4K2RA

Structural basis for activation of zap-70 by phosphorylation of the sh2-kinase linker
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
613
structure length
551
Chain Sequence
PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDFGLSWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ZAP-70
total genus 162
structure length 551
sequence length 613
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4k2rA05
1.10.930.10 Mainly Alpha Orthogonal Bundle Syk Kinase; Chain A, domain 2 Syk Kinase; Chain A, domain 2 4k2rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4k2rA04
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4k2rA03
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4k2rA01
1FVVA 4PDYA 2W1HA 4G9CA 3GU4A 4J7BA 3R8VA 4CLIA 1WQUA 5J3XA 3F7WA 4OHEA 5AULA 3A61A 3MFUA 2MK2A 3W10A 1DI8A 3D7TA 4UMQA 5BVNA 4IAIA 1UU8A 3P86A 3MY1A 5TR6A 1Q5KA 2OXYA 2OJGA 2PY3A 4KNBA 4YO4A 2WZJA 3MVMA 4FKIA 4P4CA 5DN3A 3UMXA 2IN6A 1ZOEA 2W05A 4FTQA 1O4IA 1V0PA 2YISA 3KEXA 3UVQA 4BIEA 5ICPA 4IIRA 4TXCA 5DVRA 4Y5QA 3NYVA 3KXMA 3SQQA 3HRCA 4MHAA 1RW8A 4FT5A 4MXXA 4XJ0A 4EH6A 4DCEA 1A48A 3MVLA 2XJ2A 2PZPA 1Q61A 1E9HA 2YWPA 4M67A 3EJ1A 4GS6A 4JJRA 4D2PA 1OL5A 3RPVA 3LMIA 4G3DA 3FMNA 4AXAA 5ETAA 4WBBB 3ATSA 3AD5A 1OECA 4A9RA 5AV2A 3B2WA 4Z7HA 3OOGA 3QFVA 3W33A 3O96A 3Q4CA 4IZAA 4X6QC 3CGFA 5JQ8A 4XZ1A 5K0XA 2X2LA 3R8PA 4ANSA 3PXZA 4FICA 3A7IA 3K3IA 4L7SA 5D12A 3BYUA 4GK3A 4FL2A 3R63A 2YCFA 1J1BA 1AGWA 4U45A 5EW8A 4H1OA 3IQ7A 5EW9A 3A7HA 2FUMA 3FYKX 4DH1A 5J9LA 2OJIA 4BIBA 4C2WA 3TNQB 1Q8WA 5DIAA 2LQWA 1BYGA 4Q2AA 3R1SA 1XA6A 4YTFA 2C9WA 2ZB1A 4YHTA 3NW6A 2WXVA 3UQCA 1DM2A 1F5QA 3VS7A 5KBQA 1U5QA 4EOLA 4FTIA 3RWQA 2B4SB 3MY0A 2K7AB 5I9WA 3IGGA 2WMRA 2QOCA 4DGLC 1R0PA 5HVKA 4RX7A 3KXGA 3LFQA 2PU8A 5BX0A 1KV2A 1NVQA 2OU7A 1YHSA 2UW8A 3C5UA 2IVVA 3D5WA 3F5UA 3GOPA 3Q9WA 4ZSJA 2GS2A 3UOLA 5IF1A 1SKJA 5FXRA 1TCEA 4YTCA 3FXXA 2YHVA 4DEEA 4I4FA 3WOWA 2F4JA 3QHRA 3DAKA 4GYGA 3MXCA 4LUDA 4PL5A 2A0CX 3TCPA 4K6ZA 3FLZA 4B4LA 4FIFA 3FZSA 3KK9A 2PHKA 4IHPA 3R73A 4ANLA 2YDJA 2AOBA 3FLSA 4GK2A 5BQ0A 4I20A 5M08A 3TWJA 2W1CA 4BDFA 3RWPA 3L8VA 2C69A 1OUYA 3WYXA 2ITVA 5I9YA 3FV8A 3UIUA 2Y9QA 4ZTMA 3GXLA 5HE1A 3UO6A 5KNJA 3SDJA 4CT2A 2R4BA 4CFVA 3FMKA 4R7HA 2YM6A 3VHKA 4AT5A 4BN1A 5IISA 1G3NA 1LR4A 3DLSA 4DEBA 4EH7A 1A1BA 3OROA 1PYXA 3NDMA 4FBXA 4DN5A 3RM6A 3ZDUA 1QADA 1MRYA 3HIZB 2X7OA 2YEXA 3QKLA 5E1SA 5FM2A 3LCOA 1IASA 3VRYA 2QOFA 3SGCA 2PE0A 2OZAA 2VTRA 4DAWA 2UUEA 3UOKA 4FE2A 4CD0A 4FKUA 4AGUA 3OFMA 3PJ2A 3FLYA 5HG7A 3UG1A 3UP7A 3VS2A 4F70A 5CAPA 5KMJA 1A1AA 5AP2A 1U54B 4QMZA 1O4LA 4BWPA 3EQHA 3R1QA 4D1ZA 4XG4A 4NJDA 3OY3A 4NL0A 2VTNA 2XIKA 3E5AA 3R7GA 2V55A 3O8PA 4FKGA 4IZ5A 4UV0A 3FMEA 1M2RA 3G33A 4PPCA 4KA3A 3PWYA 4ARKA 4FV3A 4BZNA 4CKJA 2R0IA 3WF7A 3O7LB 1H1PA 4CYJA 2XS0A 4JEGA 2IZSA 3SKCA 1XH9A 1OKWA 3OCSA 5DGZA 5CANA 5AADA 3SG9A 3NR9A 3V04A 3KCFA 3T3UA 2OF4A 5AA9A 3OY1A 2IZUA 2C3LA 3I5NA 4FOCA 2XVDA 4ITJA 2BHHA 2NRUA 3COMA 1ZY5A 4XS2A 2BMCA 2BAJA 3VUDA 1BHHB 3CKWA 4IAAA 4YSMA 4BTFA 2DCRA 1O4QA 5HCZA 2UZVA 3ENHA 3SW4A 2GTMA 2HW6A 3H30A 5EI6A 5L2WA 3FEGA 4CCBA 3A4PA 3DJ6A 3N8MA 3AT3A 1NT2A 1O4MA 5H9BA 2KNOA 4FYOA 3I60A 5ACBC 4MXAA 2VTLA 3DY7A 3KMUA 3NUXA 2ZMDA 3BHVA 5JFVA 4DF3A 2XNPA 1MILA 4U9AA 4IZ7A 2HAKA 3PP1A 2QOBA 3VS3A 4XG7A 4JQ7A 4IJPA 4XEYA 3AT2A 1TKIA 1LKLA 2HWPA 3R30A 4OBOA 4EJ7A 3CPBA 1WBPA 4PV0A 1FBVA 1PXJA 2AUHA 2XK4A 3DGKA 4L53A 2ZV2A 1MRUA 2QOHA 4NKAA 2BAQA 5A6NA 2F2CB 3TUDA 3FPMA 3MA3A 3R1YA 4G6LA 1PMVA 4O82A 5TOZA 3WARA 3DS6A 4F6UA 5JEBA 4RX9A 4X6RA 5D11A 4IM3A 5D0JA 4E4XA 3ORMA 4NUSA 4RWJA 2Y1MA 2XBJA 2ONLC 1YHWA 4G3FA 4M3QA 5DC4A 5A4TA 3BUMB 5KUPA 3C5IA 3OTUA 4HGLA 4FTUA 4O6EA 4FIIA 2ZB0A 3FHRA 3HRBA 4EOQA 2O63A 5JZJA 3TG1A 4ASXA 4CZTA 4ZOGA 1TQMA 3P7BA 3LCTA 3AC2A 3JS2A 1Q8YA 3PY3A 3MESA 2HMHA 4D8KA 4OT5A 4CGAA 3OWJA 3KXXA 1GAGA 2E9PA 3HL7A 2PVYA 5HCYA 4BTKA 4NM3A 4ITHA 1BMBA 1ATPE 2HELA 4J53A 3KA0A 4DG3E 4C4JA 2W7XA 4U40A 1BUHA 2VAGA 4ACCA 3MJ1A 3VQUA 4LG4A 5ETIA 4P5ZA 1KOAA 2X6DA 2YIYA 3AC1A 3KRJA 4FIHA 2WU6A 4O0WA 4YJQA 4ZTLA 4CTCA 4DGNA 4F0IA 2GPHA 4V0GA 2X8IA 4TYIA 3V5TA 3HMIA 1ZYJA 4ASZA 1LUNA 2FA2A 3ET7A 3ORLA 2DWBA 1M7QA 1IG1A 3PPJA 3C7QA 3KXNA 3W16A 4I5MA 3DKGA 4ZZOA 3GCUA 3KF7A 4Q9ZA 4BDHA 4D4YA 2JKQA 3QTXA 3IGOA 4OHHA 5EHOA 1P2AA 2EB2A 1JPAA 4OTWA 4YHFA 5E8VA 3UIMA 3DTWA 5D41A 3ZDIA 2CJMA 4DBNA 3RINA 3RVGA 2ZV7A 2B9FA 4F9CA 1VJYA 3C51A 1XQZA 4FV9A 4EI4A 4USFA 5L2SA 2ZDUA 3QQJA 4L8MA 3R7VA 3ZFXA 5CF8A 5LMBA 5J9YA 4MYGA 1WCCA 4K77A 3ORIA 1J1CA 2HWOA 5AP6A 2BROA 3GGFA 4CFWA 2B0QA 4DFBA 1BKMA 3EQIA 5IPJA 4JAIA 3BBWA 4W4VA 3UPZA 4CV8A 3QD2B 3LXLA 3LXNA 4AZSA 3AD4A 3SRVB 4D2TA 5DFPA 4JVGA 3Q4TA 1SHDA 4I5HA 4AZWA 3HKOA 2YLEA 5KMOA 3GQLA 3E88A 2J50A 4A9SA 1A1CA 2QU6A 1S9JA 3F66A 5CY3A 4BZDA 3FMDA 1OPKA 4O0YA 4FTNA 2I1MA 4QP8A 4AS0A 3SXFA 4RVTA 4BCQA 4DFXE 1SVEA 4JBQA 4PF4A 3ZH8A 5DC0B 4IVDA 4YU2A 3NAYA 4FV6A 3EHAA 3B8RA 3WA4A 3O7LD 1M27A 4UX9A 3GU7A 3CD3A 2V0DA 4F65A 2JDRA 1O4EA 2CCHA 4EH4A 2OH4A 2OFVA 3IW4A 3U6JA 4DG0E 1O46A 2P4IA 2OLCA 