4K33A

Crystal structure of fgf receptor 3 (fgfr3) kinase domain harboring the k650e mutation, a gain-of-function mutation responsible for thanatophoric dysplasia type ii and spermatocytic seminoma
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
297
structure length
293
Chain Sequence
LPADPKWELSRARLTLGKPLGEGAFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTSEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKETTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 3
publication title Structural Mimicry of A-Loop Tyrosine Phosphorylation by a Pathogenic FGF Receptor 3 Mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 293
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4k33A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4k33A01
1UV5A 1UU3A 4O7RA 3Q4UA 3C0GA 3TJCA 3ALNA 4H3BA 4C3RA 3RM6A 4C4EA 1VEBA 3VRYA 2FA2A 4FSNA 4NL0A 3AC5A 5EM7A 2UW9A 4EHEA 3DA6A 2Y7JA 3C0HA 3VHKA 3V5WA 3KC3A 1M2QA 4PTEA 3QTSA 3VBTA 3ZO2A 5JQ5A 2W9ZB 3A7JA 5JKGA 4XEYA 2PUPA 3EHAA 3MV5A 4B99A 2CNVA 3LFQA 3VQHA 3LQ3A 2YM5A 2YLEA 2WTCA 4QP4A 1AQ1A 3CTQA 1RQQA 2C0IA 3HV6A 4HYHA 3DQXA 2JAVA 4GKIA 3FDNA 4ALWA 5FTOA 1IG1A 4DGMA 2UZBA 3ULZA 4G17A 3BYUA 4J95A 2XIKA 4FKQA 3ET7A 4YURA 3D5XA 4FTTA 2HZ4A 4A9UA 4AF3A 1PF8A 4EOLA 5IQHA 4PMPA 3L8VA 2I0HA 3BU5A 4JT3A 1SVGA 3PVWA 3UC4A 3SXRA 3MVMA 5DT4A 4F6SA 2QKWB 2B53A 3E5AA 4W4XA 4ZY6A 4Z16A 3ACKA 4UYAA 3UPZA 3VUIA 5IQAA 5HE1A 2B9FA 4EK5A 3HGKA 2XCKA 2BKKA 5JMSA 3QTWA 2W0JA 4DA5A 3C4EA 2ESMA 1JNKA 4FTQA 2W1EA 5J9ZA 3MVJA 1ZMUA 3IW6A 2WMVA 3WIGA 3F3UA 5EK7A 5TOZA 2YM3A 3ZSGA 3GI3A 5DPVA 2H34A 3DK7A 3ORZA 2VWYA 3ZUUA 4LOPA 3G0EA 4QMWA 5T3QA 4LMNA 4R1VA 4S34A 4WRGA 2J9MA 3SQQA 4FV5A 5DG5A 1H8FA 1YHVA 1AD5A 2YM6A 2YWVA 3KXZA 2C0OA 1XH4A 4ZS4A 4JBPA 4RWJA 3RMFA 1BUHA 4B7TA 4C57A 3H30A 3IW7A 4N70A 4X2KA 5CAPA 4CV8A 4OAUC 5IQCA 5I3OA 4YMJA 2QHNA 3H3CA 4RC3A 1XBBA 4DEBA 4UMPA 2NNWB 3I6WA 5M55A 2O64A 3Q2MA 4DEAA 2YA9A 3GCUA 3P7BA 3W18A 3QKLA 4RWLA 4HZRA 5CSHA 4D2PA 4EORA 2JGZA 4RIOA 4K33A 2B55A 3I60A 5C26A 5J5SA 5CANA 3FC2A 4YZMA 2R5TA 4GRBA 4E7WA 2YFXA 4MYGA 4WSQA 3LJ2A 3P86A 5IUHA 2W1DA 5CVFA 5JFWA 1IA8A 2ITYA 3DXNA 5I0BA 3U6JA 3S0OA 3IONA 3OCGA 2BHEA 2XM9A 2PYWA 2ZMCA 4BCKA 5M06A 1H1SA 1WVYA 3I1AA 4NKSA 3ORLA 3RCJA 3DKCA 4FEWA 3EFJA 3OOGA 3KF7A 4FIFA 4UXLA 4O82A 2PVNA 4RBLA 2BVAA 4FKTA 1QCFA 3TNHA 4ZY4A 3ITZA 2XKFA 3TKHA 4H05A 2HELA 3FL4A 3VS1A 2PZRA 4J99A 3R73A 4XLVA 2OLCA 3LFSA 4FV8A 4EC9A 1Y6BA 4JX7A 5GHVA 4W4YA 2QOCA 3BU3A 3E64A 4IW0A 3VVHA 4MF1A 4BDBA 5JGAA 4C62A 5GIPE 3FXZA 4EHZA 3DBEA 4B9DA 2QKRA 5KMMA 2C68A 4UV0A 5CU6A 3O96A 4H3PA 1T45A 4ZK5A 3UMWA 4P7EA 3G90X 4AN9A 4F9BA 5E8YA 1P4FA 4GJ3A 4XV3A 3UNJA 5AP5A 1KOBA 4F70A 4G6OA 3Q6UA 2DS1A 2DQ7X 4GUBA 4U8ZA 5CNNA 3T9TA 5M4CA 3CSVA 3KRXA 4K1BA 4ZLOA 2QOIA 3VS5A 4L7SA 4U79A 4ANLA 3HA8A 4RIXA 3UG2A 4BIDA 3E87A 4QMVA 5IDPA 1KE8A 1BL7A 4U45A 4DH7A 5HBJA 4FTUA 4O1OA 2E9VA 5CXZA 3F2RA 1BMKA 3FI3A 2CSNA 4FTNA 2C6EA 2GFCA 4ALVA 4UMUA 4OTGA 4BCIA 4C02A 1H1RA 3Q4TA 4FKIA 2E9PA 2I6LA 3JXWA 4FI1A 4DYMA 2QI8A 5FM2A 2G2IA 2LAVA 2YIXA 3O71A 1UNHA 4FIGA 3EJ1A 3V6RA 5ANKA 4TWOA 2JITA 4WKQA 1LP4A 3WBLA 4OW8A 4GH2A 2VTOA 2ZB1A 1ZYDA 3HZTA 1BYGA 3ORTA 3NCZA 4MXAA 3F82A 2O0UA 3MI9A 5HOAA 3FPQA 3VS2A 1G3NA 3FKOA 3TDWA 5ETAA 4C33A 4TYEA 3D7TA 5D9HA 3QWKA 2VTRA 5ANEA 1OMWA 1JKTA 4GYGA 2OIBA 3BV2A 4I0TA 4JR7A 4OBQA 5FTQA 1GZNA 1E9HA 3ZRKA 5ANJA 1ZYCA 4IZ5A 3UZPA 4CXAA 4FKGA 4FVQA 4Y46A 1FVVA 4F08A 3TNWA 1R1WA 2RFEA 3DKOA 4XBRA 4GT3A 5BVFA 3ORNA 5HORA 5K4IA 4O27B 4OBPA 3MW1A 2QHMA 3LFFA 3OS3A 3PFQA 2P4IA 1OIYA 2NP8A 1IAHA 3QA8A 2E9OA 2J51A 3PIXA 4ARKA 4AN3A 4KKEA 2BTSA 4FL3A 5DFPA 3FWQA 3QCSA 3QGYA 1Q99A 3C51A 2AYPA 5CF8A 3RPOA 4EHVA 5B7VA 3EQFA 2WMBA 5AP4A 2GCDA 2QOHA 3N51A 3RI1A 3LKMA 4JQEA 3ZLSA 1IA9A 4MBIA 4J52A 1H1QA 3F5GA 3CQWA 3QZHA 4EK3A 4GG5A 2W1FA 2WQMA 4X2GA 4ZSEA 2QVSE 4TYGA 4D28A 4ZMEA 1A06A 4LV5A 2FSLX 4CFVA 2XIYA 4GIHA 2O2UA 4M0YA 5FLFA 3QHRA 4M67A 4OAVB 2ZAZA 4QP3A 5HBEA 4XP3A 3EN5A 4FL1A 4JNWA 3ETAA 1FVTA 2F2UA 4JRVA 4QMLA 5A4LA 1Q61A 5AAGA 5AP6A 4M8TA 4X2NA 3FMKA 4BWKA 4MNEA 1ZYSA 2W1HA 4D2SA 1OB3A 4FZAB 4TNBA 4QYGA 5EQYA 1DAWA 2C6TA 4QQJA 4ENXA 3G15A 5F1ZA 2C6KA 3EQDA 4FV2A 3AOXA 1U54A 5IQFA 4C3FA 1YXTA 3V3VA 3MB6A 4IZYA 1S9JA 4U7ZA 4KWPA 5A46A 5C8NA 5CX9A 2XS0A 2PSQA 2JKOA 3D0EA 5D11A 4C59A 3AC2A 4F7LA 3ORPA 1V0BA 3E93A 4MD8E 4YHJA 1Q24A 5TF9A 3WF8A 4EONA 3NUUA 5HNGA 4XBUA 3U8WA 2XNBA 4KINA 1YI6A 3A7FA 2C3IB 2SRCA 4EOOA 3P7CA 5CI6A 4GEOA 3VBVA 3TDVA 4LQMA 2RGPA 4QP2A 4QYFA 1OPLA 4M69A 3DK3A 2XIXA 2C30A 5KX8A 4YJNA 4TWPA 3KU2A 5CALA 1FGIA 3BV3A 2WIPA 3F5PA 4PDPA 4XP0A 5HVKA 1KWPA 3R02A 4HYSA 4F1MA 2LGCA 4AW1A 2OBJA 2R9SA 1YI3A 2VAGA 3PA5A 4TNDA 3ZC6A 4JAJA 5EYKA 5A9UA 1B38A 3V5LA 1WBTA 4QTBA 5J87A 2BMCA 4KS7A 2IW8A 3FLNC 4KD1A 4LYNA 3C5UA 4A4OA 4WA9A 4NM7A 3S4QA 4IX4A 4RPVA 2VTQA 4C35A 4L00A 2OZAB 3EN4A 5LWMA 3HLLA 1J91A 2GHMA 3W2RA 2C6DA 4G3GA 2R3HA 1W7HA 4NTSA 4ZS0A 5F20A 3WARA 3ZEPA 5HX6A 4LM5A 2XYUA 4HCUA 2J0LA 5CVGA 5J79A 4S30A 1ZMWA 3D5WA 3QYZA 5C1QB 5DI1A 3R2YA 4BDJA 3KULA 5DOSA 