUE 4BF2A 1KOAA 4QTDA 4WT6A 2YM8A 2OQ1A 3DK7A 2XIYA 4O7VA 4H34A 2HYYA 2XNOA 4ZJJA 3ZZWA 1R1WA 3WF9A 5E8YA 1DAWA 1FVRA 1CKPA 4R1VA 5AP6A 4ZSLA 3R2YA 2CI8A 4L3PA 4MNEA 2UZOA 5CU6A 4BYIA 2O65A 2CS0A 5KMLA 3QRIA 1G8KA 5AIRA 4A7CA 1BG1A 1BFIA 4UMQA 3P0MA 3BEAA 3DNEA 4O22A 4APPA 1GZKA 4LOOA 4NWGA 1XKKA 3DAKA 4O27B 1W2FA 2XZSA 4PMTA 2QODA 4KRCA 4DLIA 3GQIB 3NFFB 1KE6A 4I22A 3BYMA 2F4JA 4FKOA 3BCEA 4G3CA 5C8KA 5KBRA 5FXSA 4AN2A 1M7NA 3UDBA 5J9LA 3C7QA 3I81A 1XMMA 5T6KA 3NRMA 3VS1A 3NYVA 4HGTA 3BGQA 3QXPA 3W2PA 4X2FA 3POZA 5EHPA 4F4PA 3S8LA 3QTXA 4ZY5A 3R8MA 3ZC5A 5AP5A 2GHGA 3RAWA 3OT8A 4DGOA 3BL9A 5EHRA 2JDRA 1YDTE 3EL8A 2NRUA 2YAAA 4FIHA 1OGUA 4HNFA 4YGAA 4E20A 5FBNC 3A60A 2I40A 3R21A 3QZIA 3WF6A 4D2WA 3HNGA 4BKJA 4NCTA 4UALA 3V8SA 5CEKA 3U6HA 2YWPA 4IADA 3T9IA 4MF0A 4DLJA 4ALUA 4PP9A 2C4GA 2UZWE 1U4DA 2UW6A 4YC3A 3QALE 3LAUA 3UIUA 4XHKB 5CALA 3QGWA 4P5QA 3RKBA 2V7OA 4AX8A 4UYAA 4V05A 3TZ9A 3ZYAA 4KUJA 4QTEA 3UNJA 2Y9QA 3ORKA 4W9XA 4E1ZA 2JKKA 2VTRA 2Y3AB 4QP2A 1YWNA 5CF5A 2MK2A 4K6ZA 4AOJA 2FO0A 4ALVA 5J5TA 4A9TA 4AN9A 2ZV9A 4PDOA 3KN6A 2PE0A 2XKCA 3O8TA 5AIKA 5D12A 3PLFB 2J9MA 3PUPA 3Q4UA 5I0BA 3DXNA 2QG5A 2OF4A 4F1MA 3W0QA 4NCTC 3TV4A 3BYUA 2R7BA 3LMGA 3R1QA 4MH7A 3OF0A 4FIFA 3PYYA 5CQUA 3KIOC 1JKTA 1RE8A 3LCKA 2QOLA 5I3OA 5BX0A 4TYGA 2GNGA 4F0IA 3ATSA 5GNKA 4EJ7A 2X9FA 4AA5A 3ENHA 3LM0A 4FV7A 4FYNA 2C0IA 1PXJA 4BL1A 5HG9A 3FPMA 4MCVA 2GNJA 1G8JA 3D7TA 5J8IA 1Q8UA 2QOOA 3LCTA 5CZIA 2XM9A 1JSVA 1SZMA 3R7EA 2ETKA 3QF9A 3OCSA 4N4SA 3UVPA 5FDPA 4USEA 3F2RA 4GK3A 4WA9A 2OZOA 2PHKA 5E8SA 2EXEA 5JFWA 2GTNA 4CMTA 4KINA 2GPHA 3DBEA 4B8MA 4FKUA 2VWUA 5JGBA 4G5JA 4GMYA 5BYZA 2DM0A 4TZIA 2OG8A 