4QYGA 1W82A 2R2PA 1JSVA 4O0XA 4XV2A 4ZSAA 1Z57A 4FKLA 2CLXA 4CKRA 4B7TA 3P7CA 3WIKA 1OO3A 2LNXA 2K79B 3F9NA 3QX4A 5DEYA 1XH8A 2GMXA 1GIIA 2I7QA 1PW2A 1BG1A 3O8TA 5DF6A 5IA4A 3TNPC 4BFMA 2BFXA 4QOXA 4ENYA 3DB6A 4KBKA 4Q9SA 4YZCA 3BGPA 1Z9XA 4HNFA 3DBDA 5AP0A 2WIHA 3FQSA 2WMUA 4A4CA 3BI6A 1BX6A 2VNWA 4HGEA 3OXZA 1A9UA 4WA9A 3GXWA 4CMOA 4X6SA 4XV9A 3VJOA 3EL8A 3LMGA 3QQLA 4RFYA 5L2TA 4GU6A 2QG5A 4MWHA 4BDBA 3OUNB 3D94A 3GFWA 3SLSA 4F7SA 1BKLA 5F9EA 3IW6A 1L3RE 4TW9A 3W2PA 1BM2A 3FLNC 4G3EA 2VTOA 3ETAA 5DBXA 4EYJA 3GC7A 3W55A 4FBNA 5BMMA 5LJJA 3CXLA 5LARA 4XBUA 1R78A 3CR0A 4C8BA 4F5AA 3DXNA 5K3YA 5EQYA 4KKHA 4M68A 1H25A 2ECDA 3VHEA 3OB1B 1O6LA 2J51A 4KKEA 2UVYA 2PZ5A 4EBVA 1HCSB 2UZNA 3M2WA 1WFCA 2RFEA 3KN5A 5EI8A 5AUVA 5HTBA 1B47A 3C4WA 3S8OA 2XM9A 4BKYA 1GRIA 3ZXTA 3RGFA 3QQFA 3HP2A 3I81A 3NHNA 2CS0A 4EWQA 4JGHA 4C58A 4D1XA 2CDZA 3E7OA 2B9HA 4A06A 3CGOA 5C1QB 3EQFA 4TPTA 1YRPA 5CXHA 2Y6OA 3SHEA 3FY0A 2CHLA 4G1WA 2PZRA 3E3BX 4AA4A 5CSHA 3F6XA 2YM8A 4KD1A 4LGDA 4LMUA 3DXQA 4CG9A 4IEBA 4H36A 2RFSA 2IW9A 1SM2A 3Q6UA 3RNYA 2PYWA 2YIRA 4DTBA 3PXYA 1J7LA 1H07A 4FTJA 4WRSA 4EORA 1QPDA 3JY9A 3BHYA 3FMJA 4O2ZA 5IA5A 3ZONA 1JKSA 1O4AA 2YAAA 1ZOHA 2YA9A 4JE4A 4C4IA 4WO5A 1RJBA 3HV5A 3LPBA 4G5JA 4YPDA 3GT8A 5LMKA 3MAZA 5C9CA 2P33A 4ONAA 4OAVB 5D1JA 4BGHA 4F63A 5J7HA 5AV3A 3PA4A 3QCYA 3KVWA 4FI1A 5KHXA 3MB7A 3SXRA 2VWWA 3FL4A 3C4XA 2VNYA 5IA0A 1KOBA 4IX3A 4WSYA 3R7IA 4KIQA 4FKPA 4XOYA 3PQZA 3QU0A 3TJCA 3GXXA 4QP6A 1H1RA 3KMMA 4X21A 5CQWA 3QRJA 5BVDA 2ZOQA 4K44A 3GP0A 4E7WA 2WELA 4GRBA 3QGWA 5CQUA 2C3JA 5AV0A 3A8XA 3PRFA 3D2IA 5EG3B 4AGWA 2EUFB 1Q4LA 1W98A 3P78A 4O38A 4F0FA 3FLWA 3HDNA 3LLAA 1KC2A 2E9UA 4BCGA 5E8UA 4AZFA 3VBVA 3R2BA 4E20A 4HYHA 4MVFA 4R1YA 3GENA 3BV2A 4C4FA 4BDJA 1FU5A 3KN6A 4TT7A 2J0JA 3PDTA 4AOTA 3ZM9A 4O7YA 4AX8A 2VGPA 4UXLA 2BZJA 4FSNA 1JQHA 3HNGA 4IE9A 3V01A 3CLYA 2QCSA 2GS7A 2OIBA 2W1GA 3NUYA 3FSFA 3UYSA 4D0XA 3BUNB 4L44A 1PXMA 2VZ6A 4R7BA 5J8IA 5CLPA 4NM0A 4BHNA 2XNEA 2CCIA 3QC9A 3SA0A 4H3BA 3TM0A 2ITTA 1PKDA 2IVUA 5IU2A 4I3ZA 3BYOA 5JRQA 2PLEA 4B8MA 5AEPA 4E5BA 5F20A 4ANBA 3U51A 3TACA 5IH6A 4TZIA 2VWZA 3FC1X 4WG5A 5AV1A 3F69A 4A9UA 4I1ZA 4R3PA 4F7LA 1YWNA 3JYAA 3QA0A 4HGSA 4QMMA 3AXWA 5CWZA 1JLUE 3EH9A 3EQCA 4AAAA 4S32A 1W83A 3RM7A 1BLXA 1TVOA 4U80A 3LHJA 5TO8A 5I9XA 4IADA 2WQEA 3LLTA 5HORA 5EYMA 2P2HA 4A4OA 2R3HA 4NJ3A 2BKKA 4F5BA 3P5KA 4GJ3A 4TWNA 3HZTA 2HY81 3F5PA 4J96A 3MPAA 1BI7A 4C35A 3PLAE 4IC8A 2WTVA 3ENMA 4ID7A 5CALA 2H6DA 1L8TA 1UA2A 4M15A 4OAUC 4IAKA 2DM0A 2G2IA 1O4BA 1GIHA 1JSUA 2WMSA 5AX3A 4WNKA 2ZV8A 3PSKA 1LEWA 5EYDA 1OL1A 2MQIA 4JQEA 5J5TA 4L6QA 4A9YA 1P5EA 4L7FA 2YDKA 1H01A 3ORPA 1ZYLA 5ANJA 4QT1A 3ZS5A 5F95A 3QWXX 1JKKA 2G1TA 4W8EA 2OI4X 3PLSA 4I6QA 2HK5A 4IFCA 3PIYA 3QCSA 2RFNA 1TQIA 2QLQA 3KFJA 4TN6A 5AUUA 1O4DA 5D9HA 1U59A 5E8YA 4ANOA 5IA2A 3RBWA 5LWNA 4I93A 2XK3A 4BBFA 2C6MA 5IQDA 1H24A 2P55A 2WMBA 2Z7LA 3AT4A 3PUPA 3WI6A 2XYNA 4AN2A 4OLIA 5L8LA 5E7RA 4U3YA 5L8KA 1MRVA 3IK3A 3FMHA 2XP2A 2XB7A 4XG3A 3ZO4A 1YQJA 2J0LA 3VUIA 4N57A 4MD9E 4MAOA 2XCHA 2GFCA 2C5YA 3NYNA 4G6NA 2OO8X 4IB3A 4OHLA 5EDQA 2AUGA 4MCVA 4V04A 1Q41A 3QZGA 3ID6C 2H46E 2PVNA 2BHEA 1LUIA 2OICA 4JDJA 4F7JA 4EZ7A 2H8HA 3QQKA 5L6OA 4N4SA 3SOCA 2L4KA 4A07A 3VUKA 3TDVA 4J99A 3FZ1A 3LFCA 2VN9A 2XBAA 3ZYAA 3EFJA 5DA3A 5K4IA 1LUMA 5DG5A 2WTKC 2VWUA 2YERA 2CPKE 3HGKA 1VYZA 3PG1A 1GY3A 3ROCA 4DH8A 1O4CA 5AXIA 1FPUA 2BTRA 4QQTA 3IW5A 3R2YA 1FINA 3TNIA 4JX3A 3ORNA 5I9ZA 1YI3A 3P1AA 3LFSA 1ZMVA 4O7TA 4KIPA 2QURA 3S1HA 4XG9A 2XNBA 5BYYA 5J1VA 2CGWA 3ZFMA 3ZSIA 1IA8A 1CDKA 2OSCA 3ZLSA 5E9EA 4DLIA 5A4CA 1ZWSA 4WNMA 4X3FB 5CU3A 4ZTSA 1F2FA 2XKEA 3FI3A 2F7XE 4CVAA 3C50A 4FSTA 2VTJA 2WMVA 4NFMA 5L2IA 5FQDC 4HCUA 3R8MA 4BKZA 2XIXA 2JDSA 3FWQA 3I0QA 3ZC6A 4BCIA 4F1TA 5HIEA 3UIXA 4F1MA 5AR2A 2BRNA 3SX9A 1AOUF 3BHHA 1BFJA 2QOKA 5DT3A 4GPLB 4QP4A 2C5VA 2B52A 1MUOA 3R7YA 4F4PA 2ZYBA 2O65A 2R0UA 3IW7A 1OKVA 3DB8A 2Z7QA 4NW5A 4QRCA 5ACKA 3FPQA 3R9DA 3N9XA 4RA4A 4AA5A 2BRMA 4P2KA 2IUIA 1WMKA 2J5EA 5L6PA 1OIYA 4FNWA 3H9OA 4PTCA 2R3RA 4FGBA 4U43A 2EXMA 4LGHA 4BDIA 3V8SA 3NUAA 4UYNA 2C1AA 3A7GA 3NLBA 2J0KA 4BDCA 3OF0A 4QP3A 3R71A 3G9LX 4HCVA 2V5QA 4O7ZA 3OV1A 3IKAA 4IWPA 4ALUA 4HVGA 3K2LA 5FTGA 4EHEA 1YVHA 5HTCA 1UV5A 3QALE 4CCUA 3E63A 1JKLA 3PJPA 2P3GX 4QMNA 3MH0A 3M11A 3DK6A 4GFMA 4DH3A 3DAEA 1MQBA 1YDRE 3EYGA 4CFFA 4RWIA 3OCTA 4JBPA 2PUIA 4EK8A 3PVBA 4GCJA 4ZZNA 5HQ0A 3VROA 2RKUA 3UC3A 4KRDA 3CKXA 4GG7A 2KULA 5CSVA 4K1BA 1EH4A 3NYXA 3MGYA 3QD4A 4K11A 2PVJA 2ZM3A 1VZOA 1NZLA 4XUFA 2R5TA 3CTJA 2C5OA 5H8GA 3LFAA 3PZEA 5JMSA 5D7VA 2YZAA 3U6IA 2QOQA 2JDTA 4GKHA 4QP9A 4K2RA 3RPOA 3UMWA 1O4GA 4FEVA 3OP0A 5LVOA 4MD7E 4PQNA 3LFFA 4BCJA 4O1OA 2ITXA 2HZ0A 4C0TA 4MBIA 4PMMA 3EL7A 4XRLA 4L42A 1O49A 5C8KA 4LMNA 4UALA 4ACDA 2R3FA 3OW3A 3U9CA 5JSMA 3QLGA 2KK6A 4CV9A 5EM8A 4F64A 2F7EE 5FLFA 2DUVA 1LEZA 3BYVA 4QMVA 4UMRA 4IXPA 3V8WA 4QQ5A 1Y8YA 1U54A 5IQIA 3CQWA 4FK3A 3B8QA 4ZAUA 2R3NA 1UU7A 2Y0AA 3Q32A 4LYNA 1YVJA 2E2BA 4D9TA 4UB7A 2HCKA 3TZMA 3ZRLA 5EI2A 4TL0A 1JSTA 2KTYA 5HNGA 3EAZA 1FGKA 1M17A 