3TTIA 1ZY4A 4WBOA 1WMKA 3D94A 1CDKA 3ODZX 3T3VA 2RL5A 4C2VA 5LCJA 5B2LA 3IG7A 3AMYA 4PWNA 3NVKI 3DAJA 5HIEA 3BWJA 1PXMA 2Z7QA 4ACGA 4EK6A 2FSMX 4QMUA 2XKCA 2X9FA 4FIEA 4RZWA 3RM7A 2OJGA 3ZZEA 4RIYB 3UTOA 4RWIA 4DCAA 3SGCA 1T46A 5D1JA 4XCUA 3TNQB 4DFYA 5BVNA 1A48A 3AT4A 3Q9ZA 3SC1A 4HYUA 4UYNA 4U41A 2CCHA 4I20A 2R3LA 4G6NA 4PNKA 3MGYA 5KMLA 3NUAA 3HA6A 4CFUA 4H58A 3V01A 2ITOA 5EQPA 2X7OA 3B8RA 1W82A 5DA3A 5IG1A 2Q0BA 4O7WA 3NYNA 4WNMA 3RTPA 3C1XA 3ZLYA 3TUCA 3DS6A 5AV4A 1BLXA 3RK5A 4UN0C 3OXTA 4BDIA 5IA2A 2UW5A 3FQEA 4E4NA 4PMSA 2FUMA 4QMSA 2W5AA 4IWOA 3AD6A 2CKQA 4W8DA 1PXKA 2PVJA 1P2AA 1OL7A 4PV0A 3D5UA 2Z7RA 3PXRA 2B9JA 4JI9A 1JQHA 1H01A 3OXIA 1QPEA 4MK0A 1Y8GA 3Q5ZA 4TTHB 4JQ8A 4DGOA 5ANDA 1SVHA 2BCJA 2GQSA 4FT5A 4IWPA 4QTCA 4DF3A 3FQSA 4GFGA 4X7QA 1SNXA 3RWQA 2XZSA 3LPBA 4DLIA 2R0IA 1PMVA 4NW6A 1I44A 4YBJA 3G2FA 3W32A 4YZBA 1LPUA 3R8UA 1HCKA 1QPCA 3CEKA 1H07A 2GMXA 2JAMA 3LXNA 3UO5A 4AQCA 4QQTA 5KMKA 4JJRA 4XRJA 5K0XA 4AGUA 2XCHA 3I4BA 5KKRC 5JZNA 1JVPP 2ZDUA 5CYIA 3A4PA 3BE9A 3D83A 3EN9A 2WTDA 4NUSA 3A8XA 4U81A 3RALA 4FV9A 2J4ZA 4FTJA 1L8TA 3Q60A 2OGVA 3LCSA 4F0GA 4DBXA 4PNIA 4N6ZA 4RIWA 4Q5HA 4QD6A 4F1TA 3UQCA 3WI6A 4YC3A 1JKLA 3SVVA 4CMUA 5K5NA 2V62A 1NVQA 3QWJA 3OEZA 2IZSA 2BPMA 4XG3A 4RRVA 3QTQA 1GZOA 3OWKA 1NVSA 1UKIA 5FXSA 5AM6A 5CEPA 1JOWB 2ITNA 4QNAA 3BE2A 4GS6A 2YIRA 3D7TB 3O50A 4TWCA 1YKRA 2R3GA 2AC5A 3FZSA 2JC6A 2ZV9A 4FVRA 4IJPA 4QT1A 3NUSA 3BRBA 3NIEA 4GK2A 3MS9A 5LVLA 4I93A 3FZRA 1H00A 3VJNA 3AD5A 3CJFA 3NAXA 4ANMA 2WHBA 2W17A 1U46A 3HMIA 4S32A 3ZXZA 2QO9A 4QYEA 4UMRA 3QQKA 3VHEA 5H3QA 4IEBA 2IPXA 4E73A 4YJVA 4DH5A 4EI4A 4U43A 1TQMA 4KKGA 3VS3A 4BWXA 2YJRA 4JG6A 3JUHA 3JVRA 2XKEA 4O0TA 2WQNA 4BC6A 3G33A 3JVSA 4DFUA 4BDKA 4XG4A 5HKMA 3QX2A 5JN2A 5M4FA 3RJCA 3NVMB 1W84A 3NGAA 4R5YA 2QD9A 3THBA 3L1SA 2RFDA 2BAKA 3FXXA 4ZSGA 3HMNA 5L8LA 1Z5MA 3ZSHA 3ZTXA 2PTKA 4G34A 3PY3A 4GL9A 3VS7A 3PLAE 4EUUA 2OKRA 4HVHA 3O2MA 1XH7A 3GXLA 3CIKA 5AFVA 4FSZA 3NNVA 2C5NA 4M13A 4RC2A 5IH5A 2QR7A 3MA6A 3TUBA 1WZYA 5E91A 1TKIA 4NEUA 5DYJA 1SVEA 2JKQA 1XR1A 2RKUA 3LAUA 4ID7A 4YLLA 3O8TA 5M4UA 2C69A 4HW7A 3WE4A 3KL8A 2B0QA 3RP9A 2W4KA 3R9OA 4FTMA 4BI0A 3R9HA 2BZKB 2F4JA 2XRUA 4HVIA 3VAPA 5ETFA 4Z7GA 4I6QA 4XH6A 2WMXA 4FTIA 4YC8A 5KUPA 2Z8CA 4D2RA 5D7AA 4EOMA 1OL1A 1U54B 4PPBA 2UZLA 4DGGA 4KKHA 3ZU7A 5IA4A 5AR8A 4YBKA 2CN5A 3OUKA 4WG4A 4O83A 2VO6A 5L6WL 5AR2A 3AC1A 3N4VA 3MFTA 3E7VA 3I0OA 3NW6A 2H9VA 3PSDA 2ZV2A 3QKKA 3W10A 2R3RA 3W2OA 3V8SA 3G6GA 1J1BA 3OD6X 3Q9WA 3V5PA 4GT5A 2A19B 3UO6A 2R3QA 3TNIA 2RF9A 5LOHA 4L68A 2PUUA 1DI8A 3BGZA 3TKIA 2IW9A 5DGZA 4ONAA 2OXYA 3ZO1A 4L7FA 3RAHA 5E1EA 4ZY5A 2EB3A 2IW6A 2O8YA 2VN9A 4FEVA 1Q8TA 3R0TA 2ZV7A 3GQLA 1M14A 3PZHA 1S9IA 2C3LA 1H24A 2VTNA 2GNGA 3N4TA 2J7TA 3OY3A 4OTRA 3NYOA 3B8QA 1JLUE 4PRJA 5EFQA 3WF5A 5HNIX 5L6PA 1E1VA 5I9XA 3E88A 4A9SA 4WOVA 3GOKA 3NUNA 3CGOA 2YWPA 3PXKA 2UZDA 3R7UA 3ZUTA 1YWVA 3IGGA 3L9LA 3ZSIA 4D55A 4FOCA 4V0GA 3FBVA 2ETRA 2E9NA 2JDRA 3BHVA 4KIOA 4YO6A 3VUGA 1SNUA 3SXFA 3ZLXA 4TRLA 1XH9A 2W9FB 5JSMA 4IWDA 2FVDA 2YAAA 5DLSA 3T8OA 2IVVA 5CWZA 2W96B 4XUFA 5FXRA 2ZDTA 2UZTA 3P5KA 5I9VA 4D1XA 1K9AA 5K5XA 4M97A 3EWHA 2F7XE 2FH9A 3U87A 4BYIA 4QTAA 5KMIA 1R39A 3HAMA 3IK3A 3CTHA 3F9NA 3R8ZA 3AMBA 2C6MA 4ZTNA 1WVXA 4K0YA 3MPTA 4R8QA 1FMKA 2BIYA 3CR0A 3R9NA 3PP0A 1APME 3RPYA 2EXCX 5LVNA 3OW4A 3OF0A 2HOGA 3DPKA 5CASA 3BQCA 3F66A 1NVRA 1O9UA 4HGEA 3TJDA 5M53A 5IA1A 2P0CA 1IASA 2XF0A 5AUWA 3IKAA 1V0PA 1H25A 1PKDA 1ZAOA 2YABA 3HL7A 3OCTA 3BEGA 4CTCA 4O7LA 3R7YA 3ZFXA 3BBTB 4QMPA 5TO8A 4BTMA 4EOPA 4QMZA 4BDAA 2R7BA 4R1YA 2XYNA 5HCZA 4U42A 1BKXA 4DEEA 3MSSA 1PMUA 2YIWA 2BFXA 5FD2A 4ORKA 4RSSA 4QMTA 3BYOA 3B2WA 3MVLA 2R3NA 1ERKA 4QP9A 4PX6A 1UNLA 5CY3A 2GDOA 2XIZA 3FMLA 3R22A 4C4FA 3R8PA 4MBJA 3GFWA 4OTFA 2QOQA 3LMHA 1CKPA 1KE7A 1XKKA 1JKSA 4MEDA 4U80A 5DT3A 3W8QA 4F64A 3R71A 3UYTA 1WBOA 4RJ3A 4APCA 4ERKA 3QCQA 2J5EA 1PKGA 2V0DA 2WQOA 3EZRA 3HX4A 4L46A 1G5SA 4DH1A 4E8AA 5BUJA 3D4QA 2V22A 4EJNA 2HXLA 3ZOSA 4BWPA 3CD8A 4YC6A 5HO7A 2X8DA 3FXWA 3LW0A 5M57A 3R2BA 1TQPA 1PXJA 1IEPA 4NW5A 3TUDA 5KO1A 4JDKA 1SYKA 4G9RA 3Q4CA 3R8LA 5CT7A 2F7ZE 4ALUA 5JH6A 3FMJA 4U0IA 3KF4A 1ZZ2A 4HCTA 2ERZE 3EQCA 1SZMA 4BDCA 4FTOA 4G31A 3DXPA 2UVYA 2J90A 5I4NA 1OBGA 4O7YA 5AV1A 3DBDA 5BVKA 4MD9E 3W33A 4BGGA 5IH4A 3S95A 3VN9A 2E9UA 4TYHA 5FDXA 2IVUA 3HDMA 3MY0A 4IBMA 4F65A 4QO9A 5M56A 2GNHA 4U6RA 4O7TA 1OUYA 4IB3A 4FICA 3VUDA 3KMWA 1ZXEA 3Q3BA 4FSQA 3RPVA 2OFVA 2CN8A 4USEA 3DU8A 1YVJA 2OG8A 3EQBA 3QD0A 2QONA 2X9EA 4AFJA 5IMXA 4KBAA 2VNWA 4M84A 3Q6WA 3TZ9A 1X8BA 2BRBA 3VBXA 3SG8A 3NW7A 2WTWA 3AGLA 3F6XA 4W4WA 4IX6A 2CGXA 1CMKE 2W4OA 3GENA 2UUEA 4KRDA 4NIFA 5AR7A 5IA3A 2A2AA 5E8XA 2IZTA 4A4XA 4MXXA 5HU3A 2BALA 3C13A 2WNTA 3WF7A 4DEGA 4X3FA 3TIZA 4C37A 1R0PA 3OWPA 3IECA 4NU1A 3MPAA 2H6DA 4IMYA 3EYGA 3JR1A 1XHAA 2IVTA 2NRUA 3KMMA 4M15A 1Y8YA 4RT7A 3RAWA 3ZBXA 4L67A 2YM4A 3BQRA 2YDKA 4NK9A 4HYIA 4P2KA 2XJ2A 5L8KA 2OIDA 4A9RA 3TTJA 4RMZA 3C4WA 3TKUA 4FV4A 4FNXA 4JX3A 4JRNA 5AEPA 5E8TA 2PE0A 3HUCA 3CQUA 5ACBC 4ZTRA 5F94A 2OZOA 3IOPA 2BIKB 3BHYA 3A7IA 3GFEA 