4K2RA

Structural basis for activation of zap-70 by phosphorylation of the sh2-kinase linker
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
613
structure length
551
Chain Sequence
PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDFGLSWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ZAP-70
publication title Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 162
structure length 551
sequence length 613
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4k2rA05
1.10.930.10 Mainly Alpha Orthogonal Bundle Syk Kinase; Chain A, domain 2 Syk Kinase; Chain A, domain 2 4k2rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4k2rA04
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4k2rA03
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4k2rA01
1SM2A 3UG1A 2GNGA 3TT0A 4JJRA 4LGGA 3VUIA 3RVGA 4BHNA 3ZU7A 1W98A 1AOTF 4ERKA 2VTIA 3MVMA 1URWA 4HPUE 4OT5A 4S30A 3RPOA 3PA5A 1OO3A 2Y4IC 1TQIA 2QONA 3ORNA 3GB2A 3PPZA 3H9OA 4L3PA 3HIZB 3TUBA 5L6OA 3BYOA 3IK3A 4ANQA 3SOAA 4MYGA 5E8VA 5AR8A 4Y5HA 1SHDA 2WD1A 3KRLA 4DFLA 3JYAA 2YCQA 5I5ZA 3R7VA 3OTVA 2E9VA 4O0UA 3R8UA 4F7JA 3AC8A 4QYHA 2JDRA 4QQJA 4XBUA 5IUIA 3EFWA 4B99A 4KS8A 4AZVA 3HV3A 3PJ3A 4V05A 3EL8A 3WZJA 3F3TA 3TDVA 2UZUE 3GQIA 4QD6A 4YBKA 2IVSA 3ZFXA 3EKNA 4FNZA 3ZXTA 3MFSA 4O6LA 4S31A 5C9CA 4DLJA 4LI5A 4QQ5A 2BPMA 1O4EA 1JKSA 1RQQC 2GNIA 4BZOA 3NW5A 4CFUA 1FYRA 4A4LA 4BWXA 2P55A 3QKMA 4IBMA 4ANBA 4EQMA 1TQMA 1GAGA 3OT8A 3UVPA 3Q9ZA 4OR5A 1O4IA 3QRJA 1M14A 4D55A 4DT9A 3ZO3A 3VRPA 4C0TA 4E8AA 4YR8A 4A4OA 5IH4A 1LUNA 1O4MA 2OICA 3OXIA 4NM5A 2JLDA 3LM0A 3GXLA 4XUFA 5IQHA 4I5MA 1A08A 2VTSA 2OH4A 4TXCA 4TWOA 4KAOA 4AGDA 3MPAA 1PYEA 4JDKA 3PXRA 4M12A 5L2TA 2PNAA 3AXWA 4F6WA 4YO6A 2JFMA 2O65A 3VS1A 4X6RA 1H0WA 1BFIA 3VBQA 4YP8A 3NYOA 3C51A 4L9IA 5DNRA 3DTWA 1H07A 4TL0A 3R21A 3P7BA 2C6KA 5E8UA 3LXKA 4EZ7A 4O0VA 4OHIA 4CKJA 2I40A 2WHBA 2X0GA 3RAHA 5M06A 2BFYA 2I0EA 3C13A 1JYUA 2YAKA 4UWYA 1PY5A 4OGRA 2WTDA 3RPYA 3UIUA 1FPUA 2XZSA 3CLYA 3PSDA 2W1CA 3CTQA 3MDYA 3EN7A 3FHRA 3OS3A 5KBQA 2QQ7A 3C9WA 4FV3A 1WCCA 2PZIA 4CFMA 3DZQA 3SD0A 3LIJA 2ZMCA 2OF2A 4F65A 4DH7A 4OTIA 1OL1A 1YI6A 2W4KA 4G6NA 4ZY4A 4QMNA 4I94A 1OVEA 1CTPE 3KF7A 3L8XA 3E93A 4U3YA 3ANQA 4O0YA 1CJ1A 5LJJA 2YHVA 1KE5A 1UNGA 1XJDA 3QL8A 4Q9ZA 2GQSA 2YLFA 4G1WA 4NK9A 3MFRA 2OJGA 2BALA 3FZTA 2UVYA 1IAJA 1G83A 4M8TA 3RI1A 5AP3A 5C8MA 4GUBA 1KE7A 1B38A 4CCUA 5JSMA 2IVUA 2WQEA 3W8LA 4UV0A 1PICA 3IW6A 2HYYA 4BWPA 3FKOA 3G0FA 4WNKA 3QD3A 3W32A 2EL8A 5CAQA 3BHYA 4QMUA 1H25A 2PHKA 3F3ZA 3G0EA 4BDEA 1KUTA 4GUEA 4XX9A 4C38A 3F3VA 4WNPA 4FEWA 4FTLA 4YPDA 4X2KA 5HBEA 4WHZA 5D7VA 2EO6A 2YZAA 3TCPA 1JQHA 2WQBA 3DK7A 4BCHA 5CALA 4JL9A 4QP3A 4RIWA 4H1JA 5GIPE 3QTWA 4NFNA 3ZM9A 4UWBA 3UOKA 5FWKK 3IQ7A 4JR7A 5J1WA 3VS3A 4EHZA 3L9LA 5D11A 4U6RA 4FKSA 5CSXA 3ZH8A 5FTGA 2GTMA 3TKIA 3C0IA 3OBGA 3V5QA 2GU8A 3PE2A 3QHRA 4CTCA 3HGKA 3DA6A 4WOVA 4UMTA 4BDBA 3NVKI 3S2PA 4RRVA 4DTKA 3LJ1A 4Y73A 5TR6A 3KC3A 4RLLA 1ZYCA 3GNIB 2XNOA 4U17A 3KK9A 3LQ8A 3EZVA 2XNMA 3GQLA 5DBXA 2I1MA 2RFDA 3V04A 4D2WA 3HHMB 2J51A 3KQ7A 4NCTA 4WA9A 3LFDA 3A8XA 4Z9LA 3TNHA 3Q6UA 3DK6A 3S00A 3IONA 3MH0A 2WOTA 3QLGA 3UNZA 2BKZA 2XK4A 3GXXA 4DINA 4ENYA 3K54A 5EELA 5C1QB 1RE8A 3W55A 4QQTA 2Z02A 1PXJA 2GTNA 5HE0A 4M84A 3UIXA 2BBUA 2WMWA 2I0VA 2YIQA 3ORPA 2W1DA 4OAUC 4IMYA 2HMHA 4WNOA 4ZAUA 3EWHA 1M2PA 4BN1A 1Y8YA 1R0EA 2JBPA 3R0TA 3P0MA 4U45A 4J52A 4NWGA 3GFEA 4IDTA 2GFCA 3OCTA 5CAVA 2CJMA 5CDWA 3BU3A 4L7SA 4AW1A 3EQRA 3FI2A 3FLZA 3LFEA 3Q4ZA 5E8ZA 5EM5A 2VNWA 2IN6A 1JSTA 2FO0A 2O63A 2ZM3A 3E8EA 3U4WA 2HY0A 2JIUA 3Q9WA 2EXMA 4D4RA 2HCKA 4AE9A 3L1SA 5H8EA 3LLAA 2OFVA 2WPAA 4I5PA 2GNFA 1XBCA 2RGPA 4UBAA 5AV2A 1D4TA 4IM2A 4YGAA 4CLIA 3D7TB 5AMNA 3BHUA 4BDJA 2JKQA 5HQ0A 2VWZA 2VTNA 3BBTB 5HE1A 4O7ZA 3LKMA 3R7EA 2OIQA 4NL0A 5HBJA 2B53A 2YABA 4J53A 4NKAA 3G33A 5CVFA 1D4WA 4HCUA 4U8ZA 4Q9SA 2QR8A 3DXPA 4RWJA 2R0IA 4FGBA 3JUHA 3DKCA 3P7CA 4FKOA 3HV4A 5HG5A 5IQIA 3CBLA 3CWGA 3KXMA 2WELA 3BV3A 4PTEA 4AGWA 4EH3A 4IVCA 2X2MA 2Z2WA 2J0JA 5HG8A 4NYEA 1Y6BA 2YFXA 3D4QA 3E7OA 2XBJA 3MY0A 4NIFA 4RX8A 5L8JA 1FBVA 2R9SA 3EKKA 3ZEWA 3KFAA 2C6DA 3PIZA 4ALWA 5CNOA 2VZ6A 4IC8A 3EN4A 4M69A 3NUYA 3FQEA 4I92A 2GE9A 5FLFA 4OHEA 3KN6A 4RFMA 3HX4A 2P33A 2Z7RA 4WBBB 4CXAA 4QTCA 5CAOA 2UW9A 1W0XC 5AUXA 1R1PA 5DR6A 2WIPA 2MRKA 3N8MA 3L8PA 3F9NA 4K77A 3FMMA 3R1QA 1SYKA 4KNBA 5A14A 5M53A 3R8LA 4CV9A 5G1XA 3WARA 3RJCA 2ITXA 3SA0A 3DGKA 2WMXA 5EOBA 3V5WA 3GBZA 3A7JA 5IU2A 4QNAA 4TYGA 1U4DA 4O7SA 2SHPA 3ITZA 1O6KA 1M27A 3JVRA 3GU8A 1ZYJA 5KKRB 5M51A 2UW8A 1XH4A 3BGZA 2H96A 2I6LA 4LV8A 2ZV8A 4IACA 2YDJA 2P2HA 3M1SA 5E90A 4CQGA 3WF9A 3DZOA 2J0LA 3H10A 1KA7A 3R73A 2E9PA 4QMOA 4IX5A 3CGOA 3PDTA 3SX9A 4TYJA 1O46A 3AOXA 2QOOA 5CTPA 3ZNIA 4E20A 4NZWB 2AC5A 4XG4A 2QOIA 3ZLSA 2OI4X 5C8NA 3C7QA 1K9AA 2OU7A 4G16A 4HPTE 4GCJA 3WYYA 3QHWA 3ORTA 4IAAA 4EH5A 2HDVA 5AV0A 2PLEA 2R4BA 1O4HA 2REIA 3BRBA 2UVXA 1GJOA 3PY3A 3QD2B 2O2UA 3CP9A 3ZUUA 3MIYA 3CIKA 3EOCA 4GYGA 3SRVB 2VO3A 1LCJA 4FBXA 2BHEA 5AUYA 4BDIA 3MSSA 4G31A 4EH8A 4P9VA 3UTOA 3SC1A 2WMUA 