5EH0A 3QUEA 1AOTF 3FZPA 5EQEA 3MFSA 3PSBA 3WF5A 3DAJA 4TYHA 4X3JA 4ZJJA 3HMMA 1OUKA 3FDNA 3JXWA 1JKTA 4K33A 4L68A 2PULA 2AC5A 3TTIA 3VF8A 4KWPA 4KSPA 5GZ8A 4MXOA 5M53A 2CGXA 1YXUA 2C6KA 2HXLA 2O0UA 3VW8A 1NY3A 4DA5A 3HDMA 3OB2B 3EYHA 4B6LA 5HO8A 4D4RA 3OS3A 5M07A 2CIAA 5K0KA 4JIKA 4OBPA 4I94A 1A81A 4H58A 5CZHA 2C3IB 3BU3A 2JKOA 4L52A 4F08A 3NUNA 4AZVA 5HX8A 2WD1A 2EWAA 2WAJA 4H39A 4R7IA 3P79A 2V22A 1SZMA 4ZLYA 4NK9A 4OTIA 4CEGA 3BKBA 5FD2A 4O84A 1JVPP 4U7ZA 5LMAA 4U3ZA 3LJ0A 4JIAA 4X2FA 1LP4A 2YCRA 3R28A 3VNTA 5IA1A 3S0OA 2UVZA 2HENA 1I3ZA 5KE0A 4DGMA 1PXKA 2W1IA 1MQ4A 3W8QA 4EH5A 4BDGA 3HAVA 4W4XA 4RIYA 5TF9A 4LV8A 1O4FA 3UZPA 2CKPA 1B39A 3FI2A 2BCJA 1UNGA 4OBQA 4XP3A 3R8ZA 3RPYA 3TT0A 1A09A 3HRFA 4LOPA 5H8BA 3C9WA 3OT8A 3D7TB 5J79A 4CRSA 1E1XA 2V7OA 4EEVA 1IR3A 3DU8A 3O23A 3QQUA 5AWMA 3ZOSA 3FXWA 4B0GA 4NT4A 3FI4A 3DCVA 4PY1A 2ACXA 3GI3A 3EN9A 5CT7A 1FGIA 4AACA 4EH8A 4EQCA 1XH5A 1R1QA 3FUPA 1GJOA 3KULA 1BKXA 4O0TA 4HW7A 3ZTXA 1MP8A 4JG8A 1NVSA 1OB3A 2WEVA 4YNOA 4C33A 3UTOA 4KRCA 4E4NA 4E1ZA 1D4WA 3CCNA 5IQCA 3QTIA 4RX5A 4F9WA 4FKTA 2EB3A 2VV9A 2QOOA 5K5NA 3BU5A 2ETZA 4IC7A 2WMAA 3PLFB 4E6DA 4CFXA 3F3VA 4D1SA 3K5VA 4FTMA 5M51A 3ACKA 2WQOA 4TYJA 1BI8A 1URCA 3RI1A 4EUTA 2UZLA 4LGGA 4OTPA 3Q9YA 5EK7A 4FL1A 4OW8A 4V0GB 4ZJVA 4Z7GA 4IANA 2WTCA 4GL9A 3C13A 4WWQA 2OFUA 5IUGA 4KB8A 5AUZA 5HGIA 2W1FA 3NVKI 2IUGA 2JAVA 2HOGA 2VTQA 4AT4A 3ZZWA 2YZLA 2V62A 2W99B 1JOWB 5DNRA 2YABA 3G51A 3R7UA 3G5DA 2EU9A 2CN8A 2PZYA 4YJUA 5HD7A 4BF2A 4G6OA 4D9UA 5CAUA 2X9FA 3OC1A 2X8DA 2QG7A 2IUHA 4GU9A 3QA8A 3AMYA 4ZY6A 2GE9A 3C0IA 4W9WA 4ACMA 3TZ9A 3MDYA 5IZFA 5LVPA 4JDKA 3CY3A 4I6BA 3VRZA 4WNPA 1ZYCA 4HVDA 5HBHA 4GWFA 5EHLA 5ANEA 5AAFA 4EZ5A 4QYFA 4O1PA 2PE1A 3C4CA 5LOHA 4OR5A 4CSVA 3QX2A 2HYYA 2BZKB 3FE3A 3AGMA 3P08A 2FB8A 2GNJA 2J9MA 4JBOA 4FTKA 4F6WA 4ORKA 2REIA 4QYEA 4S33A 2W4OA 5FP5A 2PTKA 2JBOA 5IDPA 5E92A 2FCIA 2WMWA 4KIOA 4M8TA 4Y8DA 3ZO1A 2XK6A 4J1RA 5AV4A 1YHVA 3Q5ZA 5KMIA 2X7FA 3VULA 4EZ3A 2GS6A 4FTCA 3VBXA 1K3AA 2PPQA 4JI9A 2VTIA 3COIA 5FM3A 3FZOA 4QMQA 2FGIA 2VGOA 4Z16A 1XBCA 4LRJA 3BYMA 3W2CA 3NNVA 3W2SA 3CXWA 4IVAA 3FJQE 5FDXA 4BI0A 4LL0A 3CC6A 3R9NA 2EVAA 4IMYA 4CTBA 3P4KA 2CNUA 4IVCA 3AC4A 3NIEA 1O42A 1O48A 1RJAA 5HICA 4EOOA 2JIUA 1CSZA 4RVLA 4CZYB 3VBQA 3BE2A 4QTBA 4XV1A 1CMKE 4RFMA 4APCA 1IRKA 1QL6A 1UU3A 5HO6A 4UEUA 3EQGA 1OL7A 4QTDA 5E91A 5EYCA 2QMSA 2RORA 1W84A 2PVFA 4YJSA 4O22A 5FG8A 5JFWA 4DHFA 4ZTQA 2OG8A 4FZ6A 3DJ5A 3BZ3A 4FOBA 2PSQA 4PUZA 3LQ3A 1FQ1B 4E3CA 2OXXA 3EOCA 4RT7A 5E8WA 4C3PA 1IS0A 2DLYA 5GZAA 2B54A 4J71A 4EC8A 4FF8A 2C6LA 1Q8ZA 4GVJA 4PNKA 2O64A 5HESA 4QMOA 4U44A 4BHZA 3GU8A 4D28A 5CI7A 1O4OA 5GNKA 4YLJA 1YXXA 3PJ8A 4BIDA 5I9UA 3GC8A 4MF0A 2BRBA 4IQ6A 2A1AB 3O50A 2YAKA 5CZIA 4DEIA 2YCQA 3UDBA 3V51A 2OQ1A 3Q9XA 1QPCA 3HV4A 4FC0A 5LVNA 5DMZA 1OPLA 3QLFA 3RAWA 1GOLA 2PVHA 3MBLA 4AOJA 4BC6A 2QODA 2VD5A 5HHWA 3WF9A 3EFKA 4YR8A 1KWPA 1U46A 1Q8UA 1UNLA 4UXQA 4E4LA 5HIBA 3REPA 4FV0A 4K9YA 2RG5A 1BL6A 4FR4A 4JR3A 3S95A 3PIXA 3UGCA 4MF1A 3E3PA 5LMKC 5M44A 1Z5MA 4E6CA 3CJFA 4QP2A 3QWJA 3NW5A 4P7EA 3VUMA 3SG8A 5EHPA 2RGPA 5BUEA 2XK7A 3LM5A 1M2QA 2YCSA 2JKMA 2OBJA 5DHJA 5BYLA 3UZTA 3CIKA 4ERWA 3DA6A 2W0JA 3MVJA 3O8UA 3QZHA 3ZLYA 4EH9A 2OGVA 2R3KA 4UWCA 5J5SA 3T3VA 4I23A 3IW8A 3PXRA 4OTFA 4YP8A 5L3AA 4NSTA 5CNNA 3W2RA 2OH0E 5AP3A 2R64A 3RZBA 1A06A 1KE9A 3OUKA 2J4ZA 2OZOA 3IMJA 1PMNA 3SC1A 3QD0A 3VC4A 2ITPA 1XKKA 4BZOA 3GNIB 4UWYA 2ITYA 3PWDA 5HD4A 3H0ZA 3BLRA 4UWBA 1JYUA 5I6VA 3BIZA 2EYYA 3ERKA 5EDPA 2O5KA 2ETKA 4QTCA 2WO6A 4MBJA 4W8DA 1ERKA 1REKA 4BWXA 1SHBA 4APPA 4E68A 4KKGA 1ZRZA 3EN6A 1RQQC 2ABLA 2SHPA 4EJNA 3O51A 4PX6A 4FSQA 5EG3A 3E62A 4IDVA 5BMSA 2NO3A 4PPBA 4DFLA 3C0GA 3P7AA 4DGOA 3UOJA 4YTHA 3NS9A 4XZ0A 4HJOA 2WTIA 4YZBA 4MH7A 3VRQA 4RQVA 1ZXEA 2XIRA 4GG5A 2ITOA 4OTHA 5JH6A 3QWKA 2JIIA 2R3GA 3WZUA 3NNUA 5I3OA 4X2JA 3I6UA 4CXAA 3VWAA 2JBPA 5AP5A 3D2KA 4KINA 3TV4A 3TV7A 1KV1A 1REJA 2WKMA 4FEUA 1B38A 4CT1A 2A2AA 3BRBA 4YC8A 1T46A 3PRIA 2BVAA 1F0QA 4AP7A 1ZFPE 1M14A 1KE5A 3OWKA 2C6IA 3BLHA 5B2KA 4NFNA 4TRLA 5HTIA 2XA4A 1IA9A 3H3CA 2R3QA 3L9MA 4HYSA 4M66A 3U8WA 3N84A 1RDQE 3ZZEA 2WQBA 5AR8A 2YITA 1PKGA 5CF5A 4GUEA 3R9RA 2RIOA 4IX6A 4GUBA 4IB5A 2AOAA 3COHA 3GU6A 2JDOA 1DAYA 4O7LA 2PUPA 4IW0A 3OCBA 4NYEA 5FWKK 5AUWA 3DBQA 4BDKA 4M69B 4GV1A 5K9IA 5CU2A 2Y7JA 3QBNA 5HOAA 4R8QA 3TN8A 2BBUA 3BU6A 4U97A 2F7ZE 3ALNA 5DR6A 3DLZA 4RBLA 1FHSA 2WTKB 3DBEA 3IDCA 3ACJA 3S3IA 2RSYA 4GYIA 3HECA 2ITZA 1O44A 2RVFA 1R0EA 3QCXA 5E8SA 2YIWA 3PJ3A 4ZS0A 4EH3A 4J52A 1LKKA 2MRKA 1GIJA 4NWFA 1WBVA 2QHMA 3QRTA 2BTSA 3ZHPC 5CXZA 3CY2A 4DINA 3U55A 3QTWA 4R3CA 1UVRA 5A46A 5H8EA 4L1BB 4G3CA 4AW5A 4E93A 3SV0A 3QUDA 3S2PA 3BEAA 3OWPA 5M56A 4L00A 3BCEA 3QWYA 4RVKA 5T68A 4O86A 3QXPA 4YGAA 3ZO3A 4LI5A 3RHKA 4NU1A 2ETRA 4WBOA 4GW8A 4Y83A 3RPRA 3LFDA 3NUPA 1ZY4A 3L8SA 2AYPA 2Y8OA 5ANGA 4ZY4A 5BVEA 4BGQA 1WVXA 5JKGA 5JFXA 5B0XA 3CTQA 5LCJA 5I9VA 3A62A 4EQUA 4EUUA 4QPSA 4KAOA 2UZBA 2OZAB 3QXOA 4TKSA 4UMTA 2WTWA 2XF0A 3DTCA 1V1KA 3NWWA 4AGDA 4GFGA 5BYZA 4DG2E 1X6CA 4C59A 4M97A 3P9JA 