3WBLA 4F9YA 2DWBA 3DQXA 4R78A 3AD5A 4J99A 4PPCA 5HX8A 4PL5A 5F94A 3W0SA 3LLTA 2Z60A 4FBXA 4FKRA 3EQBA 4AGUA 2ERKA 3CCNA 1M14A 3ZFXA 2JYQA 2J0LA 3QUEA 4RX5A 5EW3A 2EB2A 1PXOA 4U7ZA 3VQUA 3DNDA 5HCYA 1AOUF 1YXSA 3R73A 1D1ZA 5D9HA 3HV4A 2F2UA 2EYVA 4UYNA 2RG6A 2EO6A 2BHEA 5AV0A 1O47A 3F66A 3EH9A 4ZSAA 4O7LA 1FPUA 3KRLA 2BAKA 2AC5A 4ORKA 3EQGA 4Z7GA 2JAVA 3JS2A 3BUXB 3MJ2A 5TOZA 1R3CA 4FT3A 3CQWA 3EYGA 3GU6A 2F7ZE 3P7CA 3QCQA 5E8XA 5EK7A 3ZBXA 1Q8ZA 1BI8A 2PUIA 1TZEE 4M12A 4C36A 2YDKA 3T04A 1XWSA 3W8QA 4O4DA 2P2IA 1SHAA 4IZYA 1RQQA 2X8EA 4DEBA 4ZS0A 2QHMA 1IRKA 4DGLC 3B8QA 4AZTA 4EY0A 3UZPA 3DKGA 4QOXA 2VWZA 4EUTA 5KHWA 1BKMA 2UV2A 3TWJA 4AOIA 4N0SA 4JDHA 4IAKA 4TXCA 4XG2A 5FBOA 4BI1A 1A1AA 3O5AA 4UMRA 2CLQA 1LCKA 1M7QA 3C4XA 2W1CA 4TN6A 4IDTA 4G5PA 5CYIA 5FM2A 2QOCA 4GVAA 2E2BA 2WTDA 5ANJA 5FEEA 1E1XA 2VAGA 5TO8A 4C58A 4TL0A 1O46A 5LMKA 4U43A 1TFFA 3GCVA 3S8NA 4YJTA 1R0PA 1URWA 4BKYA 2BUJA 2XK6A 2YM7A 4X2NA 2GU8A 3KXNA 3PXRA 1ST0A 3NW5A 3C0GA 3B2WA 2QU6A 4QYYA 5H8EA 1RQQC 5H2UA 3Q4ZA 4K33A 4WUNA 1XH6A 5FD2A 3SQQA 4RMZA 2HCKA 4C4JA 1OKZA 3IDBA 1AOTF 2WXVA 4F7JA 3U54A 3CY3A 4MD8E 3VAPA 4MXOA 1XJDA 3NS9A 3TN8A 4KRDA 4E6CA 4F99A 1WCCA 3R9NA 4IAIA 4JQ8A 2HOGA 3NUPA 4ACHA 2C0TA 1P4FA 1OL5A 4RZVA 5HQ0A 3PWDA 3FC1X 5LMKC 4RC4A 2R9SA 3UPZA 2YABA 5JFXA 3NUXA 3ZSIA 3L8PA 4FZAB 4JDJA 4C2VA 1OIYA 4G2FA 1IA8A 4LMNA 3BUWB 4YBKA 4PNIA 3OCTA 2OW3A 3P7BA 3ZZEA 4ANOA 1I3ZA 4KSPA 4DC2A 1BFJA 1VEBA 4QMOA 2EU0A 3QUDA 3M11A 2QOKA 2H46E 1OPJA 2PSQA 3UYSA 3PSCA 1YVHA 1ZWSA 5CEQA 1UNHA 3HL7A 5L2IA 3KU2A 2C6KA 4IM0A 4YZDA 4XLIA 3G0EA 4FT0A 4FV8A 2IUIA 1YXVA 1SNXA 3MFUA 3CXWA 4M67A 3PFYA 1LEZA 3GCQA 4NH1A 4IWDA 