4K35A

The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
719
structure length
719
Chain Sequence
DDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEAPLLTYAYAHHLTSIDDSNVKRTDMTLQSATKGPMTALVGNEWTLRETELSPVEWLPLQAAPNPTTINEIMTEINKDIASNYTQETAKEDNYFSGKGLQKFAMLALILNKSDQTQLRNPELAQIALDKLKAAFLPYLQNEQADPFRYDTLYKGIVAKAGLPTSMGGTDDLSAEFGHSYYSDHHYHQGYFVVTAAIIHHLDPTWNADRLKAWTEALIRDVNNANDGDEYFAAFRNWDWFAGHSWAGGIKPDGALDGRDQESVPESVNFYWGAKLWGLATGNTPLTKLASLQLAVTKRTTYEYFWMLDGNKNRPENIVRNKVIGIYFEQKTDYTTYFGRFLEYIHGIQQLPMTPELMEYIRTPEFVSQEWDEKLGAIAPTVQSPWAGVLYLNYAIINPAEAYPALRKVQMDDGQTRSYSLYLTATRPHFFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords glycoside hydrolase family 81 endo-beta-1,3-glucanase
publication title The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
pubmed doi rcsb
source organism Rhizomucor miehei
molecule tags Hydrolase
total genus 246
structure length 719
sequence length 719
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain
A PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1170 Mainly Alpha Orthogonal Bundle Helix Hairpins glycoside hydrolase family 81 endo-[beta] glucanase 4k35A03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4k35A04
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 4k35A02
2WMMA 1OVRA 1U7JA 2LXBA 2LXCB 2QRXA 3BVWA 2B87B 3RGUA 1LT1A 1HXKA 1BDCA 1H0TB 2F18A 2UWJE 2P58A 3CV5A 5CBNA 3EJRA 1EDKA 2FYVA 2JWDA 4GOFA 3PH0A 1R33A 3FXDA 1OVUA 1EDIA 3LVTA 4CPGA 2KUBA 1NVOA 4EYYQ 3BUDA 3BVUA 4BXLA 1TQUA 1DEEG 2F7PA 3CZNA 3ZDMA 1TQTA 4HJGH 2F1BA 5K5GB 3BVVA 1TQVA 3D4ZA 2OW6A 4ASWA 1EDLA 2B89A 4HKZH 4NPDA 3DX1A 3CZSA 3EJPA 3MZWB 2HR3A 4KJMA 3BUIA 2I8DA 1LP1B 4NPFX 1HWWA 3MHVA 2M5AB 3FXEA 3D51A 2KZJA 4ZMDA 1TQWA 5CBOA 1MFTA 2LR2A 2M0BA 3EJTA 4GOEA 3BVXA 1EDJA 1U7MA 4ASVA 2RKLA 1O7DD 3BUBA 4NPEA 5C39A 3BUPA 4IOIH 3D50A 2OW7A 4HB1A 1EC5A 1X0TA 2B87A 4JBZA 1QX1A 4WWIA 1QWUA 1H0TA 2QVAA 3DDGA 2B88A 4K3AA 3D4YA 3EJQA 2SPZA 2ZAEB 3EJSA 2F7RA 3D52A 1R34A 2WYHA 1BDDA 1FC2C 1Q2NA 3BVTA 5DJUB 2WYIA 3DX4A 4ZNCA 1TQSA 4GODA 2F1AA 3EJUA 3DX0A 1QWNA 5DJTB 2KI7B 2K3RA 2ALWA 2Q1KA 2R44A 5EFWB 3QWOC 1JMBA 2KIKA 1HTYA 1ZW0A 4MN4C 3BUQA 2KZIA 1ZXGA 2F7QA 1PS3A 3S1KA 1LP1A 1Y47A 3BLBA 1SS1A 2M5AA 3DX2A 3DDFA 1OVVA 1S3JA 5KBPA 3DX3A 1JM0A 2F7OA 4K35A 2OTKE 2KS1B
chains in the Genus database with same CATH superfamily
5JVDA 1PKXA 3OGIB 1LWUB 2YI9A 1JCCA 1NTMJ 2O57A 5B66H 3AMOB 3B09A 1DK1A 3ALAA 2FYUH 5LMUB 3D70A 5BZBA 1L0LD 1QAFA 4FZ0A 1EZVG 2WT7A 5CJ4A 2WLMA 2WLIB 1KQFB 3UT5A 2IW5A 1Z45A 1NOHA 1K92A 5D5QA 3J80N 4W7ZA 1ZV8A 1M1JB 4I7ZC 1JYXA 4EV5A 3OAAG 3MI6A 3VQYA 2LKMA 3P8CD 4LF7O 3Q5RA 2PP6A 2DYSC 1RF1B 2EIMB 2ZD9A 2C0WA 1ZX3A 2P2UA 3ABLC 1DF5A 1MUUA 1ZR2A 3SJBC 3BRTB 2JEEA 3DYOA 4D7SA 1LXMA 3LIDA 1EKMA 5J9PC 1S1CX 2W83C 4C7NA 3K5LA 4HNAB 4JV5O 2J5UA 3BCCJ 2CGNA 4MTFA 4DR3B 3L75H 3W68A 1ENVA 3FD9A 1AJQA 1NTKJ 3V2RA 2IZ1A 4N23A 1SQBJ 4H0LB 2M8RA 4ZKIA 2GTSA 5AVRB 4KT0J 1KILC 4JI2B 4PA3A 3E89A 1R8EA 2YIAA 2XU6A 4LF5B 3FWLA 1O7DD 5BMVA 1I94B 2ZIMA 4RJTA 1VQ5V 1FDMA 1SP4A 1BHAA 3CZJA 4P9OA 1BCCG 3AG1B 3L72J 3ZRVA 1BQZA 2EBOA 1KQSU 3ITKA 4EV2A 1N7LA 2YKPA 1Q82Q 1QWUA 2QVAA 4EB6B 4BZHA 5CCHA 2KSEA 2FKWB 2R5BA 3EJQA 1O9GA 2X7RB 3A3YB 1HWTC 2YIBD 2JGDA 2N04A 1HN1A 2YXYA 1LR1A 3SPIA 4GX2A 1OW8A 1YZBA 3N2KB 3DX4A 3T0UA 3A0RA 1D6YA 2EINB 3JSNA 1L4AB 1HGZA 1PGJA 5HFLA 1K05A 1X1IA 2ZE7A 3L73D 1R6KA 2O01H 3WG7B 4TQDA 1S4XA 3BGAA 2GUSA 4NTWA 2E24A 1S5LE 2YO2A 4AHCA 3CCJV 3CCMV 