5CS6A 4KA3A 2QLUA 4DTAA 1B39A 3FMNA 1YDTE 4CRLA 4HGSA 1IRKA 1TVOA 2WOTA 4ITIA 4ANQA 1VZOA 2RFNA 3LFAA 4I6FA 4B6LA 1Q4LA 5IEXA 2C5XA 3GU5A 3ID6C 1O6KA 2OO8X 3GQIA 3NLBA 2VWWA 3RHXA 3LVPA 3UOKA 1BL6A 1DI9A 2KULA 3DAKA 2XNPA 2O65A 4YJPA 5IA0A 2HAKA 2J0JA 3GCQA 1UU8A 4TWNA 5CEIA 1Q8WA 3FZ1A 5K4JA 5TR6A 5KCVA 4X3FC 5KHXA 3ZM9A 3DB6A 5AV3A 3CY2A 4XG8A 4DEHA 3C0IA 3DTCA 4RFYA 4IAFA 4K6ZA 3IW5A 4FE2A 5CAUA 4IJ9A 3F2AA 4ENYA 2W7XA 4NM0A 4PP9A 3TT0A 5C8KA 5HI2A 2XBJA 2UZWE 4C38A 1GZKA 2PK9A 2WEVA 4I94A 5LVMA 3COKA 4J97A 2YM8A 4QYYA 5EM8A 3WIKA 3SV0A 3G51A 4AP7A 4NKAA 5K0KA 3UP7A 3R6XA 2V5QA 3EL7A 4EC8A 3BBWA 2R7IA 5IF1A 4FEQA 3DDPA 5LMAA 5J9LA 4FZ6A 2VWIA 3QRIA 2X4ZA 4YZ9A 4I1ZA 1ZZLA 3RPSA 3V8TA 4WNKA 1VR2A 4WSYA 3HRCA 4HPTE 2QC6A 3UC3A 4YNOA 1KE9A 4GKHA 3KRRA 3TNPC 4A06A 3KCKA 5CQUA 4Z55A 5GZ8A 5J95A 4MTAA 3GCVA 3UNZA 4BI1A 4I5PA 4IB5A 5E8WA 4E4LA 1U59A 3EZVA 4F99A 3NPCA 5EW8A 4AX8A 4EQCA 3R63A 1J7UA 2HK5A 2GQGA 2QOKA 3KRJA 4FSRA 5GJGA 4DH8A 2ONLC 3DKGA 5AR5A 5EKNA 5IQBA 2ACXA 1XH8A 1O6YA 1MQ4A 2YAKA 4E1ZA 3CXWA 4EBVA 3M1SA 4MBLA 2Y4IC 1H26A 2CLXA 5HESA 1W8CA 3PDTA 2X81A 2QU5A 2WTVA 1GIHA 3FYJX 5I9WA 2XNGA 3V04A 4CYJA 3EQHA 5FUTA 3QTZA 4FSTA 4I21A 2BZIB 3PWDA 4CFFA 1STCE 3QRUA 3ENMA 3QXPA 4AW5A 3KREA 4V0GB 5CEKA 4ASDA 3A7GA 1MRUA 4L42A 2OICA 3EFKA 3PP1A 4B8MA 5ITAA 4EZ7A 1JSUA 5L2QA 2PULA 4QMOA 4JG7A 3E3PA 4QOXA 1P5EA 3G9NA 4EHGA 2IG7A 1XBAA 2GTNA 4R7HA 4CKIA 4O86A 2C5YA 3DKFA 2JIVA 3R8MA 4L52A 4EH5A 4B8LA 3QFVA 4H3QA 3DNDA 4C8BA 3U6HA 1YOLA 5BYZA 2BRNA 3LM0A 4E4MA 1NY3A 3QXOA 4F9WA 2GU8A 2JFLA 3UJGA 3QALE 3R00A 3V5QA 3W1FA 3PIZA 4MWHA 4RZVA 3PVGA 3LXPA 5DH3A 5HCXA 5CU3A 2GQRA 1YDRE 2ITQA 4J98A 4UWCA 3OROA 5A6NA 4ZSJA 3OTUA 1TQIA 3PLSA 4O7SA 3F61A 4QQ5A 4RGJA 1FGKA 4AZSA 4D4VA 1OBDA 1CTPE 2IO6A 3BYSA 2WO6A 2J6MA 2DUVA 4K18A 3VW8A 1R78A 4I3ZA 2PZIA 4BY9E 4L6QA 4JXFA 1FVRA 2UZUE 3DAEA 4IX3A 4FYNA 3DCVA 3DDQA 2W06A 3GU6A 4BKZA 3QUPA 5JFXA 4DGNA 2HENA 1REJA 4TKSA 5EYMA 3FLQA 3ZS5A 2R3PA 1DM2A 3LQ8A 3QKMA 3DLSA 3VC4A 3F5XA 2HXQA 4TXCA 3H0ZA 4G16A 4AGCA 4FKJA 3QRTA 2GHLA 4IFCA 4F9YA 4FEXA 2YISA 3RAIA 4FNYA 4ZEGA 3IW4A 3M11A 4BCFA 1OGUA 4PY1A 3HEGA 4QTEA 3O0GA 3ATTA 4BGHA 2OH0E 1GIIA 3HV4A 3NEWA 3L8SA 4LRJA 2VD5A 4B0GA 2YIYA 4F09A 4AZWA 3IW8A 4RX8A 1JBPE 5LQFA 3VUMA 3NIZA 3DTWA 4IM0A 5F4NA 4BICA 4BCNA 5AX3A 1YWRA 3ORIA 4ZZNA 4O0YA 4P90A 2ZB0A 3BX5A 3P7AA 4FVPA 4R3CA 3SAYA 5LCKA 2OWBA 5CU4A 2RSVA 4DG3E 4LUEA 1OVEA 3QYWA 1JKKA 4L3LA 5CEOA 4M68A 3H4JA 5LVOA 2R3MA 3OBJA 5I5ZA 3AXWA 4W4VA 5EDRA 3PPJA 4FTLA 3II5A 4Y85A 2BDJA 2W99B 3GU8A 3HP5A 3HUBA 3UE4A 4TYHB 1M2RA 5E92A 5CLPA 3TZMA 4PTCA 3QD4A 1OKZA 4AU8A 2WMUA 2BDWA 3AGMA 2BAQA 5CF4A 2QNJA 2Y6MA 3O7LB 3OT8A 4YHTA 4F6WA 1PHKA 3C4ZA 3KQ7A 5BVEA 4I4EA 3C7QA 1JPAA 4XS2A 3UQGA 4IX5A 2QQ7A 2ZOQA 1ZLTA 3MVHA 4G3DA 3DGKA 1LEWA 4GUEA 2YLFA 2WIHA 2HCKA 2BRGA 2X6DA 3VS6A 1GJOA 2R0UA 3ZM4A 2JKKA 4EH4A 4KIPA 4ZLZA 5ANIA 4ZTMA 2UVXA 1OIRA 3LOKA 2B9IA 3C50A 4FTKA 2XBAA 1OPJA 3CGFA 1MRYA 2XUUA 2VUWA 3Q32A 4FMQA 4HGLA 5LARA 3HMMA 3HMOA 1PRYA 4CG8A 2EUFB 2PMOX 2A1AB 3QTIA 2VTMA 3TI1A 3KCFA 3LFNA 2B54A 3NCGA 2X2MA 1FQ1B 5IEVA 5AUUA 3DBFA 5LXMA 3FMHA 5ETIA 5M44A 2W1IA 3PE1A 4BN1A 3DZOA 4UX9A 2VGOA 4FIIA 3ZC5A 4CNHA 5L4QA 1XJDA 2VO3A 2Y6OA 3VS4A 3O23A 2I0VA 3R30A 3OOMA 3BELA 5CNOA 3ZO4A 1HCLA 2YCRA 3EN6A 3FY2A 4QMYA 3VF8A 4BGQA 4LFIA 3PY1A 3SRVA 4AE6A 4FTCA 4RC4A 3K54A 4O2PA 5LMBA 4Y95A 2PMIA 4EH3A 2XEZA 3OEFX 3F3WA 4NT4A 5E8ZA 3U9NA 4PF4A 3PJ1A 5F9EA 3UOJA 5IUGA 3PYYA 4ACDA 3NWWA 3CC6A 4ANSA 5B0XA 2V7AA 5HG5A 4O0RA 5A3XA 3FL5A 3PPKA 3BHTA 5TT7A 3UIXA 5AA8A 3GC8A 2BHHA 4X3JA 2PMNX 3GT8A 3IDCA 4FTRA 4J8NA 4NSTA 3NZ0A 4WHZA 2NRYA 5EOLA 5A4QA 5JFVA 4UWYA 5A6OA 3FLZA 1UWHA 3NSZA 5H9BA 2UZVA 5EI8A 1G8AA 5HGIA 3LFDA 4JDJA 4CKJA 2QR8A 5HEZA 4FG7A 3LCKA 1YOMA 2JDTA 5HLNA 4I0RA 3LCDA 1M7NA 2C3KA 2VWVA 4TZRA 4CV9A 3FI8A 4C2WA 4R6VA 4BVUA 3NRMA 1YXXA 5AP7A 4OGRA 4YZNA 3EKKA 2B7AA 2VX1A 5FBNC 3QCXA 2FYSA 3I7BA 4XOZA 4D9UA 3UOLA 5HLWA 4D4YA 5J9YA 2WU6A 4C7TA 3MN3A 3BIZA 3WZJA 3RZBA 3O51A 1ZMVA 4BIEA 4BYJA 4BDHA 2C1BA 1CSNA 4FKUA 4FZFB 4GFMA 4GMYA 4LGDA 4MKCA 4N6YA 2YITA 3LFEA 3MWUA 4CT2A 5GZ9A 5FP5A 5KMNA 4R7BA 2QODA 3W2QA 4JVGA 4O0UA 3GU7A 2WZJA 3GC0A 4USFA 1J1CA 3E63A 3EQPA 4L9IA 4Z9LA 4FF8A 4EOKA 1SMHA 2PVFA 4GSBA 4II5A 2Z7LA 2JFMA 4UXQA 3FSFA 4YNEA 4CQEA 4H1MA 2WTIA 3ATSA 2XNOA 2ZV8A 3T3UA 4DFNA 4FKVA 3BZ3A 4NCTA 4YJSA 5IDNA 2BILB 3COIA 5DBXA 3OWJA 4KSPA 1QL6A 4PMMA 4YJQA 4RIXB 4F63A 3L9PA 2QOOA 2GPHA 4GVJA 4C4GA 3MTLA 1XO2B 3R1SA 4C4HA 3UVPA 5BVOA 3OWLA 2X2LA 3PIYA 2WTKC 4IWQA 4XG2A 2V7OA 5AUTA 4MCVA 5M07A 4DEDA 3JY9A 3MFSA 2GS6A 5BVWA 2KTYA 4EH7A 1WVWA 4Y72A 5CZHA 3NDMA 2C1AA 5FDPA 5JQ8A 2BZHB 4EUTA 5L8JA 1OL2A 3EOCA 2C3JA 4HGTA 2ITUA 4FZDB 3RKBA 3UQFA 2VWZA 4OBOA 4D1SA 3BLRA 5CTPA 3Q5IA 3F88A 2HWOA 4PPAA 3PJ3A 4LRKA 4KIQA 4O0XA 4E6AA 4U44A 4NTTA 4LL5A 3A7HA 1H1PA 4RJ5A 4PDOA 2XJ1A 2EVAA 3Q52A 4ZZOA 3ROYA 4F0FA 3WZDA 4NCTC 4P5QA 3UIBA 4GFOA 3PUPA 4FC0A 3UMXA 4ZLYA 2FSOX 4HCVA 4DBNA 4WG3A 4BKJA 2PVLA 4D4RA 3QA0A 1YQJA 3M42A 4E6QA 3G9LX 5A4TA 2GTMA 2Y9QA 3VUTA 