3TNQB 3ITZA 1UNLA 4PDPA 4QMTA 4IZ5A 4TY1A 2SRCA 5BUEA 3V3VA 4F9AA 3H10A 5BVFA 2IJMA 3L8XA 3VF9A 3TL0A 3E8DA 4AT4A 4CKRA 4FGRA 1T46A 3C4WA 4DBXA 2MRKA 4AACA 1GZNA 5C01A 5K5XA 3FQEA 4U3ZA 3Q9WA 4CT1A 3MY0A 2BRMA 1GIHA 2X7OA 5IQCA 3ZH8A 4DCEA 4A9SA 3C5UA 3UODA 4W4YA 4X2JA 2RORA 2RL5A 1XH9A 1SMHA 4I6BA 4QNAA 2HXQA 2WNTA 4BDKA 4H3PA 2BALA 4NL0A 5BPYA 3D94A 3QA0A 3V04A 2R64A 3RGFA 4ZTQA 3UMWA 4GSBA 4ACCA 4CLIA 4DCAA 1BUHA 4FG9A 2HDXA 2HDVA 3F5UA 4AGWA 3IECA 2F7EE 4AA0A 3EZVA 3KK9A 4IB1A 2WU6A 5KMJA 4FV0A 3CTHA 3S1HA 2FCIA 2W1EA 2OICA 4UV0A 4WKQA 1M17A 3MV5A 2R3FA 3OY3A 4MNEB 4QNYA 5DT3A 3TZ7A 5L6PA 1NY3A 3Q2MA 3G0FA 3IG7A 1OI9A 1CTPE 1P2AA 3I6WA 3ORNA 3RVGA 5FP5A 3WF5A 4D2RA 4ITHA 1A1CA 5AR2A 3FMEA 4EH2A 3LOKA 1D4TA 3QYZA 2VO0A 3ULIA 4DGMA 2E9PA 5L8KA 2PLEA 2C3LA 3MA3A 3KQ7A 2GFCA 2GS6A 3EFLA 4EQUA 4YU2A 5LQFA 4RVTA 4KS8A 3UYOA 1FQ1B 3LJ2A 3TKIA 2YA9A 3GC9A 3I7BA 4IM2A 5GZ9A 3ZLSA 5IA3A 1IS0A 4DGNA 3MPMA 3TNWA 1A07A 3KRJA 4YUQA 1JAMA 4EH9A 2XH5A 2Z7SA 3WI6A 4YC8A 3WZKA 4KIPA 4RJ4A 4FVPA 1OITA 3TM0A 3LPBA 4TWNA 5IQFA 1G83A 3VHKA 1YVJA 2XMYA 2CGWA 3LFDA 4UMTA 3WE8A 4C3RA 4DAWA 2XIRA 1KC2A 4FL3A 2YCQA 4G16A 2UVYA 4JAIA 3FMMA 3QA8A 4RFMA 4RC2A 5F9EA 4GCJA 3HA8A 2BR1A 2DLZA 4EOJA 3MXCA 1NZVA 3LXNA 5D7VA 3DOGA 1PRYA 3C13A 3K3JA 3LFCA 3UYTA 4GV1A 4YJVA 3FLYA 4G6OA 4C3PA 5JZJA 3LJ0A 3LQ8A 4JIAA 4HPTE 4QMSA 3Q9ZA 3E8NA 3GBZA 4QP4A 3KXMA 1W2DA 4QMWA 3VULA 2XANA 2VV9A 1SKJA 1I09A 3HV3A 4BZNA 4XNEA 1JSUA 2W1FA 3AD6A 3HKOA 4YJOA 3T8OA 1FHSA 2R3MA 3HHMB 2KGYA 4XBUA 2XIKA 4RA4A 4EC9A 4G6NA 4USDA 4YNOA 3W32A 4BBEA 3DU8A 3OHTA 4QP3A 2PU8A 3B8RA 4C8BA 5CX9A 2CKEA 4FV2A 4QO9A 3D0EA 2RIOA 3IOKA 3D14A 4P90A 