3FZPA 2YA9A 1PXLA 2XUUA 4G5PA 5KHXA 3NUSA 4WRGA 4N0SA 3V5LA 5E8TA 1ZY5A 4FSNA 5CF4A 4DTAA 5E7RA 4ALVA 3TI1A 1AYAA 3MXCA 4FTQA 4QSYA 4XBRA 4JBVA 3V5TA 4R6VA 4EYJA 1XA6A 5FEDA 4UY9A 4I6HA 5GIOE 3ORZA 4MF0A 3UZPA 3VIDA 3WZEA 2JKOA 2OFUA 2FYSA 3DKOA 4JXFA 3T3UA 2OBJA 3Q9XA 3TNQB 3W8QA 1H4LA 2RMXA 2C3KA 2W7XA 4IDVA 3AQVA 4BKJA 4C35A 5K5NA 2HXQA 3R28A 5ICPA 3NYXA 4IFGA 4IX3A 2VWWA 4AZTA 4D1ZA 4PY1A 3FZ1A 5A4LA 5J5TA 4RJ6A 4E5BA 4L01A 3ZSGA 4Z16A 4DGXA 2G9XA 3PIYA 5KCVA 4EQUA 2YAAA 1CSYA 4FTIA 1O4NA 4E26A 4M67A 3ULIA 4HVSA 4DT8A 5BUIA 5KBRA 4PL5A 3MN3A 3IW4A 3U54A 3BUXB 4G3CA 5EQEA 4A9TA 3MWUA 4NJ3A 1FU5A 2WNTA 2Z7LA 5HIBA 4WT6A 5CSPA 2XJ0A 4BCNA 4BDKA 2QKRA 4JG6A 1UNLA 2OKRA 4BIDA 1M17A 2IZUA 4C36A 5GJHA 3EFJA 2VTRA 4JBOA 3NHNA 1WBSA 2YIYA 1YDRE 3LMIA 1A1EA 4NW5A 5JGDA 1M2RA 2OO8X 4GRBA 4O38A 5CEMA 4RX5A 1BI7A 4AP7A 3R7GA 4NTTA 2XEYA 2JDOA 5M55A 4FX3A 3R9RA 1J91A 4DEHA 3KEXA 1Q8WA 2OLCA 3C5IA 4A4BA 2VN9A 4GK2A 2R3OA 4BDFA 4RIWB 5AIRA 4ZTSA 2WTJA 4EORA 4IWDA 3S95A 3COIA 3DBEA 3O96A 4ROJA 2J90A 1B39A 2A4LA 3HRBA 2O8YA 4BCQA 2GNLA 4USEA 4USFA 5LMKA 2C0TA 4O81A 4DTBA 4F9YA 1PXOA 2ERZE 2GFSA 3W16A 4CFVA 4RJ5A 3HEGA 1D1ZA 1JSVA 2B1PA 3TTIA 3OCSA 3NUAA 3H0YA 1UU3A 4EC8A 2WTVA 3PFVA 3A4PA 4IFCA 3T3VA 3H4JA 2QODA 4EZ3A 2HAKA 5I4NA 2IG7A 4H34A 5IA1A 2LNWA 3Q53A 4L6QA 5AAGA 2R3GA 2DLYA 3ACKA 2CCIA 3C4CA 2ETKA 2WTWA 3WZDA 1JYQA 1OUKA 2X39A 3G9NA 5A3XA 4OTDA 2C69A 4D1SA 1AYDA 2BDJA 1CKIA 3U87A 4C4IA 4ZJIA 5DC9A 3K3JA 4CV8A 3UG2A 1YWRA 2BZIB 3LZBA 5D0JA 2FGIA 3CPCA 2WMVA 3CQUA 1Q41A 2UZDA 3D2IA 4MQ2A 3ZO2A 3ZONA 4ASZA 4ASDA 4M15A 3RWPA 4JIAA 3TKUA 2XCHA 4KINA 4FT7A 1MP8A 4RWKA 4BB4A 4E5WA 3TL8A 3I5NA 5G6VA 3N4TA 3BYUA 2BZHB 4KSQA 4PPAA 4RJ3A 2R7IA 4ZOGA 3UP7A 2Y1NA 4RPVA 2RL5A 4DEBA 4YNEA 1BLXA 2OF4A 3F5XA 5AA8A 3VULA 2WQMA 4X6SA 4WG5A 3H9FA 1KOBA 3UVQA 2BIKB 2GCDA 5BVFA 2GNHA 3T9TA 2XKFA 3DNEA 5FDPA 4R8QA 1BM2A 2IZRA 5I9ZA 4O83A 5JGBA 3F69A 3K2MA 5ITAA 3UF4A 2RFNA 4K0YA 5J95A 4F7LA 3NNWA 3POZA 5E8WA 2WEVA 5EKOA 4EBVA 3A7HA 1O44A 3QQJA 2BDWA 3W2OA 3A4OX 1JOWB 2BZKB 1BX6A 4FICA 1W82A 4RVLA 2ITVA 3SOCA 3RNYA 4RBLA 3DAJA 1A1AA 1JBPE 2X81A 3US4A 5BMMA 3WOWA 1UU7A 2R64A 3R9OA 4FKQA 5AAEA 5HVYA 4NIFB 3CKXA 2HIWA 2IWIA 4QP4A 5IZFA 3QUEA 3BUNB 3RKBA 2C6LA 1RQQA 4ZLOA 3V6RA 4M69B 5CASA 1M7NA 3EACA 5HKYA 2F7ZE 1Y91A 2VX0A 3FLYA 3OUKA 3Q3BA 3ZXZA 2WAJA 3BHTA 2X9FA 1OO4A 1PMVA 3FYJX 3DK3A 3MFUA 4ZS4A 1AYBA 3BGPA 1REJA 3QUPA 2OZAA 5AUZA 2QD9A 4KBAA 4UXLA 3OW4A 4NEUA 3VUKA 1JAMA 4FNWA 5EQYA 4PX6A 4NM0A 2XB7A 5LVLA 3SXFA 4ZTNA 4Y95A 2C1BA 5IQEA 2YIXA 3ZUVA 5JQ5A 2ZAZA 4ZSAA 3KF4A 3DLZA 4W4WA 2QVSE 3OY1A 3QALE 5CU3A 4F9BA 2UW6A 3QCYA 3ZLXA 4ITHA 3ZO4A 4Y46A 3I7CA 1REKA 1XH5A 3DOGA 1A07A 2K7AB 1GZKA 3LFQA 4R78A 4CRSA 4FSZA 4DEIA 5IH6A 3VQUA 3NIEA 3AC4A 2W1HA 5EI8A 2J50A 5DRBA 4BKYA 4EHEA 1FVRA 5HX8A 5DEYA 4G6LA 4O0WA 3R7UA 2KNOA 4HVIA 2OK1A 3G6GA 3MH1A 3PP0A 2W0JA 1YI4A 2C5OA 3A61A 5ANIA 4CEGA 1IRKA 2QOKA 3NCGA 4CKIA 2AUGA 5I6VA 3LW0A 5JFSA 2PVYA 1XQZA 4CD0A 2X4ZA 4QP8A 4GWFA 3QQLA 1GZ8A 2F49A 1ZYSA 3R9HA 3BBWA 4MD9E 3GEQA 4HNIA 4W4XA 4BIBA 3PSCA 3O23A 1PXMA 2YWPA 4D5HA 3HDMA 4O0XA 4G2FA 5IA4A 3LCDA 4C57A 4DEGA 3O8TA 2W06A 1O4CA 5EHYA 2XYNA 4ZY6A 4EONA 4XRJA 5HLPA 5KMJA 3LMHA 1JLUE 4QMWA 4NW6A 3R83A 2UZLA 1KSWA 3RGFA 4AA5A 2XNBA 5IG1A 4GVJA 5DE2A 2PWLA 2UZVA 5CANA 4FEUA 2V5QA 3I6WA 3Q4UA 3MJ1A 4DITA 2Q0NA 4UMRA 1NRVA 4QYGA 4YZDA 2RKUA 3CR0A 4ZP5A 4AG8A 4APPA 3UYSA 4E1ZA 4FKGA 3BKBA 3Q5IA 3FY2A 4RFYA 2C5XA 3HMOA 2GPHA 3F66A 5HZNA 5DA3A 5HCYA 3REPA 3ORXA 3QQGA 4LRJA 2YM3A 4IB3A 3FLWA 1U5RA 2CN8A 4BIEA 3OVVA 2LAVA 4EH7A 3P5KA 4QNYA 4RX9A 4B7TA 4QTDA 5D1JA 1O4LA 4PTCA 1R0PA 4OAVB 4OHLA 4JR3A 4NJDA 3PPKA 4J96A 1YVJA 2I7QA 4BGHA 2OGVA 1R39A 3FDNA 4O84A 5ETIA 3G15A 2JFLA 5JFWA 4Q2AA 1CKJA 1G5SA 4FV6A 2ZV2A 1OIQA 4C58A 1OIUA 3EFLA 5FEQA 3M7FA 5JRSA 3E88A 5K5XA 3ET7A 4FVPA 5HTIA 3Q2MA 4ARKA 3QWKA 1TCEA 2PU8A 4ZIMA 3T9IA 1AQ1A 1WBOA 1YOLA 4FVRA 3RZFA 2Y9QA 4QP6A 3VW8A 4I6FA 2W5HA 4D2TA 3OFMA 3O8PA 1WBNA 3HRCA 4LGDA 5AM6A 2DS1A 3GENA 3MA3A 3MXYA 3FMJA 1O4GA 1QG1E 4EBWA 2YCSA 2DX0A 3KA0A 4J98A 1Q99A 4TWNA 1F0QA 1JNKA 2R3LA 3EIDA 1DI9A 4FI1A 4XLIA 1SHAA 4WBOA 4RVKA 4USDA 3JS2A 5B7VA 4D9UA 4F4PA 1O4JA 3VJNA 5BVWA 3ZZEA 4IAIA 4RIXA 4MXOA 4R77A 3PP1A 5HG7A 3L9NA 5BO4A 1R78A 5AULA 1J1CA 4GYIA 1O4KA 2BHHA 4W4YA 1AGWA 1WQUA 2XIYA 3QZGA 1ERKA 2YISA 2W4OA 3DAKA 4ZLYA 5KMKA 4D2SA 3DB8A 2DQ7X 3EH9A 3DBDA 4P5ZA 3VRZA 4F9AA 2OXYA 1VR2A 4HGSA 4QMLA 3HMNA 4XV2A 1BYGA 1ND4A 1OPJA 3NCZA 1OPKA 1GNGA 4LMUA 2BCJA 3LFAA 3O7LB 2R3PA 3D5UA 4XMOA 4EIHA 2VTQA 3ODYX 2HW7A 4GW8A 4O86A 3GC7A 3D7TA 3TL0A 4BCMA 4KIPA 2CKEA 4DFNA 4MBIA 1LP4A 3KB7A 1XR1A 1O49A 3I6UA 2X2KA 5FEEA 1PW2A 3ZS5A 5EDRA 3VS2A 1KA6A 3ORKA 2EU9A 3JR1A 2VTOA 3FMNA 3JY9A 2CGVA 4O7YA 3JVSA 1M2QA 3OZ6A 3QFVA 4ZEGA 2PUPA 3QD0A 2Y8OA 5CAPA 4EOLA 3OG7A 4J1RA 3HECA 4FKVA 3O71A 4YZ9A 3BZ3A 3TN8A 2BAQA 3GP0A 2WOUA 3C7IA 3LMGA 2RSYA 2G1TA 4IWQA 4IW0A 3TV6A 3M11A 1FINA 2ONLC 1YDSE 2X4FA 3RHKA 3SW4A 3GCPA 4JT3A 4D4VA 1H0VA 1O9UA 3NDMA 4M14A 4IH8A 1Q8TA 3C4ZA 5B0XA 4YC3A 3DJ7A 