2P4KA 3ACSA 1HTYA 1MMZA 1LTAC 1JZ3A 2VRSA 1SQVD 1AFOA 3SDLA 3C3TA 3OB8A 1K1WA 2WW0A 2QWPB 3OEHG 1E79H 1YIJP 1QALA 2RNBA 2HVKC 4DK1A 1AVKA 1WMNA 3U1AA 5KBPA 2Y69C 3QTCA 2OOVC 3KZIE 3ZS8C 5EIBD 3PRJA 1BE3D 5KAFE 1G1XB 3HKCA 1NTME 1OVRA 2DJVA 5EK0A 3I3EA 4IIJB 3B77A 1KQSO 5B1BB 1N7SD 3NR7A 3HIIA 4GT1A 2UXDO 3SX1A 4BZGA 2EACA 3ZRWA 1K5QA 1M5IA 2ZFCA 4XE5B 2HG5C 5C8YA 2D2CC 4RUFA 1NVOA 3CL3D 2ZJSE 4FFKA 2OQQA 1X1JA 3L71D 1BGYJ 1NH4A 1H54A 1BCCE 2BCCJ 3CJHA 5AW8B 1ZAUA 3BAAA 1SFCD 1SQPD 3O9OA 5K5GB 1LOHA 1CEZA 5AVUB 3SEPA 5JMDA 4DR7B 1ZMEC 2E76C 2NNUA 2KXPB 2LGQA 2W27A 1URFA 3H32B 1N34B 2OIEA 4ZHQA 2B89A 2Q73A 3I5CA 2E42A 3TGUD 3OUFA 1R3LC 2AXTZ 3CZSA 3DSQA 1S5HC 3L74D 2BSKA 1NTKE 3A0OA 2JDIG 4GX5A 4GX1A 1SQBE 1FZGA 1OCCC 1W3YA 1PGOA 3JC22 3JARB 4O4JB 4B7EA 1TQWA 3CSXA 3WU2Z 1BT8A 4LF6O 4CH6A 3V4WA 4D6TJ 1YJWP 1LT9C 3N27A 1WMOA 3BVXA 2ZXWB 2KNCB 4L75A 3Q1MA 3M99B 1FZBA 1NU1G 1JMKC 1TUBA 4NXNB 2CG1A 3VD7A 1HM2A 2PI5A 1LTTC 3HUSB 4OX9O 1JYVA 1EBOA 4ZI7A 3I55V 3LSSA 2KLVA 1FJPA 1FJKA 2X0LA 3L72E 4YY3O 1MV8A 5KKZB 3I56V 3LSUA 1M57D 2IDBA 2OW7A 3RK3B 2CTRA 4FK5C 1AI7A 3NXSA 4LF9O 1P4RA 4X1YA 1IDSA 2HODB 4K3AA 3VOPA 1VIBA 2AGAA 3SFDC 4FMTA 1P84I 3AK1A 3F5HA 2XV5A 5AVWB 2KG7B 5CMUA 2R9IA 1NR1A 3FGAD 1GO3F 3K5BA 3STLC 4XBFA 1QL2A 5B5EH 1QNMA 3H1HD 2ZVNB 1V54B 4ZNCA 2FB5A 2F1AA 4IHJB 1IC2A 3EJUA 5LMNO 1R6TA 2H3OA 4LH7A 1KILA 1OJOA 1J1DB 2BEQD 5EC2C 2ZINA 1JOVA 3L73H 3BASA 2IJJA 4RO2A 3G6BA 3PJSK 3NJXA 3O6QB 2AHZA 1JMBA 4MVRA 4X1KA 1XDCA 2W6BA 1OZHA 1SQVH 3GWOA 5L3EA 2N1TB 3ZMZA 4IL6E 2WVYA 1W4NA 2RN9A 5B3SB 1XMOO 1JX9A 3AEFC 3VP8A 2R9RB 3QO5A 1Z5VA 2A45G 4H13C 1VQ9P 2NPSC 3RYCA 3THOA 4DR4O 1NT2B 1L0NG 5CA3A 1R3JC 1BE3H 3ASNC 4TUYA 1OXZA 3RGBA 4PA7A 2RDCA 2FYZA 3HR0A 2K88A 3NMDA 3NBBA 3L75J 4FFBB 4WFGA 2YKOA 4JAAA 5CBNA 1LTJB 3VYIA 4FNTA 3H1IG 3K04A 3ECQA 2ZE8A 3RFRA 5JCOC 1JYNA 4OH8B 5FNVB 1RKYA 2IFMA 3P3NA 1X9VA 3RK2C 2OYIC 2HVJC 5E79Z 2XNDG 5KLVH 2HHHO 4FM0A 4X62O 3IAPA 1WMPA 3QO7A 3SSUA 4AI8A 5IYDO 1P84E 2OW6A 1G4YB 2R9AA 2OOVA 4O2BA 3CWBH 4OK2A 3TGUH 1OCOC 1XOUA 1OW6A 3AEAC 3L74H 1N36O 1AR5A 4DR6O 2WO0A 2Y4TA 5CCGC 1FFTB 1NSMA 1AV1A 4JI0B 4MTGA 3FB8C 4JASA 2UXDB 1P84F 3N2GA 1G1IA 3AE4C 3ABKC 1WP7A 3W67A 3A24A 1KORA 1RWHA 1OIPA 1K97A 1GN4A 2QIWA 1JFFA 3AK3A 3B2EE 1PP9G 2CTPA 1Y74A 3CC7V 4PDLA 2W6JH 2EIKC 3BUPA 2BT3A 2X03A 3RN4A 2MK3A 3R2PA 2A7WA 5IJ0B 2PGGA 3VQWA 1PPJH 3I5DA 3IFXA 2ZT9D 3KN4A 5LHGA 1THZA 5H5NA 4I50A 3K0GA 4KHXA 2C10A 1YHQP 1N86A 4GKKO 1L0NE 3EJSA 3MDSA 3SYAA 4WCEV 2F7RA 2JKVA 3KG2A 3K57A 1VQ7V 1YJNV 4BR6A 3KIIA 1SS3A 1ZRTD 1LT9A 2YS8A 3DX0A 2Z5HA 4QGPA 4FNVA 1VQ6P 2FYUE 1PNKA 1RWAA 1PV0A 3WIRA 3C3SA 3S4DA 3B8MA 4PDMA 3LW5H 1V55B 1Q8IA 2ZE6A 1FE6A 2UUCO 1JOYA 1RP3B 4W7YA 1ZTEA 1S5LX 3BCCD 4YY3B 1QR9A 4DRXB 1NTZD 2WVRA 1WPXA 4OGQD 2NZ2A 3USSA 2W0FC 2GUZA 2J58A 2WLJA 4J80A 2UUAB 3C8VA 2Q9IA 1E79G 4CC6A 3CCUV 1MSWD 1SS1A 5TISH 1Z56A 2WSSH 3FAVA 3DDFA 1OVVA 3CX5E 2C11A 4UB8H 3N9HA 4JYCA 1RSOB 1URQC 4L74A 1VQNP 2KS1B 3EJRA 3HIGA 1JPXA 5APSA 2E3CA 1TAEA 2YXRB 1T3JA 1VDFA 2Y0CA 3JSVC 1GTOA 4WFBV 1IQXA 4JAUA 3JAKA 4LWSA 1Y67A 3Q4HB 1EDIA 2QR4A 3E8HA 2LJ2A 3D3QA 4UVCA 4X88A 1AVMA 3E8GA 1LTIC 1SQQG 1L0LG 1GTWA 2BEZF 2RMKB 1VF5C 3GB7C 3OFNG 4UCUA 4DV3O 2PUSA 1DYUA 2QJPC 2XDJA 1N7SB 3GW6A 1T2KC 4JI8O 2AXCA 2I1KA 5AW0B 1LGHB 4ZKPA 5CJ0A 4NVPA 1TU3F 2QE7H 1RH5B 2NPSA 5EBMC 3HD7B 1HWYA 1ROPA 3JASB 4GIFA 3K59A 4LFAO 2QGNA 3BUIA 2OQEC 4O9BA 1HWWA 5APYA 3T4ZA 3JSLA 1ZWIC 4JZ2A 2PRRA 1W5CE 2RDYA 3DC5A 1SFCB 