3CLYA 2FO0A 3MH0A 3EL8A 3FLYA 3LFBA 4IAAA 4IVBA 2XK4A 3VS0A 4BL1A 3HV3A 3MH1A 5CAOA 1W98A 3WF6A 5J8IA 1O6LA 3NX8A 3O17A 5AP1A 4EL9A 2WQBA 4UZHA 2Z7SA 3SXSA 4ANOA 2PWLA 2HZIA 5D12A 2C5OA 5HG9A 4RJ6A 3W8LA 4G6LA 1PMEA 2J2IB 2WKMA 3FJQE 4WRSA 4R77A 4ACMA 3SLSA 1OKYA 4F9CA 3TZ8A 4BBFA 3D14A 3QLFA 5BVDA 3UBDA 3PXZA 1M17A 1MRVA 1UKHA 3PVUA 4FT7A 4IAZA 3M2WA 4L3JA 4I5HA 4J1RA 4PUZA 2PL0A 3LM5A 4ZTHA 4V04A 4YHFA 3U4WA 1R3CA 2ERKA 2A4LA 1K2PA 3D2IA 3DNEA 3TCPA 2J0KA 5ACKA 2IN6A 3R28A 4GW8A 4BHZA 4W9XA 3NMUF 1KE5A 3EFLA 3LXLA 1GOLA 2VZ6A 4FIHA 1BI8A 3QZGA 4X6RA 2CDZA 3AC4A 3RNYA 3DB8A 4O84A 4BIBA 3V5JA 2X4FA 3VIDA 4USDA 4D2WA 2YIQA 3LMGA 2WGJA 4MNEB 4D0XA 5IH6A 1YHSA 4CLIA 4HPUE 1U4DA 3QX4A 4WBBB 4ERWA 2O5KA 4GU9A 4K9YA 4Y5QA 3KXNA 2P55A 2VO0A 5CSVA 4U40A 3REPA 2EXMA 1XQZA 2JKMA 1PMNA 2EWAA 3Q4ZA 2UZOA 4Y83A 4AGWA 2VWUA 3RBWA 4FUXA 3F3TA 4NJ3A 5IKWA 4LMUA 2X7GA 3PVBA 2G9XA 4FT3A 3MYGA 3PE2A 4JR3A 4YR8A 2VTTA 4A07A 3C9WA 5IQIA 3PG1A 1W0XC 3KXHA 3RAKA 2PMLX 4V05A 2WMWA 4PDYA 4EJ7A 3ODYX 4FOBA 2OJJA 4DE4A 2BR1A 4R3RA 3I81A 2VWBA 4E6DA 3VO3A 3PXYA 2QURA 4PP7A 5A54A 3BEAA 5FEEA 4DTKA 2IZRA 2HY0A 4G3FA 1U5QA 4KBKA 2PZYA 4M69B 2QLQA 3SKCA 4I5CA 4EYJA 3TXOA 3KY2A 2PE1A 4EQUA 3SG9A 1OZ1A 4IVCA 2XK9A 4EZ5A 4EBWA 5C27A 4AOJA 1LR4A 5IEYA 4AT5A 2JDOA 3KRLA 2CGVA 5KZ0A 4NZWB 2PY3A 3OT3A 1RDQE 3PY0A 4IIRA 4U97A 3OUNB 4M7IA 3P78A 4QP6A 4RX7A 4XJ0A 4XV1A 2JEDA 3SRVB 4PL4A 4YLKA 4FR4A 2XB7A 3UIMA 4FZ7A 4K11A 5A4EA 5CSWA 4GJ2A 3A8WA 4FV7A 3NNXA 4YZDA 3MJ1A 2W1CA 3CBLA 3DJ7A 4BI2A 3FMDA 4O2ZA 4JLCA 2OSCA 1KUTA 3H9FA 5LJJA 3OW3A 4R3PA 3SHEA 5C4LA 3R01A 3AQVA 4JS8A 1BI7A 1SM2A 2O63A 4ZZMA 2I0YA 3MESA 2RG5A 2JIUA 4ZOGA 3I79A 5FP6A 4C61A 4AOTA 4CRSA 4IZAA 2YDIA 4D5HA 3KULB 2XIRA 3HP2A 4BZOA 4O7NA 5K3YA 4LOOA 4Z7HA 1VYZA 5HE0A 3BWFA 1Y57A 5BQ0A 3SDJA 5IQEA 2X1NA 5CU0A 4TL0A 3U4UA 4UZDA 3P9JA 3GVUA 1PXOA 3QUEA 4AW0A 5HBHA 4E93A 4GV1A 4DTBA 3WYYA 2ZVAA 4IVDA 3MFUA 5CEMA 4XG6A 2ITTA 4IC8A 3HRFA 4HVSA 4F7NA 3LHJA 4KS8A 2BFYA 1AGWA 2VV9A 3R21A 4CT1A 4AOIA 4DT8A 2VTPA 4RFMA 4IB1A 4CKRA 3B2TA 4LL0A 1WAKA 1H0VA 4RJ8A 3FUPA 3R7EA 4DEIA 2R3IA 3Q9XA 4U5JA 4EEVA 2X7FA 3OTVA 5KKRB 4O7ZA 3ORMA 3UVRA 5IQDA 5EDPA 4PTGA 4BCPA 3ZHPC 4FGBA 4GG7A 4JOAA 4FV0A 4QTDA 4BDEA 4CVAA 1XH6A 4Y8DA 4WNOA 5HVYA 4HOKA 3ZXTA 1QMZA 4I41A 5GIOE 1OIUA 1H27A 4QYHA 5AWMA 3ZZWA 4YO4A 5BNJA 3ANQA 5E1SA 2CKOA 5FWKK 4MQ1A 3KMUA 4AWIA 2R64A 4IAIA 3BGQA 2B52A 4RVTA 2W1ZA 2C5VA 2YDJA 3QQFA 4MVFA 3WILA 4EH8A 3QTRA 3ORXA 3VULA 4GK3A 5AUYA 5B2MA 4LG4A 3UZTA 3GU4A 3MH2A 2Y4PA 3WF9A 3PA4A 2WD1A 3O8UA 4LGHA 3TWJA 3MDYA 2VTAA 1OPKA 4BBEA 3QRJA 4FA2A 4JBOA 3QC4A 4H39A 2OFUA 3RZFA 4CGAA 1WBSA 2YEXA 5CF6A 3IDPA 1GY3A 4J96A 5AR3A 4S33A 4DG0E 4RVKA 4DLJA 4E26A 5L2IA 3R7VA 5FG8A 3ZDIA 3SW7A 3DK6A 3HECA 4NFNA 2ETKA 4FSUA 1V1KA 4HJOA 3F3ZA 1PJKA 3QTUA 4RFZA 4TY1A 4UY9A 1UNGA 2YM7A 4QRCA 4RX5A 2XK7A 3DXQA 2IVSA 4O6EA 2BDFA 1WBVA 4RIWB 2ETMA 1Q8YA 3PSBA 5JT2A 2JD5A 3NAYA 4YTCA 3U55A 1PXPA 2Q0NA 3G0FA 1YI4A 2UW8A 4DHFA 3S1HA 2VWXA 1OITA 2YZAA 5FM3A 2BTRA 3QQGA 3TIYA 5DN3A 5JRQA 3VUKA 3U6IA 5AUXA 2RG6A 3ELJA 2GS2A 4H1JA 3DT1A 3DQWA 3IQ7A 3FQHA 3RCDA 1H4LA 2IWIA 3FAAA 4G2FA 4QPSA 3AG9A 3CY3A 4IDVA 2UW4A 4M66A 5I9YA 3ENHA 1YXSA 3OZ6A 4JIAA 3WE8A 1PYEA 2WEIA 3PSCA 4W8EA 5G6VA 1IR3A 3OFMA 4OTDA 2X8IA 4NWMA 4CFXA 5FGKA 3KVXA 4JBVA 2I7QA 5E9EA 4K2RA 4E3CA 2XNMA 2OXXA 2WTJA 2J0IA 3RINA 3QRKA 2GS7A 3MPMA 2VTHA 1JAMA 4I23A 5AADA 1URCA 3H9RA 3ALOA 4NH1A 2BUJA 3QTXA 4PL5A 3LCOA 2R4BA 4XOYA 3VBQA 4D9TA 3D7ZA 4C3PA 3EKNA 3P0MA 3IGOA 2XH5A 3OXZA 3FLSA 1Z57A 1GNGA 4KABA 4A4LA 3F5UA 5HLPA 3QD2B 4MF0A 4FK6A 3RVGA 3ZONA 2FSTX 5TKDA 2B1PA 3A99A 2PUNA 3MIAA 5E8SA 2VU3A 3DY7A 2ONLA 4F1OA 2HW6A 3KXMA 5F95A 2BAJA 5AMNA 4D5KA 4UEUA 4TT7A 4IANA 4BCQA 4FG9A 3GUBA 4BDGA 4X2FA 2X0GA 1QPDA 3GB2A 5EDQA 5AR4A 4OLIA 4ANNA 4P4CA 4E5WA 1MP8A 5HTCA 2CNUA 4AE9A 2OZAA 4RVLA 2GNFA 1ZY5A 3BI6A 3FMEA 5EM6A 4HVDA 5E8UA 3ERKA 3HV7A 4ITJA 4Z3VA 2PZ5A 4KRCA 4FT9A 2OIQA 4C58A 3QZFA 5BYYA 4EK4A 4NFMA 4RLKA 4RQKA 5JFSA 3C4XA 4FIJA 3KRWA 4X2JA 3OHTA 5A4CA 2XK8A 1MQBA 2YERA 4J71A 3R9RA 4DCEA 3UDBA 4EQMA 4DFBA 4ZSLA 1NW1A 2O3PA 4TN6A 4LRMA 3QU0A 3VW6A 3RK7A 4OT5A 3CE3A 5FTGA 2XEYA 4N0SA 3QQLA 2DWBA 1OIQA 1ATPE 3H9OA 4G1WA 5GNKA 3SW4A 1Y91A 2F57A 2CJMA 3CKXA 4I92A 3VWAA 4RIYA 3LLAA 1Q3DA 2R3JA 3SOCA 3G5DA 3KXGA 5H8BA 1RE8A 5BYLA 3UVQA 1URWA 3OG7A 1KV2A 5DR6A 1OI9A 1PW2A 4UMTA 5HTIA 4FSMA 3BCEA 2PZPA 4Q9ZA 3D5VA 2WMQA 4KSQA 3KKVA 2C6LA 3VF9A 1P4OA 4IQ6A 2GNLA 2WMAA 5KMOA 3EB0A 1XH5A 2ITPA 1Q8UA 4YTIA 1PXIA 3E92A 3K5UA 3QLGA 4IVAA 3FEGA 5AV2A 5AV0A 4FODA 4U3YA 4ACHA 4EK8A 4FEUA 1ZARA 3L9NA 3ULIA 3U54A 1Z9XA 1H08A 3CPBA 1ND4A 4AS0A 5CENA 3D15A 5AAEA 3BKBA 5ANGA 2C6IA 4F7SA 3NUXA 3N4UA 4EOIA 5M51A 5HD7A 3SOAA 1VJYA 3GGFA 3TG1A 2VTLA 2Y0AA 3CD3A 1F5QA 5DE2A 4BTJA 2C47A 3BYVA 2VX3A 4YSMA 1DAYA 5ICPA 5DT0A 2CPKE 4RA5A 2XRWA 3ZDUA 5J7HA 4DT9A 5J5TA 1F0QA 1Q8ZA 4IFGA 4AT4A 3HNGA 2YJSA 1GAGA 4GK4A 2CGWA 5HICA 3LE6A 4CSVA 4HVGA 2OJ9A 3PA3A 1GZ8A 4GU6A 3F3VA 3A60A 2XA4A 3LXKA 4ACCA 5HTBA 4G3EA 5CSXA 4G5PA 2IZUA 5JK3A 