1MW4A 2WO6A 4IZ7A 5CZIA 2JAMA 2JEDA 4DCAA 5L2IA 3LXLA 1GZNA 2OH0E 4JQEA 4F1TA 2ITYA 3ZZWA 4UMUA 4AT4A 5IMEA 4DFZE 4GV1A 5HHWA 5GJDA 3TIZA 2Y4IB 4CFWA 3HV7A 2G15A 3OOMA 4L3LA 2W1EA 5BQ0A 5JFVA 2XBAA 5FXQA 4KRCA 4EOJA 1BF5A 2FA2A 4IX4A 3OC1A 5ANDA 4QYEA 4FSQA 4GL9A 4L43A 5K9IA 5M07A 2CGXA 2AUHA 3ACJA 3QTZA 5EK7A 4C2WA 4HVGA 2Y6MA 3CD3A 1GIIA 1P4OA 4U42A 4XG2A 4DG3E 5IA3A 2PULA 3MESA 3GU6A 4XZ0A 2IPXA 4ZY5A 2VU3A 3IOKA 4RFZA 4Y85A 3BE2A 5JQ8A 5AR2A 5B2MA 4RA4A 4FSUA 5FP5A 4EOPA 2CLXA 1UA2A 2HZIA 4EK8A 3D14A 5IQBA 2ZM4A 2OIDA 3PY1A 1S9JA 4HVHA 2PVMA 3UNKA 4YC6A 4J97A 3P78A 4FNXA 3VAPA 4TNDA 4MWHA 3PXKA 4JQ8A 5IPJA 4JAJA 4LOPA 3V5JA 2IVVA 2NRUA 3QRUA 3FXXA 3A62A 3HAVA 3T04A 3THBA 3CGFA 4O2PA 1KOAA 3OV1A 3DJ6A 4DLIA 4C7TA 4BTKA 5LARA 1P13A 3BCEA 5I0BA 3EN6A 2UW7A 2UZEA 5HO8A 5BVDA 1QADA 4OTPA 3R7YA 2OZAB 3H3CA 4I4EA 2XJ2A 1WVXA 4DF3A 2W99B 3ZRKA 3FI4A 5CEOA 5D12A 4OHHA 4FODA 2JYQA 5HGIA 3SRVA 1SPRA 1Q24A 5IEVA 2R7BA 1F5QA 2V22A 3AT3A 4HCTA 3S1HA 2R3NA 2QOQA 2DM0A 4A07A 3RTPA 2VD5A 3NUUA 3QQKA 1ZYLA 2VO7A 3O0GA 4KBKA 1SHBA 4XHKB 3TTJA 5D9HA 4K6ZA 3JY0A 2WMTA 4FOCA 4JEGA 2VRXA 4EYMA 1O4RA 1VZOA 2KULA 2P3GX 1OITA 3DY7A 1YDTE 4PNIA 3IMDA 2CIAA 3RAWA 3UDBA 4B6LA 4W4VA 3AMAA 3ZC6A 5AX3A 4CNHA 1CSNA 2UW4A 4XZ1A 3QWJA 4LG4A 1OPLA 5EM7A 5EI2A 2HZ0A 4A9UA 4JLCA 2ETZA 3MB7A 3PUPA 3ATSA 1KV2A 2ZV7A 3G9LX 3M2WA 4WD5A 5AR3A 3QX2A 2GSBA 4MBLA 3MPMA 2R0UA 4C3FA 4Z3VA 1IAHA 4QT1A 2XIKA 2F7XE 1YKRA 3B8QA 3BYMA 3PXZA 4QYYA 4RJ7A 4TWCA 2XK9A 5AM7A 5GJFA 2X6DA 4N6ZA 4OBQA 3MTLA 3QD4A 2AC3A 3TV7A 1O4DA 1J1BA 2VTHA 2QU6A 2VTAA 3QLFA 1FVVA 2BRGA 3EYHA 3QC9A 5HNIX 2VV9A 4I22A 2VTLA 4GEOA 1F1WA 5FTOA 1JWOA 5HLNA 4HGLA 4D2RA 3GC0A 4UMQA 4O7LA 1UKIA 4GT3A 3HDNA 3KRWA 3OBJA 2YLEA 3F3UA 3C1XA 3IOPA 1H1SA 3LOKA 3Q5ZA 4FIIA 4UZDA 4GT4A 3P79A 4X2JA 3U55A 2PMOX 2PTKA 3MS9A 2PK9A 3MTFA 4GFMA 4IWOA 4L00A 4XV3A 5EM6A 2MRJA 2ZOQA 4FNYA 5CQWA 4EKLA 3PA3A 5L3AA 1IG1A 3V8TA 5CEKA 3KXNA 5AV4A 3FLSA 5AADA 3FI8A 2PVNA 4I93A 4WSQA 1O6YA 4YLJA 5LWNA 1PRYA 4XG8A 4A9SA 4MXXA 4JDIA 3RNIA 2C5NA 2B9JA 1BMKA 2XNNA 3TNPC 3IDBA 1OL7A 1H24A 2JDSA 4I0RA 2OJJA 5CSVA 5CSHA 3JXWA 2ZDTA 2CDZA 4EEVA 1SVHA 3GC9A 5IISA 4PTGA 1CM8A 3QZFA 3B2TA 4GFOA 1ZFPE 3HMMA 3UMWA 4AOTA 3NNXA 3DBCA 3ZBFA 2ITPA 3BGQA 3V51A 3VS7A 2ITQA 4ANMA 4AZEA 3CS9A 4L46A 3SKCA 4KIQA 1UKHA 4MXZA 3KRJA 3FKNA 4U1PA 1O45A 1A81A 1H9OA 3Q04A 4QPMA 2DUVA 4QP7A 4M4ZA 4O0SA 4XJ0A 3FPMA 1LKLA 3VW6A 5A9UA 2WGJA 3CD8A 1A9UA 2CHLA 4IM3A 4D4SA 3AT4A 3QRKA 4BCIA 3F61A 2PE1A 5CI7A 1LKKA 3VNTA 4EH6A 4GIIA 4XP3A 3A7IA 1CSZA 1QPDA 3FI3A 2UW0A 4FKJA 5F94A 3FMKA 3HA8A 4IJPA 4RIXB 3PS5A 4HYHA 4FV1A 1R1QA 4O7NA 2C1AA 3ATTA 5CF8A 5J9LA 1BL6A 4PL4A 4EOKA 3VS4A 2VTJA 4I0SA 4MD7E 3KY2A 5TKDA 5F4NA 4AW2A 4C61A 2Y3AB 4C8BA 4I41A 5LCKA 3W10A 4F1MA 3PVWA 5I9UA 4MAOA 1W84A 4ZJJA 2EB3A 3F2NA 4O91A 2B9HA 3QQFA 3PVGA 3RP9A 2CCHA 4I1ZA 5FM2A 2C3LA 2BAKA 2J0IA 4F5BA 3F82A 5BMSA 4JG7A 5H3QA 2A2AA 1JYRA 5HIEA 3A99A 1MRVA 4FL3A 2BRNA 1XO2B 1OKZA 4I5CA 3WE8A 3S0OA 2EWAA 3E92A 3UE4A 1I3ZA 2HZNA 3M42A 4YMJA 2WB8A 4GJ2A 4AS0A 5HCXA 3ORIA 5LVPA 3QBNA 3BX5A 2CNUA 5ACKA 3PYYA 3QTIA 4JNWA 4KSPA 2J2IB 3BQCA 4ZMEA 4FL1A 3LJ2A 4ZXTA 5E9EA 4FE2A 4W8EA 3RHXA 4JAIA 1ZZLA 2A1AB 4EC9A 5F20A 2IW9A 2Z7QA 3IO7A 4XG9A 1RJAA 4K45A 4QP1A 3QAME 1YI3A 1XKKA 2IZVA 2EUFB 4HCVA 5L4QA 4KWPA 3GCVA 2WMAA 3E63A 3UQGA 4FBNA 3MPTA 2VAGA 2XMYA 5DPVA 4DC2A 5EQPA 3PSJA 1ZRZA 3AGLA 4PDPA 2WXVA 4BYIA 2PVLA 3ALNA 3LLTA 2Q0BA 2B55A 4FMQA 3FSFA 3Q4TA 5IMXA 2XM9A 4D4YA 4D2PA 3E8DA 3GCQA 5HE3A 1ZMUA 3HV5A 4FOBA 1ZMVA 5IDNA 2QO9A 2WQOA 3IN7A 3WA4A 2W9FB 1BLJA 2HXLA 5K0KA 5J7HA 1CMKE 3RK5A 3NLBA 5I9XA 3CTHA 2W1IA 4BI1A 5IEXA 5KMMA 2XKDA 3RM7A 3NUPA 4AFJA 5DF6A 3IG7A 3K2LA 1X6CA 2LQWA 2WTKC 5CXHA 3ZSIA 4PDYA 1UURA 3RAKA 3FEGA 4DHFA 3WF6A 4ZMFA 5IBMA 1BHHB 3BIZA 3IKAA 3C4EA 4S33A 4R1VA 1FHSA 5CXZA 4JE4A 3KN5A 2CR4A 2R3FA 1PKDA 1FQ1B 2B9IA 5ANGA 2XIRA 5FGKA 3L8SA 5AV3A 3UYTA 4D58A 1WZYA 3O7LD 1XHAA 3RM6A 3I0QA 3S4QA 4F7SA 3FXZA 1F3MC 2R3KA 5C01A 5BNJA 1H08A 4JG8A 1H01A 4O0TA 4U5JA 5F9EA 1WVWA 4NH1A 4MQ1A 5LVOA 4M3QA 5HBHA 4QRCA 3OTUA 5EW3A 2Y1MA 3TJCA 3SDJA 1P4FA 3R22A 4RVTA 3VN9A 2NP8A 5CZHA 1U5QA 2V55A 4C4JA 4C4GA 1M52A 3QQUA 3TZ9A 4BBFA 2X8IA 2RF9A 3A60A 4TZIA 3QYZA 2RG5A 3RCJA 3WF7A 1QPCA 2O64A 1P5EA 2IVTA 2VWUA 3P4KA 2EU0A 3OVEA 3HNGA 1Y57A 1QCFA 4W8DA 1ZOEA 2ZDUA 2ZB0A 3CPBA 1OKYA 2ITZA 3FZSA 2ZYBA 1BLKA 1IASA 3N51A 4P7EA 2WMQA 4RJ4A 4APCA 2BMCA 3PJCA 4G6OA 4QP2A 2IZTA 3FL4A 4MK0A 4O27B 4A7CA 4BKZA 4FTRA 4DH1A 1QL6A 2IUHA 5KAZA 2XM8A 4BR3A 4L44A 4UN0C 3UMXA 2ZB1A 5CWZA 2WU6A 1TKIA 3V8SA 3ZLYA 4YHJA 2YM8A 3PPJA 2HWPA 3VS0A 5KMIA 3BLRA 1PF8A 4AWIA 5AP2A 4EUTA 4DFUA 2J0MB 4TKSA 5DYJA 3D5XA 4I21A 5JZNA 4U79A 2QOFA 1ATPE 2JKKA 4K44A 3EQIA 3CY2A 4NTSA 5CY3A 5AR4A 3SVVA 1LUIA 3OD6X 3DCVA 5DVRA 4E68A 4QTBA 4YZMA 5EOLA 4BBEA 3FQSA 5J87A 1NW1A 2BFXA 2FSLX 3ULZA 2VTTA 3DKFA 1RW8A 3EHAA 3NYNA 5C4KA 5AUTA 1XH7A 2L4KA 1QPJA 1TQPA 3R8PA 2ERKA 1OL5A 2PZ5A 1WFCA 3CC6A 3CCNA 4FEQA 3HV6A 3QRIA 2XYUA 3DXNA 4WG4A 5CEQA 4WUNA 4WO5A 5TF9A 3BQRA 4LGHA 