4YJ3A 5LYJB 2AEJA 3Q5SA 1MZEA 2LR2A 3G6EP 4I55A 5JCOA 1IX9A 4J41A 4DUZO 3X3ZA 3G9RA 2WSCH 4JGSA 2A06G 5A1AA 2OYIA 1KV4A 2FMLA 4ZIBA 1PU4A 1MMUA 2HHHB 4NPEA 2CFGA 3CRAA 4YXWH 3OA7A 3ETQA 2BOBC 1SLQA 5CBGA 1H38A 1PL5A 3AG3C 1GU5A 4DUVA 1PL4A 5KMGB 4DV2B 2DQ0A 3OMIB 2CPSA 2RMZA 2WZSA 1QVFU 4B3TO 1FXKC 4KFMA 4JF7A 2GM4A 1PX4A 1HM3A 3DXRA 2CWTA 5CCGA 1LTGC 3QDEA 5APTA 1M57B 5IT9N 2VWKA 1BE3J 4WY4C 1BGYD 2ZM6B 2YEVB 2BCCD 1XHXA 1COWG 4YHHB 1AR4A 4J7ZA 4Z1MG 1XUQA 5AW1B 4H33A 1GL2B 3TETA 1L0LE 3L73G 3HE5A 3CEIA 2N74A 4F6EA 1SQXD 4HZ3A 4Z1VA 2PY5A 1LNQA 3P8CE 3BCCH 2DWEC 4XA4A 1NS0A 3AG4B 2K1AA 5KLVJ 1NTZH 1WN7A 1EM1A 3H25A 4U7JA 2H94A 1D5AA 2ZYDA 1XILA 2ZNJA 4J9YB 4EKWA 4D6TD 3MHHC 2E75D 3MD0A 3DX3A 1GMJA 4IL6X 2LW1A 1JY2N 2JIZG 1J2JB 3AEEC 1JTHA 4JI5O 4WWIA 1TVKB 3T97A 3CWBJ 1M93A 1Q43A 4MMIA 1NR7A 2ITDC 2AEFA 2Y4UA 1W6GA 2Y0EA 4AQ0A 4JI4O 4GOFA 1QR8A 4GKGA 1Q86W 4BRYB 3TCUA 4PV1D 1QVFO 2B1GA 4C7UA 1YSCA 4Y99C 1XNRB 1K34A 1VQ5P 4UCRA 1H89A 4R8CA 3L70J 4UB6H 3F7YC 3L71G 3FYEB 4PD4D 1N0JA 3WFAA 3ASOC 1T8ZA 1LWUC 1YHQV 1SQPG 2Q3IA 4I6MC 2QJYC 1JY3P 3S4CA 1AI5A 5GTHH 2Q6QA 1N32B 5JJEB 3OE7G 3K5NA 3VDAA 1HGVA 3LDCA 3MAQA 1URQA 4X8AA 4TV9B 4X66O 3MZWB 2WPRA 1RWFA 2IM9A 3A0HH 5J2TB 1VQ6V 3FXEA 4JTAB 1M1JC 3EJTA 3ABMB 3EFFK 4NR1A 3CC4V 3T1YB 4K0KB 4P9PA 3VP9A 2EIMC 1RF1C 3AE7C 3L73E 3V2NA 4NXMO 3LUTB 5IY5C 5KAIE 2JK5C 3GVMA 3BATA 4L87A 4DV3B 4DJGA 3LW5J 1DGSA 2ZIOA 5CCHC 1SQVE 2H88C 4DV0O 1DIPA 4JI8B 1TA8A 4PA4A 3L75D 1R3KC 3RL0g 3DDGA 1S5LZ 2CTWA 1W2EA 4H0LC 2JS5A 4EEQA 2BRPA 2D73A 4DV7O 1GM9A 4AQYO 2P22C 2QJKB 2OQEA 1B04A 2W6IG 5BR8B 1BE3E 1KB9D 1SKVA 1ZP0C 4ABMA 3E7JA 4PHZA 1WLEA 1BGYH 2Q68A 1ZL8B 3H1HG 2BCCH 5GTIH 3BVOA 2ZT9B 3AG1C 4BW5A 2AEMA 5KAFZ 4YJ2A 1JMMA 1S77D 2ALWA 2Q0AA 1IVWA 2OT5A 3UM7A 4P2ZA 5BVZA 1TU5A 1SQXH 1MMYA 4NEIA 5KLVE 2PTMA 2KZIA 5IWAO 3L71E 4DV6O 5APUA 5IYZA 4EFBA 2XZRA 2XAHA 1YTFD 3KCYA 1E5WA 1SQPE 3T0DA 3DX2A 3TF5A 2M5AA 2YC0A 3S4AA 3T2MA 4GYCB 1GZLA 3KKYA 2EINC 5CBFA 1L4AC 3HPLC 1H8EG 1FXKA 3H1KH 1OCRB 3TGUE 3S3XA 1NH2D 2K37A 3L74E 2OYHB 4QIWF 3WG7C 5IJ9A 3EQ2A 1AROP 5CB4A 2Q3EA 4WY4A 1LT1A 2CH7B 1L0NK 4OGQB 1JZ5A 1X8YA 4IFFA 4FIPC 4C7RA 2WOHA 4CH3A 3CD6P 2EIJB 2WPVB 1F23A 4R50A 2JWDA 2FUTA 3ETGA 3TDKA 1Q6HA 4TQFA 5J2UB 1T6AA 1R33A 1JZ6A 2LO1A 4ZOLB 4DCKA 1SESA 2FXOA 4BXLA 1DEEG 2FYUK 3O65A 1JY2P 2WSCJ 1X1HA 4JI1B 4H44D 1HR0O 2XAQA 3OD4A 5A2QN 1KSIA 5KX5B 2OYQA 4PD4H 2YMYA 2YXQB 3K08A 5GONB 4R7CA 2VQFB 4HAMA 3PGBA 1HNXO 1IO4A 3SPCA 5B1BC 4ASWA 4JI3B 3WB1A 2BTQA 1US1A 2FYNB 4NPDA 3X42A 4JI5B 2QWQB 3JD4A 1EXIA 3HKEA 5CA0A 1FJGO 3H1HE 4KHPO 1J1EB 3HE4A 2ZYGA 3OTOB 2NLJC 4JI4B 2GV9A 4EFEA 2IBZD 2GA1A 1JY3O 3R65A 4FNRA 1IBMB 3OEEG 2D2CD 1K9MW 1YEWA 4UVBA 4UCOA 2XHBA 2E74B 2HTAA 5EBLC 2IPPA 4LNUA 1NAFA 4BZEA 3E83A 2AXTH 3CPWU 1D5NA 3CYOA 1FU1A 1LWUA 3CXHH 1X0TA 2Z5UA 2E76D 2MJZA 4FNPA 4DV4O 1NTMG 1NTZJ 1PZQA 1XL6A 3FKSG 3U11A 5TISE 3AMOA 1I5YA 2WW1A 4UB8E 3U10A 3STZC 1Z2GA 2P7TC 2ZXWC 1DTOA 1IURA 1KQLA 3CMEV 4OXSA 1MSDA 2WLIA 5AVYB 1MNGA 3BVTA 3AE8C 1KB9H 1A32A 2YIDA 4IL6Z 1M1JA 4RKUJ 4DV1O 3HTKA 2Q67A 1JCDA 3EHBB 1RF1A 1FZCB 4DR5B 3RK3C 3ZEDA 2JO1A 4BTYA 2IFNA 1NJIQ 4IYHA 4MVQA 4NXMB 2UUBO 4JTDB 2ZXXA 4U3FH 3CRMA 4HNAA 2LGWA 3NFQA 2JEXA 1KZUB 1VQMP 3ZBHA 1F4MA 2YIUC 4DV0B 3D71A 1NTKG 1N73B 3E2EA 5KA5A 1V54C 1IK7A 1SQBG 4K8XA 4LF8O 5APQA 3H1LH 1YF2A 3JAMN 1J1DC 3VMYA 4AQYB 1VQOP 1C82A 3B5NB 1EGUA 1EZJA 4ICGA 2YMKA 3T2QA 1VQ4P 3QG5A 3SYPA 3CPWO 1RW9A 1UI8A 1NGMB 4XDKA 4DUXA 1RFYA 