2A19B 4XZ0A 3PLSA 1O4KA 4F64A 2XB7A 2RF9A 1O4NA 2Y8OA 5E4HA 1MUOA 5L6WL 1FYRA 3R9OA 3FMNA 5EYMA 4G3FA 4QMYA 4ASXA 3LMHA 3THBA 2DS1A 3ALNA 5F95A 5AR3A 3V5TA 5EW9A 3HDNA 3SRVA 3V8WA 4DE4A 1FMKA 2WFYA 2VZ6A 2YIWA 4XCUA 2DX0A 1UU8A 5JZNA 2HK5A 3VRZA 4Y83A 4M7IA 2C6DA 2VO7A 3A4OX 2R3GA 4CFXA 2Q83A 1QADA 1YDRE 3DLSA 3DBDA 3SHEA 1YWRA 3ZDIA 3CGOA 1GZ8A 3FLZA 5KUPA 4NJ3A 4L42A 4DA5A 2WPAA 4D0XA 4XG6A 5D41A 3KMWA 3MIYA 1WBNA 2AOAA 4FNXA 5DC0B 2GDOA 4MNFA 4IWOA 2K79B 1YI4A 4PDYA 3DS6A 3GQLA 3QZGA 1O44A 4ANMA 3TZMA 4NW6A 4QP1A 2F49A 5KMMA 2JEDA 1ERKA 2QLUA 4X21A 3TV7A 4MUQA 2R4BA 5I9UA 2WAJA 2WQMA 2X81A 4O7NA 4ACGA 4C2WA 5AEPA 1BKLA 1PICA 5F20A 4LM5A 4X3JA 1OL6A 4EH6A 2VTPA 4IIRA 5CU2A 5AP0A 1YI6A 4BTFA 4M0ZA 3O8PA 3H3CA 4LL0A 3D83A 1RW8A 4W4XA 5DH3A 5CU0A 3PXQA 2ITVA 1U5RA 2WMAA 3DDPA 3HCKA 3MGYA 4L00A 3RWQA 2WMBA 3VJOA 4EOQA 5AAGA 4PL3A 3VROA 2HUWA 4Y85A 3VNTA 2QO7A 1H28A 5AV1A 4ITIA 2CNVA 3OVEA 5GJHA 2G01A 5KAZA 4FIEA 4IVDA 3RJCA 4BVUA 5BV3A 3K5VA 3BRBA 3O7LB 3WOWA 3ATTA 1WBPA 1PMEA 3GQIA 5L6OA 3EQHA 5EM6A 3GXWA 2PVNA 4PV0A 1LR4A 4L52A 4QQTA 3CSVA 2PYWA 3DAJA 4OW8A 4G34A 2IO6A 4EBVA 3KULB 4QMMA 3V5WA 5L4QA 4D5HA 2Q0BA 5GINE 3ORIA 2ABLA 4L68A 4S33A 5HVYA 4ANSA 3RZFA 5JK3A 4FV4A 4OTGA 5DGZA 5LVNA 1JOWB 4FSYA 1O43A 1O4RA 3LVPA 2J90A 4YJUA 5HICA 1FBNA 2WTWA 4YJNA 2ZM1A 4BWXA 4AGCA 5AULA 1WBOA 4JG8A 2ITNA 2AUGA 2IWIA 2OH0E 1W0XC 1ZZLA 2VTSA 4FUXA 4JR3A 2BAQA 4U41A 1PF8A 4ANBA 1KOBA 1TZDA 3DA6A 3ELJA 5FEQA 3RALA 4LOQA 1M2PA 1SHBA 3BBTB 2X2KA 1V0OA 4D58A 2XAMA 3ZLWA 4D2TA 3BU3A 4C37A 5D10A 2GMXA 5EOLA 2W4KA 3AXWA 3GU7A 3ORLA 4ZTRA 3VUHA 1PXIA 2ITUA 2REIA 1HOWA 2ZMDA 4L43A 2AEGA 1YHWA 3FLWA 3FE3A 