1HCLA 5IQAA 3MVHA 3FLQA 1YHVA 4FIHA 5ETAA 1F2FA 4EOIA 5IH5A 4B8MA 2BAJA 2YIWA 2HZ4A 2Y7JA 2XRUA 3LFCA 1Q97A 2YM5A 4O0RA 3RCDA 5IBSA 3MAZA 2HOGA 5HG9A 3NR9A 3PRIA 3GC8A 5EYDA 4IB1A 3EQGA 5HKMA 3S9KA 1PMUA 1X27A 2VGPA 3ZO1A 5AFVA 2PVHA 3A2CA 5KMOA 4EOMA 5JT2A 4UYAA 4FV8A 4IXPA 3QF9A 3E8CA 4ALUA 3DT1A 3VWAA 5GZAA 1O4OA 1SPSA 1O4PA 3PLAE 2YM4A 5FDXA 2GDOA 4AN9A 1V0BA 3AGMA 4XNEA 4ZSJA 4BYJA 4QYFA 4TWPA 3QZIA 5CS6A 4CT1A 3N7YA 4LUEA 4DCEA 4P5QA 2WU7A 5DC4A 4NM3A 1GOLA 3QA8A 3MFTA 4JDJA 3PY0A 4RC2A 5GZ9A 2YDKA 3VC4A 2QOCA 1Q8YA 4FV0A 3ZYAA 4GU9A 1NVRA 3KXHA 4J71A 5L2SA 4C62A 3FMLA 3FWQA 5BVKA 2CLQA 4O96A 1YXVA 4ASXA 1SNUA 4X0MA 4TYHA 4IANA 3LCKA 4MBJA 4EK6A 1ZOHA 2BTSA 3FKLA 4FL2A 3HUCA 4CZYB 4X6QC 3FQHA 3LCSA 5CEIA 4Q5EA 2QNJA 4IAZA 1OKVA 1BFJA 3ENHA 5BPYA 5HCZA 4BC6A 4IQ6A 4AT5A 4J99A 4FTOA 5LOHA 3IGGA 2V7AA 5JH6A 1OBGA 2BUJA 3O51A 4I3ZA 4RQKA 4L67A 2HELA 4FZAB 4OW8A 4FA2A 1SVEA 4U80A 3K5UA 3IECA 4Z7GA 2YN8A 4KKGA 4DFYA 4LYNA 5CU4A 4GL9E 1YQJA 3FHIA 4HYSA 4L53A 3L9MA 4FSMA 4V04A 5BX0A 4RC4A 2CRHA 4EY0A 3R2BA 5TO8A 2PPQA 4I20A 4AZWA 4MEDA 2ONLA 4NCTC 2X8DA 3QQHA 5DR2A 2MQIA 4ASEA 3QWYA 1BG1A 3E5AA 4BF2A 4EH4A 5EDPA 3L8VA 2J9MA 4YC8A 2JIIA 3HYHA 4L7FA 3D83A 3EL7A 1VEBA 3TUCA 1JKTA 3C5UA 4RT7A 3IW7A 4PF4A 3N4UA 2CSNA 4FV4A 4IJ9A 4U0IA 1LUKA 4OLIA 2F4JA 4ZSLA 3LPBA 5DWRA 4LL0A 3EAZA 2H34A 4PMMA 4HW7A 4YU2A 3UGCA 4J95A 3WYXA 3ZFYA 3LXNA 4DEDA 2EOBA 1H26A 4E5AX 4IAKA 3GXWA 3BYVA 1IR3A 4EJNA 5FQDC 4C4FA 4FYOA 2HWOA 5M44A 4M0YA 3E7VA 2UZBA 5D7AA 1BKMA 3VRRA 5GHVA 2UVZA 3R30A 4XRLA 5AAFA 3A8WA 4QMZA 2RG6A 4ACGA 4BZNA 4I0TA 4L68A 2E9NA 3WZUA 3OEZA 3VUDA 4DGGA 4YSMA 5HO7A 5T68A 2B7AA 4M68A 3MA6A 4TY1A 4HVDA 3AC5A 4A06A 4C3PA 2F2CB 3HRFA 4FIJA 3DFAA 4EK4A 5EG3B 4KIOA 3AD5A 1H1QA 3UNJA 3FMEA 3DBQA 3OW3A 3QGYA 3OHTA 4ORKA 3F3WA 4MNFA 4MWIA 1OKWA 2RIOA 4PWNA 3RMFA 4NM7A 3S8OA 5B2KA 4QTEA 5AP7A 5EHPA 3MY1A 4S34A 5F95A 4XP2A 4YTFA 3G6HA 5CU0A 4LM5A 3U9CA 3F5PA 1EH4A 1ZOGA 3AC1A 3EQBA 4ID7A 3VHEA 4E4NA 2OQ1A 4ZTRA 1OGUA 1Y8GA 4G3FA 3DTCA 5J79A 3VUGA 1Q3WA 3VUMA 2EYYA 5EEQA 2QOHA 4LV5A 4CQEA 5DFPA 3AC2A 3HP2A 2UZWE 3D5WA 1YXSA 5JFXA 2B52A 5M4UA 3F5GA 5FD2A 2XP2A 3FJQE 3KFJA 3KL8A 5JN2A 2CNQA 4YHTA 4K2RA 2KK6A 3HUBA 3OCBA 4QMYA 5FTQA 1WAKA 3KVXA 4TPTA 4IVBA 5C4LA 1A06A 4P2KA 4CFXA 5DH3A 4I4FA 2FSTX 4NKSA 2AYPA 3I4BA 5EYMA 1OIYA 3IW8A 5CYIA 5IKWA 4X21A 2OWBA 2CMWA 4ENXA 3FSKA 2VTMA 4CG9A 1OZ1A 3MGYA 5M4CA 4P9ZA 5IA0A 5J9YA 4H1OA 3VQHA 3PQZA 2HUWA 4D5KA 2IUGA 2FUMA 4NWFA 4OBOA 4FTKA 1Q8ZA 4HZRA 5HESA 1LEZA 4FZ6A 2EB2A 5L2QA 4FIEA 1UNHA 4FIFA 4XLVA 4JRVA 4X3JA 2JDTA 4B4LA 4RIOA 2GQRA 1H1WA 4F0GA 2WTIA 3PTGA 4BHZA 3CSVA 2B0QA 4GH2A 3ZUTA 3ZMMA 1W83A 4J7BA 4BCFA 5KMLA 4EK5A 1SKJA 2H5KA 4R3PA 2WZJA 2ACXA 1G3NA 3TNIA 4ITJA 1WBPA 5ANOA 4CYJA 1O47A 2A27A 2BZJA 5EHRA 4FGRA 4MNEA 2YU7A 4PPBA 4FT9A 3R9DA 4EI4A 3EQDA 3D94A 2BVAA 3ANRA 1YXUA 4FTTA 4DH5A 3W2CA 3MBLA 2YWVA 1HCTB 2XVDA 4D1XA 4G3DA 4JRNA 4O1OA 1H8FA 4UEUA 2W05A 4UALA 3BWFA 3NZ0A 4ZZNA 4GT5A 5FXRA 3UC4A 3RK9A 2MC1A 4JIKA 2XK7A 1ZMWA 2W96B 4H1MA 4WNMA 5LVNA 2FH9A 2XJ1A 3TKZA 4LOOA 5DEWA 3EFKA 4ZLZA 3VO3A 4R1YA 5CVHA 2OG8A 4AUAA 3LQ5A 2R3HA 2X6EA 3CEKA 4FTJA 4PDSA 4BDHA 3TKHA 3TNWA 4K33A 3FMDA 4KA3A 4DEAA 2G01A 2PE0A 4N4SA 1UU9A 4R7BA 3DJ5A 2G2HA 3NUXA 5AXIA 4OTWA 3DKGA 1B6CB 3F7ZA 4G5JA 2WFYA 4B9DA 5KHWA 2C47A 1L3RE 3R6XA 1QMZA 1YOJA 4JI9A 4ZTMA 4FZFB 4IZAA 4PV0A 3KCKA 4EHGA 3OCGA 3RALA 3PJPA 5I3OA 5KMNA 5IUGA 1UWJA 4RQVA 2UZTA 4IE9A 2G2IA 2XF0A 4ZTHA 4CG8A 1WVYA 2Y0AA 2XIXA 4N6YA 3TG1A 3LFNA 1WBWA 4ZTQA 1PMNA 2UW5A 4LFIA 4BTJA 3FV8A 3ETAA 4NFMA 4MH7A 4FEXA 2YDIA 3OROA 2YM7A 3FL5A 4EUUA 4CRLA 4L45A 2CN5A 4CLJA 5CU2A 4QMQA 1E1XA 3HVCA 5CF5A 2BRMA 4U41A 3GU7A 2UZOA 5IEYA 5TE0A 2E9UA 4BWKA 3VBYA 3QKLA 5CT0A 2W1FA 3O2MA 2PLDA 3FPQA 4DYMA 3R1YA 4WSYA 4G34A 2W5AA 4ZZOA 1OIRA 4L3JA 3CY3A 2A0CX 5LMBA 4YJRA 3HCKA 4H58A 3VJOA 3BUMB 3F2RA 4IIRA 1PKGA 1K3AA 3DNDA 3MH3A 4QQCA 5E8SA 4L8MA 4X2GA 3CJGA 5DOSA 4BI0A 4TYHB 2XK3A 3HZTA 4F0IA 2L3TA 4QO9A 4DGPA 3FBVA 4XOZA 4AA0A 2LCTA 2XRWA 5FXSA 4GU6A 1B47A 4MKCA 2P4IA 4FKPA 4LMNA 2C0OA 1MUOA 5HICA 2RORA 1SVGA 2R3JA 3GOKA 5CSWA 5HORA 5I3RA 5M57A 2R3RA 3CQEA 4FC0A 4FTNA 2P0CA 4MXAA 5CVGA 3I60A 5L2WA 3PXFA 5H8BA 3R01A 1YOMA 4NUSA 4U7ZA 4YLKA 2VO6A 1T45A 3B2WA 4K18A 4TYEA 3DV3A 5DC0B 2C3IB 5DHJA 4XV9A 3QRTA 3KVWA 5C8KA 1LUFA 3NNVA 2P2IA 2JBOA 2OZOA 4ACHA 3C4XA 5FBNC 4ITIA 1XBBA 5M56A 3NIZA 3EN5A 3W1FA 2XKEA 2EKXA 3PJ1A 4ZSGA 4YTHA 4IHPA 4PDOA 4DFBA 4FSRA 4LUDA 3UO5A 2PNBA 4XG6A 1BKLA 4GK3A 3RK7A 2G2FA 4YJOA 3SW7A 1ZLTA 2BKKA 4BCPA 3GUBA 2ESMA 4RG0A 5CI6A 2F57A 3Q32A 1FGIA 3R8VA 2F9GA 2R2PA 3GGFA 3OWJA 3DS6A 3VBXA 4HYUA 3LCTA 3UQFA 3QGWA 4OTRA 4CFFA 3DFCB 4U81A 2YZLA 1OUYA 5AEPA 4O21A 3N4VA 5A4EA 4KIKA 4AW5A 1J7IA 3SLSA 3VF8A 1U46A 1PXKA 4P4CA 5E4HA 3F7WA 5L8KA 4JX7A 4EL9A 3OEFX 4G3GA 4LL5A 5LCJA 5EHLA 3VHKA 4E6AA 4EKKA 2OIBA 1BHHA 1V0OA 2YCRA 1HCKA 4LRKA 4MD8E 5AIKA 1YHSA 4YPSA 4Y83A 2CKQA 3NAYA 2UZNA 4PMTA 2ZV9A 2ABLA 4RSSA 5AP6A 2ITOA 4BL1A 2XH5A 3PWYA 1PYXA 2BIYA 1Q8UA 5FG8A 4C3RA 4F7NA 4GK4A 3TZMA 