1AVOA 1S9KD 3CRCA 5L8RJ 2JKPA 4TWKA 3H9VA 1TXKA 1HP8A 5AVTB 3MWXA 2E75B 4AILC 2QJ1A 2WSFH 5KUKA 2WZ7A 3L72G 5KHIA 2N1TC 3NJVA 3AG2B 1KU9A 2K9JB 2OCHA 5JH7B 1HVVA 4DOJA 2ADQB 4CS4A 5B3SC 4DXWA 4EB6A 3CC7P 3TNUB 1SQQK 2WITA 1L0LK 2QA4V 1O9HA 1YJ9V 5IWAB 2B9BA 5AW4B 1MG1A 3J7AU 1Q82W 3SWFA 4X20B 4G28B 3RYIB 2QEXV 4NTXA 4WBNB 3ZRWB 4JAVA 1IBKO 3CRQA 1N7RA 2YX9A 3VD3A 4PV1B 1LTJC 4H13D 4H37A 1L4AA 4LH6A 1Y8AA 2NPSD 4JTCB 3IMHA 3CE2A 2HJDA 2CGOA 1YJNP 1JY2O 1VQ7P 1M56D 3AFJA 1I8QA 1GRJA 3M9BA 3BRCA 1I0HA 3E8BA 3UKMA 1Y76B 3FYIB 1AI4A 3ZMUA 1NVPD 1ZRTE 1K1YA 5KLVD 3II6A 1EDJA 5KJ7D 1YQ4C 4N78D 1CZQA 5CMZA 1AJYA 2IBZH 1FXVA 4MT8A 5KHGA 1WRGA 2QG4A 2RKLA 4DR2O 2JGUA 1M90Q 2NRGA 2H8PD 3CWBD 1HH0A 1SQXJ 3BCCE 1NTZE 4IIJA 1SERA 4JYAO 3R66A 4F4LA 4IT5A 3CCUP 1XREA 3OTFA 4BIUA 1HNXB 4I0XB 3ZN1A 3G71V 1NU1J 3E22B 1QX8A 3MGNA 1N8RQ 3OT7A 3H01A 3IC7A 1G2CB 1NBMG 2K1EA 4F6RA 1TUEB 1WA8B 2UXCO 4LR3A 3W7XA 3BPZA 1K8AW 3CD6V 3GMAA 1R34A 3H1KJ 3M91A 4W80A 2WYHA 5CCGD 3IAQA 1AP5A 5C93A 5H2FZ 5EC1C 1EQ7A 4R4MA 2LW7A 2PNCA 3L70D 3CB2A 3KQGA 1RQVA 2PF4E 3ABLB 3RVYA 2ODMA 3JYCA 3CCRV 3CCQP 2KI7B 4X1YB 4LF7B 1UIXA 5D5PA 1FZEA 1SETA 2OTJV 3ZMVA 1RE4C 1LUWA 3H32A 2F1MA 2WLLB 1PPJD 3WB0A 1IVUA 4GZRB 4MN4C 1H2MA 4KXRA 4DUYO 1L8DA 1ZXGA 4UB6E 1Q81W 3EWKA 4JI6O 2Q7GA 4JV5B 1E1QG 3JARA 5AVXB 4O4JA 2AZ2A 4ZBMA 5ITZB 4YIPA 1MMMA 1JM0A 1SQVK 3AEIA 2KYVA 2L91A 5GTHE 3M8AA 4D6TG 1S2EA 2CK3H 4I9QA 3NTNA 3HKDB 2KNCA 4CZZA 1YQ3C 4L73A 3H1JD 3HUSA 2B87B 3Q3DA 5AW5B 3A0HE 1ZLLA 1V55C 3LNNA 4DV1B 2JJLA 3MPHA 1YTFB 5JJJB 2WVXB 5FPRA 2CIRA 1N7NA 2FYVA 3X3XA 3RL0D 3QNEA 4FJCC 3CMAV 1AVLA 1NKNA 1HJBA 1KFNA 4RUEA 2ZQ0A 3T09A 1NH2B 2HODA 2V7QG 3APOA 1WPBA 2Z3YA 3JAWB 1AJNA 5LA6B 3N4XA 1JZ8A 3F89A 3BVVA 1TQVA 3NBJA 4LP8A 4FPPA 1GK9A 3OGCC 1PNLA 3W7UA 3JCUZ 1KFMA 3K06A 4IHJA 3PHLA 1SQPK 1YXBA 2O3JA 4PD4I 1YDXA 1B06A 1LP1B 1VEWA 1MOFA 4H44B 1IVSA 2R5DA 3T08A 2FYUG 4W4LA 5EIBC 3O6QA 1U97A 3PTZA 1MFTA 3JCZA 2WSEJ 3M9QA 1BGYE 2B1IA 5GTIE 2BCCE 2CE4A 1N7SC 1OHHG 1IBLO 3PN1A 4CBCA 2N1TA 2WOFA 5B1NA 2ARHA 3ZHSA 1SIHA 3CRRA 1VQMV 2HPCB 4FNQA 3DTUB 5AW2B 4KP4A 3ABTA 3RT3C 3B4SA 4B3SO 1YI2P 1Y66A 1NWQA 3S3WA 1SQXE 1ZSPA 1QGKB 3KHUA 5KA6A 2HEPA 3UQ8A 3HD7C 3M7MX 4U3FJ 2FY8A 4FM1A 1VQPV 2F23A 2P1JA 1SA0B 4O4IB 2XN2A 1PD3A 2E2VA 4DR1O 4FFBA 3G67A 1VQOV 2BASA 1SFCC 3L75G 1LTJA 1IBKB 4UV9A 2M3BA 1VQ4V 5CHXA 4D6TE 1RJOA 3CXHI 1F4AA 5FNVA 1PP9J 2JJ2G 3H1LJ 1BDDA 2D1WA 2EABA 4DV5O 2P06A 3U0ZA 3L70H 3ZRXA 2Y0PA 4JI7O 1GW4A 3OW2U 1F1SA 2IJKA 2WA4A 1QVGU 5GW7A 4UCVA 1KB9I 2HLOA 2GDSA 3DGEA 4I50B 4J11A 1EZVD 3AEBC 2WSFJ 2KIKA 1PNMA 3SJQC 2KOGA 2XT9A 3O8ZA 1ZW0A 2JKAA 1CI6B 3TYYA 3MUDC 1MN0A 1Q7YQ 2G8YA 3X2QB 1Y47A 2DW3A 3E7KA 4PD4E 4JYAB 2FXMA 3RYFB 1M57C 2P10A 3S9OA 1D6UA 3T0AA 3JALB 4OPAA 2QWRB 3FX0A 3S4RA 4FLTA 5CA1B 5B66E 2EZPA 1SF9A 4LF6B 3A0BZ 3BHPA 5LXTB 1VQ8P 1GL2C 5AW9B 3H1JH 4EOTA 1HXKA 1F9GA 4WY4D 1V7XA 4CH4A 4OX9B 1FAFA 1AJPA 2Y0IA 3CC4P 1RY3A 1IZNB 2HTBA 3DYPA 3AG4C 2KB7P 2WLNA 4PD4F 5IJ0A 3DC6A 3GWKC 3K5OA 1DD3A 1RE4A 4QMAA 4QE9A 1KC8W 1NS4A 1NKGA 3M06A 1Q5OA 2QKAA 3AEGC 1EN4A 4LF9B 2ZL8A 1K4CC 1AVYA 1XMQO 1UJWB 4DUYB 4AYCA 1SNZA 2YDEA 2HP8A 2P90A 1KECA 4FNSA 1GDTA 1QVGO 5K1XA 5JQGB 4TT3H 4GX0A 3WUVA 3L75E 5LOVB 2PZSA 3T1HO 5KAIZ 4B7KA 4TV8B 2W90A 2N05A 1JY3N 4KJMA 1GN3A 4I4TB 4P30A 1FZFA 3DCDA 5LMNB 2RQ6A 5IE9A 3VMZA 2YIBA 5DM6V 2GTAA 3CCQV 1KB9E 5B1AB 5M1BA 4DRXA 2JP3A 1QBZA 1KYOH 1R5SA 3UCSC 1KD1Q 1D2DA 1N7QA 3CXHF 2HYNA 4NB5A 3ABUA 4OWFA 2QSIA 