2UVXA 3PE1A 4BCPA 5BNJA 2GCDA 4G31A 3TNHA 3UG2A 4YJTA 1PXLA 4FSUA 1OBGA 3OHTA 4DFUA 1XH7A 3EWHA 4YZNA 2BDWA 5IH5A 1OPJA 4D4VA 1X27A 3PXKA 3T9IA 4XX9A 2OF2A 2DVJA 4CMUA 2XJ1A 5JZNA 3IPHA 1YDTE 5ANOA 4FX3A 2I40A 1KE8A 2X8EA 3ZUVA 4QMLA 4RIWB 2ZAZA 2ZM4A 5IEXA 2FSTX 4FT3A 2X4FA 2UZTA 1YW2A 2JITA 5CI6A 3H9FA 1U4DA 3OW4A 4FSZA 4JNWA 4KABA 4V01A 3T9TA 3UYOA 1YKRA 1YXSA 3F3WA 4MNEA 5DRDA 3K2MA 1YXTA 4R78A 5KZ0A 3V5PA 1H0VA 1SVGA 2J5FA 4QMSA 4FKQA 3OP5A 3PYYA 4E5WA 1SMHA 2L6KA 4BCOA 3QTUA 4YBKA 4CMTA 4JRNA 4ZSLA 4O7SA 3JUHA 2CRHA 5HG5A 3ZSGA 3EQDA 4R77A 1OVEA 1H26A 3PVGA 2FVDA 5EYKA 3MSSA 1KSWA 2Y3AB 1BHHA 4BBEA 1XWSA 1ZARA 1WVYA 2OJFE 1PHKA 1HCLA 3VBTA 1FVRA 3D14A 3LXKA 1GNGA 3QTSA 2XYUA 5I3RA 4HCTA 4BCHA 1SPSA 4BI2A 1OMWA 2C1BA 3AMAA 3R6XA 1H1QA 5ANKA 3IN8A 3FKLA 4RWKA 5AP7A 1OO4A 4JR7A 3FC2A 2VRXA 3C4ZA 4ITIA 3GEQA 5A9UA 4XP0A 4GIIA 4PMSA 4G34A 2VTSA 4ZJIA 4RA5A 3DJ7A 4NIFB 2XIYA 3T8OA 2EU0A 3PXQA 2X9EA 4GT4A 4C2VA 4AZTA 3UVPA 2ETMA 2RL5A 2ITWA 5DOSA 2JFLA 2WEIA 4J98A 5HU9A 2J0MB 3LM0A 4ZZMA 1AYAA 1G8SA 2CNQA 4QNYA 4JXFA 4O21A 5IA3A 4CG8A 1FBZA 2EYZA 4D5HA 4M0ZA 2LQNA 2VTPA 5I4NA 3RAHA 2GNIA 2C0IA 3LMHA 4GSBA 3OT3A 1XHAA 3FBVA 3DFAA 3QRKA 3RCJA 3TKIA 3GB2A 4U79A 5EM5A 3MH2A 1ZYSA 4E26A 3KRXA 4JX7A 1BLJA 1I09A 3FQHA 3GBZA 2VWIA 3KKVA 4A4XA 2AC3A 2X0GA 3Q53A 4I6FA 2QOIA 5HU3A 4XH6A 5BUIA 1CJ1A 2QC6A 2Z2WA 4I24A 2JEDA 4G5PA 1SHAA 2R3LA 3L8PA 4GFOA 4TZRA 4O7RA 3D9VA 3V6RA 4XP2A 5TT7A 4DEDA 5J7BA 5IMEA 3EN5A 2PUUA 3H10A 5EKOA 2IZTA 1YWVA 3WE8A 2UW3A 3DK7A 1B6CB 4IX4A 5M4FA 1O4PA 2F9GA 4O0VA 1JU5A 4XRJA 3VS4A 3MJ2A 3NEWA 2H9VA 1UNHA 2QD9A 2R3PA 3MY5A 3VBWA 3MPTA 1O9UA 4QMXA 2EYVA 4C61A 4ZTNA 2IJMA 2J90A 3NGAA 4JOAA 5DR2A 5EHYA 4EKKA 3BELA 4C57A 4RC4A 3LOKA 1O45A 1JBPE 2GQGA 2J0IA 4IWQA 4G2FA 4X3FC 3ALOA 4MNEB 3RHXA 4D5KA 2BZHB 2PZIA 3KMWA 5M57A 2LCTA 3L1SA 1ZZLA 4EK3A 4LV5A 1UURA 5B2MA 3VW6A 2H5KA 4MXZA 4GKIA 3F5XA 3U54A 2GNFA 2WTDA 5JGDA 2VTAA 3GQIB 4QYHA 2PL0A 4UBAA 3US4A 3QQGA 1MW4A 2JLDA 2X4ZA 3Q52A 4N6YA 3TEIA 3UPXA 4AQCA 5C8NA 1R39A 4WOVA 3DQXA 4ZTHA 4FZ7A 5G1XA 5M06A 1QMZA 4I5CA 2C6TA 4AE6A 3QD3A 1STCE 3BWJA 3V8TA 3WILA 5ANDA 4AW0A 3C0HA 4Q5HA 2WPAA 3EKKA 2PNBA 2Q0BA 4FKSA 3MIAA 3WZEA 2QO7A 2GHLA 1DS5A 5TE0A 1QPJA 2YJRA 4WUNA 4Y73A 5EKNA 2W1ZA 1M61A 3LFBA 4J97A 4C3FA 3DKFA 3DKOA 4AFJA 3MN3A 3PP0A 4LRMA 2W5HA 3Q9ZA 1OITA 2PE2A 2WTJA 2C6OA 4AOIA 4NWMA 1UWJA 1YI4A 4GK4A 2I0EA 2Z8CA 1YI6A 3G6GA 2VWXA 3VQHA 4BCNA 1KE7A 3NRMA 3PZHA 3DDPA 4AW1A 4FEXA 3ITZA 5CS6A 4YNEA 5A3XA 1R1SA 2H96A 4GEOA 4PMTA 3OTVA 3PPZA 3WZDA 1LCJA 2CBLA 4QYYA 2UZUE 3O71A 3OZ6A 3VS6A 3E8CA 1OGUA 3KGAA 1URWA 3BQRA 3KB7A 4FKVA 4GJ2A 4RLKA 3QL8A 5AIRA 1H00A 3TNWA 4DFNA 3TL0A 1DI9A 3EACA 4EONA 2HZIA 4BTJA 4E73A 4IDTA 3ZEWA 3ZLWA 5J95A 2C0OA 3D5VA 1OKYA 3I79A 3MA6A 2XNGA 3CEKA 4KUJA 1JNKA 2PLDA 3LIJA 2QI8A 2UV2A 3GOKA 1Y6BA 3ZXZA 4ACHA 4ZLOA 2DQ7X 1QPEA 3KRLA 4QMPA 2RF9A 4RC2A 2QR7A 1WBTA 2CLQA 3FXZA 4NZWB 3PJCA 5IG1A 3N7YA 4YJNA 2PMIA 2J7TA 1T45A 2CI8A 5HE0A 4XG8A 3VUTA 2XIZA 2BPMA 4WKQA 5C26A 1O4NA 5AJQA 2WMQA 3GQIA 3G0FA 3CP9A 3K3JA 4TY1A 4Y72A 4FIGA 3VUGA 4FKRA 1CKIA 4FK6A 4X3FA 4BCKA 5JN2A 4ENXA 4R3RA 4Y5HA 1GHUA 4KIKA 2XNNA 2F57A 3MTFA 4DH5A 1TZEE 4L3LA 3BHTA 1JWHA 4XV3A 1RE8A 3OEZA 1IJRA 1Q24A 3A2CA 3QUPA 3S8LA 2NNWB 4X2GA 3PFVA 3FQEA 2XNMA 4WG4A 3ANRA 4BKJA 1JYRA 3VRRA 3OXIA 5FDPA 3QC4A 5E8XA 4O7WA 4BCFA 4L67A 4DGXA 3S4QA 4O6LA 2Q83A 2PVLA 3KRRA 2X7GA 2VO6A 3TV6A 3TTJA 4C34A 5KMMA 2VWVA 2UZOA 1P4OA 3V5LA 4K0YA 4F09A 5CEMA 2A4LA 4LRKA 5CU0A 3LKMA 4OTGA 3SVVA 2ITQA 5AP1A 1XBAA 3VF9A 4QP7A 5GZ9A 4C62A 4GIHA 4QPMA 2XZSA 4ZSEA 4ZY5A 2I6LA 3CBLA 4XOZA 5DH3A 1TQPA 1WBOA 5CAQA 3R7EA 3NYOA 3QTQA 3W32A 2QKWB 5EDRA 5FEQA 5HCXA 2C4GA 3NUUA 5CSWA 1G83A 2VO3A 2JDVA 1PXPA 4FIEA 1KUTA 4AN9A 2C6DA 2FSMX 3ORTA 3UJGA 2VX1A 2BAKA 3ORXA 4AA0A 3LE6A 3QHWA 4ZXTA 4ACGA 2R9SA 4FT7A 4L46A 4E5AX 3U87A 3RNIA 4UMPA 4LQMA 4S31A 4E8AA 3EB0A 3IO7A 3TIYA 2QQ7A 3ORZA 4RIWA 4GT5A 2XMYA 3VO3A 4DFZE 4HVIA 4JS8A 3BE9A 5AR4A 3F88A 4R6VA 1ZYDA 3FLQA 5FXQA 4JAJA 4ALWA 5CEKA 4YBJA 3IMDA 5FXSA 1WAKA 2WB8A 1V0OA 2QOLA 4JRVA 3BGZA 5EOLA 4DGPA 4O81A 5CT0A 5DR9A 4CFNA 1OKZA 4W4WA 2BRGA 3KL8A 5IKWA 4TTHB 1KA7A 4RJ5A 4D58A 2VTTA 4QMWA 3FAAA 3ULIA 4H1MA 3A4OX 3MPMA 3WE4A 4FV2A 2BRHA 3A7JA 3NNXA 1V0BA 1YOJA 2O3PA 4BDAA 4MXCA 5HLPA 1ND4A 3KU2A 5GJIA 1CSYA 3RJCA 2VX3A 3KREA 4FTOA 5AUYA 2X6EA 1OM1A 2CMWA 3II5A 4O0SA 3TUBA 3D4QA 3LCDA 3PS5A 4O27B 3C7IA 1SNUA 1RQQA 5FP6A 4AN3A 4U1PA 3NSZA 3HCKA 4I0RA 4ZTRA 3ZO2A 2OK1A 4CZUA 4J8MA 5KMNA 1CKPA 4AG8A 2ZDTA 2WFYA 3ANQA 1OIRA 3NIZA 1FOTA 3OXTA 3COKA 4PDOA 4XLVA 3TZ8A 4YO6A 3Q2JA 3AGLA 3E87A 3NMUF 4FG7A 1SNXA 4EOSA 4X2NA 4S30A 3ZBXA 4HZSA 4YZMA 3IONA 4IB0A 4FV5A 3ZCLA 5FGKA 4C38A 4ERKA 2QO2A 4M84A 4Z9LA 3MI9A 5CASA 1VR2A 1KA6A 3R1NA 3QKKA 4AZEA 3RZFA 2E9NA 2DLZA 2BZIB 3JVSA 1FBNA 2YM4A 2W1DA 1CTPE 4UYAA 3MVHA 3FY2A 4RJ3A 1OBDA 4ROJA 3FMLA 4C7TA 5CEOA 1OIQA 4FKWA 3E8EA 2HZ4A 4F9AA 2WQMA 3MH3A 4W9XA 5M4UA 3E64A 4RSSA 3QYZA 3EN7A 5FBNC 4EBWA 4IAFA 5KX8A 1ZAOA 3W2QA 5IUHA 1SPRA 5IQHA 4BICA 3BUXB 