4FZDB 3IDCA 3ID6C 4R5SA 5HEZA 2C3JA 2AOBA 5AWMA 4B8LA 2X9EA 3FE3A 3QZHA 3CKWA 3RBWA 4AN3A 4IB5A 3DBFA 3D2KA 4KBCA 3TV4A 1AOUF 3MB6A 4FSYA 3VRYA 3DQXA 2R3QA 1XH6A 2PL0A 4JBQA 1LUMA 1X0NA 3PE1A 3W18A 4AGUA 4DE4A 1XBAA 5IQGA 1KWPA 2C30A 3LFFA 5HLWA 3D5VA 3PIXA 2IJMA 3ZRLA 4X2FA 3COKA 1CWEA 2ITNA 1T46A 5IUHA 2FVDA 4X7QA 2IO6A 3EZRA 3NEWA 2HENA 2VWBA 3PSBA 3KU2A 3OWKA 1OECA 1IEPA 4FEVA 1MQBA 5ANEA 3VBTA 5HO6A 4K1BA 4GPLB 2UW3A 3KULB 3SHEA 4MHAA 2C4GA 1WMKA 4PRJA 5A4QA 1O4AA 4AACA 1L8TA 3R00A 1RDQE 3N9XA 2PUUA 2FCIA 5H2UA 3G90X 5EW8A 1GY3A 4RLKA 5HTCA 1ZAOA 4DA5A 3VF9A 1NVSA 3U6IA 3KMWA 4DFXE 2C5YA 2I0HA 3UOJA 5GINE 2O3PA 3BYSA 2PVKA 3NS9A 1GZOA 4U44A 5EHOA 4YUQA 4XYFA 1GIJA 4KS7A 2YJRA 4RIYB 5FP6A 5EH0A 5BUJA 2NNWB 4WRSA 5DT3A 4WG3A 3I5ZA 4KABA 2CS0A 5A54A 1OM1A 2ECDA 2CGWA 3PXQA 4KKEA 4HZSA 4ANNA 4BVUA 3U9NA 2PZRA 5M09A 4AZSA 1HCSB 3EQHA 4MNEB 4BICA 1NY3A 3E3BX 3LM5A 1LCKA 2WMBA 2YSXA 4AOJA 3FXWA 2JGZA 2Q83A 3VRNA 1H27A 4X3FB 4X3FC 4PP7A 4FF8A 2W17A 4DEEA 3OB2B 3FAAA 3G2FA 3ROCA 2PUIA 4YTCA 4M7IA 3S8LA 3BLHA 4FSWA 3U51A 3UIMA 2HW6A 1BKXA 4AX8A 1GHUA 1Z3KA 2CBLA 2OJ9A 4UB7A 5E92A 4B0GA 4C59A 3I1AA 4YJSA 1OL6A 3UO6A 5HI2A 3BHVA 3OXZA 4YSJA 3ZBXA 1AYCA 1V0PA 2JKMA 2QI8A 2GSFA 1URCA 3P86A 5L6WL 3PVBA 3WF5A 1XWSA 2NRYA 3PZHA 4AQCA 4GSBA 2GS6A 1ZARA 1Z57A 2OJIA 1Z9XA 3KXXA 3QTXA 4V01A 2JC6A 3SV0A 3WF8A 4IVAA 4PMSA 2W1GA 2CI9A 2X2LA 4M13A 4YZBA 5EFQA 3MY5A 3F88A 2BDFA 5AR5A 3FZOA 3EQFA 3EMGA 3OWPA 4ZZMA 5DMZA 4D0XA 4YNOA 3IS5A 4RZWA 4UX9A 3BWJA 3FY0A 1YW2A 3I7BA 2BTRA 1VYWA 3O8UA 2CI8A 4CMOA 2QC6A 4V0GA 2JAVA 5AUVA 2VWYA 2C6EA 3ZLWA 1KE8A 1W7HA 3II5A 4U43A 5J7BA 4GVAA 4ACMA 2OW3A 2CGUA 3TDWA 2PVRA 4WKQA 4K8AA 5I9YA 4ONAA 2BROA 3RPRA 5L8LA 2VNYA 3QXPA 5IDPA 1DAWA 1Q4LA 3A7FA 3DXQA 2JDVA 2WQNA 4O7RA 4C2VA 2J7TA 3BHHA 2ETRA 3PA4A 5J5SA 1G8SA 4E4LA 2PMIA 3OMVA 2EO3A 2GHMA 1W8CA 3ELJA 2GS2A 3LFSA 4XOYA 4QMPA 3SAYA 3UIBA 2F2UA 5L6PA 3CXWA 2XIZA 4L42A 3W2QA 4YZCA 4KUJA 4N57A 3UZRA 4YO4A 3C4FA 4GS6A 4H05A 1V1KA 4FSTA 4BDGA 1LPUA 4JGHA 4BTMA 5AP4A 2X7GA 3SG8A 3VUHA 5JKGA 1R1SA 3DDQA 1YWNA 3UODA 4X2NA 4ZK5A 1K2PA 5CLPA 2XP1A 2QLUA 4YJVA 4EK3A 2HY81 2J5FA 4XH6A 5E1SA 1NT2A 5CENA 3MH2A 2EXCX 3UQCA 3Q2JA 2GNJA 3GI3A 3UOHA 3W2RA 4EWHA 2PZPA 1ZYDA 2XK6A 4J8MA 4IM0A 3QA0A 3D9VA 3T8OA 2B3OA 3CTJA 2Y4PA 5BVNA 4I6BA 4UWCA 3OF0A 4TT7A 4PUZA 5TT7A 5IQDA 4ERWA 5EKNA 5GJIA 4AU8A 4FYNA 4ZTLA 3NNUA 4FV5A 4O2ZA 4W9WA 3NPCA 2XK8A 3SQQA 1NZLA 5ETCA 4F99A 1E9HA 4XG7A 4GKIA 4CT2A 3FMHA 3V6SA 2B4SB 4O7WA 4F6SA 2HK5A 3QKKA 4R3RA 2J6MA 4KB8A 3UO4A 3PLFB 3IMJA 4YZNA 5EG3A 4HNFA 3PJ8A 3GU4A 4IEBA 3V01A 3KREA 1I44A 5CAUA 5DLSA 2WMRA 1Q5KA 4MXCA 3E62A 3ZFMA 2C68A 4DGNA 4FT5A 4EH9A 4P90A 2LNXA 1PXIA 3B8RA 3I0OA 1YXXA 2DWBA 4E7WA 1UUSA 2JITA 5HE2A 4F5AA 1P14A 4NT4A 2ZM1A 4IAFA 5FUTA 4I23A 5KE0A 3BV2A 4M97A 5H9BA 2L6KA 3QCQA 4XS2A 1NVQA 4QMMA 3LAUA 1U54A 5C03A 2QR7A 3F5UA 4KIKB 3N84A 3E64A 3F6XA 3UPXA 3BUWB 2WTKB 4JQ7A 4QPAA 4XCUA 4Z55A 4AGCA 1A1CA 3PJ2A 5DGZA 3ROYA 4CMUA 1PXPA 4S2ZA 3U8WA 3KRRA 2K79B 5IF1A 2ZMDA 3QWXX 5JEBA 1TVOA 3LXPA 4EH2A 5KX8A 2ITWA 4CYIA 1A1BA 2EYZA 2YITA 1RPYA 5JK3A 4Y72A 1J3HA 3ZOSA 3HL7A 4KD1A 2VTPA 3PFQA 3F2AA 4LOQA 4DN5A 4F70A 3DB6A 4A9RA 3PRFA 5D41A 4FV2A 5HD7A 2PVFA 3LVPA 1DM2A 3OP5A 2PMLX 2H46E 5KKRC 4BBMA 4EHVA 3KMMA 3RPSA 1LEWA 3IGOA 4QTAA 3FUPA 3SXRA 3E3PA 5CU6A 2R3IA 4HJOA 2ITTA 3O50A 4CVAA 2H6DA 1PMEA 4I24A 5HVKA 4LQMA 4DBXA 2W4JA 1KV1A 4OHDA 2QOBA 4JVGA 2EYVA 2XA4A 5HIDA 2DYLA 3R71A 4F59A 1NA7A 4G17A 3LE6A 3EJ1A 3GQIB 4Q5HA 4F9CA 4CKRA 3H0ZA 1BL7A 1MRYA 1P2AA 4TYIA 5I9VA 2CKPA 2V0DA 3GOPA 2PVJA 4ACDA 3WE4A 1G8AA 2IZSA 1RJBA 2YIRA 3LHJA 3R1SA 4JDHA 3RAIA 4F09A 4R7HA 3SG9A 3GCUA 4XP0A 4NSTA 1IS0A 1YVLA 1O4FA 5BUEA 4FG8A 1YVHA 3VVHA 4IZ5A 3TUDA 4DH3A 4EZ5A 1SZMA 3ERKA 3W2PA 3WILA 4E6QA 1VYZA 4II5A 5BVEA 1FBNA 4FKUA 3BU5A 4G9RA 2GHGA 1O4BA 4R7IA 1KC2A 2RVFA 4UZHA 3PG1A 5EYKA 5AP1A 1FVTA 4FTUA 4O7TA 4FKLA 4BDCA 3BEAA 3OP0A 3V8WA 3WZKA 2OXXA 3DDPA 4FKTA 3RINA 3ZCLA 3BLQA 3DU8A 3C50A 1OL2A 3GVUA 4QMTA 4L52A 2C6TA 3QXOA 3HP5A 1Y1UA 3VROA 5E8XA 2VX1A 3NWWA 5LVMA 4JX3A 2Z8CA 2PUNA 4BRXA 1CWDL 2VIFA 1U59A 4O22A 3EQCA 4FZ7A 2LGCA 3NW6A 3P23A 2WEIA 3R9NA 4D0WA 1NZVA 4EQCA 4U3ZA 5LMAA 4FKWA 4RZVA 4XG3A 2QHNA 4O6EA 4Y8DA 2W1ZA 5H8GA 3TEIA 1KE6A 4DAWA 4D8KA 3RZBA 4A4CA 3QTSA 4FT3A 5A4TA 3KK8A 2VWVA 3D15A 4R3CA 5KUPA 2W5BA 4QPSA 4ANOA 4U40A 2C5VA 5BYZA 1J7LA 3W33A 4YJTA 2DVJA 1FGKA 3ORMA 3UZTA 4EOQA 2XNPA 3LQ3A 1JVPP 3NUNA 3P9JA 5EYCA 4BFMA 2RSVA 2IW6A 1R1WA 4R5YA 2YM6A 3CJFA 4D28A 4L1BB 2DLZA 3OOGA 4MVFA 4UYNA 4IC7A 4E4MA 4A4XA 3NRMA 1E1VA 3FYKX 4HGEA 1YHWA 2QOLA 4QMVA 4GJ3A 4GIHA 3QTRA 5HX6A 4U97A 2PSQA 2CPKE 4E6CA 5JZJA 4DH8A 3PXYA 1OMWA 3R63A 3UBDA 2C0IA 4YTIA 2DCRA 3LJ0A 3HMIA 1CDKA 4PL3A 4V0GB 4E6DA 2BILB 2X7FA 3EB0A 3EYGA 3TXOA 5T6KA 3AT2A 4AT3A 3JPVA 1NXKA 5HTBA 5CF6A 3NW7A 4YBJA 5DT4A 4AFEA 2A19B 3BE9A 1H00A 3R1NA 4FVQA 1ZXEA 4ZS0A 2PZYA 3HLLA 1ZWSA 2Z60A 4FUXA 2F7EE 3PG3A 5AV1A 3U4UA 1QPEA 4CGAA 4EJ7A 3R7OA 3V5PA 3Q52A 5M08A 1O43A 4H3QA 3PVUA 1XH8A 2QO2A 4Z7HA 5T3QA 1WBTA 