2AC3A 4YJTA 1WBWA 3DFCB 4D2TA 3CS9A 3ZBFA 2OK1A 4V01A 3SD0A 4GT4A 2OXDA 1PXLA 1H28A 1K3AA 2R2PA 4CMOA 4I4FA 2E2BA 3EH9A 3VRZA 4EOJA 2CNQA 3QAME 4RJ4A 4YZCA 4E5BA 3BYMA 3PG3A 4AN2A 3W2PA 4DGLC 2C4GA 2PE2A 2RIOA 3GBZA 5C4KA 2WXVA 4FX3A 1RW8A 4QMXA 3VNTA 4I5MA 2YZLA 4CFWA 4RX9A 4YJOA 4CCBA 4BRXA 4MH7A 1Q5KA 4FKLA 4JL9A 3F69A 4TW9A 4S31A 5CEQA 4IM3A 5AUZA 3RHKA 4AG8A 2JBOA 4FT0A 4O96A 1YRPA 4IXPA 4BHNA 5CAVA 2F2CB 5HVJA 1J7LA 3ZH8A 5CU2A 1UU9A 1H0WA 2OF2A 2OU7A 3A2CA 3P4KA 4A9YA 4GVAA 5L6OA 4ASXA 3GNIB 3NYVA 3VBWA 5JZJA 2CKPA 4FL2A 4AA4A 2R3FA 4KAOA 5J7BA 4O81A 4OT6A 5D10A 2VTSA 4QNYA 4EKKA 4C34A 2F7EE 2GSFA 2I1MA 3EIDA 1ZYLA 3HKOA 4PQNA 4QQCA 4YTHA 2B9HA 1Y6AA 5JRSA 5EW3A 2VRXA 3PJ8A 4W9WA 3LMIA 4MHAA 4IADA 4BZNA 1UWJA 1ZOHA 2Z60A 1ZRZA 4DAWA 1P14A 5DMZA 3DV3A 3QQJA 3E8NA 4NJDA 4IZ7A 2XM8A 2VTJA 2X2KA 4N4SA 2X39A 4APPA 3FHIA 4QP8A 5BMSA 1WCCA 2RFSA 3KB7A 2UW6A 4CFMA 3GCPA 5LMKA 3CCNA 4XMOA 3TZ7A 4DFZE 4ITHA 4A7CA 5BX0A 3JPVA 5FEQA 4NIFB 4I6BA 5H8EA 4JQ7A 4YJRA 5HU9A 4AZEA 1V0OA 3NNUA 1OKVA 5FEDA 4QMQA 4X3FB 5IQGA 2Z2WA 3EYHA 1OL5A 4FKRA 3BLHA 1ZOGA 5DEWA 4ZSAA 4MXZA 4WD5A 4S2ZA 3E7OA 3R9DA 1ZYJA 3AT2A 4XX9A 4F4PA 5LWNA 2IJMA 3BU6A 4MQ2A 4FSYA 3FPMA 3LFCA 5EW9A 4X0MA 3TN8A 4XV2A 4DFLA 2HY81 2ITXA 2QOFA 4J53A 4YPDA 2VTIA 1KSWA 3KK9A 3NW5A 4WG5A 2ITZA 2ZJWA 3CPCA 3HYHA 5FRIA 2PPQA 3FLWA 2W4JA 4MWIA 5HG7A 4BDFA 3QQHA 3R1YA 4GYIA 5DNRA 3PTGA 3AT3A 3G6HA 4HZSA 1M7QA 5C01A 4YJUA 5A14A 3FZTA 2HZNA 4CTBA 5HQ0A 4IM2A 3BHHA 3PPZA 4RWKA 3I6UA 3QC9A 1YHWA 4QMMA 4YSJA 4YUQA 3ZFMA 4BCOA 4QMNA 3QCYA 5DR9A 5DIAA 4Q9SA 3UIUA 2A0CX 4F7JA 3UO4A 5LMKC 2BRMA 5KHWA 4BCGA 5BUEA 4OTPA 3PRFA 2JDVA 4E4XA 4BR3A 2QU6A 3V6SA 1CKIA 5H8GA 1QPJA 1OECA 3GC7A 4WNPA 2WPAA 2VO7A 2YACA 3LJ0A 1KV1A 2WB8A 3DJ6A 5IA5A 3BGPA 4FG8A 3AD4A 4O21A 4QP1A 5BPYA 4KIKA 2F9GA 2WMRA 4IAYA 5L3AA 1G8SA 5HZNA 4MXOA 5IISA 2G01A 5T6KA 3ZEWA 3OC1A 2JDSA 3BHUA 2UW0A 1JWHA 2G2FA 4FK3A 3C4FA 1LEZA 2GNJA 4LV8A 2WFYA 2OJFE 2Q83A 2Y4IB 1YWNA 3V5TA 3U9CA 4BZDA 3ZRLA 5E8VA 2P33A 2G2HA 4CZUA 5E4HA 5IZFA 4L8MA 2P3GX 3P1AA 1RJBA 4ZTSA 3R7OA 4AZFA 3EFWA 4CG9A 2YCFA 4JDHA 5HG8A 4ZMFA 4CQGA 4ZP5A 5BMMA 3UG1A 2W1GA 4G9CA 4AA0A 5EQEA 5IU2A 3OY1A 5L2WA 5HNBA 4WO5A 3HVCA 4G5JA 4HNIA 4TPTA 3ANRA 4YU2A 2VX0A 5DR2A 4BF2A 4A9TA 1WBPA 4UB7A 5C8MA 3F2NA 2QG5A 4XG9A 4I6HA 4ANBA 5ANOA 4RVMA 2J0MB 3MBLA 1L3RE 4FKWA 3UGCA 4CZYB 4RQVA 5M08A 1UU7A 5EHOA 4ZIMA 2ITWA 5EYDA 4OUCA 5CXHA 2W5HA 3DJ5A 4EOQA 4C36A 3R1QA 5GZAA 4Q2AA 3IO7A 4L45A 5CQWA 4L01A 4YP8A 4O0WA 4CEGA 4L3PA 3FYKX 4CYIA 4U3ZA 2V55A 1ZWSA 4U9AA 5AP3A 2NPQA 3ZLWA 3KN6A 1OM1A 5AUVA 1JSVA 5EYCA 5CF5A 2I0EA 2X8EA 2Z02A 3HAVA 3Q2JA 4F9AA 1OKWA 4M12A 5J1WA 3F7ZA 3AC3A 2PHKA 3FHRA 3NNWA 3P79A 4BKYA 3OCBA 3P23A 2C6OA 2HWPA 2FB8A 1PYXA 4C4IA 4M3QA 4M14A 3DOGA 2J5FA 2Y8OA 4Q5EA 3P08A 4FTAA 2R3KA 2WELA 4JG8A 4AAAA 4TYIA 4QPAA 5EOBA 3R8VA 3EMGA 4XHKB 3H0YA 3L8PA 2GHGA 5AIRA 2OW3A 4O0SA 4IE9A 5EHLA 4ZJVA 5AM7A 5AIKA 3W55A 2QO7A 1YDSE 3E3BX 4J7BA 1ZOEA 4AXAA 3MTFA 2ZMDA 5KE0A 3W2SA 1REKA 2X6EA 1YXUA 2G15A 4O0VA 4ZJJA 3V51A 5D7VA 2GNIA 3FC1X 3MB7A 4O7VA 1Q3WA 3QF9A 4CCUA 3SX9A 4EH9A 3SA0A 2CLQA 4PL3A 5L2SA 4E6CA 4RJ7A 2UZEA 3MIYA 4AW2A 1JSTA 2PU8A 3VUHA 3WZUA 1HOWA 3A4OX 2JIIA 3Q04A 5HE2A 4AA5A 4CMTA 3E62A 4DG2E 2WAJA 5AAFA 3TL8A 4CLJA 4G3CA 2YCSA 1YOJA 3PJ2A 5FXQA 3U51A 2PVRA 2PVKA 3HRBA 1I09A 3CQEA 3NUYA 3IOKA 3JYAA 2UV2A 2WU7A 3LCTA 4OTQA 4J8MA 5AJQA 5E90A 4BCJA 5M09A 5DWRA 4OTHA 2A27A 5KMJA 3EQIA 1BX6A 3DFAA 4BFMA 3AMAA 1E1XA 1KOAA 1OUKA 2PVMA 5C03A 3ZCLA 3LIJA 5CI7A 3FKLA 5GJDA 2DYLA 3R7GA 2EXEA 4OR5A 5CT0A 5AX9A 4WUNA 4AFEA 1XBCA 3KVWA 3PWYA 3QZIA 5AP2A 1UA2A 5HCYA 3VBYA 4UWBA 2HZ0A 3TM0A 2H8HA 3L9MA 1NT2A 5HO6A 2PVYA 2QOLA 2UZNA 3EQRA 4YLJA 2XJ0A 3N9XA 4LGGA 1B6CB 3KXXA 4E20A 5JEBA 1CM8A 5C9CA 5BUIA 3WYXA 1EH4A 4XG7A 1YXVA 2JLDA 2F49A 5AP0A 2WMTA 2ZM3A 2W05A 3S00A 2XNEA 3KEXA 4PDSA 2WMSA 5GINE 5EKOA 4XP2A 2YN8A 4XYFA 3H10A 5JGBA 3ZUVA 2CCIA 3LJ1A 4MXYA 1UVRA 4I0SA 5J1VA 5HE3A 4FKOA 3COHA 2YHVA 4UBAA 5KZIA 4BTFA 3RNIA 5AA9A 4H36A 5EG3A 3MY1A 4BBMA 3GC9A 3O7LD 1Q97A 4ZTLA 1NXKA 3WOWA 4E5AX 4O91A 4O22A 3FZOA 4BCMA 5IPJA 5DRBA 3NR9A 3R1NA 3POOA 4I24A 4FV1A 4HNFA 1NA7A 4BTKA 5IUIA 4CZTA 5CAQA 1DS5A 3K2LA 5EI2A 5FQDC 3TV6A 3ZO3A 5DHJA 4XRLA 2QCSA 4L53A 5DEYA 4BB4A 3ORKA 3ZFYA 5K9IA 2CKEA 1FOTA 3DBQA 1Q41A 4IACA 3MY5A 4DH3A 2VNYA 3CTJA 3PXQA 3VQUA 4RA4A 3QL8A 3MJ2A 1CKJA 4WIHA 3A62A 5DVRA 4XV9A 3WZKA 3RPRA 4EOSA 4YPSA 5M4IA 3HMPA 1H1WA 3KGAA 4GIIA 4OTIA 4UALA 4NM5A 2ZM4A 5IMEA 3PXFA 1M2PA 1VYWA 1MUOA 3ZMMA 2HIWA 3IPHA 4ZTQA 5L2TA 3F7WA 2UW7A 4ZXTA 2XKDA 3NYXA 2UVZA 3Q53A 4RLLA 4MAOA 1FMOE 2OH4A 4D4SA 3QUDA 4AACA 4AUAA 3UZRA 3NS9A 3ZRMA 5D41A 4UMQA 3JS2A 2GFSA 2P2IA 3CKWA 3TEIA 3UODA 5EH0A 2ZM1A 3Q96A 3QBNA 4IHPA 3HDNA 5EI6A 3R7IA 4FKSA 4F0IA 3FY0A 3S2PA 2P2HA 3BLQA 4FV3A 2BROA 3C4CA 3PZEA 1W83A 3FMMA 4IC7A 4KNBA 4QP7A 3C5IA 4DC2A 2JBPA 4CFNA 3I0QA 3LZBA 2XMYA 4EKLA 5CSPA 4R7IA 4WUAA 4FYOA 3K3JA 4FKPA 3R83A 1J3HA 3IDBA 4O6LA 3ZYAA 4ZJIA 1J7IA 3FV8A 4MNFA 4AZTA 3OBGA 4I22A 1R0EA 4Y73A 5GJFA 2WOUA 4DFXE 2I40A 