4I0SA 4TYHB 4JBVA 3TKZA 4M7IA 2MRJA 2QNJA 2VTMA 3HMNA 4RJ4A 3LQ8A 2ITUA 3QRUA 5EM7A 4O83A 1W0XC 1LUKA 4NWGA 1HCKA 3A7FA 5HKWA 3ULZA 3O17A 5HKZA 4IBMA 5EHRA 2B7AA 3ROYA 4NKSA 3KF4A 2JYQA 1O41A 4QMUA 5CF6A 2WIPA 5LVMA 1GZ8A 3GCQA 1XO2B 4RPVA 4C4GA 3OVEA 4YJPA 5AIKA 3CTHA 4QTEA 4XCUA 2GTNA 4XLIA 3VUHA 4IAYA 2NPQA 2ESMA 3EN4A 4EYMA 3U6HA 3UQGA 3BUWB 2BILB 3KULB 4MEDA 4U41A 2VWBA 3ZUUA 2BIYA 3NCGA 2IW6A 4PMPA 3MB6A 2WNTA 2X39A 2IWIA 1M7NA 3BQCA 3UBDA 4EK5A 3JR1A 5DT4A 2W9ZB 4WG3A 3SD0A 4WRGA 2XJ0A 1OL2A 2CKQA 3DNEA 4M12A 1XH4A 4MKCA 2JAMA 4KS7A 4XHKB 1Q3WA 3PSJA 5IEVA 5HI2A 2ONLA 1ZZ2A 4HYUA 4DC2A 4EOKA 5A6OA 5HKMA 2YIQA 3R0TA 3NPCA 4U8ZA 4B8LA 3D5XA 4F1OA 2C5NA 3VRNA 2W4KA 1PJKA 2YJSA 3NX8A 4HPTE 5HVJA 3V5QA 3G15A 5BO4A 1AYDA 1SYKA 4DTAA 5J87A 3HEGA 3VBYA 1D1ZA 3EKNA 3GUBA 3Q3BA 2XK8A 5FTOA 4AGCA 3EQBA 1YOMA 2HUWA 5IBMA 5KMKA 5EELA 3EZVA 1YOLA 4ANMA 1Q62A 3THBA 5J9ZA 3TXOA 2ZJWA 2C3KA 3HP5A 2GQSA 4EH2A 3FSKA 4A4BA 1CKJA 2X2KA 4FODA 4FZAB 4FVRA 4RRVA 4EK4A 3F2AA 3KRWA 4ZSGA 1UUSA 1AD5A 1PYEA 4HPUE 1WBWA 2X1NA 1O4HA 3R8UA 4D4SA 4AWIA 4ZMFA 2BDFA 5IQFA 4B9DA 2E9OA 3IN7A 3KFAA 4BY9E 4NW6A 3FL5A 5EQPA 1IAHA 3N51A 5C8MA 4C3RA 3VS0A 1K2PA 4IVBA 1I44A 2A19B 4GH2A 5IUIA 5L4QA 4M69A 3HV7A 4ZLZA 5CAOA 3QYWA 2WMXA 5IMXA 3QF9A 3HA6A 4D2VA 3OG7A 1GZNA 4I41A 5EEQA 2UW6A 2BUJA 1H1WA 3G9NA 4FG9A 4BBMA 1WBSA 4KSQA 5GJFA 3PJ1A 5FEDA 4DEAA 5IQBA 4DT9A 3CWGA 3M1SA 2W17A 3LAUA 4XG2A 2JGZA 1AB2A 3CD8A 3MFRA 2ERKA 2UW7A 4C4EA 4P9ZA 2R3MA 2XKDA 5HBJA 4C36A 1W7HA 3GCPA 5M4CA 4YLLA 1AYCA 4EKLA 4FNYA 2ITNA 3EMGA 4IACA 5CVFA 2PUNA 3PVUA 2WMTA 3B2TA 3PSDA 5AUXA 3R22A 5JRSA 3R8LA 4WIHA 2HDVA 1A08A 5DC9A 5CVHA 4PNIA 2CR4A 4XMOA 1NRVA 5CYIA 5A14A 3SOAA 3PXFA 3HUBA 5DT0A 4BRXA 4TNDA 1FU6A 5E8ZA 3IOKA 3ZLXA 1YDSE 4GT3A 5H2UA 2Y4IC 3MH1A 5CU6A 3Q04A 2RG6A 4DTKA 1Q8TA 3D7ZA 3ELJA 4XYFA 5IQAA 2Y1NA 5CDWA 4EL9A 4H3QA 3NW7A 2YFXA 3FI8A 2UW0A 3FKNA 3RKBA 3DNDA 3FHIA 5AA8A 4JG6A 2EOBA 4YC6A 5K5XA 3Q6WA 2O2UA 3V6SA 4UZHA 2YN8A 2B1PA 3TKHA 4EQMA 1XJDA 3AOXA 2OIQA 4RMZA 1BFIA 1X8BA 3QKMA 4O96A 5IDNA 5DPVA 4EOMA 3AMBA 4AFEA 5DRBA 4L01A 3P0MA 5DYJA 4BR3A 4BYIA 1ZLTA 3TDWA 3M7FA 5T3QA 3QZIA 4YHJA 5I0BA 2MC1A 4D2SA 3G6HA 5T6KA 2EKXA 4MXYA 4MBLA 1CWDL 4DEHA 1JYQA 3I7CA 1G5SA 2CGUA 3F5GA 2HIWA 2VUWA 4FNZA 4RIXA 4D2WA 4DITA 5M09A 5KAZA 3OOMA 5KBRA 3G0EA 1P4FA 5JQ5A 3TI1A 4YMJA 1J3HA 3LCKA 2IZVA 5F1ZA 4U6RA 2PVRA 2HW7A 4FSMA 4O0RA 3FZRA 3S8NA 2GNLA 3IECA 2HY0A 5F4NA 3SRVA 4DE4A 4MQ1A 3T04A 4P90A 4RGJA 3HV3A 2JFMA 3IDPA 3DBFA 3FKOA 3LCSA 1BF5A 1J7UA 5E90A 2XH5A 3WF6A 2WHBA 3I1AA 4ZS4A 3OMVA 4L45A 4PDPA 2GNHA 3PY1A 2QONA 4JL9A 4PL4A 4PTGA 5CNOA 5AP4A 5BVFA 3EFLA 3F61A 3HMPA 4WSQA 3V3VA 2PVKA 4A4LA 2C6EA 5M4IA 2PNAA 5CSXA 4EOPA 3RCDA 5HBEA 4PP9A 4RG0A 4GL9E 4AT3A 4PPAA 5CTPA 3F2RA 3ZRMA 1M2PA 2XRUA 4D2RA 5AAGA 4FV7A 1H28A 3RALA 1Y57A 5JGAA 3MYGA 2JKKA 4RIYB 4D0WA 4AUAA 1BL7A 4I5PA 3VIDA 4F99A 3RK9A 2OW3A 4GVAA 5CEQA 2UW4A 2PVMA 5IQGA 4HGTA 5GJGA 3CJGA 5C01A 1OI9A 3C1XA 1E1VA 5E1EA 2XUUA 3R9OA 3O2MA 4B99A 4I22A 3I5ZA 4QQJA 5C27A 3Q2MA 5KKRC 2YM5A 4I21A 4EHZA 3TUCA 2HDXA 4H34A 4IX5A 1APME 2V7AA 4MTAA 4YLKA 2GSBA 4CQGA 2WOUA 4S34A 4I0TA 4O0UA 4S2ZA 4YSJA 5KKRB 4RLLA 4F9YA 1F3MC 2CNVA 3MTLA 3UIBA 1R1WA 1H08A 2VO7A 3UP2A 3KXHA 1H4LA 4WNOA 1VYWA 2W06A 4YJRA 5B2LA 5HKYA 3LJ2A 3MS9A 1G8AA 3N4TA 5B7VA 4RZVA 2FSOX 1QCFA 4N6ZA 3BYSA 3POOA 2XEZA 3OD6X 5H3QA 3MW1A 4K8AA 5HNIX 2YIXA 5HZNA 4R5SA 1UKIA 3IOPA 3R04A 3K5UA 2XEYA 3Q60A 2PMOX 4J95A 4MWIA 4FMQA 2UW5A 3VS1A 4PRJA 5HO7A 1FYRA 3IG7A 5D7AA 2ERZE 4WD5A 3CQEA 3JVRA 2IVSA 2CGVA 4NM7A 3GVUA 4WUAA 5AR7A 2JIVA 2EO3A 4U42A 4M0YA 4IZYA 4FIJA 4LUEA 2UZWE 4FVPA 4NEUA 1VEBA 5IBSA 3F3ZA 3F2NA 4FZDB 3SAYA 3UODA 4DYMA 1CWEA 3LVPA 4QD6A 4C4HA 4ZMEA 3D83A 4IWOA 4CLJA 2W5BA 2W9FB 4FG8A 4QP1A 2X2MA 3DFCB 4FZFB 4BGGA 4QMTA 3GCVA 1AQ1A 3Q4UA 4JDIA 4Q5EA 2R7BA 3UVRA 1Q99A 4FA2A 3GFEA 2OIDA 5I5ZA 1U5RA 3DZQA 4F7NA 3L9PA 4L9IA 2HXQA 4JT3A 2Y6MA 3EFWA 4IFGA 2H34A 4KBCA 2OXDA 4YC3A 3V5WA 3ZEPA 4F0GA 4F6SA 4NM5A 5HLWA 3OWLA 3S00A 2Z02A 3TL8A 3W18A 4FYNA 4D55A 4FEQA 1IAJA 4I4EA 5E8TA 4Y95A 3LJ1A 2W4JA 5KHWA 1XR1A 3U4UA 4HYIA 4R1VA 4YZDA 4NH1A 2GHMA 4XG6A 2WOTA 5FTQA 3E8DA 3ODZX 3ATTA 3VN9A 2RSVA 5KO1A 4EHGA 4ASEA 2P2IA 5CENA 4FT0A 3BX5A 2R7IA 1O4KA 2C5XA 3UC4A 2B53A 3PG3A 5GIPE 4V05A 3EZRA 3OCGA 2Y4IB 5BVWA 1QG1E 5LCKA 3KQ7A 4FL3A 2CKEA 4YZ9A 3U4WA 4E4MA 4DGGA 5BPYA 1PXIA 2G2FA 3Q4ZA 4K45A 4EWHA 4TWPA 3H9RA 5AMNA 4LL5A 5LQFA 2E9VA 4UMUA 4FUYA 3QRIA 4RQKA 4EHVA 4O7NA 1OL6A 2B9IA 2XP1A 2GNGA 4IM2A 3LQ5A 4FV1A 4YPSA 3UO4A 5CEIA 5E4HA 5FBOA 4H05A 2PMNX 3F3TA 4ZK5A 4L3PA 5CVGA 4ASDA 2LNWA 5G6VA 5KZIA 3PY0A 4HVHA 5KCVA 3R01A 3WZKA 1O47A 4PP7A 3QGYA 5CX9A 4FEWA 1A07A 2BALA 2EXCX 2WGJA 3Q96A 4F9BA 4WHZA 2GDOA 3KVXA 4FSWA 1PMEA 3KC3A 3IDBA 3NCZA 1ZMWA 3BHUA 4L3JA 3UO5A 2QKRA 5BVKA 4G16A 2YSXA 4EIHA 3P23A 3RK7A 5IEYA 5GINE 3C4EA 4IWDA 2GSFA 4MNFA 5HIDA 3VAPA 5IH4A 2NRYA 2J6MA 4AU8A 4FV8A 4FGRA 4OTDA 3CS9A 4IB1A 1DAWA 1KE6A 5FRIA 3FZTA 2Z7SA 4ALVA 2Y4PA 3AG9A 2QU5A 4AW2A 3EQPA 4KIKB 2ZV9A 2ZVAA 1J7IA 