2VUWA 4Y5QA 5ANKA 1UV5A 3OWLA 5KNJA 4KRDA 4AW0A 5ANJA 5JMSA 4GMYA 5J9ZA 3D0EA 3COMA 3QC4A 3R8ZA 4FKRA 4LRMA 4BDAA 3DLSA 4YJPA 4BCJA 4QP9A 1A48A 3QX4A 3L9PA 3ZC5A 1O6LA 5AP5A 4FTCA 2CNVA 3CE3A 4C4EA 4K11A 3TM0A 2J0KA 2BR1A 4BZDA 4TTHB 3P08A 2Y6OA 4DGOA 4F6UA 3GCSA 4H36A 3QTUA 2WTCA 4FUYA 4PQNA 1J7UA 1O42A 5KZIA 4QOXA 3DPKA 3PLSA 2H9VA 3UPZA 3TWJA 1HOWA 2ETMA 5A6OA 5AP0A 4I5HA 3NGAA 4MCVA 4E73A 3UC3A 3GU5A 2YEXA 3OXTA 4MX9A 5DI1A 1M61A 5HOAA 3TJDA 3OB1B 3D7ZA 2R3MA 4M0ZA 2OJFE 2GHLA 1H1PA 4OBPA 1STCE 4F9WA 5LXMA 1FOTA 4FR4A 3SGCA 4BCKA 3P1AA 4JS8A 1O41A 3MI9A 5FBOA 3QCSA 3HAMA 4FK6A 2WKMA 1FU6A 2QKWB 2RFEA 3QYWA 4IZYA 4DBNA 2BRBA 4F63A 2X1NA 2SRCA 4I6QA 4DGLC 4BCOA 2C9WA 3TZ7A 3LFBA 3BU6A 4ANSA 4WUAA 4G3EA 4F0FA 5F1ZA 5BYLA 1Z5MA 4CCBA 3G5DA 4FTMA 1JPAA 4O7VA 3IPHA 4BDDA 3KKVA 2GMXA 5B2LA 3CQWA 2E2BA 5LQFA 3QU0A 5HKWA 5IA5A 3NAXA 4CFNA 3BUOB 4TRLA 1BMBA 4JBPA 4FG9A 2EXEA 4RJ8A 3KXGA 4GKHA 2J4ZA 4EWQA 4PP9A 3AD4A 4RMZA 3ZDIA 3W2SA 1U54B 2VWXA 5AA9A 1TZEE 3HA6A 3DQWA 3S8NA 1Q62A 3VBVA 4AXAA 1OI9A 2X8EA 5DRDA 5HD4A 5CQUA 4BTFA 4PMPA 3KXZA 3MIAA 2UUEA 1MILA 2XKCA 2O5KA 4G9CA 1BHFA 4MTAA 1FMKA 4CTBA 1H1RA 5BYYA 1JWHA 5CX9A 3Q60A 5HU9A 1GRIA 1PJKA 1UVRA 4E4XA 3IN8A 3AMYA 4OTQA 4YJNA 1DS5A 3NYVA 3IW5A 4IAYA 3OUNB 3R8MA 2CKOA 5DT0A 1ZZ2A 4YHFA 2YACA 2PMNX 2QHMA 3KULA 2WIHA 3DAEA 4FT0A 4OUCA 5E91A 1PHKA 3ENMA 3SXSA 2ZJWA 1H28A 4MXYA 2J5EA 3AG9A 4IX6A 3QUDA 3NSZA 4O82A 3AD6A 4JOAA 5FRIA 3MW1A 4UMPA 3RWQA 2VWIA 1PXNA 1IA9A 3U6JA 3O17A 3UOLA 2C6OA 3VUTA 3TZ8A 3KCFA 3UP2A 3BI6A 4RIYA 3I79A 4YJQA 5CNNA 4RC3A 5GZ8A 3Q96A 3WBLA 3MJ2A 1SNXA 2VGOA 1MRUA 2GS7A 2YERA 3FZRA 4FTAA 4OT6A 4W9XA 4ZSEA 5FM3A 3ORLA 5AUUA 1CKPA 2QMSA 4NWMA 4GG7A 5K0XA 3AC3A 4FV9A 4C34A 3QCXA 4ACCA 2FB8A 4AA4A 1XH9A 4H39A 3I81A 3ZTXA 3VGOA 4X3FA 3FC1X 4F64A 2IUIA 4NU1A 2IW8A 4FV7A 4OTHA 4CZUA 2ZVAA 5C27A 4D2VA 1OBDA 2QCSA 3VS5A 1BUHA 4C02A 5DIAA 5A6NA 2XCKA 3R2YA 4PPCA 3IDPA 3Q6WA 4TW9A 1UWHA 2VO0A 1IJRA 3VRQA 1R3CA 4IVDA 5AX9A 4ZJVA 4RWLA 1Q61A 2E9OA 1DI8A 2EVAA 3WI6A 3H9RA 4A9YA 4ANLA 5GJGA 4AOIA 2QG7A 4DG2E 5BVOA 2AOAA 4KKHA 4OTGA 1WBVA 4YLLA 4HOKA 4J8NA 2NO3A 3NVMB 4BCGA 4FG7A 4YURA 4IADA 5DG5A 4IWPA 3ZRMA 4F08A 1JU5A 3H30A 3MYGA 5DN3A 4AAAA 3BPRA 3K3IA 3ZHPC 3FLNC 4H3BA 2XNEA 3UJGA 3CXLA 3OT3A 4AZFA 4XEYA 2VX3A 2PY3A 1M7QA 2YJSA 3HMPA 3P7AA 4RWIA 2C6MA 5HNBA 4O1PA 4DGMA 5A4CA 3R04A 5EW9A 2RFSA 3V3VA 1LR4A 2R5TA 4AN2A 4FKIA 4AE6A 5M4IA 1MQ4A 2X7OA 4GG5A 3E8NA 4RGJA 2FSMX 5J3XA 5JGAA 1JKKA 3VS6A 3ZEPA 3KRXA 5KO1A 1Q3DA 4RX7A 4DG0E 2XNGA 3FC2A 5AUWA 3S3IA 1JSUA 1Y6AA 4C37A 5E8YA 3ODZX 3TACA 4YJUA 3WIKA 1FBZA 2Z7SA 4HGTA 4E93A 1ZY4A 5TOZA 2QU5A 3R02A 4BGQA 2YCFA 3ZDUA 4PNKA 3C4WA 2JIVA 3COHA 3A7GA 4QMXA 3MV5A 5LWMA 2MK2A 5J8IA 5J1VA 2HDXA 2NPQA 3C0HA 4WIHA 1VJYA 4S32A 5HNGA 4OTFA 4EOOA 2UV2A 2H8HA 3NX8A 4H3PA 4M66A 1GIHA 4CZTA 5IQCA 5GNKA 3BELA 5K4JA 2W9ZB 3PSKA 5HKZA 2QG5A 4HYIA 3TIYA 2FSOX 2JD5A 1IA8A 5EI6A 4BI2A 4FK3A 4BGGA 1YWVA 5C26A 4QMSA 3UVRA 3C0GA 1OB3A 3U6HA 5HVJA 1O48A 3VBWA 2XEZA 4D9TA 4UXQA 1SMHA 5LMKC 2QURA 3R7IA 2QLQA 2B54A 2PE2A 2I0YA 4U9AA 4CSVA 4RVMA 1O4QA 2QO7A 1BI8A 1S9IA 5EM8A 2WMSA 1AB2A 2XS0A 3PWDA 1UU8A 3OY3A 1KE9A 3BEGA 3MVJA 4EOSA 3MVLA 4E3CA 3ZSHA 4GFGA 5AR7A 3QTQA 3PZEA 5KZ0A 3EQPA 5D10A 3LCOA 5EDQA 3ALOA 4C33A 2OSCA 4C4HA 2OXDA 3G51A 4WWQA 2GQGA 2PYWA 2KTYA 5JRQA 3NMUF 5A46A 2V7OA 4CMTA 4IB0A 5I9WA 1YRPA 5IA2A 4N70A 2V62A 3UYOA 5ACBC 4AF3A 3AMBA 5E1EA 5ETFA 3GT8A 3POOA 4K9YA 3E87A 3Q4CA 4TNBA 1APME 2O0UA 3K5VA 3RPVA 3GFWA 3KGAA 3HKOA 4XV1A 4TZRA 2BRHA 1I09A 3EN9A 5M4FA 3WIGA 2LQNA 5AJQA 5DR9A 1A09A 4MF1A 5K3YA 1X8BA 2B9FA 1FMOE 1AD5A 5CT7A 2C6IA 4F1OA 5CEPA 1YXTA 1DAYA 3KMUA 3ZM4A 5IQFA 5K4IA 4RA5A 5HU3A 4BY9E 2ITUA 1JKLA 4FIGA 3Q9YA 4TN6A
chains in the Genus database with same CATH superfamily
1SM2A 3UG1A 2GNGA 3TT0A 4JJRA 4LGGA 3VUIA 3RVGA 4BHNA 3ZU7A 1W98A 1AOTF 4ERKA 2VTIA 3MVMA 1URWA 4HPUE 4OT5A 4S30A 3RPOA 3PA5A 1OO3A 2Y4IC 1TQIA 2QONA 3ORNA 3GB2A 3PPZA 3H9OA 4L3PA 3HIZB 3TUBA 5L6OA 3BYOA 3IK3A 4ANQA 3SOAA 4MYGA 5E8VA 5AR8A 4Y5HA 1SHDA 2WD1A 3KRLA 4DFLA 3JYAA 2YCQA 5I5ZA 3R7VA 3P5JC 3OTVA 2E9VA 4O0UA 3R8UA 4F7JA 3AC8A 4QYHA 2JDRA 4QQJA 4XBUA 5IUIA 3EFWA 4B99A 4KS8A 4AZVA 3HV3A 3PJ3A 4V05A 3EL8A 3WZJA 3F3TA 3TDVA 2UZUE 3GQIA 4QD6A 4YBKA 2IVSA 3ZFXA 3EKNA 4FNZA 3ZXTA 3MFSA 4O6LA 4S31A 5C9CA 4DLJA 4LI5A 4QQ5A 2BPMA 1O4EA 1JKSA 1RQQC 2GNIA 4BZOA 3O5AA 3NW5A 4CFUA 1FYRA 4A4LA 4BWXA 2P55A 3QKMA 4IBMA 4ANBA 4EQMA 1TQMA 1GAGA 3OT8A 3UVPA 3Q9ZA 4OR5A 1O4IA 3QRJA 1M14A 4D55A 4DT9A 3ZO3A 4DHIB 3VRPA 4C0TA 4E8AA 1XMMA 4YR8A 4A4OA 5IH4A 1LUNA 1O4MA 2OICA 3OXIA 4NM5A 2JLDA 3LM0A 3GXLA 4XUFA 5IQHA 4I5MA 1A08A 2VTSA 2OH4A 4TXCA 4TWOA 4KAOA 4AGDA 3MPAA 1PYEA 4JDKA 3PXRA 4M12A 5L2TA 2PNAA 3AXWA 4F6WA 4YO6A 2JFMA 2O65A 3VS1A 4X6RA 1H0WA 1BFIA 3VBQA 4YP8A 3NYOA 3C51A 4L9IA 5DNRA 3DTWA 1H07A 4TL0A 3R21A 3P7BA 2C6KA 5E8UA 3LXKA 4EZ7A 4O0VA 4OHIA 4CKJA 2I40A 2WHBA 2X0GA 3RAHA 5M06A 2BFYA 2I0EA 3C13A 1JYUA 2YAKA 4UWYA 1PY5A 4OGRA 2WTDA 3RPYA 3UIUA 1FPUA 2XZSA 3CLYA 3PSDA 2W1CA 3CTQA 3MDYA 