3I5ZA 3JY0A 3KK8A 4FNWA 4IH8A 2WQEA 5DRDA 4D1ZA 3RWPA 1KE6A 4D0WA 4KIKB 4M0ZA 4MX9A 5HO8A 4LI5A 4EH2A 2REIA 4DITA 3T9IA 3V8WA 4YTFA 4JDIA 5JGDA 1F3MC 2EB2A 3EQGA 4FUYA 3MA3A 4QPMA 2CGUA 4FSWA 4PPCA 3I5NA 5HD4A 4YGAA 4ASEA 4LOQA 3COMA 3FE3A 2XP2A 3NUPA 3UYSA 4BCHA 1WFCA 4P5ZA 4PMTA 3VJOA 2UW3A 3D9VA 3FI4A 2EU9A 1PY5A 1PXNA 3PRIA 4JAIA 2BZJA 4R5SA 5T68A 3WZEA 2C0TA 3CJGA 3D2KA 5H2UA 4D2VA 3E8CA 5KBQA 3O8PA 2XVDA 5G1XA 3RK9A 3MH3A 4EZ3A 3GOPA 3QD3A 4XLIA 3FSKA 1OL6A 2PUIA 5I9UA 3KN5A 3Q9YA 3AC8A 4O1PA 4WT6A 2YCQA 3FI2A 5KNJA 4O38A 4FGRA 4JBQA 2QOBA 3FKNA 2R3OA 3L8XA 4NM3A 2QG7A 3OCSA 2G1TA 4C0TA 5HX8A 2FGIA 3OP5A 2XNNA 3OMVA 4DINA 4EH6A 4OTWA 2CHLA 3E8EA 2PVHA 3IS5A 2ITVA 3LQ5A 3ACJA 4KB8A 1GIJA 3TV4A 3TV7A 5E7RA 4EYMA 3RGFA 2NO3A 2WTKB 5HHWA 5HIBA 4RG0A 3K5VA 1U5RA 3TACA 4IB0A 3GP0A 4C4JA 4B4LA 3KA0A 4K8AA 5I9ZA 1LUFA 1IAJA 3DBCA 4GCJA 4IDTA 5CZIA 3POZA 5I3RA 3BPRA 3OVVA 4KUJA 1FINA 4JIKA 4AT3A 2CMWA 5EM5A 5TE0A 1Q62A 3GCSA 2ZYBA 3CP9A 4EWHA 1M52A 3UNKA 1FBNA 3S3IA 2B4SB 3W16A 4ASZA 3E8DA 5B2KA 3FZPA 1FPUA 1A9UA 3EN7A 3QHWA 4FBXA 4ZAUA 4EWQA 3UPXA 4AZVA 3MFRA 5FBOA 3A61A 3QQUA 4IAKA 4AGDA 4F6UA 4N57A 2HW7A 2HYYA 4LUDA 5EHYA 5ETCA 2VGPA 3I7CA 2XK6A 3PJCA 3DLZA 5HIDA 3GEQA 3UOHA 3QGWA 4X6QC 3ROCA 4KBCA 3UP2A 4MD7E 3KFAA 2OI4X 3HV5A 2J50A 4L43A 3W2CA 3K3IA 4TYJA 4NYEA 2AUHA 4CD0A 5KBRA 4FV6A 4K77A 5LVPA 4FNZA 3LLTA 1XWSA 4X21A 4D58A 1WBNA 2XK3A 2W5BA 4DN5A 4R78A 5CVHA 3R04A 3DZQA 4L44A 2OJIA 2H96A 2QO2A 2BRHA 2BKZA 4XNEA 4BDDA 4Y5HA 4MXCA 1YW2A 2OF4A
chains in the Genus database with same CATH superfamily
1UV5A 1UU3A 4O7RA 3Q4UA 3C0GA 3TJCA 3ALNA 4H3BA 4C3RA 3RM6A 4C4EA 1VEBA 3VRYA 2FA2A 4FSNA 4NL0A 3AC5A 5EM7A 2UW9A 4EHEA 3DA6A 2Y7JA 3C0HA 3VHKA 3V5WA 3KC3A 1M2QA 4PTEA 3QTSA 3VBTA 3ZO2A 5JQ5A 2W9ZB 3A7JA 5JKGA 4XEYA 2PUPA 3EHAA 3MV5A 4B99A 2CNVA 3LFQA 3VQHA 3LQ3A 2YM5A 2YLEA 4O4BB 2WTCA 4QP4A 1AQ1A 3CTQA 1RQQA 2C0IA 3HV6A 4HYHA 3DQXA 2JAVA 4GKIA 3FDNA 4ALWA 5FTOA 1IG1A 4DGMA 2UZBA 3ULZA 4G17A 3BYUA 4J95A 2XIKA 4FKQA 3ET7A 4YURA 3D5XA 4FTTA 2HZ4A 3AKLA 4A9UA 4AF3A 1PF8A 4EOLA 5IQHA 4PMPA 3L8VA 2XALA 2I0HA 3BU5A 4JT3A 1SVGA 3PVWA 3UC4A 3SXRA 3MVMA 5DT4A 4F6SA 2QKWB 2B53A 3E5AA 4W4XA 4ZY6A 4Z16A 3ACKA 4UYAA 3UPZA 3VUIA 5IQAA 5HE1A 2B9FA 4EK5A 3HGKA 2XCKA 2BKKA 5JMSA 3QTWA 2W0JA 4DA5A 3C4EA 2ESMA 1JNKA 4FTQA 2W1EA 5J9ZA 3MVJA 1ZMUA 3IW6A 2WMVA 3WIGA 3F3UA 5EK7A 5TOZA 2YM3A 3ZSGA 3GI3A 5DPVA 2H34A 3DK7A 3ORZA 2VWYA 3ZUUA 4LOPA 3G0EA 4QMWA 5T3QA 4LMNA 4R1VA 4S34A 4WRGA 2J9MA 3SQQA 4FV5A 5DG5A 1H8FA 1YHVA 1AD5A 2YM6A 2YWVA 3KXZA 2C0OA 1XH4A 4ZS4A 4JBPA 4RWJA 3RMFA 1BUHA 4B7TA 4C57A 3H30A 3IW7A 4N70A 4X2KA 5CAPA 4DDIA 4CV8A 4OAUC 5IQCA 5I3OA 4YMJA 2QHNA 3H3CA 4RC3A 1XBBA 4DEBA 4UMPA 2NNWB 3I6WA 5M55A 2O64A 3Q2MA 4DEAA 2YA9A 3GCUA 3P7BA 3W18A 3QKLA 4RWLA 4HZRA 5CSHA 4D2PA 4EORA 2JGZA 4RIOA 4K33A 2B55A 3I60A 5C26A 5J5SA 5CANA 3FC2A 4YZMA 2R5TA 4GRBA 4E7WA 2YFXA 4MYGA 4WSQA 3LJ2A 3P86A 5IUHA 2W1DA 3NFGB 5CVFA 5JFWA 1IA8A 2ITYA 3DXNA 5I0BA 3U6JA 3S0OA 3IONA 3OCGA 2BHEA 2XM9A 2PYWA 2ZMCA 4BCKA 5M06A 1H1SA 1WVYA 3I1AA 4NKSA 3ORLA 3RCJA 3DKCA 4FEWA 3EFJA 3OOGA 3KF7A 4FIFA 4UXLA 4O82A 2PVNA 4RBLA 2BVAA 4FKTA 1QCFA 3TNHA 4ZY4A 3ITZA 2XKFA 3TKHA 4H05A 2HELA 3FL4A 3VS1A 2PZRA 4J99A 3R73A 4XLVA 2OLCA 3LFSA 4FV8A 4EC9A 1Y6BA 4JX7A 5GHVA 4W4YA 2QOCA 3BU3A 3E64A 4IW0A 3VVHA 4MF1A 4BDBA 5JGAA 4C62A 5GIPE 3FXZA 4EHZA 3DBEA 4B9DA 2QKRA 5KMMA 2C68A 4UV0A 5CU6A 3O96A 4H3PA 1T45A 4ZK5A 3UMWA 4P7EA 3G90X 4AN9A 4F9BA 5E8YA 1P4FA 4GJ3A 4XV3A 2XARA 3UNJA 5AP5A 1KOBA 4F70A 4G6OA 3Q6UA 2DS1A 2DQ7X 4GUBA 4U8ZA 5CNNA 3T9TA 5M4CA 3CSVA 3KRXA 4K1BA 4ZLOA 2QOIA 3VS5A 4L7SA 4U79A 4ANLA 3HA8A 4RIXA 3UG2A 4BIDA 3BL9A 3E87A 4QMVA 5IDPA 1KE8A 1BL7A 4U45A 4DH7A 5HBJA 4FTUA 4AXFA 3P5JC 4O1OA 2E9VA 5CXZA 3F2RA 1BMKA 3FI3A 2CSNA 4FTNA 2C6EA 2GFCA 4ALVA 4UMUA 4OTGA 4BCIA 4C02A 1H1RA 3Q4TA 4FKIA 2E9PA 2I6LA 3JXWA 4FI1A 4DYMA 2QI8A 5FM2A 2G2IA 2LAVA 2YIXA 3O71A 1UNHA 4FIGA 3EJ1A 3V6RA 5ANKA 3VONA 4TWOA 2JITA 4WKQA 5M08A 1LP4A 3WBLA 4OW8A 4GH2A 2VTOA 2ZB1A 4DHIB 1ZYDA 3HZTA 1BYGA 3ORTA 3NCZA 4MXAA 3F82A 2O0UA 3MI9A 5HOAA 3FPQA 3VS2A 1G3NA 3FKOA 3TDWA 5ETAA 4C33A 4TYEA 3D7TA 5D9HA 3QWKA 2VTRA 5ANEA 1OMWA 1JKTA 4GYGA 2OIBA 3BV2A 4I0TA 4JR7A 4OBQA 5FTQA 1GZNA 1E9HA 3ZRKA 5ANJA 1ZYCA 4IZ5A 3UZPA 4CXAA 4FKGA 4FVQA 4Y46A 1FVVA 4F08A 3TNWA 1R1WA 2RFEA 2IF8A 3DKOA 4GT3A 4XBRA 5BVFA 3ORNA 5HORA 5K4IA 1G8JA 4O27B 4OBPA 3MW1A 2QHMA 3LFFA 3OS3A 3PFQA 2P4IA 1OIYA 2NP8A 1IAHA 4I6LA 3QA8A 2E9OA 2J51A 3PIXA 4ARKA 4AN3A 4KKEA 2BTSA 4FL3A 5DFPA 3FWQA 3QCSA 3QGYA 1Q99A 3C51A 2AYPA 5CF8A 3RPOA 4EHVA 5B7VA 3EQFA 2WMBA 5AP4A 2GCDA 2QOHA 3N51A 3RI1A 3LKMA 4JQEA 3ZLSA 1IA9A 4MBIA 4J52A 1H1QA 3F5GA 3CQWA 3QZHA 4EK3A 4GG5A 2W1FA 2WQMA 4X2GA 4ZSEA 2QVSE 4TYGA 4D28A 4ZMEA 1A06A 4LV5A 2FSLX 4CFVA 2XIYA 4GIHA 2O2UA 4M0YA 5FLFA 3QHRA 4M67A 4OAVB 2ZAZA 4QP3A 5HBEA 4XP3A 3EN5A 4FL1A 4JNWA 3ETAA 1FVTA 2F2UA 4JRVA 4QMLA 5A4LA 1Q61A 5AAGA 5AP6A 4M8TA 4X2NA 3FMKA 4BWKA 4MNEA 1ZYSA 2W1HA 4D2SA 1OB3A 4FZAB 4TNBA 4QYGA 5EQYA 1DAWA 2C6TA 4QQJA 4ENXA 3G15A 5F1ZA 