3BLQA 3R02A 1OIUA 4LM5A 4DT8A 2F49A 4Z55A 3WF8A 2FH9A 2LAVA 3TJDA 4WT6A 5AFVA 4K18A 3OBGA 3ZFYA 4USEA 5L6WL 2DYLA 3QTRA 3BEGA 2FYSA 5HLNA 2BIKB 2XNOA 4G17A 2XK9A 3LFEA 5HE2A 3ZUTA 3VJNA 2CKOA 4F59A 2OJ9A 1O4JA 1Q97A 2B55A 2UW9A 5DE2A 4QPAA 5GJDA 4RWLA 3DDQA 4FTAA 3VS5A 4U5JA 3I7BA 3M42A 1XH6A 2SRCA 2IW8A 3DQWA 1LCKA 3DBCA 1WVWA 3OEFX 4MX9A 4Y85A 4EK6A 3BV3A 2XKFA 3KY2A 2DS1A 5FEEA 5HX6A 1Y8GA 3HLLA 5EOBA 1R3CA 3ZU7A 3AD6A 5DI1A 2YM7A 4UN0C 2G9XA 3LFNA 3W1FA 4E6AA 4Z3VA 3E8NA 4L43A 1OZ1A 2PWLA 1PMUA 1GZOA 1CM8A 4X2KA 2P0CA 3PA5A 4U81A 2W5AA 4XBRA 5ANIA 3R21A 5DWRA 5KMLA 4DEGA 4DFYA 4OUCA 2PK9A 2LGCA 2OWBA 4FVQA 4QO9A 2A27A 3BPRA 3ZSHA 4AE9A 2RMXA 4ZP5A 4U0IA 3E93A 2R3IA 3G2FA 1UU9A 4O91A 1H8FA 3A8WA 3QTZA 4OT6A 3R00A 3R7OA 4RVMA 3UQFA 4R5YA 5AM7A 3VGOA 3AC3A 1NXKA 3CE3A 3I0OA 3U9NA 3F7ZA 4MD8E 4EOJA 5CU4A 3QCQA 5BUJA 2UZEA 1PY5A 2L3TA 3HAMA 4FNXA 4G9RA 3ZM4A 1X0NA 3GCSA 1WZYA 3JPVA 5HG9A 3AC5A 4RJ7A 4USDA 4A9TA 2EXEA 3UZRA 3PE2A 3EIDA 3PIZA 4II5A 2XRWA 3D15A 2VTHA 4LOOA 4UZDA 3R83A 5K4JA 4QNAA 3NVMB 2CI9A 1M52A 3WBLA 4M13A 3BGQA 3PPKA 2IZRA 5GIOE 4KS8A 3N4UA 3VRPA 4CRLA 4HVSA 2Z60A 3MIYA 4RIXB 3UNJA 3KK8A 4BDDA 4FV4A 4YURA 3HA8A 2CN5A 1Q3DA 4J8NA 4BL1A 5L8JA 1NZVA 3HV6A 2WQNA 4FT9A 5A4LA 4TWOA 5M55A 5CAVA 2HZNA 4FTRA 2G15A 2YLFA 3W2OA 1HOWA 4DCAA 3UNZA 1PRYA 4EOIA 2IVTA 3A99A 4TWCA 3Q5IA 1Y91A 2GU8A 3L9NA 4OTRA 3MV5A 5AR5A 4YTIA 3RAIA 2BKZA 5JGBA 5FUTA 2R3OA 4H3PA 5HEZA 4O7VA 5JFSA 3ORKA 5HNBA 1PICA 2ZMCA 5DEWA 3MWUA 2BR1A 1ZMUA 2UZDA 1LPUA 2FSLX 2WU7A 4BYJA 1NVRA 3TZ7A 2IPXA 4FTTA 4HZRA 3HUCA 4MQ2A 1YVLA 4P9VA 2W1EA 1H0WA 3LXPA 2DX0A 4FSRA 2FO0A 2QR8A 5HVYA 1J91A 3S9KA 3LW0A 4N70A 3GC9A 1F1WA 1O4RA 5AAEA 2I0VA 4RJ6A 4PTEA 4YJVA 3HYHA 3NUSA 4E6QA 5ETFA 1NW1A 2C47A 4PL3A 4BB4A 4RC3A 3CSVA 3DXPA 4YJOA 2QHNA 4CFMA 1H1SA 3HHMB 3UF4A 4RZWA 5LVLA 2J2IB 3QZFA 2IO6A 4IM0A 4JDHA 4BWKA 4JLCA 3MXYA 5L2QA 3CQUA 3L9LA 5GJHA 2OJJA 1O6KA 2VX0A 4OTQA 3UE4A 3ZMMA 4A7CA 1BLKA 3IS5A 2R3JA 4EY0A 5A54A 5HG8A 4X0MA 1FMKA 4FKJA 1PXOA 3I6WA 1W8CA 4QTAA 4EC9A 3UOHA 4IAZA 3HX4A 4BVUA 5CF4A 4JQ8A 5J1WA 2OKRA 3L8XA 4TYEA 2XCKA 1CSNA 4TYGA 4ANQA 1A1EA 4LFIA 1LUFA 2VO0A 4KBAA 4TNBA 1Z3KA 4UY9A 3PA3A 4AF3A 5AR3A 5LWMA 3TKUA 4QSYA 2VWYA 3NZ0A 4I6HA 1H9OA 2XM8A 4O2PA 5BVOA 2I0YA 2C0TA 1Y6AA 4LOQA 5F94A 5GHVA 3UYTA 5C4LA 4P5QA 2EO6A 2QO9A 1FVTA 2YACA 3NAXA 3PTGA 2JD5A 1IEPA 5ITAA 3OBJA 1AYBA 2VU3A 2VIFA 5JT2A 2ZM1A 4RJ8A 3WYYA 4ANNA 1SVHA 2PMLX 3AQVA 4ZEGA 4CKIA 2EL8A 3F82A 2Q0NA 3GU5A 4FTLA 4C37A 4IJ9A 4DBXA 3DPKA 4NCTA 3RMFA 5JK3A 4NTSA 3HMOA 4RIOA 1PXNA 3C4FA 4OGRA 3TIZA 3VVHA 4QMYA 3KXZA 3ZRKA 3PSCA 2G2HA 3ZNIA 3DK3A 4NCTC 5CSPA 3UNKA 2YU7A 4M4ZA 2BDJA 4MK0A 2C30A 2QLUA 5CEPA 4CYIA 5EFQA 5EM6A 2W96B 4N0SA 1NA7A 1JAMA 4PDSA 2O8YA 1D4TA 3QAME 1GZKA 1PF8A 4BCMA 5AUTA 3AC8A 4NIFA 2YWVA 4BTMA 3OVVA 4CNHA 4I92A 3F3UA 1XBBA 5C4KA 3DT1A 2YDIA 2F2UA 3I4BA 3A60A 4CQEA 2GFSA 1BMKA 5C03A 2GQRA 3JY0A 3LZBA 3V5JA 3ZC5A 4FKOA 3N4VA 3NNWA 2YM3A 3RTPA 3FYJX 3HVCA 3BWFA 3FMMA 1BHFA 4BI1A 3H0YA 4X7QA 3CPCA 2X81A 3D0EA 3G90X 1UKHA 1O6YA 1YWRA 3DOGA 3GC0A 4QQCA 5D10A 5ETCA 4DLJA 3POZA 4FSYA 4IH8A 4ZIMA 4BDEA 4NTTA 2RFDA 2JC6A 3O0GA 3PVWA 3QQHA 5LXMA 2XKCA 3PFQA 1Y1UA 3ODYX 1WBNA 2BFYA 5AX9A 1UWHA 3DV3A 3K54A 3E7VA 2GHGA 4Y46A 5A4QA 1H27A 4U17A 4CFUA 4OHDA 4G3GA 2NP8A 3MFTA 5TKDA 1S9IA 2G01A 2Z7RA 3DKCA 3WIGA 1HCTB 3DZOA 3SW7A 1JWOA 3W8LA 2B3OA 1FMOE 4HOKA 4C02A 3E92A 5AM6A 4FUXA 3D5UA 3WZJA 2I0HA 2C68A 4JG7A 1P13A 1R1PA 4M14A 4RX8A 3BUOB 5EW3A 5HE3A 2CSNA 4GMYA 4W4YA 4HNIA 3RPSA 4OHIA 1K9AA 3BBTB 4RFZA 1P14A 2QVSE 4PWNA 2B9JA 5DLSA 1ZOGA 3ZBFA 5IQEA 4XNEA 5A4EA 3R9HA 3RP9A 3H4JA 4YUQA 3RAKA 1RPYA 2IG7A 3SXSA 4DH7A 1YXVA 3KCKA 3RK5A 3EQRA 1O43A 4H1JA
chains in the Genus database with same CATH superfamily
2X0PA 1FVVA 4JMQA 4PDYA 2W1HA 4G9CA 3GU4A 4J7BA 3R8VA 4CLIA 1WQUA 5J3XA 3F7WA 4OHEA 5AULA 3A61A 3MFUA 2MK2A 3W10A 1DI8A 3D7TA 4UMQA 5BVNA 4IAIA 1UU8A 3P86A 3MY1A 5TR6A 1Q5KA 2OXYA 2OJGA 2PY3A 4KNBA 4YO4A 1XMMA 2WZJA 3MVMA 4FKIA 4P4CA 5DN3A 3UMXA 2IN6A 1ZOEA 2W05A 4FTQA 1O4IA 1V0PA 2YISA 3KEXA 3UVQA 4BIEA 5ICPA 4IIRA 4TXCA 5DVRA 4Y5QA 3NYVA 3KXMA 3SQQA 3HRCA 4MHAA 1RW8A 4FT5A 4MXXA 4XJ0A 4EH6A 4DCEA 1A48A 3MVLA 2XJ2A 2PZPA 1Q61A 1E9HA 2YWPA 4M67A 3EJ1A 4GS6A 4JJRA 4D2PA 1OL5A 3RPVA 3LMIA 4G3DA 3FMNA 4AXAA 5ETAA 2XALA 4WBBB 3ATSA 3AD5A 1OECA 4A9RA 5AV2A 4QDVA 3B2WA 4Z7HA 3OOGA 3QFVA 3W33A 3O96A 3Q4CA 4IZAA 4X6QC 3CGFA 5JQ8A 4XZ1A 5K0XA 2X2LA 3R8PA 4ANSA 3PXZA 4FICA 3A7IA 3K3IA 4L7SA 5D12A 3BYUA 4GK3A 4FL2A 3R63A 2YCFA 1J1BA 1AGWA 4U45A 5EW8A 4H1OA 3IQ7A 5EW9A 3A7HA 2FUMA 3FYKX 4DH1A 5J9LA 2OJIA 4BIBA 4C2WA 3TNQB 4BJJA 1Q8WA 5DIAA 2LQWA 1BYGA 4Q2AA 3R1SA 1XA6A 4YTFA 2C9WA 2ZB1A 4YHTA 3NW6A 2WXVA 3UQCA 1DM2A 1F5QA 3VS7A 5KBQA 1U5QA 4EOLA 4FTIA 3RWQA 2B4SB 3MY0A 2K7AB 5I9WA 3IGGA 2WMRA 2QOCA 4DGLC 1R0PA 5HVKA 4RX7A 3KXGA 3LFQA 2PU8A 5BX0A 1KV2A 1NVQA 2OU7A 1YHSA 2UW8A 2X0OA 2IVVA 3C5UA 3D5WA 3F5UA 3GOPA 3Q9WA 2GS2A 4ZSJA 3UOLA 1SKJA 5FXRA 1TCEA 4YTCA 3FXXA 2YHVA 4DEEA 4I4FA 3WOWA 2F4JA 3QHRA 3DAKA 4GYGA 