4UCSA 1PGPA 2HKOA 1IVVA 3RRSA 3K3WA 1OJHA 1BSHA 1PL0A 3RW0A 3T2OA 1UI7A 1NS1A 1RSOA 4O4LB 1M56B 4U3FE 5C39A 4DUWA 3SYQA 1XMOB 2KS1A 5AW3B 2IBZI 3BA8A 4PI2A 1OW7A 1JJ2U 2YI8A 1DF4A 1NVPB 2L5GB 1R6NA 1LF6A 1KB9F 4DR4B 1K4DC 1HW7A 4G27B 1RM1B 2XKMA 1H2LA 1H2GA 3ZMSA 2WQYC 1NTMK 1QEXA 3Q4HA 2JS3A 1DLBA 4AUWA 5LGNA 1FBMA 4B3RO 2WPSA 2CISA 2ZYAA 2C9LY 4I9WA 5KHJA 3DECA 2RN0A 1N7SA 4X64O 1IBLB 1I5XA 4X62B 4XDLA 1OCOB 4FLUA 4B3MO 2K3RA 1ORQC 2Y74A 3E1F1 1EZVH 3FB7C 1WB8A 1MABG 1FDOA 2QM7A 1N7OA 1JZ2A 1DD4A 4B3SB 2QTSA 1S72V 1XNQO 3F5WC 3HD7A 3JASA 4YXDC 1J0MA 2QJKC 5CCHD 2CFLA 1I08A 4R4LA 2DYRB 4OPHA 2M3EA 1N36B 4FLXA 3A7OA 1SFCA 2YKQA 5DN6G 5B1OA 1IFNA 4DR6B 1NYHA 1P49A 5K1PA 2ZDIC 1XQ8A 2H89C 2PGDA 4X89A 1NTKK 1H8HG 2ZT9C 2JKEA 2QWOB 1SQBK 1U7JA 4GCZA 1FFXB 1XL4A 2EIKB 3Q5PA 1NS8A 3RGUA 3SJCC 1CB8A 2FTKA 5FLXN 1H0TB 2UWJE 1V7VA 2B9ZA 3CV5A 4WFFA 4X1IB 2JRIA 3BA9A 1OFCX 1JNMA 3VQXA 2F93B 1YI2V 3HI7A 2OCCB 2KUBA 2IBZE 3T1CA 4L8JA 1NU1D 3WFVA 4EYYQ 3BUDA 1SQVG 4GDOA 4YIOA 2DN9A 3R4YA 2A9HA 5KMGA 1FZAA 2Q7HA 2YICA 2F1BA 4DYLA 2Q4PA 3MUDA 1OCRC 2H43A 3WA2X 2OARA 2IH3C 3H1KD 3VSNA 2GUVA 2OYHC 4QPKA 1BCCH 4GKKB 3SJAC 2XASA 3RL0B 3BY6A 1HDJA 1EDLA 3G4SV 4OGQC 3UO3A 2YEVA 3HKBB 4NYKA 1BE3G 4UFCA 4O4HB 5AVZB 1MA1A 1SZTA 2EIJC 1L4AD 4WB4A 2HR3A 3EXAA 3IC9A 3VTPC 1TGOA 1QLED 3AE9C 3CMEP 1QAKA 3A5TA 4EI2A 2Y9ZA 1GL2A 1A02J 1H8AA 2OTLV 4LCUC 2ETNA 3JD3A 4TOIA 3K58A 4PJ0H 1Q3EA 3X40A 1WJZA 2LQTA 5EZYB 5TISZ 1NS2A 3B8NA 4KTPA 4RNLA 4UB8Z 1U7MA 3BLCA 2UUCB 5KLVG 4PDVA 5LMUO 3X41A 1J95A 4TSFG 1XTGB 2FYNC 1NZ6A 2JJ1G 1XEQA 1TVKA 4Q20A 2QTOA 1GK6A 2ITCC 3CWBG 1VF7A 2CAZC 1IXMA 3TGUG 1R73A 2XTAA 2KB1A 3L74G 1G6UA 1GMGA 2FFDB 3SXXA 3EVKA 1VQ8V 2E2UA 2KLUA 2ZAEB 1J1EC 5B5EE 1GU4A 3Q2YA 1K1XA 5APXA 3GHGB 4BRYA 1CW5A 3BS6A 1KKDA 1K73Q 3I3DA 2F4VO 1QL1A 3ZHVA 2AW9A 1BZKA 5L3BA 4DR3O 2Q7CA 3G3ZA 1F4HA 3M0DC 5E1QA 5DEDA 2E74C 3H1JJ 1YITV 1QU7A 3SPHA 1S9KE 3H1ID 5DJTB 2QM8A 3P3PA 1SQGA 1NAYA 2W6JG 3AK2A 1HJ0A 5EFWB 1JZ4A 1GW3A 3CXHD 3QWOC 2E22A 3SR2C 4JI2O 5JMFA 2C2AA 4FLZA 1R3IC 4X65O 2QA4P 3FX7A 1OACA 3QFZA 4LF5O 4TV9A 3V4QA 1YJ9P 1FXHA 4KFEA 3UO2A 1PPJG 1PS3A 5EYPB 2W8ZA 1OV9A 2Q1FA 4U7OA 4EDFA 1VMGA 5KUMA 3MIWA 3ZJZA 2QEXP 3VDBA 5J2TA 4U3JB 1VQLV 1OJPA 4LFAB 2Q8VA 1USDA 1JCHA 2F7OA 3H6PA 1M1KQ 1FZCC 1VARA 3SWKA 4QE7A 1KILD 5LP6B 3ICXA 1D7MA 2IZ0A 3KZIZ 2V1DA 4DUZB 2JDIH 2P58A 3DYMA 1GK4A 3L35A 3SYOA 3P7KA 1NQTA 2GSMB 1H2SB 4YPCA 3PH0A 4U3FD 2XN0A 1OVUA 2EILB 3RK3D 1OCZB 1I7FA 4O2AB 3EFGA 3A8TA 4N78E 3V6IA 1KP3A 4B3MB 1N73C 4J5TA 1LUVA 1NU1H 2A0LA 4GKJO 1ZR4A 5AW7B 2R3SA 1PP9D 1X59A 2ZCEA 1SPUA 2WSSG 3H1LD 3W7WA 4WY4B 1HF9A 3B5NC 3CCSP 3CWBE 3D4ZA 1GH6A 1F7YA 4B3TB 4AQRD 1UG9A 3G71P 2FUQA 5FL7G 3KPEA 2ZDIA 1ZL8A 1IFDA 1IVXA 1CP9A 4OK4A 2O1KA 1V9PA 2E75C 2C0XA 1D6ZA 2P5OA 3AG2C 2FKXA 3JD2A 3D51A 4LC1A 3RYHB 2CFDA 4I5SA 4DT0A 5FPOA 3L70E 3CCRP 5JVDB 3IJ4A 3AE5C 1QLNA 1IJDB 3IAOA 1PV3A 1OX3A 2N1TD 2OTJP 2H7HA 1NKDA 4B08A 3ML0A 5AG2A 2I1JA 2CG0A 1KYOI 4PV1C 1U96A 2QWNB 1NI8A 1PPJE 4LFBO 2WT7B 2WCOA 3ZN0A 2OYHA 1K9MQ 2QE7G 3UT5B 3UIAA 2BTOA 3TXQA 2CH7A 1IU7A 3WIQA 1U57A 2ZXQA 3MHSC 3B40A 2EX3A 2HFEC 3JATA 5J2UA 3M9HA 1N2DC 2A45H 4ZOLA 4UB6Z 5BY1A 1FC2C 5H6QA 1OMIA 1L0NH 3K5MA 4LGDE 3H1JE 1YBKA 4L76A 2HG5D 2PI4A 4C7NB 3ASOB 1AR1B 2XHNA 5GTHZ 1UIIA 3CMAP 1M7LA 2QJYB 2DE0X 5L3FA 2V4HA 5KX5A 3H1IH 5GONA 4RQEA 2L6LA 4UV8A 1GM8A 1WAZA 4BAYA 4YXWG 1SQQD 4NXNO 1HN0A 3A0HZ 3J81N 2ZXEB 3AE6C 1NSSA 2XNDH 3D3IA 3HTKB 2QKSA 1RHZB 1EZVI 