2C6KA 3EQDA 4FV2A 3AOXA 1U54A 5IQFA 4C3FA 1YXTA 3V3VA 3MB6A 4IZYA 1S9JA 4U7ZA 4KWPA 5A46A 3BLAA 5C8NA 5CX9A 2XS0A 2PSQA 2JKOA 3D0EA 5D11A 4C59A 3AC2A 4F7LA 3ORPA 1V0BA 3E93A 4MD8E 4YHJA 1Q24A 5TF9A 3WF8A 4EONA 3NUUA 5HNGA 4XBUA 3U8WA 2XNBA 4KINA 1YI6A 3A7FA 2C3IB 2SRCA 4EOOA 3P7CA 4DHZA 5CI6A 4GEOA 3VBVA 3TDVA 4LQMA 2RGPA 4QP2A 4QYFA 1OPLA 4M69A 3DK3A 2XIXA 2C30A 5KX8A 4YJNA 4TWPA 3KU2A 5CALA 1FGIA 3BV3A 2WIPA 3F5PA 4PDPA 4XP0A 5HVKA 1KWPA 3R02A 4HYSA 4F1MA 2LGCA 4AW1A 2OBJA 2R9SA 1YI3A 2VAGA 3PA5A 4TNDA 3ZC6A 4JAJA 5EYKA 5A9UA 1B38A 3V5LA 1WBTA 4QTBA 5J87A 2BMCA 4KS7A 2IW8A 3FLNC 4KD1A 4LYNA 3C5UA 4A4OA 4WA9A 4NM7A 3S4QA 4IX4A 4RPVA 2VTQA 4C35A 4L00A 2OZAB 3EN4A 5LWMA 3HLLA 1J91A 2GHMA 3W2RA 2C6DA 4G3GA 2R3HA 1W7HA 4NTSA 4ZS0A 5F20A 3WARA 3ZEPA 5HX6A 4LM5A 2XYUA 4HCUA 2J0LA 5CVGA 5J79A 4S30A 2X0PA 1ZMWA 3D5WA 3QYZA 5C1QB 5DI1A 3R2YA 4BDJA 3KULA 5DOSA 3TTIA 1ZY4A 4WBOA 1WMKA 3D94A 1CDKA 3ODZX 3T3VA 2RL5A 4C2VA 5LCJA 5B2LA 3IG7A 3AMYA 4PWNA 3NVKI 3DAJA 5HIEA 3BWJA 1PXMA 2Z7QA 4ACGA 4EK6A 2FSMX 4QMUA 2XKCA 2X9FA 4FIEA 4RZWA 3RM7A 2OJGA 3ZZEA 4RIYB 3UTOA 4RWIA 4DCAA 3SGCA 1T46A 5D1JA 4XCUA 3TNQB 4DFYA 5BVNA 1A48A 3AT4A 3Q9ZA 3SC1A 4HYUA 4UYNA 4U41A 2CCHA 4I20A 2R3LA 4G6NA 4PNKA 3MGYA 5KMLA 3NUAA 3HA6A 4CFUA 4H58A 3V01A 2ITOA 5EQPA 2X7OA 3B8RA 1W82A 5DA3A 5IG1A 2Q0BA 4O7WA 3NYNA 4WNMA 3RTPA 3C1XA 3ZLYA 3TUCA 3DS6A 5AV4A 1BLXA 3RK5A 4UN0C 3OXTA 4BDIA 5IA2A 2UW5A 3FQEA 4E4NA 4PMSA 2FUMA 4QMSA 2W5AA 4IWOA 3AD6A 2CKQA 4W8DA 1PXKA 2PVJA 1P2AA 1OL7A 4PV0A 3D5UA 2Z7RA 3PXRA 2B9JA 4JI9A 1JQHA 1H01A 3OXIA 1QPEA 4MK0A 1Y8GA 3Q5ZA 4TTHB 4JQ8A 4DGOA 5ANDA 1SVHA 2BCJA 2GQSA 4FT5A 4IWPA 4QTCA 4DF3A 3FQSA 4GFGA 4X7QA 1SNXA 3RWQA 2XZSA 3LPBA 4DLIA 2R0IA 1PMVA 4NW6A 1I44A 4YBJA 3G2FA 3W32A 4YZBA 1LPUA 3R8UA 1HCKA 1QPCA 3CEKA 1H07A 2GMXA 2JAMA 3LXNA 3UO5A 4AQCA 4QQTA 5KMKA 4JJRA 4XRJA 5K0XA 3UDSA 4AGUA 2XCHA 3I4BA 5KKRC 5JZNA 1JVPP 2ZDUA 5CYIA 3A4PA 3BE9A 3D83A 3EN9A 2WTDA 4NUSA 3A8XA 4U81A 3RALA 4FV9A 2J4ZA 4FTJA 1L8TA 3Q60A 2OGVA 3LCSA 4F0GA 4DBXA 4PNIA 4N6ZA 4RIWA 4Q5HA 4QD6A 4F1TA 3UQCA 3WI6A 4YC3A 1JKLA 3SVVA 4CMUA 5K5NA 2V62A 1NVQA 3QWJA 3OEZA 2IZSA 2BPMA 4XG3A 4RRVA 3QTQA 1GZOA 3OWKA 1NVSA 1UKIA 5FXSA 5AM6A 5CEPA 1JOWB 2ITNA 4QNAA 3BE2A 4GS6A 2YIRA 3D7TB 3O50A 4TWCA 1YKRA 2R3GA 2AC5A 3FZSA 2JC6A 2ZV9A 4FVRA 4IJPA 4QT1A 3NUSA 3BRBA 3NIEA 4GK2A 3MS9A 5LVLA 4I93A 3FZRA 4QEBA 1H00A 3VJNA 3AD5A 3CJFA 3NAXA 4ANMA 2WHBA 2W17A 1U46A 3HMIA 4S32A 3ZXZA 2QO9A 4QYEA 4UMRA 3QQKA 3VHEA 5H3QA 4IEBA 2IPXA 4E73A 4YJVA 4DH5A 4EI4A 1XMMA 4U43A 1TQMA 4KKGA 3VS3A 4BWXA 2YJRA 4JG6A 3JUHA 3JVRA 2XKEA 4O0TA 2WQNA 4BC6A 3G33A 3JVSA 4DFUA 4BDKA 4XG4A 5HKMA 3QX2A 5JN2A 5M4FA 3RJCA 3NVMB 1W84A 3NGAA 4R5YA 2QD9A 3THBA 3L1SA 2RFDA 2BAKA 3FXXA 4ZSGA 4O4EA 3HMNA 5L8LA 1Z5MA 3ZSHA 3ZTXA 2PTKA 4G34A 3PY3A 4GL9A 3VS7A 3PLAE 4EUUA 2OKRA 4HVHA 3O2MA 1XH7A 3GXLA 3CIKA 5AFVA 4FSZA 3NNVA 2C5NA 4M13A 4RC2A 5IH5A 2QR7A 3MA6A 3TUBA 1WZYA 5E91A 1TKIA 4NEUA 5DYJA 1SVEA 2JKQA 1XR1A 2RKUA 3LAUA 4ID7A 4YLLA 3O8TA 5M4UA 2C69A 4HW7A 3AKKA 4BJJA 3WE4A 3KL8A 2B0QA 3RP9A 2W4KA 3R9OA 4FTMA 4BI0A 3R9HA 2BZKB 2F4JA 2XRUA 4O4FA 4HVIA 3VAPA 5ETFA 4Z7GA 4I6QA 4XH6A 2WMXA 4FTIA 4YC8A 5KUPA 2Z8CA 4D2RA 5D7AA 4EOMA 1OL1A 1U54B 4PPBA 2UZLA 4DGGA 4KKHA 3ZU7A 5IA4A 5AR8A 4YBKA 2CN5A 3OUKA 4WG4A 4O83A 2VO6A 5L6WL 5AR2A 3AC1A 3N4VA 3MFTA 3E7VA 3I0OA 3NW6A 2H9VA 3PSDA 2ZV2A 3QKKA 3W10A 2R3RA 3W2OA 3V8SA 3G6GA 1J1BA 3OD6X 3Q9WA 3V5PA 4GT5A 2A19B 3UO6A 2R3QA 3TNIA 2RF9A 5LOHA 4L68A 2PUUA 1DI8A 3BGZA 3TKIA 2IW9A 5DGZA 4ONAA 2OXYA 3ZO1A 4L7FA 3RAHA 5E1EA 4ZY5A 2EB3A 2IW6A 2O8YA 2VN9A 4FEVA 1Q8TA 3R0TA 2ZV7A 3GQLA 1M14A 3PZHA 1S9IA 2C3LA 1H24A 2VTNA 2GNGA 3N4TA 2J7TA 3OY3A 4OTRA 3NYOA 3B8QA 1JLUE 4PRJA 5EFQA 3WF5A 5HNIX 5L6PA 1E1VA 5I9XA 3E88A 4A9SA 4WOVA 3GOKA 3NUNA 3CGOA 2YWPA 3PXKA 2UZDA 3R7UA 3ZUTA 1YWVA 3IGGA 3L9LA 3ZSIA 4D55A 4FOCA 4V0GA 3FBVA 2ETRA 2E9NA 2JDRA 3BHVA 4KIOA 4YO6A 3VUGA 1SNUA 3SXFA 3ZLXA 4TRLA 1XH9A 2W9FB 5JSMA 4IWDA 2FVDA 2YAAA 5DLSA 3T8OA 2IVVA 2NYAA 5CWZA 2W96B 4XUFA 5FXRA 2ZDTA 2UZTA 3P5KA 5I9VA 4D1XA 1K9AA 5K5XA 4M97A 3EWHA 4AAYA 2F7XE 2FH9A 3U87A 4BYIA 4QTAA 5KMIA 1R39A 3HAMA 3IK3A 3CTHA 3F9NA 3R8ZA 3AMBA 2C6MA 4ZTNA 1WVXA 4K0YA 3MPTA 4R8QA 4AXCA 1FMKA 2BIYA 3CR0A 3R9NA 3PP0A 1APME 3RPYA 2EXCX 4MUQA 5LVNA 3OW4A 3OF0A 2HOGA 3DPKA 5CASA 3BQCA 3F66A 1NVRA 1O9UA 4HGEA 3TJDA 5M53A 5IA1A 2P0CA 1IASA 2XF0A 5AUWA 3IKAA 1V0PA 1H25A 1PKDA 1ZAOA 2YABA 3HL7A 3OCTA 3BEGA 4CTCA 4O7LA 3R7YA 3ZFXA 3BBTB 4QMPA 5TO8A 4BTMA 4EOPA 4QMZA 4BDAA 2R7BA 4R1YA 2XYNA 5HCZA 4U42A 1BKXA 4DEEA 3MSSA 1PMUA 2YIWA 2BFXA 5FD2A 4ORKA 4RSSA 4QMTA 3BYOA 3B2WA 3MVLA 2R3NA 1ERKA 4QP9A 4PX6A 1UNLA 5CY3A 2GDOA 2XIZA 3FMLA 3R22A 4C4FA 3R8PA 4MBJA 3GFWA 4OTFA 2QOQA 3LMHA 1CKPA 1KE7A 1XKKA 1JKSA 4MEDA 4U80A 5DT3A 3W8QA 4F64A 3R71A 3UYTA 1WBOA 3TYKA 4RJ3A 4APCA 4ERKA 3QCQA 2J5EA 1PKGA 2V0DA 2WQOA 3EZRA 3HX4A 4L46A 1G5SA 4DH1A 4E8AA 5BUJA 3D4QA 2V22A 4EJNA 2HXLA 3ZOSA 4BWPA 3CD8A 4YC6A 5HO7A 2X8DA 3FXWA 3LW0A 5M57A 3R2BA 1TQPA 1PXJA 1IEPA 4NW5A 3TUDA 5KO1A 4JDKA 