3MXCA 4LUDA 4PL5A 2A0CX 3TCPA 4K6ZA 3FLZA 4AXCA 4B4LA 4FIFA 3FZSA 3KK9A 3AKLA 2PHKA 4IHPA 3R73A 4ANLA 2YDJA 2AOBA 3FLSA 4GK2A 5BQ0A 4I20A 5M08A 3TWJA 2W1CA 4BDFA 3RWPA 3L8VA 2C69A 1OUYA 3WYXA 2ITVA 5I9YA 3FV8A 3UIUA 2Y9QA 4ZTMA 3GXLA 5HE1A 3UO6A 5KNJA 3SDJA 4CT2A 2R4BA 4CFVA 3FMKA 4R7HA 2YM6A 3VHKA 4AT5A 4BN1A 5IISA 1G3NA 1LR4A 3DLSA 4DEBA 4EH7A 1A1BA 3OROA 1PYXA 3NDMA 2IEWA 4FBXA 3RM6A 3ZDUA 4DN5A 1QADA 1MRYA 3HIZB 2X7OA 2YEXA 3QKLA 5E1SA 5FM2A 3LCOA 1IASA 3VRYA 2QOFA 3SGCA 2PE0A 2OZAA 2VTRA 4DAWA 2UUEA 3UOKA 4FE2A 3W0PA 4CD0A 4FKUA 4AGUA 3OFMA 3PJ2A 3FLYA 5HG7A 3UG1A 3UP7A 3VS2A 4F70A 5CAPA 5KMJA 1A1AA 5AP2A 1U54B 4QMZA 1O4LA 4BWPA 3EQHA 3R1QA 4D1ZA 3BL9A 4XG4A 4NJDA 3OY3A 4NL0A 2VTNA 2XIKA 3E5AA 3R7GA 2V55A 3O8PA 4FKGA 4IZ5A 4UV0A 3FMEA 1M2RA 3G33A 4PPCA 4KA3A 3PWYA 4ARKA 4FV3A 4BZNA 4CKJA 2R0IA 3WF7A 3O7LB 1H1PA 4CYJA 2XS0A 4JEGA 2IZSA 3SKCA 1XH9A 1OKWA 3OCSA 5DGZA 5CANA 5AADA 3SG9A 3NR9A 3V04A 3KCFA 3T3UA 2OF4A 5AA9A 3OY1A 2IZUA 2C3LA 3I5NA 4FOCA 2XVDA 4ITJA 2BHHA 2NRUA 3COMA 1ZY5A 4XS2A 2BMCA 2BAJA 3VUDA 1BHHB 3CKWA 4IAAA 4YSMA 4BTFA 2DCRA 1O4QA 5HCZA 2UZVA 3ENHA 3SW4A 2GTMA 2HW6A 3H30A 5EI6A 5L2WA 3FEGA 4CCBA 3A4PA 3DJ6A 3N8MA 3AT3A 1NT2A 1O4MA 5H9BA 2KNOA 4FYOA 3I60A 5ACBC 4MXAA 2VTLA 3DY7A 3KMUA 3NUXA 2ZMDA 3BHVA 5JFVA 4DF3A 2XNPA 1MILA 4U9AA 4IZ7A 2HAKA 3PP1A 2QOBA 3VS3A 4XG7A 4JQ7A 4IJPA 4XEYA 3AT2A 1TKIA 1LKLA 2HWPA 3R30A 4OBOA 4EJ7A 3CPBA 1WBPA 4PV0A 1FBVA 1PXJA 2AUHA 2XK4A 3DGKA 4L53A 2ZV2A 1MRUA 2QOHA 4NKAA 2BAQA 5A6NA 2F2CB 3TUDA 3FPMA 3MA3A 3R1YA 4G6LA 1PMVA 4O82A 5TOZA 3WARA 3DS6A 4F6UA 5JEBA 4RX9A 4X6RA 5D11A 4IM3A 4LDTA 5D0JA 4E4XA 3ORMA 4NUSA 4RWJA 2Y1MA 2XBJA 2ONLC 1YHWA 4G3FA 4M3QA 5DC4A 5A4TA 3BUMB 5KUPA 3C5IA 3OTUA 4HGLA 4FTUA 4O6EA 4FIIA 2ZB0A 3FHRA 3HRBA 4EOQA 2O63A 5JZJA 3TG1A 4ASXA 4CZTA 4ZOGA 1TQMA 3P7BA 3LCTA 3AC2A 3JS2A 1Q8YA 3PY3A 3MESA 2HMHA 4D8KA 4OT5A 4CGAA 3OWJA 3KXXA 1GAGA 2E9PA 3HL7A 2PVYA 5HCYA 4BTKA 3UDTA 4NM3A 4ITHA 1BMBA 1ATPE 2HELA 4J53A 3KA0A 4DG3E 4C4JA 2W7XA 4U40A 1BUHA 2VAGA 4ACCA 3MJ1A 3VQUA 4LG4A 5ETIA 4P5ZA 1KOAA 2X6DA 2YIYA 3AC1A 3KRJA 4FIHA 2WU6A 4O0WA 4YJQA 4ZTLA 4CTCA 4DGNA 4F0IA 2GPHA 4V0GA 2X8IA 4TYIA 3V5TA 3HMIA 1ZYJA 4ASZA 1LUNA 2FA2A 3ET7A 3ORLA 2DWBA 1M7QA 1IG1A 3PPJA 3C7QA 3KXNA 3W16A 4I5MA 3DKGA 4ZZOA 3GCUA 3KF7A 4Q9ZA 4BDHA 4D4YA 2JKQA 3QTXA 3IGOA 4OHHA 5EHOA 1P2AA 2EB2A 1JPAA 4OTWA 4YHFA 5E8VA 3UIMA 3DTWA 5D41A 3ZDIA 2CJMA 4DBNA 3RINA 3RVGA 2ZV7A 2B9FA 4F9CA 1VJYA 3C51A 1XQZA 4FV9A 4EI4A 4USFA 5L2SA 2ZDUA 3QQJA 4L8MA 3R7VA 3ZFXA 5CF8A 5LMBA 5J9YA 4MYGA 1WCCA 4K77A 3ORIA 1J1CA 2HWOA 5AP6A 2BROA 3GGFA 4CFWA 2B0QA 4DFBA 1BKMA 3EQIA 5IPJA 4JAIA 3BBWA 4W4VA 3UPZA 4CV8A 3QD2B 3LXLA 3LXNA 4AZSA 3AD4A 3SRVB 4D2TA 5DFPA 4JVGA 3Q4TA 1SHDA 4I5HA 4AZWA 3HKOA 2YLEA 5KMOA 3GQLA 3E88A 2J50A 4A9SA 1A1CA 2QU6A 1S9JA 3F66A 5CY3A 4BZDA 3FMDA 1OPKA 4O0YA 4FTNA 2I1MA 4QP8A 4AS0A 3SXFA 4RVTA 4BCQA 4DFXE 3PFYA 1SVEA 4JBQA 4PF4A 3ZH8A 4DDGA 5DC0B 4IVDA 4YU2A 3NAYA 4FV6A 3EHAA 3B8RA 3WA4A 3O7LD 1M27A 4UX9A 3GU7A 3CD3A 2V0DA 4F65A 2JDRA 1O4EA 2CCHA 4EH4A 2OH4A 2OFVA 3IW4A 3U6JA 4DG0E 1O46A 2P4IA 2OLCA 4QYGA 1W82A 2R2PA 1JSVA 4O0XA 4XV2A 4ZSAA 1Z57A 4FKLA 2CLXA 4CKRA 4B7TA 3P7CA 3WIKA 1OO3A 2LNXA 2K79B 3F9NA 3QX4A 5DEYA 1XH8A 2GMXA 1GIIA 2I7QA 1PW2A 1BG1A 3O8TA 1XMLA 5DF6A 5IA4A 3TNPC 4BFMA 2BFXA 4QOXA 4ENYA 3DB6A 4KBKA 4Q9SA 4YZCA 3BGPA 1Z9XA 4HNFA 3DBDA 5AP0A 2WIHA 3FQSA 2WMUA 4A4CA 3BI6A 1BX6A 2VNWA 4HGEA 3OXZA 1A9UA 4WA9A 3GXWA 4CMOA 4X6SA 4XV9A 3VJOA 3EL8A 3LMGA 3QQLA 4RFYA 5L2TA 4GU6A 2QG5A 4MWHA 4BDBA 3OUNB 3D94A 3GFWA 3SLSA 4F7SA 1BKLA 5F9EA 3IW6A 1L3RE 4TW9A 3W2PA 1BM2A 3FLNC 4G3EA 2VTOA 3ETAA 5DBXA 4EYJA 3GC7A 3W55A 4FBNA 5BMMA 3BL7A 5LJJA 3CXLA 5LARA 4XBUA 1R78A 3CR0A 4C8BA 4F5AA 3DXNA 5K3YA 5EQYA 4KKHA 4M68A 1H25A 2ECDA 3VHEA 3OB1B 1O6LA 2J51A 4KKEA 2UVYA 2PZ5A 4EBVA 3W0SA 1HCSB 2UZNA 3M2WA 1WFCA 2RFEA 3KN5A 5EI8A 5AUVA 5HTBA 1B47A 3C4WA 3S8OA 2XM9A 4BKYA 1GRIA 3ZXTA 3RGFA 3QQFA 3HP2A 3I81A 3NHNA 2CS0A 4EWQA 4JGHA 4C58A 4D1XA 2CDZA 3E7OA 2B9HA 4A06A 3CGOA 5C1QB 3EQFA 4TPTA 1YRPA 5CXHA 2Y6OA 3SHEA 3FY0A 2CHLA 4G1WA 2PZRA 3E3BX 4AA4A 5CSHA 3F6XA 2YM8A 4KD1A 4LGDA 4LMUA 3DXQA 4CG9A 4IEBA 4H36A 2RFSA 2IW9A 1SM2A 3Q6UA 3RNYA 2PYWA 2YIRA 4DTBA 3PXYA 1J7LA 1H07A 4FTJA 4WRSA 4EORA 1QPDA 3JY9A 3BHYA 3FMJA 4O2ZA 5IA5A 3ZONA 1JKSA 1O4AA 2YAAA 1ZOHA 2YA9A 4JE4A 4C4IA 4WO5A 1RJBA 3HV5A 3LPBA 4G5JA 4YPDA 3GT8A 5LMKA 3MAZA 5C9CA 2P33A 4ONAA 4OAVB 5D1JA 4BGHA 4F63A 5J7HA 5AV3A 4FJVA 3PA4A 3QCYA 3KVWA 4FI1A 5KHXA 3MB7A 3SXRA 2VWWA 3FL4A 3C4XA 2VNYA 5IA0A 1KOBA 4IX3A 4WSYA 3R7IA 4KIQA 4FKPA 4XOYA 3PQZA 3QU0A 3TJCA 3GXXA 4QP6A 1H1RA 3KMMA 4X21A 5CQWA 3NFGB 3QRJA 5BVDA 2ZOQA 4K44A 3GP0A 4E7WA 2WELA 4GRBA 3QGWA 5CQUA 2C3JA 5AV0A 3A8XA 3PRFA 3D2IA 5EG3B 4AGWA 2EUFB 1Q4LA 1W98A 3P78A 4O38A 4F0FA 3FLWA 3HDNA 3LLAA 1KC2A 2E9UA 4BCGA 5E8UA 4AZFA 4DHZA 3VBVA 3R2BA 4E20A 4HYHA 4MVFA 3UDZA 4R1YA 3GENA 3BV2A 4C4FA 4BDJA 1FU5A 3KN6A 4TT7A 2J0JA 3PDTA 4AOTA 3ZM9A 4O7YA 4AX8A 2VGPA 4UXLA 2BZJA 4FSNA 1JQHA 3HNGA 4IE9A 3V01A 3CLYA 