3WU2H 4X66B 2WDAA 3BLBA 1VF6C 2XAFA 5BMVB 1FKAO 3AE3C 1AP6A 2WSEH 3HUSC 1BCCJ 3V2PA 5H2FH 1N0NA 2OWOA 2K9PA 1HMUA 5IY5B 3CX5H 2LXBA 5KKZC 2ZKOA 2Y48A 2F4VB 4X9QA 3QVNA 3M0DA 3RSYA 4FLYA 3WB2A 2Q7EA 2ZVOB 1SO0A 1RF0C 2JGDB 3FXDA 3MV01 2NR5A 2LFSA 1KYOE 4LBEC 1HNZO 4BZFA 1P7BA 3SYCA 2V4DA 1JYWA 4JYBA 2M6YA 3CCVV 3BCCG 3U1CA 1TQUA 1L1FA 3SPJA 1NTZG 2A06D 2E5YA 3TSIA 4X65B 1VL2A 4MVSA 4UVAA 1PP9H 1VQPP 5GTIZ 3BRVB 1IFMA 4DV7B 3QH9A 3T0BA 3TJTA 1T5EA 4R6ZA 4FLVA 3PP5A 4FNUA 1AQ5A 2QSAA 1KYOF 1FZCA 5CBHA 2GHYA 1YTZT 2E5LO 4DO2A 1K5SA 2D3OW 4NPFX 1S5JA 1Q6IA 5APVA 1LURA 2IJIA 1OZ0A 1IFJA 4FM2A 1W2BU 2CDYA 1EN5A 1MMXA 4J42A 4N21A 2WPDG 1N9EA 1SVFA 3HKCB 1NJIW 2YXHA 4J7KA 3ZRSA 4M3LA 4DV6B 5L3CA 1N73A 1QLEB 1FYJA 1NHLA 4GKJB 1EZVE 5H9CA 4CH5A 3JCUH 3N2KA 2XSGA 1W2ZA 2PAJA 3B5NA 3GF7A 2XAGA 1CPYA 5C8YB 4H44C 3RWRD 4KUMA 2X6AA 1G1JA 1QX1A 1NSUA 1KTMA 2SPZA 3CJHB 4XDJA 1JZ7A 4HYOA 1IK9A 3TXSA 5E79H 3CCEV 5JH7A 2K9JA 4PI0A 1W59A 1VQKP 4ZHQB 4FZ1A 1Y6XA 3TNUA 5KLIB 3RK2D 4A7PA 2W0XA 2BSKB 4JI0O 5KTBA 1K8AQ 5B66Z 4X20A 3RYIA 1GN6A 1HR0B 1M4UA 4WBNA 2IX7C 2ZQMA 1K3EA 4F6RB 2VQEO 3CCSV 3D6ZA 1SQQH 1DX7A 1L0LH 1W2BO 2MKVA 1JO5A 1IFPA 1CXZB 4LFBB 3HD7D 2KP8A 1TUBB 3ZX6A 4A5UB 3RVZA 3AFLA 4KFFA 2IU0A 1GN2A 4G2KA 4I7ZB 4D7TA 4ZI7B 2P4VA 4E2LA 1Y76A 1SC5B 1PX3A 3TY1A 2R32A 4K35A 2I8DA 2OTKE 2HLDG 2DYSB 2JVDA 5KHKA 2WMMA 1Q81Q 4UUJC 1FJGB 3ETEA 4KHPB 3BVWA 1BGYG 2BCCG 3VD9A 2F18A 4RESB 1KMIZ 2WAMA 1LTSC 3HRNA 4PJ0E 4E4EA 3LDEA 5A9GA 3JD0A 2P6JA 3FB6C 1SQXG 4CPGA 4WFHA 3X2QC 1SZXA 1M90W 1JEKA 1FD9A 4I0XA 4TTGA 3E22A 2BRVX 3E8FA 2A06H 1G2CA 3E1IA 1KILB 4Y28J 1TQTA 3CCLP 2Y9YA 4DV4B 1AQTA 1WA8A 4QPJA 1BQ0A 3D8CA 3OR7C 2DOSA 5AW6B 1VF6A 2XOKG 1N8RW 1IFIA 3A0BH 3H1KG 1Q90D 3K03A 3OR6C 3DX1A 4X1KB 4EIJA 2J59M 2UUAO 5LHHA 2ZR2A 1KQGB 2V7QJ 1JVMA 1NSRA 4JQ0D 1GL2D 1FS0G 2WLLA 2W6AA 2WVZA 1JA8A 4RQFA 2WW2A 2YIUB 1L0NJ 2X6BA 1RF0A 3RYCB 2UUBB 3KYQA 1X79B 3ZHUA 4OVNF 3ZIAG 2OGUA 4TUYB 2KSJA 2KG7A 1HNZB 4BWNA 3CLQA 1NKZB 5APWA 3LIEA 3BEHA 4UXNA 4MSWC 5ITZA 3H1IJ 4Z1MH 1MZFA 5IYCO 4KTRA 5KLVK 3WMM0 1N4CA 1ULVA 1S72P 1IXBA 2XNXA 1DEBA 2FYUJ 1JUNA 3HKDA 1PIXA 2FL4A 1L2PA 2W0QA 2EJ7A 5KAIH 1LXKA 4LF8B 2YFNA 1URQD 2B87A 4JBZA 3AECC 1WMKA 1W5ZA 4BIOA 2Y73A 2BOCC 4BW9A 1OWAA 2B88A 2X6CA 2WVXA 2R3CA 5B1AC 3V5BA 1WP8A 4UFZA 1PGQA 1QCEA 4LF4O 4LFCO 3T4DA 2E5LB 1KYOD 2G3AA 2JWAA 3CC2P 2WYIA 2Y69B 1TQSA 2WA3A 4O2BB 3JAWA 3FWNA 2A45I 1VF5D 1M56C 5LA6A 4GLXA 1H2KA 2AHYA 3MUZ1 2Q9LA 1RE3C 1ZLZA 3IN6A 1T2KD 3QFYA 5KJ7C 1NU1E 4FVMA 2KK7A 1RM1C 2Z4EA 3VD5A 3BFRA 2YSUB 4CS3A 2F7QA 3N2GB 3E1RA 1LP1A 4MW8A 2UU9O 2D2CB 2G38A 1YVWA 3MUY1 3L71H 3H1KE 1JFFB 3G4SP 2H8PC 3KXDA 1Y74B 3CS5A 1N7PA 1J5EO 1SQPH 2CPBA 2VRZA 1S76D 3OJAB 4TLFA 2ZNIA 2K9YA 4IFDK 4DV2O 2E76B 5L3DA 1QQCA 2OTLP 2UXNA 3L36A 1B6QA 1FS0E 3MTUE 2B5UA 1NSXA 2HPCA 2CQTA 5DECA 5H6RA 3E86A 1B3QA 5L3GA 1WB7A 1EDKA 1AI6A 2WLKA 3CX5I 4DR2B 5EBWC 2ZM6O 1OCCB 1SA0A 2IYOA 4U3FG 4O4IA 2DYRC 2IJHA 1VP7A 3CHXA 3N7NA 4YHHO 1PFIA 2EZOA 2F7PA 1LT9B 2VQEB 2NN4A 1JQ0A 1KUQA 3ZDMA 2PFXA 1IQYA 5HFMA 4WVZA 2Z5IA 2O01J 1MFZA 1KC8Q 3W7SA 1YIJV 3H1LG 3QF7A 5KHHA 2UXCB 1XBLA 1Y4MA 1HTLC 5LGTA 2CWUA 1NTMD 1RPRA 2IU3A 3AE1C 3RBXA 1VQKV 3A2AA 4Q6GA 2OYOA 3I3BA 2ADPA 2GUZB 2OCCC 2Q5ZA 1VPCA 1WT6A 3FAVB 3U59A 4ZMDA 1AA0A 1YITP 1CI6A 1MKMA 4QNHB 2IYPA 5B5EZ 3WVFA 2DQ3A 1Z5WA 4WFAV 3H1HH 3GG2A 2PYJA 3L9DA 3H1IE 1NSZA 1FOSE 3RYFA 3WA3A 1QHTA 4JI6B 1BCCD 2AXTE 1BHBA 3JALA 3RL0C 1KKCA 3OW2O 1H88A 3CXHE 1R1BA 1Q7YW 1PM9A 