3EN7A 3FHRA 3OS3A 5KBQA 2QQ7A 3C9WA 4FV3A 1WCCA 2PZIA 4CFMA 3DZQA 3SD0A 3LIJA 2ZMCA 2OF2A 4F65A 4DH7A 4OTIA 1OL1A 1YI6A 2W4KA 4G6NA 4ZY4A 4QMNA 4I94A 1OVEA 1CTPE 3KF7A 3L8XA 3E93A 4U3YA 3ANQA 4O0YA 1CJ1A 5LJJA 2YHVA 1KE5A 1UNGA 1XJDA 3QL8A 4Q9ZA 2GQSA 2YLFA 4G1WA 4NK9A 3MFRA 2OJGA 2BALA 3FZTA 2UVYA 1IAJA 1G83A 4M8TA 3RI1A 5AP3A 5C8MA 4GUBA 1KE7A 4BJJA 1B38A 4CCUA 5JSMA 2IVUA 2WQEA 3W8LA 4UV0A 1PICA 3IW6A 2HYYA 4BWPA 3FKOA 3G0FA 4WNKA 3QD3A 3W32A 2EL8A 5CAQA 3BHYA 4QMUA 1H25A 2PHKA 3F3ZA 3G0EA 4BDEA 1KUTA 4GUEA 4XX9A 4C38A 3F3VA 4WNPA 4FEWA 4FTLA 4YPDA 4X2KA 5HBEA 4WHZA 5D7VA 2EO6A 2YZAA 3TCPA 1JQHA 2WQBA 3DK7A 4BCHA 5CALA 4QEBA 4JL9A 4QP3A 4RIWA 4H1JA 5GIPE 3QTWA 4NFNA 3ZM9A 4UWBA 3UOKA 5FWKK 3IQ7A 4JR7A 5J1WA 3VS3A 4EHZA 3L9LA 5D11A 4U6RA 4FKSA 5CSXA 3ZH8A 5FTGA 2GTMA 3TKIA 3C0IA 3OBGA 3V5QA 2GU8A 3PE2A 3QHRA 4CTCA 3HGKA 3DA6A 4WOVA 4UMTA 4BDBA 3NVKI 3S2PA 4RRVA 4DTKA 3LJ1A 4Y73A 5TR6A 3KC3A 4RLLA 1ZYCA 3GNIB 2XNOA 4U17A 3KK9A 3LQ8A 3EZVA 2XNMA 3GQLA 5DBXA 2I1MA 2RFDA 3V04A 4D2WA 3HHMB 2J51A 3KQ7A 4NCTA 4WA9A 3LFDA 3A8XA 4Z9LA 3TNHA 3Q6UA 3DK6A 3S00A 3IONA 3MH0A 2WOTA 3QLGA 3UNZA 2BKZA 2XK4A 3GXXA 4DINA 4O4EA 4ENYA 3K54A 5EELA 5C1QB 1RE8A 3W55A 4QQTA 2Z02A 1PXJA 2GTNA 5HE0A 4M84A 3UIXA 2BBUA 2WMWA 2I0VA 2YIQA 3ORPA 2W1DA 4OAUC 4IMYA 2HMHA 4WNOA 4ZAUA 3EWHA 1M2PA 4BN1A 1Y8YA 1R0EA 2JBPA 3R0TA 3P0MA 4U45A 4J52A 4NWGA 3GFEA 4IDTA 2GFCA 3OCTA 5CAVA 2CJMA 5CDWA 3BU3A 4L7SA 4AW1A 3EQRA 3FI2A 3FLZA 3LFEA 3Q4ZA 5E8ZA 5EM5A 2VNWA 2IN6A 1JSTA 2FO0A 2O63A 2ZM3A 3E8EA 3U4WA 2HY0A 2JIUA 3Q9WA 4JMQA 2EXMA 4D4RA 2HCKA 4AE9A 3L1SA 5H8EA 3LLAA 2OFVA 2WPAA 4I5PA 2GNFA 1XBCA 2RGPA 4UBAA 5AV2A 1D4TA 4IM2A 4YGAA 4CLIA 3D7TB 5AMNA 3BHUA 4BDJA 2JKQA 5HQ0A 2VWZA 2VTNA 3BBTB 5HE1A 4O7ZA 3LKMA 3R7EA 2OIQA 4NL0A 5HBJA 2B53A 2YABA 4J53A 4NKAA 3G33A 5CVFA 1D4WA 4HCUA 4U8ZA 4Q9SA 2QR8A 3DXPA 4RWJA 2R0IA 4FGBA 3JUHA 3DKCA 3P7CA 4FKOA 3HV4A 5HG5A 5IQIA 3CBLA 3CWGA 3KXMA 2WELA 3BV3A 4PTEA 4AGWA 4EH3A 4IVCA 2X2MA 2Z2WA 2J0JA 5HG8A 4NYEA 1Y6BA 2YFXA 3D4QA 3E7OA 2XBJA 3MY0A 4NIFA 4RX8A 5L8JA 2IF8A 1FBVA 2R9SA 3EKKA 3ZEWA 3KFAA 3W0SA 2C6DA 3PIZA 4ALWA 5CNOA 2VZ6A 4IC8A 3EN4A 4M69A 3NUYA 3FQEA 4I92A 2GE9A 5FLFA 4OHEA 3KN6A 4RFMA 3HX4A 2P33A 2Z7RA 4WBBB 4CXAA 4QTCA 5CAOA 2UW9A 1W0XC 5AUXA 1R1PA 5DR6A 2WIPA 2MRKA 3N8MA 3L8PA 3F9NA 4K77A 3FMMA 3R1QA 1SYKA 4KNBA 5A14A 5M53A 3R8LA 4CV9A 5G1XA 3WARA 3RJCA 2ITXA 3SA0A 3DGKA 2WMXA 5EOBA 3V5WA 3GBZA 3A7JA 5IU2A 4QNAA 4TYGA 1U4DA 4O7SA 2SHPA 3ITZA 1O6KA 1M27A 1G8JA 3JVRA 3GU8A 1ZYJA 5KKRB 5M51A 2UW8A 1XH4A 3BGZA 2H96A 2I6LA 4LV8A 2ZV8A 4IACA 2YDJA 2P2HA 3M1SA 5E90A 4CQGA 3WF9A 3DZOA 2J0LA 3H10A 1KA7A 3R73A 2E9PA 4QMOA 4IX5A 3CGOA 3PDTA 3SX9A 4TYJA 1O46A 3AOXA 2QOOA 5CTPA 3ZNIA 4E20A 4NZWB 2AC5A 4XG4A 2QOIA 3ZLSA 2OI4X 5C8NA 3C7QA 1K9AA 2OU7A 4G16A 4HPTE 4GCJA 3WYYA 3QHWA 3ORTA 4IAAA 4EH5A 2HDVA 5AV0A 2PLEA 2R4BA 1O4HA 2REIA 4I6LA 3BRBA 2UVXA 1GJOA 3PY3A 3QD2B 2O2UA 3CP9A 3ZUUA 3MIYA 3CIKA 3EOCA 4GYGA 3SRVB 2VO3A 1LCJA 4FBXA 2BHEA 5AUYA 4BDIA 3MSSA 4G31A 4EH8A 4P9VA 3UTOA 3SC1A 2WMUA 3FZPA 2YA9A 1PXLA 2XUUA 4G5PA 5KHXA 3NUSA 4WRGA 4N0SA 3V5LA 5E8TA 1ZY5A 4FSNA 5CF4A 4DTAA 5E7RA 4ALVA 3TI1A 1AYAA 3MXCA 4FTQA 4QSYA 4XBRA 4JBVA 3V5TA 4R6VA 4EYJA 1XA6A 5FEDA 4UY9A 4I6HA 5GIOE 3ORZA 4MF0A 3UZPA 3VIDA 3WZEA 2JKOA 2OFUA 2FYSA 3DKOA 4JXFA 3T3UA 2OBJA 3Q9XA 3ML1A 3TNQB 3W8QA 1H4LA 2RMXA 2C3KA 2W7XA 4IDVA 3AQVA 4BKJA 4C35A 5K5NA 2HXQA 3R28A 5ICPA 3NYXA 4IFGA 4IX3A 2VWWA 4AZTA 4D1ZA 4PY1A 3FZ1A 5A4LA 5J5TA 4RJ6A 4E5BA 4L01A 3ZSGA 4Z16A 4DGXA 2G9XA 3PIYA 5KCVA 4EQUA 2YAAA 1CSYA 4FTIA 1O4NA 4E26A 4M67A 3ULIA 4HVSA 4DT8A 5BUIA 5KBRA 4PL5A 3MN3A 3IW4A 3U54A 3BUXB 4G3CA 5EQEA 4A9TA 3MWUA 4NJ3A 1FU5A 2WNTA 2Z7LA 5HIBA 4WT6A 5CSPA 4BJJB 2XJ0A 4BCNA 4BDKA 2QKRA 4JG6A 1UNLA 2OKRA 4BIDA 1M17A 2IZUA 4C36A 5GJHA 3EFJA 2VTRA 4JBOA 3NHNA 1WBSA 2YIYA 1YDRE 3LMIA 1A1EA 4NW5A 5JGDA 1M2RA 2OO8X 4GRBA 4O38A 5CEMA 4RX5A 1BI7A 4AP7A 3R7GA 4NTTA 2XEYA 2JDOA 5M55A 4FX3A 3R9RA 1J91A 4DEHA 3KEXA 1Q8WA 2OLCA 3C5IA 4A4BA 2VN9A 4GK2A 2R3OA 4BDFA 4RIWB 5AIRA 4ZTSA 2WTJA 4EORA 4IWDA 3S95A 3COIA 3DBEA 3O96A 4ROJA 2XAOA 2J90A 1B39A 2A4LA 3HRBA 2O8YA 4BCQA 2GNLA 4USEA 4USFA 5LMKA 2C0TA 4O81A 4DTBA 4F9YA 1PXOA 2ERZE 2GFSA 3W16A 4CFVA 4RJ5A 3HEGA 1D1ZA 1JSVA 2B1PA 3TTIA 3OCSA 3NUAA 3H0YA 1UU3A 4EC8A 2WTVA 3PFVA 3A4PA 4IFCA 3T3VA 3H4JA 2QODA 4EZ3A 2HAKA 5I4NA 2IG7A 4H34A 5IA1A 2LNWA 3Q53A 4L6QA 5AAGA 2R3GA 2DLYA 3ACKA 2CCIA 3C4CA 2ETKA 2WTWA 3WZDA 1JYQA 1OUKA 2X39A 3G9NA 5A3XA 4OTDA 2C69A 4D1SA 1AYDA 2BDJA 1CKIA 3U87A 4C4IA 4ZJIA 5DC9A 3K3JA 4CV8A 3UG2A 3AKJA 1YWRA 2BZIB 3LZBA 5D0JA 2FGIA 3CPCA 2WMVA 1Q41A 2UZDA 3CQUA 3D2IA 4MQ2A 3ZO2A 3ZONA 4ASZA 4ASDA 4M15A 3RWPA 1G8KA 4JIAA 3TKUA 2XCHA 4KINA 4FT7A 1MP8A 4RWKA 4BB4A 4E5WA 3TL8A 3I5NA 5G6VA 3N4TA 3BYUA 2BZHB 4KSQA 4PPAA 4RJ3A 2R7IA 4ZOGA 3UP7A 2Y1NA 4RPVA 2RL5A 4DEBA 4YNEA 1BLXA 2OF4A 3F5XA 5AA8A 3VULA 2WQMA 4X6SA 4WG5A 3H9FA 1KOBA 3UVQA 2BIKB 2GCDA 5BVFA 2GNHA 3T9TA 2XKFA 3DNEA 5FDPA 4R8QA 1BM2A 2IZRA 5I9ZA 4O83A 5JGBA 3F69A 3K2MA 5ITAA 2LRAA 3UF4A 