2QCSA 2GS7A 2OIBA 2W1GA 3NUYA 3FSFA 3UYSA 4D0XA 3BUNB 4L44A 1PXMA 2VZ6A 4R7BA 5J8IA 5CLPA 4NM0A 4BHNA 2XNEA 1JYQA 2CCIA 3QC9A 3SA0A 4H3BA 3TM0A 2ITTA 1PKDA 2IVUA 5IU2A 4I3ZA 3BYOA 5JRQA 2PLEA 4B8MA 5AEPA 4E5BA 5F20A 4ANBA 3U51A 3TACA 5IH6A 4TZIA 2VWZA 3FC1X 4WG5A 5AV1A 3F69A 4A9UA 4I1ZA 4R3PA 4F7LA 1YWNA 3JYAA 3QA0A 4HGSA 4QMMA 3AXWA 5CWZA 1JLUE 3EH9A 3EQCA 4AAAA 4S32A 1W83A 3RM7A 1BLXA 1TVOA 4U80A 3LHJA 5TO8A 5I9XA 4IADA 2WQEA 4O4FA 3LLTA 5HORA 5EYMA 2P2HA 4A4OA 2R3HA 4NJ3A 2BKKA 4F5BA 3P5KA 4GJ3A 4TWNA 3HZTA 2HY81 3F5PA 4J96A 3MPAA 1BI7A 4C35A 3PLAE 4IC8A 2WTVA 3ENMA 4ID7A 5CALA 2H6DA 1L8TA 1UA2A 4M15A 4OAUC 4IAKA 2DM0A 2G2IA 1O4BA 1GIHA 1JSUA 2WMSA 5AX3A 4WNKA 2ZV8A 3PSKA 1LEWA 5EYDA 1OL1A 2MQIA 4JQEA 5J5TA 4L6QA 4A9YA 1P5EA 4L7FA 2YDKA 1H01A 3ORPA 1ZYLA 5ANJA 4QT1A 3ZS5A 5F95A 3QWXX 1JKKA 2G1TA 4I6LA 4W8EA 2OI4X 3PLSA 4I6QA 2HK5A 4IFCA 3PIYA 3QCSA 2RFNA 1TQIA 2QLQA 3KFJA 4TN6A 5AUUA 1O4DA 5D9HA 1U59A 5E8YA 4ANOA 5IA2A 3RBWA 5LWNA 4I93A 2XK3A 4BBFA 2C6MA 5IQDA 1H24A 2P55A 2WMBA 2Z7LA 3AT4A 3PUPA 3WI6A 2XYNA 4AN2A 4OLIA 5L8LA 5E7RA 4U3YA 5L8KA 1MRVA 3IK3A 3FMHA 2XP2A 2XB7A 4XG3A 3LYVA 3ZO4A 1YQJA 2J0LA 3VUIA 4N57A 4MD9E 4MAOA 2XCHA 2GFCA 2C5YA 3NYNA 4G6NA 2OO8X 3W0MA 4IB3A 4OHLA 5EDQA 2AUGA 4MCVA 4V04A 1Q41A 3QZGA 3ID6C 2H46E 2PVNA 2BHEA 1LUIA 2OICA 4JDJA 4F7JA 4EZ7A 2H8HA 3QQKA 5L6OA 4N4SA 3SOCA 2LRAA 2L4KA 4A07A 3VUKA 3TDVA 4J99A 3FZ1A 3LFCA 2VN9A 2XBAA 3ZYAA 3EFJA 5DA3A 5K4IA 1LUMA 5DG5A 2WTKC 2VWUA 2YERA 2CPKE 3HGKA 1VYZA 3PG1A 1GY3A 3ROCA 4DH8A 1O4CA 5AXIA 1FPUA 2BTRA 4QQTA 3IW5A 3R2YA 1FINA 3TNIA 4JX3A 3ORNA 5I9ZA 1YI3A 3P1AA 3LFSA 1ZMVA 4O7TA 4KIPA 2QURA 3S1HA 4XG9A 2XNBA 5BYYA 5J1VA 2CGWA 3ZFMA 3ZSIA 1IA8A 1CDKA 2OSCA 3ZLSA 5E9EA 4DLIA 5A4CA 1ZWSA 4WNMA 4X3FB 5CU3A 4ZTSA 1F2FA 2XKEA 3FI3A 2F7XE 4CVAA 3C50A 4FSTA 2VTJA 2WMVA 4NFMA 5L2IA 5FQDC 4HCUA 3R8MA 4BKZA 2XIXA 2JDSA 3FWQA 3I0QA 3ZC6A 4BCIA 4F1TA 5HIEA 3KIOC 3UIXA 4F1MA 5AR2A 2BRNA 3SX9A 1AOUF 3BHHA 1BFJA 2QOKA 5DT3A 4GPLB 4QP4A 2C5VA 2B52A 1MUOA 3R7YA 4F4PA 2ZYBA 2O65A 2R0UA 3IW7A 1OKVA 3DB8A 2Z7QA 4NW5A 4QRCA 5ACKA 3FPQA 3R9DA 3N9XA 4RA4A 4AA5A 2BRMA 4P2KA 2IUIA 1WMKA 2J5EA 5L6PA 1OIYA 4FNWA 3H9OA 4PTCA 2R3RA 4FGBA 4U43A 2EXMA 4LGHA 4BDIA 3V8SA 3NUAA 4UYNA 2C1AA 3A7GA 3NLBA 2J0KA 4BDCA 3OF0A 4QP3A 3R71A 3G9LX 4HCVA 2V5QA 4O7ZA 3OV1A 3IKAA 4IWPA 4ALUA 4HVGA 3K2LA 5FTGA 4EHEA 1YVHA 5HTCA 1UV5A 3QALE 4CCUA 3E63A 1JKLA 3PJPA 2P3GX 4QMNA 3MH0A 3M11A 3DK6A 4GFMA 4DH3A 3DAEA 1MQBA 1YDRE 3EYGA 3TYKA 4CFFA 4RWIA 3OCTA 4JBPA 2PUIA 4EK8A 3PVBA 4GCJA 4ZZNA 5HQ0A 3VROA 2RKUA 3UC3A 4KRDA 3CKXA 4GG7A 2KULA 5CSVA 4K1BA 1EH4A 3NYXA 3MGYA 3QD4A 4K11A 2PVJA 2ZM3A 1VZOA 1NZLA 4XUFA 2R5TA 3CTJA 2C5OA 5H8GA 3LFAA 3PZEA 5JMSA 5D7VA 3UDSA 2YZAA 3U6IA 2QOQA 2JDTA 4GKHA 4QP9A 4K2RA 3RPOA 3UMWA 1O4GA 4FEVA 3OP0A 5LVOA 4MD7E 4PQNA 3LFFA 4BCJA 4O1OA 2ITXA 2HZ0A 4C0TA 4MBIA 4PMMA 3EL7A 4XRLA 4L42A 1O49A 5C8KA 4LMNA 4UALA 4ACDA 2R3FA 3OW3A 3U9CA 5JSMA 3QLGA 2KK6A 4CV9A 5EM8A 4F64A 2F7EE 5FLFA 2DUVA 1LEZA 3BYVA 4QMVA 4UMRA 4IXPA 3V8WA 4QQ5A 1Y8YA 1U54A 5IQIA 3CQWA 4FK3A 3B8QA 4ZAUA 2R3NA 1UU7A 2Y0AA 3Q32A 4LYNA 1YVJA 2E2BA 4D9TA 4AXDA 4UB7A 2HCKA 3TZMA 3ZRLA 5EI2A 4TL0A 1JSTA 2KTYA 5HNGA 3EAZA 1FGKA 1M17A 5EH0A 3QUEA 1AOTF 3FZPA 5EQEA 3MFSA 3PSBA 3WF5A 3DAJA 4TYHA 4X3JA 4ZJJA 3HMMA 1OUKA 3FDNA 3JXWA 1JKTA 4K33A 4L68A 2PULA 2AC5A 3TTIA 3VF8A 4KWPA 4KSPA 5GZ8A 4MXOA 5M53A 2CGXA 1YXUA 2C6KA 2HXLA 2O0UA 3VW8A 1NY3A 3NFFB 4DA5A 3HDMA 3OB2B 3EYHA 4B6LA 5HO8A 4D4RA 3OS3A 5M07A 2CIAA 5K0KA 4JIKA 4OBPA 4I94A 1A81A 4H58A 5CZHA 2C3IB 3BU3A 2JKOA 4L52A 4F08A 3NUNA 4AZVA 5HX8A 2WD1A 2EWAA 2WAJA 4H39A 4R7IA 3P79A 2V22A 1SZMA 4ZLYA 4NK9A 4OTIA 4CEGA 3BKBA 5FD2A 4O84A 1JVPP 4U7ZA 5LMAA 4U3ZA 3LJ0A 4JIAA 4X2FA 1LP4A 2YCRA 3R28A 3VNTA 5IA1A 3S0OA 2UVZA 2HENA 1I3ZA 5KE0A 4DGMA 1PXKA 2W1IA 1MQ4A 3W8QA 4EH5A 4BDGA 3HAVA 4W4XA 4RIYA 5TF9A 4LV8A 1O4FA 3UZPA 2CKPA 1B39A 3FI2A 2BCJA 1UNGA 4OBQA 4XP3A 3R8ZA 3RPYA 3TT0A 1A09A 3HRFA 4LOPA 5H8BA 3C9WA 3OT8A 3D7TB 5J79A 4CRSA 1E1XA 2V7OA 4EEVA 1IR3A 3DU8A 3O23A 3QQUA 5AWMA 3ZOSA 4AXEA 3FXWA 4B0GA 4NT4A 3FI4A 3DCVA 4PY1A 2ACXA 3GI3A 3EN9A 5CT7A 1FGIA 4AACA 4EH8A 4EQCA 1XH5A 1R1QA 3FUPA 1GJOA 3KULA 1BKXA 4O0TA 4HW7A 3ZTXA 1MP8A 4AQKA 4JG8A 1NVSA 1OB3A 2WEVA 4YNOA 4C33A 3UTOA 4KRCA 4E4NA 4E1ZA 1D4WA 3CCNA 5IQCA 3QTIA 4RX5A 4F9WA 4FKTA 2EB3A 2VV9A 2QOOA 5K5NA 3BU5A 2ETZA 4IC7A 2WMAA 3PLFB 4E6DA 4CFXA 3F3VA 4D1SA 3K5VA 4FTMA 5M51A 3ACKA 2WQOA 4TYJA 1BI8A 1URCA 3RI1A 4EUTA 2UZLA 4LGGA 4OTPA 3Q9YA 5EK7A 4FL1A 4OW8A 4V0GB 4ZJVA 4Z7GA 4IANA 2WTCA 4GL9A 3C13A 4WWQA 2OFUA 5IUGA 4KB8A 5AUZA 5HGIA 2W1FA 3NVKI 2IUGA 2JAVA 2HOGA 2VTQA 4AT4A 3ZZWA 2YZLA 2V62A 2W99B 1JOWB 5DNRA 2YABA 3G51A 3R7UA 3G5DA 2EU9A 2CN8A 2PZYA 4YJUA 5HD7A 4BF2A 4G6OA 4D9UA 5CAUA 2X9FA 3OC1A 2X8DA 2QG7A 2IUHA 4GU9A 3QA8A 3AMYA 4ZY6A 2GE9A 3C0IA 4W9WA 4ACMA 3TZ9A 3MDYA 5IZFA 5LVPA 4JDKA 3CY3A 4I6BA 3VRZA 4WNPA 1ZYCA 4HVDA 5HBHA 4GWFA 5EHLA 5ANEA 5AAFA 4EZ5A 4QYFA 4O1PA 2PE1A 3C4CA 5LOHA 4OR5A 4CSVA 3QX2A 4AAYA 2HYYA 2BZKB 3FE3A 3AGMA