4PELA 2XAJA 3JAKB 4LWSB 5CA1A 4JZGA 1XNRO 3PLNA 3V2QA 3ABVC 2Q69A 3D50A 1SQQJ 5AVSB 1L0LJ 5TJHA 5LXTA 2PYLA 2R72A 5LL6Y 1G8MA 1US6A 4Z2WA 3WU2E 4WF9V 1VQLP 3L4FA 4ASUG 3D4YA 4MTOA 2M7WA 4NKGB 1NTKD 3WUUA 1YQ2A 3C1LA 3CP1A 1SQBD 5H2FE 4YTPC 3FFQA 1N32O 1FOSF 3F5TA 1Q2NA 3HB3B 2QM4A 2IH1C 3ZHTA 1KILE 4GODA 4NTYA 4H13B 1FPOA 4JYYA 1KN7A 5JWPA 1YJWV 1ZN5A 2IBZG 2NPSB 1A2VA 1HNWO 2EADA 3ASNB 2QKCA 2GBOA 1OJNA 2E2TA 2WTYA 3CCLV 3VN0A 3L72D 1E1RG 3ZMTA 5JQGA 3T1YO 4RWUA 4K0KO 3L37A 3RK3E 4YJ3B 2WGQA 1YYCA 5LOVA 2FFDC 1J0NA 4I55B 4TV8A 4HYTB 1SRYA 1KBHA 4ZKUA 3CX5F 4I4TA 2C9NY 3GHGC 4UCTA 3ABMC 1PP9E 3VMAA 2CFWA 1SQFA 3FB5C 3OS7A 3RK2B 2OYIB 2MW2B 3H1LE 4XFJA 3Q1NA 4MTXA 2E5TA 2Y0DA 3D6YA 2KKWA 3JD1A 4DK0A 4LF4B 4LFCB 1YTZI 1LF9A 2A3QA 2A79B 3NREA 1BDCA 3SGIA 4MW3A 3AG7A 5BR8O 4O4LA 1KD1W 2AZ0A 2E74D 2L35A 4PA9A 1XHZA 3MV11 1EXJA 1YCIA 3LVTA 1S5LH 4GUNA 3DXRB 1RE3A 4BIZA 3IFMA 2UXXA 1K04A 3BVUA 2YUAA 1N33O 5KJ7A 5AVQB 2RH0A 2EULA 4DR1B 5LYJA 3JCUE 3ABKB 2O01N 3VQVA 4H0LD 1NTZK 3L73J 5CN0A 2UU9B 3T2PA 5LP6C 4RO0A 3VSMA 1AB3A 4C46A 2CK3G 3HE5B 3ZHQA 4HKZH 3KZIH 4QJFB 3CC2V 2DW4A 1P7GA 1J5EB 3IGAC 5KAFH 3EJPA 1NTMH 2ILMA 1VQ9V 3OAKA 1HBWA 3VOUA 1SQVJ 4DV5B 1Q6UA 2RCVA 2EILC 3CI9A 1OCZC 4JI7B 3K5TA 3MHVA 2BE3A 3OM3B 5E79E 3J7HA 3VMXA 3OMNB 1LTBC 2KZJA 1SIIA 1FDIA 1WNSA 1Y9BA 3ZCCA 1BS3A 5LBQA 1JTHB 3OUSA 4PDRA 3T97B 3KCXA 2YNYA 3M0AA 3K9AA 4IYIA 1Q86Q 1DH3A 4DW0A 2WPQA 2YO3A 2F66C 4MVUA 5JJNB 5IDJA 1X22A 2LFRA 4CC5A 1P84D 1SQQE 3ETDA 4K8ZA 3MP7B 1GAXA 4HB1A 2CWVA 3D36C 4J9ZB 3LOYA 4JF3A 4JI1O 2POHA 2Q0OC 3B5ND 1FFXA 3S4BA 2UXBO 3ACTA 3GF3A 2WLHA 2ZE5A 1H0TA 4J10A 1F4NA 4X1IA 1W0JG 3L71J 1NTKH 3WUTA 2VQFO 4IGGA 4I2LC 1SQBH 2YXLA 4JI3O 3RBZA 3D52A 1SQPJ 2N9YB 2CFKA 3SWYA 2JR8A 5DJUB 2E43A 1RWCA 2LP7A 3C9IA 1LVNA 1W7CA 2RJZA 4WBAA 4BTWA 4HH2A 2EJRA 4DZOA 4N3YB 1GD2E 4IFMA 2DWDC 1URQB 1T3UA 4FLWA 3TGUJ 1UFIA 1JRQA 1QWNA 2XN1A 3K25A 3L74J 3VBBA 3ZHRA 4MVZA 2FBWC 1F51A 1XMQB 5BXZA 2P67A 3CCVP 2Q1KA 3OTOO 2R44A 3L72H 2Z0AA 3P30A 3HKBA 5BU8B 1X4TA 4O4HA 2KQXA 1IBMO 2A06E 1W0KG 4MVOA 3T1HB 1KP2A 2QDOA 3BABA 1VF5B 1JR9A 1NO4A 3A0BE 3W7TA 1L0ND 5EZYA 2F95B 3IAYA 1YGAA 3X3YA 2ZR3A 2QJPB 1EN6A 1DP0A 3IR9A 2HFED 1HUCA 1IZ3A 2WW3A 4WFEA 1S0VA 3APQA 2LXCB 2QRXA 4DW1A 3BVHA 1ZUQA 3L70G 2CTQA 2FYUD 5IYBO 2DMXA 3SPGA 1HNWB 5E1AC 2VS0A 2VWJA 1I94O 2JEUA 3C90A 3CZNA 4HBNA 3H1HJ 2FFDA 4DR5O 1CSBA 1SQXK 1JJOA 4HJGH 3CCJP 3CCMP 2CQSA 2Q6AA 3P8MC 4PA6A 3GHGA 4IL6H 4YJ2B 1NU1K 1EFRG 3VD4A 3CX5D 1GKFA 1LJ2A 1HMWA 3AEDC 4JPRA 3LDDA 1XTCC 3AE2C 4B3RB 4MMHA 1RPOA 3H1JG 1K73W 5IYZB 2OIGA 4CS2A 1VQNV 1USEA 4I1LA 5AVVB 3KDPB 3CCEP 3IF4A 1MZ9A 3E35A 3K0DA 4N6JA 1K7DA 3AG3B 2M5AB 4X64B 5CBOA 3P32A 1BL8A 1XI1A 1JB0J 2M0BA 4GOEA 1BSMA 1FXKB 1M9NA 5F2VO 5EYPA 2R70A 3TK1A 1GM7A 5IJ9B 1NS7A 5CB4B 1XNQB 1RWGA 4U3JA 1N33B 3CXCU 3BUBA 5LHIA 4BTXA 2KSDA 2CIQA 4IOIH 1P84H 2YFOA 2BRWA 1R5LA 3B71A 4TT3G 1ZOYC 4MVMA 1EC5A 5LP6A 3VDCA 2FXPA 1JOCA 2ATKC 2WWWA 3K9SA 4LLHA 1M1KW 1BSNA 2CUGA 3G80A 3K79A 4BWAA 4D6TH 4O2AA 1K33A 2ITAA 3B8EB 1FAVA 1BMFG 4KFDA 4W4KA 1QLEC 2P7JA 2BTQB 3OBAA 3LSQA 1W6CA 4MS2A 3G6EV 1NSVA 2HJFC 3E80A 2Q5UA 1UPGA 2N9BA 4B86A 3OMAB 4U7NA 3HKEB 5LGUA 1A02F 1L7JA 4KL1A 1L7KA 3LNMB 4OJZA 4JPZB 2XUMA 1RQUA 3JATB 5CA0B 3QO8A 1V7WA 3SFEC 3BUQA 3HE4B 2EAEA 3GLMA 4PJ0Z 2V7QH 3I55P 3D36A 3S1KA 2O1JA 4DR7O 2F43G 4J7JA 1AILA 1AV4A 4RAIA 4Y99B 3I56P 3A2FA 2UXBB 5BU5A 1N34O 1H2NA 1M8OB 1S3JA 3RYHA 1OJMA 5KLIC 4LNUB 3F7VC 4ASVA 3QG0A