1SYKA 4G9RA 3Q4CA 3R8LA 5CT7A 2F7ZE 4ALUA 5JH6A 3FMJA 4U0IA 3KF4A 1ZZ2A 4HCTA 2ERZE 3EQCA 1SZMA 4BDCA 4FTOA 4G31A 3DXPA 2UVYA 2J90A 5I4NA 1OBGA 4O7YA 5AV1A 3DBDA 5BVKA 4MD9E 3W33A 4BGGA 5IH4A 3S95A 4FJVA 3VN9A 2E9UA 4TYHA 5FDXA 2IVUA 3HDMA 3MY0A 4IBMA 4F65A 4QO9A 5M56A 2GNHA 4U6RA 4O7TA 1OUYA 4IB3A 4FICA 3VUDA 3KMWA 1ZXEA 3Q3BA 4FSQA 3RPVA 2OFVA 2AEGA 2CN8A 4USEA 3DU8A 1YVJA 2OG8A 3EQBA 3QD0A 2QONA 2X9EA 4AFJA 5IMXA 4KBAA 2VNWA 4M84A 3Q6WA 3TZ9A 1X8BA 2BRBA 3VBXA 3SG8A 3NW7A 2WTWA 3AGLA 3F6XA 4W4WA 4IX6A 2CGXA 3PFYA 1CMKE 2W4OA 3GENA 2UUEA 4KRDA 4NIFA 5AR7A 5IA3A 2A2AA 5E8XA 2IZTA 4A4XA 4MXXA 5HU3A 2BALA 3C13A 2WNTA 3WF7A 4DEGA 4X3FA 3TIZA 4C37A 1R0PA 3OWPA 3IECA 4NU1A 3MPAA 2H6DA 4IMYA 3EYGA 3JR1A 1XHAA 2IVTA 2NRUA 3KMMA 4M15A 1Y8YA 4RT7A 3RAWA 3ZBXA 4L67A 2YM4A 3BQRA 2YDKA 4NK9A 4HYIA 4P2KA 2XJ2A 5L8KA 2OIDA 4A9RA 3TTJA 4RMZA 3C4WA 3TKUA 4FV4A 4FNXA 4JX3A 4JRNA 5AEPA 5E8TA 2PE0A 3HUCA 3CQUA 5ACBC 4ZTRA 5F94A 2OZOA 3IOPA 2BIKB 3BHYA 3A7IA 3GFEA 5CS6A 4KA3A 2QLUA 4DTAA 1B39A 3FMNA 1W2FA 1YDTE 4CRLA 4HGSA 1IRKA 1TVOA 2WOTA 4ITIA 4ANQA 1VZOA 2RFNA 3LFAA 4I6FA 4B6LA 1Q4LA 5IEXA 2C5XA 3GU5A 3ID6C 1O6KA 2OO8X 3GQIA 3NLBA 2XANA 2VWWA 3RHXA 3LVPA 3UOKA 1BL6A 1DI9A 2KULA 3DAKA 2XNPA 2O65A 4YJPA 5IA0A 2HAKA 2J0JA 3GCQA 1UU8A 4TWNA 5CEIA 1Q8WA 3FZ1A 3KIOC 5K4JA 5TR6A 5KCVA 4X3FC 5KHXA 3ZM9A 3DB6A 5AV3A 3CY2A 4XG8A 4DEHA 3C0IA 3DTCA 4RFYA 4IAFA 4K6ZA 3IW5A 4FE2A 3TMOA 5CAUA 4IJ9A 3F2AA 4ENYA 2W7XA 4NM0A 4PP9A 3TT0A 5C8KA 5HI2A 2XBJA 2UZWE 4C38A 4BJJB 1GZKA 2PK9A 2WEVA 4I94A 5LVMA 3COKA 4J97A 2YM8A 4QYYA 5EM8A 3WIKA 3SV0A 3G51A 4AP7A 4NKAA 5K0KA 3UP7A 3R6XA 2V5QA 3EL7A 4EC8A 3BBWA 2R7IA 5IF1A 4FEQA 3DDPA 5LMAA 5J9LA 4FZ6A 2VWIA 3QRIA 2X4ZA 4YZ9A 4I1ZA 1ZZLA 3RPSA 3V8TA 4WNKA 1VR2A 4WSYA 3HRCA 4HPTE 2QC6A 3UC3A 4YNOA 1KE9A 4GKHA 3KRRA 3TNPC 4A06A 3KCKA 5CQUA 4Z55A 5GZ8A 5J95A 4MTAA 3GCVA 3UNZA 4BI1A 4I5PA 4IB5A 5E8WA 4E4LA 1U59A 3EZVA 4F99A 3NPCA 5EW8A 4AX8A 4EQCA 3R63A 1J7UA 2HK5A 2GQGA 2QOKA 3KRJA 4FSRA 5GJGA 4DH8A 1W2DA 2ONLC 3DKGA 5AR5A 5EKNA 5IQBA 2ACXA 1XH8A 1O6YA 1MQ4A 2YAKA 4E1ZA 3CXWA 4EBVA 3M1SA 4MBLA 2Y4IC 1H26A 2CLXA 5HESA 1W8CA 3PDTA 2X81A 2QU5A 2WTVA 1GIHA 3FYJX 5I9WA 2XNGA 3V04A 4CYJA 3EQHA 5FUTA 3QTZA 4FSTA 4I21A 2BZIB 3PWDA 4CFFA 1STCE 3QRUA 3ENMA 3QXPA 4AW5A 3KREA 4V0GB 5CEKA 4ASDA 3A7GA 1MRUA 4L42A 2OICA 3EFKA 3PP1A 4B8MA 5ITAA 4EZ7A 1JSUA 5L2QA 2PULA 4QMOA 4JG7A 3E3PA 4QOXA 1P5EA 3G9NA 4EHGA 2IG7A 1XBAA 2GTNA 4R7HA 4CKIA 4O86A 2C5YA 3DKFA 2JIVA 3R8MA 4L52A 4EH5A 4B8LA 3QFVA 4H3QA 3DNDA 4C8BA 3U6HA 1YOLA 5BYZA 2BRNA 3LM0A 4E4MA 1NY3A 3QXOA 4F9WA 2GU8A 2JFLA 3UJGA 3QALE 3R00A 3V5QA 3W1FA 3PIZA 4MWHA 4RZVA 3PVGA 3LXPA 5DH3A 5HCXA 5CU3A 2GQRA 1VLRA 1YDRE 2ITQA 4J98A 4UWCA 3OROA 5A6NA 4ZSJA 3OTUA 1TQIA 3PLSA 4O7SA 3F61A 4QQ5A 4RGJA 1FGKA 4AZSA 4D4VA 1OBDA 1CTPE 2IO6A 3BYSA 2WO6A 2J6MA 3W0SA 2DUVA 4K18A 3VW8A 1R78A 4I3ZA 2PZIA 4BY9E 4L6QA 4JXFA 1FVRA 2UZUE 3DAEA 4IX3A 4FYNA 3DCVA 3DDQA 2W06A 3GU6A 4BKZA 3QUPA 5JFXA 4DGNA 2HENA 1REJA 4TKSA 5EYMA 3FLQA 3ZS5A 2R3PA 1DM2A 3LQ8A 3QKMA 3DLSA 3VC4A 3F5XA 2HXQA 4TXCA 3H0ZA 4G16A 4AGCA 4FKJA 3QRTA 2GHLA 4IFCA 4F9YA 4FEXA 2YISA 3RAIA 4FNYA 4ZEGA 3IW4A 3M11A 1OGYA 4BCFA 1OGUA 4PY1A 3HEGA 4QTEA 3O0GA 3ATTA 4BGHA 2OH0E 1GIIA 3HV4A 3NEWA 3L8SA 4LRJA 2VD5A 4B0GA 2YIYA 4F09A 4AZWA 3IW8A 4AXEA 4RX8A 1JBPE 5LQFA 3VUMA 3NIZA 3DTWA 4IM0A 5F4NA 4BICA 4BCNA 5AX3A 1YWRA 3ORIA 4ZZNA 4O0YA 4P90A 2ZB0A 3BX5A 3P7AA 4FVPA 4R3CA 3SAYA 5LCKA 2OWBA 5CU4A 2RSVA 4DG3E 4LUEA 1OVEA 3QYWA 1JKKA 4L3LA 5CEOA 4M68A 3H4JA 5LVOA 2R3MA 3OBJA 5I5ZA 3AXWA 4W4VA 5EDRA 3PPJA 4FTLA 3II5A 4Y85A 2BDJA 2W99B 3GU8A 3HP5A 3HUBA 3UE4A 4TYHB 1M2RA 5E92A 5CLPA 3TZMA 4PTCA 3QD4A 1OKZA 4AU8A 2WMUA 2BDWA 3AGMA 2BAQA 5CF4A 2QNJA 2Y6MA 3O7LB 3OT8A 4YHTA 4F6WA 1PHKA 3C4ZA 3KQ7A 5BVEA 4I4EA 3C7QA 1JPAA 4XS2A 1TZDA 3UQGA 3W0OA 4IX5A 2QQ7A 2ZOQA 1ZLTA 3MVHA 4G3DA 3DGKA 1LEWA 4GUEA 2YLFA 2WIHA 2HCKA 2BRGA 2X6DA 3VS6A 5BV3A 1GJOA 2R0UA 3ZM4A 2JKKA 4EH4A 4KIPA 4ZLZA 5ANIA 4ZTMA 2UVXA 1OIRA 3LOKA 2B9IA 3C50A 4FTKA 2XBAA 1OPJA 3CGFA 1MRYA 2XUUA 2VUWA 3Q32A 4FMQA 4HGLA 5LARA 3HMMA 3HMOA 1PRYA 4CG8A 2EUFB 2PMOX 2A1AB 3QTIA 2VTMA 3TI1A 3KCFA 3LFNA 2B54A 3NCGA 2X2MA 1FQ1B 5IEVA 5AUUA 3DBFA 5LXMA 3FMHA 5ETIA 5M44A 2W1IA 3PE1A 4BN1A 3DZOA 4UX9A 3ML1A 2VGOA 4FIIA 3ZC5A 4CNHA 5L4QA 1XJDA 2VO3A 2Y6OA 3VS4A 3O23A 2I0VA 3R30A 3OOMA 3BELA 5CNOA 3ZO4A 1HCLA 2YCRA 3EN6A 3FY2A 4QMYA 3VF8A 4BGQA 4LFIA 3PY1A 3SRVA 4AE6A 4FTCA 4RC4A 3K54A 4O2PA 5LMBA 4Y95A 2PMIA 4EH3A 2XEZA 3OEFX 3F3WA 4NT4A 5E8ZA 3U9NA 4PF4A 3PJ1A 5F9EA 3UOJA 5IUGA 3PYYA 4ACDA 3NWWA 3CC6A 4ANSA 5B0XA 2V7AA 5HG5A 4O0RA 5A3XA 3FL5A 3PPKA 3BHTA 5TT7A 3UIXA 5AA8A 3GC8A 2BHHA 4X3JA 2PMNX 3GT8A 3IDCA 4FTRA 4J8NA 4NSTA 3NZ0A 4WHZA 2NRYA 5EOLA 5A4QA 5JFVA 4UWYA 5A6OA 3FLZA 1UWHA 3NSZA 5H9BA 2UZVA 5EI8A 1G8AA 5HGIA 3LFDA 4JDJA 4CKJA 2QR8A 5HEZA 4FG7A 3LCKA 1YOMA 2JDTA 5HLNA 4I0RA 3LCDA 1M7NA 2C3KA 2VWVA 4TZRA 4CV9A 3FI8A 4C2WA 4R6VA 4BVUA 3NRMA 1YXXA 5AP7A 4OGRA 4YZNA 3EKKA 2B7AA 2VX1A 5FBNC 3QCXA 2FYSA 3I7BA 4XOZA 4D9UA 3UOLA 5HLWA 4D4YA <