4PUZA 1YOMA 4OAVB 2I6LA 4I41A 2V55A 3A8WA 2PWLA 3BYOA 3IGOA 3NIEA 3C1XA 3QU0A 4FIGA 4RG0A 4KBCA 3R9RA 4JAJA 2XYUA 3II5A 4D1XA 3LXPA 4F6SA 2JIIA 4KKHA 4CQEA 4OHLA 3MFSA 3UIXA 4CFMA 4A06A 2ZDUA 3B2TA 2VTIA 3ORXA 5HIBA 3UVRA 3IQ7A 1ZYSA 5LVMA 4PRJA 1G8SA 5CLPA 3DK6A 4JQEA 1LEWA 4YO6A 4CKIA 2C5OA 2KTYA 3IONA 1WBTA 3GENA 3QYWA 4FSQA 4TWCA 3SW4A 4EH8A 4OAUC 4RA5A 2GSBA 3TKUA 4F5BA 1L3RE 4MD7E 4O83A 4ZXTA 5A6NA 2GQGA 2XK4A 4EK4A 5AFVA 2VTOA 3R8ZA 3REPA 4DHIB 2X2LA 4FTQA 1GOLA 5IMXA 5C4LA 3NFGB 1OPLA 2GHMA 4LV5A 1BYGA 4FOBA 5A14A 2OFVA 3QKKA 4YTIA 2ZJWA 4RC3A 2QONA 3MJ1A 4K9YA 5CEOA 3O7LD 4I6FA 1SM2A 2CGVA 1AYBA 2Y4IB 4ACDA 1UVRA 4LYNA 4FTOA 4BDCA 4V01A 2O0UA 3I6UA 4EHEA 2GNHA 3BGZA 4IX6A 4CT2A 3UZRA 4UX9A 3QD3A 3ROCA 5C03A 2CLXA 2PMIA 2JDTA 3Q6WA 4GFGA 4XG7A 5DFPA 1E1VA 1OECA 5AP1A 4DTBA 3FKOA 3O96A 2WTJA 3H0ZA 5IQIA 2YIRA 5HKYA 5AM6A 5ANEA 3CPBA 2OJGA 3CGFA 3RK5A 3A62A 5E8WA 2JDSA 5EI8A 4EORA 1H1WA 5AV4A 5AXIA 5C27A 4DT9A 4DG0E 4CVAA 5HE1A 4D4RA 2JC6A 3GC7A 4GYIA 4DITA 1F5QA 2GQSA 5M06A 4XG3A 3MVLA 2JFMA 2P2HA 3UTOA 2DVJA 3TKHA 3W18A 4MXAA 2GS2A 4E73A 3DBQA 4G3EA 4G9CA 5FWKK 4Y5HA 5GJGA 3BYSA 4ASEA 3Q2JA 2O3PA 3P86A 3A7GA 3FMDA 4R6VA 5EOBA 3LMIA 3GB2A 3EYHA 3Q9YA 4O0YA 3R8VA 2XJ1A 3AC4A 3QTSA 3FEGA 4FNYA 3HUBA 1PYEA 4MBLA 3W0OA 2PUNA 4F0GA 5HO8A 4G3DA 2HWOA 5CVGA 4BTMA 5DR6A 2GQRA 2AOBA 3IN7A 2V0DA 2JFLA 2VWBA 2O5KA 3BU5A 3OCBA 4TYJA 5AUTA 3KMMA 3ANRA 3FC2A 5AX3A 3VUGA 3U87A 3UBDA 3TG1A 1NW1A 2PNBA 4IX4A 2I0HA 3E7VA 5HBJA 2MRJA 1PKDA 4DGGA 3P7AA 4ASZA 3NUAA 4FK3A 5EYDA 3S4QA 4FSUA 4XBRA 3R7UA 5KE0A 5J1VA 4TYHA 3F7WA 2UW7A 3C5IA 2Q0NA 3VUDA 3UPXA 5IA1A 2JITA 4FV9A 5DIAA 3ZXZA 2W06A 2WKMA 