2RFNA 4K0YA 5J95A 4F7LA 3NNWA 3POZA 5E8WA 2WEVA 5EKOA 4EBVA 3A7HA 1O44A 3QQJA 2BDWA 3W2OA 3A4OX 1JOWB 2BZKB 1BX6A 4FICA 1W82A 4RVLA 2ITVA 3SOCA 3RNYA 4RBLA 3DAJA 1A1AA 1JBPE 2X81A 3US4A 5BMMA 3WOWA 1UU7A 2R64A 3R9OA 4FKQA 5AAEA 5HVYA 4NIFB 3CKXA 2HIWA 2IWIA 4QP4A 5IZFA 3QUEA 3BUNB 3RKBA 2C6LA 1RQQA 4ZLOA 3V6RA 4M69B 5CASA 1M7NA 3EACA 5HKYA 2F7ZE 1Y91A 2VX0A 3FLYA 3OUKA 3Q3BA 3ZXZA 2WAJA 3BHTA 2X9FA 1OO4A 1PMVA 3FYJX 3DK3A 3MFUA 4ZS4A 1AYBA 3BGPA 1REJA 3QUPA 2OZAA 5AUZA 2QD9A 4KBAA 4UXLA 3OW4A 4NEUA 3VUKA 1JAMA 4FNWA 5EQYA 4PX6A 4NM0A 2XB7A 5LVLA 3SXFA 4ZTNA 4Y95A 2C1BA 5IQEA 2YIXA 3ZUVA 5JQ5A 2ZAZA 4ZSAA 3KF4A 3DLZA 4W4WA 2QVSE 3OY1A 3QALE 5CU3A 4F9BA 2UW6A 3QCYA 3ZLXA 4ITHA 3ZO4A 4Y46A 3I7CA 1REKA 1XH5A 3DOGA 1A07A 2K7AB 1GZKA 3LFQA 4R78A 4CRSA 4FSZA 4DEIA 5IH6A 3VQUA 3NIEA 3AC4A 2W1HA 5EI8A 2J50A 5DRBA 4BKYA 4EHEA 1FVRA 5HX8A 5DEYA 4G6LA 4O0WA 3R7UA 2KNOA 4HVIA 2OK1A 3G6GA 3MH1A 3PP0A 2W0JA 1YI4A 2C5OA 3A61A 5ANIA 4CEGA 1IRKA 2QOKA 3NCGA 4CKIA 2AUGA 5I6VA 3LW0A 5JFSA 2PVYA 1XQZA 4CD0A 2X4ZA 4QP8A 4GWFA 3QQLA 1GZ8A 2F49A 1ZYSA 3R9HA 3BBWA 4MD9E 3GEQA 4HNIA 4W4XA 4BIBA 3PSCA 3O23A 1PXMA 2YWPA 4D5HA 3HDMA 4O0XA 4G2FA 5IA4A 3LCDA 4C57A 4DEGA 3O8TA 2W06A 1O4CA 5EHYA 2XYNA 4ZY6A 4EONA 4XRJA 5HLPA 5KMJA 3LMHA 1JLUE 4QMWA 4NW6A 3R83A 2UZLA 1KSWA 3RGFA 4AA5A 2NYAA 2XNBA 5IG1A 4LDTA 4GVJA 5DE2A 2PWLA 2UZVA 5CANA 4FEUA 2V5QA 3I6WA 3Q4UA 3MJ1A 4DITA 2Q0NA 4UMRA 1NRVA 4QYGA 4YZDA 2RKUA 3CR0A 4ZP5A 4AG8A 4APPA 3UYSA 4E1ZA 4FKGA 3BKBA 3Q5IA 3FY2A 4RFYA 2C5XA 3HMOA 2GPHA 3F66A 5HZNA 5DA3A 5HCYA 3REPA 3ORXA 3QQGA 4LRJA 2YM3A 4IB3A 3FLWA 1U5RA 2CN8A 4BIEA 3OVVA 2LAVA 4EH7A 3P5KA 4QNYA 4RX9A 4B7TA 4QTDA 5D1JA 1O4LA 4PTCA 1R0PA 4OAVB 4OHLA 4JR3A 4NJDA 3PPKA 4J96A 1YVJA 2I7QA 4BGHA 2OGVA 1R39A 3FDNA 4O84A 5ETIA 3G15A 2JFLA 5JFWA 4Q2AA 1CKJA 1G5SA 4FV6A 2ZV2A 1OIQA 4C58A 1OIUA 3EFLA 5FEQA 4FRFA 5JRSA 3E88A 3M7FA 5K5XA 3ET7A 4FVPA 5HTIA 3Q2MA 4ARKA 3QWKA 1TCEA 2PU8A 4ZIMA 3T9IA 1AQ1A 1WBOA 3W0PA 1YOLA 4FVRA 3RZFA 2Y9QA 4QP6A 3VW8A 4I6FA 2W5HA 4D2TA 3OFMA 3O8PA 1WBNA 3HRCA 4LGDA 5AM6A 2DS1A 3GENA 3MA3A 3MXYA 3FMJA 1O4GA 1QG1E 4EBWA 2YCSA 2DX0A 3KA0A 4J98A 1Q99A 4TWNA 1F0QA 1JNKA 2R3LA 3EIDA 1DI9A 4FI1A 4XLIA 1SHAA 4WBOA 4RVKA 4USDA 3JS2A 5B7VA 4D9UA 4F4PA 4AAYA 3VJNA 5BVWA 3ZZEA 1O4JA 4IAIA 4RIXA 4MXOA 3TMOA 4R77A 3PP1A 5HG7A 3L9NA 5BO4A 1R78A 5AULA 1J1CA 4GYIA 1O4KA 2BHHA 4W4YA 1AGWA 1WQUA 2XIYA 3QZGA 1ERKA 2YISA 2W4OA 3DAKA 4ZLYA 5KMKA 4D2SA 3DB8A 2DQ7X 3EH9A 3DBDA 4P5ZA 3VRZA 4F9AA 2OXYA 1VR2A 4HGSA 4QMLA 3HMNA 4XV2A 1BYGA 1ND4A 1OPJA 3NCZA 1OPKA 1GNGA 4LMUA 2BCJA 3LFAA 3O7LB 2R3PA 3D5UA 4XMOA 3BL9A 2VTQA 3ODYX 4EIHA 2HW7A 4GW8A 4O86A 3GC7A 3D7TA 3TL0A 4BCMA 4KIPA 2CKEA 4DFNA 4MBIA 1LP4A 3KB7A 1XR1A 1TFFA 3I6UA 1O49A 2X2KA 5FEEA 1PW2A 3ZS5A 5EDRA 3VS2A 1KA6A 3ORKA 2EU9A 3JR1A 2VTOA 3FMNA 3JY9A 2CGVA 4O7YA 3JVSA 1M2QA 3OZ6A 3QFVA 4ZEGA 2PUPA 3QD0A 2Y8OA 5CAPA 4EOLA 3OG7A 4J1RA 3HECA 4FKVA 3O71A 4YZ9A 3BZ3A 3TN8A 2BAQA 3GP0A 2WOUA 3C7IA 3LMGA 2RSYA 2G1TA 4IWQA 4IW0A 3TV6A 3M11A 1FINA 2ONLC 1YDSE 2X4FA 3RHKA 3SW4A 3GCPA 4JT3A 4D4VA 1H0VA 1O9UA 3NDMA 4M14A 4IH8A 1Q8TA 3C4ZA 5B0XA 4YC3A 3DJ7A 1MW4A 2WO6A 4IZ7A 5CZIA 2JAMA 2JEDA 4DCAA 5L2IA 3LXLA 1GZNA 2OH0E 4JQEA 4F1TA 2ITYA 3ZZWA 4UMUA 4AT4A 5IMEA 4DFZE 4GV1A 5HHWA 5GJDA 3TIZA 2Y4IB 4CFWA 3HV7A 2G15A 3OOMA 4L3LA 2W1EA 5BQ0A 5JFVA 2XBAA 5FXQA 4KRCA 4EOJA 1BF5A 2FA2A 4IX4A 3OC1A 5ANDA 4QYEA 4FSQA 4GL9A 4L43A 5K9IA 5M07A 2CGXA 2AUHA 3ACJA 3QTZA 5EK7A 4C2WA 4HVGA 2Y6MA 3CD3A 1GIIA 1P4OA 4U42A 4XG2A 4DG3E 5IA3A 2PULA 3MESA 3GU6A 4XZ0A 2IPXA 4ZY5A 2VU3A 3IOKA 4RFZA 4Y85A 3BE2A 5JQ8A 5AR2A 5B2MA 3TYKA 4RA4A 4FSUA 5FP5A 4EOPA 2CLXA 1UA2A 2HZIA 4EK8A 3D14A 5IQBA 2ZM4A 2OIDA 3PY1A 1S9JA 4HVHA 2PVMA 3UNKA 4YC6A 4J97A 3P78A 4FNXA 3VAPA 4TNDA 4MWHA 3PXKA 4JQ8A 5IPJA 4JAJA 4LOPA 3V5JA 2IVVA 2NRUA 3QRUA 3FXXA 3A62A 3HAVA 3T04A 3THBA 3CGFA 4O2PA 1KOAA 3OV1A 3DJ6A 4DLIA 4C7TA 4BTKA 5LARA 1P13A 3BCEA 5I0BA 3EN6A 2UW7A 2UZEA 5HO8A 5BVDA 1QADA 4OTPA 3R7YA 2OZAB 3H3CA 4O4BB 4I4EA 2XJ2A 1WVXA 4DF3A 2W99B 3ZRKA 3FI4A 5CEOA 5D12A 4OHHA 4FODA 2JYQA 5HGIA 3SRVA 1SPRA 1Q24A 5IEVA 2R7BA 1F5QA 2V22A 1VLRA 3AT3A 4HCTA 3S1HA 2R3NA 2QOQA 2DM0A 4A07A 3RTPA 2VD5A 3NUUA 3QQKA 1ZYLA 2VO7A 3O0GA 4KBKA 1SHBA 4XHKB 3TTJA 5D9HA 4K6ZA 3JY0A 2WMTA 4FOCA 4JEGA 2VRXA 4EYMA 1O4RA 1VZOA 2KULA 2P3GX 1OITA 3DY7A 1YDTE 4PNIA 3IMDA 2CIAA 3RAWA 3UDBA 4B6LA 4W4VA 3AMAA 3ZC6A 5AX3A 4CNHA 1CSNA 2UW4A 4XZ1A 3QWJA 4LG4A 1OPLA 5EM7A 5EI2A 2HZ0A 4A9UA 4JLCA 2ETZA 3MB7A 3PUPA 3ATSA 1KV2A 2ZV7A 3G9LX 3M2WA 4WD5A 5AR3A 3QX2A 2GSBA 4MBLA 3MPMA 2R0UA 4C3FA 4Z3VA 1IAHA 4QT1A 2XIKA 2F7XE 1YKRA 3B8QA 3BYMA 3PXZA 4QYYA 4RJ7A 4TWCA 2XK9A 5AM7A 5GJFA 2X6DA 4N6ZA 4OBQA 3MTLA 3QD4A 2AC3A 3TV7A 1O4DA 1J1BA 2VTHA 2QU6A 2VTAA 3QLFA 1FVVA 2BRGA 3EYHA 1W2CA 3QC9A 5HNIX 1XMLA 2VV9A 4I22A 2VTLA 4GEOA 1F1WA 5FTOA 1JWOA 5HLNA 4HGLA 4D2RA 3GC0A 4UMQA 4O7LA 1UKIA 4GT3A 3HDNA 3KRWA 3OBJA 2YLEA 3F3UA 3C1XA 3IOPA 1H1SA 3LOKA 3Q5ZA 4FIIA 4UZDA 4GT4A 3P79A 4X2JA 3U55A 2PMOX 2PTKA 3MS9A 2PK9A 3MTFA 4GFMA 4IWOA