3MY5A 3MVMA 4YLJA 2VGOA 3LKMA 3GCSA 1YXUA 3LFQA 5LWNA 3D2IA 3NR9A 4DDIA 5H8GA 3PP0A 1NT2A 4L67A 3UIBA 5ETFA 3RPSA 5JRSA 4BRXA 2GNFA 4FICA 4IANA 3AMYA 4ZIMA 3ANQA 5HBHA 2PNAA 5B2LA 1CMKE 1BLXA 1O4QA 2EXMA 3MVHA 4OHHA 1H00A 1MQBA 3EFJA 2G1TA 3I5NA 4KS7A 2P3GX 4FKGA 1OB3A 4FV1A 3ORPA 5HNGA 4FJVA 1BX6A 4DFYA 4IC8A 5M4UA 5HE0A 5IDNA 1Q3WA 4L3LA 2WQNA 3W33A 2V62A 3CJGA 1TQMA 1K9AA 4ZOGA 1GNGA 1MRYA 4AW1A 4U45A 4LOPA 1UNGA 2BRGA 5EW8A 1JYRA 3ZDUA 4YMJA 4AAYA 4Z3VA 3RK9A 4H39A 1A9UA 3CPCA 3NVKI 1LP4A 5ANKA 3SRVB 4S34A 5HTCA 3Q32A 3RM7A 1GRIA 5E7RA 3DFAA 2RFSA 1FU5A 4K45A 3UNKA 4ZY6A 5E8ZA 3EKKA 3ZO2A 4KIQA 3VW8A 5FEDA 2HAKA 2R5TA 4YSMA 4ZEGA 1J3HA 3D2KA 3PQZA 4D2SA 5EELA 3VBXA 2BVAA 1XO2B 3WZJA 1O4PA 3IKAA 4L7SA 4KKEA 5HCXA 5KBQA 2RG5A 4EL9A 2RVFA 3VBTA 3AOXA 3TT0A 1E9HA 4LUEA 4F59A 1QL6A 1WAKA 4RBLA 5JGAA 1ZY4A 2PK9A 2YISA 4CV9A 3ZRMA 4U17A 2J51A 1LCJA 3DPKA 4GFOA 4I0RA 2ERZE 1ZOHA 4JJRA 3D5VA 3R02A 5A4CA 4O6EA 4NYEA 4QT1A 4JVGA 4DEGA 1SVEA 4TTHB 4XX9A 2IW9A 4BJJB 1AD5A 1CKIA 3CS9A 4I6QA 4IZ7A 4RLKA 4E3CA 2PZ5A 5HHWA 4AGDA 3LQ3A 3QAME 5CT7A 2YERA 3H30A 1IEPA 2VWVA 4D28A 5LCJA 3R8LA 2PMNX 3ERKA 5DG5A 3RAHA 1WBSA 4ROJA 5AP3A 1O4AA 3KREA 1O4BA 4ARKA 1Q8WA 3CKWA 4I4FA 4B9DA 4UN0C 3BLAA 4PNKA 2ETZA 1UU7A 4QMUA 4JX3A 3RWPA 4CSVA 3GGFA 4FKQA 3Q60A 4DG2E 2HZ0A 3KY2A 4F7LA 3TACA 3H9RA 4PTCA 4YPSA 4K1BA 1X8BA 4O1PA 3V5PA 4HVSA 4H58A 3LCDA 3OUNB 4HVGA 4GPLB 3UZTA 1QMZA 3BLQA 3EB0A 4D8KA 3IPHA 1O4LA 4A9YA 4CMOA 4O86A 1FBZA 4MXZA 2XKFA 2VX0A 4EOSA 3HMNA 4B8LA 4YURA 1H8FA 4EONA 4BYJA 3BHTA 4C33A 4LL5A 5LVPA 2P0CA 3HVCA 4M84A 4O4BB 2IW8A 1CDKA 2IEWA 2X39A 5GJDA 1B6CB 1WVWA 3FI4A 3EHAA 4JBPA 1U59A 4XRLA