chains in the Genus database with same CATH topology
2WMMA 1OVRA 1U7JA 2LXBA 2LXCB 2QRXA 3BVWA 2B87B 3RGUA 1LT1A 1HXKA 1BDCA 1H0TB 2F18A 2UWJE 2P58A 3CV5A 5CBNA 3EJRA 1EDKA 2FYVA 2JWDA 4GOFA 3PH0A 1R33A 3FXDA 1OVUA 1EDIA 3LVTA 4CPGA 2KUBA 1NVOA 4EYYQ 3BUDA 3BVUA 4BXLA 1TQUA 1DEEG 2F7PA 3CZNA 3ZDMA 1TQTA 4HJGH 2F1BA 5K5GB 3BVVA 1TQVA 3D4ZA 2OW6A 4ASWA 1EDLA 2B89A 4HKZH 4NPDA 3DX1A 3CZSA 3EJPA 3MZWB 2HR3A 4KJMA 3BUIA 2I8DA 1LP1B 4NPFX 1HWWA 3MHVA 2M5AB 3FXEA 3D51A 2KZJA 4ZMDA 1TQWA 5CBOA 1MFTA 2LR2A 2M0BA 3EJTA 4GOEA 3BVXA 1EDJA 1U7MA 4ASVA 2RKLA 1O7DD 3BUBA 4NPEA 5C39A 3BUPA 4IOIH 3D50A 2OW7A 4HB1A 1EC5A 1X0TA 2B87A 4JBZA 1QX1A 4WWIA 1QWUA 1H0TA 2QVAA 3DDGA 2B88A 4K3AA 3D4YA 3EJQA 2SPZA 2ZAEB 3EJSA 2F7RA 3D52A 1R34A 2WYHA 1BDDA 1FC2C 1Q2NA 3BVTA 5DJUB 2WYIA 3DX4A 4ZNCA 1TQSA 4GODA 2F1AA 3EJUA 3DX0A 1QWNA 5DJTB 2KI7B 2K3RA 2ALWA 2Q1KA 2R44A 5EFWB 3QWOC 1JMBA 2KIKA 1HTYA 1ZW0A 4MN4C 3BUQA 2KZIA 1ZXGA 2F7QA 1PS3A 3S1KA 1LP1A 1Y47A 3BLBA 1SS1A 2M5AA 3DX2A 3DDFA 1OVVA 1S3JA 5KBPA 3DX3A 1JM0A 2F7OA 4K35A 2OTKE 2KS1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMM A;  1OVR A;  1U7J A;  2LXB A;  2LXC B;  2QRX A;  3BVW A;  2B87 B;  3RGU A;  1LT1 A;  1HXK A;  1BDC A;  1H0T B;  2F18 A;  2UWJ E;  2P58 A;  3CV5 A;  5CBN A;  3EJR A;  1EDK A;  2FYV A;  2JWD A;  4GOF A;  3PH0 A;  1R33 A;  3FXD A;  1OVU A;  1EDI A;  3LVT A;  4CPG A;  2KUB A;  1NVO A;  4EYY Q;  3BUD A;  3BVU A;  4BXL A;  1TQU A;  1DEE G;  2F7P A;  3CZN A;  3ZDM A;  1TQT A;  4HJG H;  2F1B A;  5K5G B;  3BVV A;  1TQV A;  3D4Z A;  2OW6 A;  4ASW A;  1EDL A;  2B89 A;  4HKZ H;  4NPD A;  3DX1 A;  3CZS A;  3EJP A;  3MZW B;  2HR3 A;  4KJM A;  3BUI A;  2I8D A;  1LP1 B;  4NPF X;  1HWW A;  3MHV A;  2M5A B;  3FXE A;  3D51 A;  2KZJ A;  4ZMD A;  1TQW A;  5CBO A;  1MFT A;  2LR2 A;  2M0B A;  3EJT A;  4GOE A;  3BVX A;  1EDJ A;  1U7M A;  4ASV A;  2RKL A;  1O7D D;  3BUB A;  4NPE A;  5C39 A;  3BUP A;  4IOI H;  3D50 A;  2OW7 A;  4HB1 A;  1EC5 A;  1X0T A;  2B87 A;  4JBZ A;  1QX1 A;  4WWI A;  1QWU A;  1H0T A;  2QVA A;  3DDG A;  2B88 A;  4K3A A;  3D4Y A;  3EJQ A;  2SPZ A;  2ZAE B;  3EJS A;  2F7R A;  3D52 A;  1R34 A;  2WYH A;  1BDD A;  1FC2 C;  1Q2N A;  3BVT A;  5DJU B;  2WYI A;  3DX4 A;  4ZNC A;  1TQS A;  4GOD A;  2F1A A;  3EJU A;  3DX0 A;  1QWN A;  5DJT B;  2KI7 B;  2K3R A;  2ALW A;  2Q1K A;  2R44 A;  5EFW B;  3QWO C;  1JMB A;  2KIK A;  1HTY A;  1ZW0 A;  4MN4 C;  3BUQ A;  2KZI A;  1ZXG A;  2F7Q A;  1PS3 A;  3S1K A;  1LP1 A;  1Y47 A;  3BLB A;  1SS1 A;  2M5A A;  3DX2 A;  3DDF A;  1OVV A;  1S3J A;  5KBP A;  3DX3 A;  1JM0 A;  2F7O A;  4K35 A;  2OTK E;  2KS1 B; 
#chains in the Genus database with same CATH topology
 5JVD A;  1PKX A;  3OGI B;  1LWU B;  2YI9 A;  1JCC A;  1NTM J;  2O57 A;  5B66 H;  3AMO B;  3B09 A;  1DK1 A;  3ALA A;  2FYU H;  5LMU B;  3D70 A;  5BZB A;  1L0L D;  1QAF A;  4FZ0 A;  1EZV G;  2WT7 A;  5CJ4 A;  2WLM A;  2WLI B;  1KQF B;  3UT5 A;  2IW5 A;  1Z45 A;  1NOH A;  1K92 A;  5D5Q A;  3J80 N;  4W7Z A;  1ZV8 A;  1M1J B;  4I7Z C;  1JYX A;  4EV5 A;  3OAA G;  3MI6 A;  3VQY A;  2LKM A;  3P8C D;  4LF7 O;  3Q5R A;  2PP6 A;  2DYS C;  1RF1 B;  2EIM B;  2ZD9 A;  2C0W A;  1ZX3 A;  2P2U A;  3ABL C;  1DF5 A;  1MUU A;  1ZR2 A;  3SJB C;  3BRT B;  2JEE A;  3DYO A;  4D7S A;  1LXM A;  3LID A;  1EKM A;  5J9P C;  1S1C X;  2W83 C;  4C7N A;  3K5L A;  4HNA B;  4JV5 O;  2J5U A;  3BCC J;  2CGN A;  4MTF A;  4DR3 B;  3L75 H;  3W68 A;  1ENV A;  3FD9 A;  1AJQ A;  1NTK J;  3V2R A;  2IZ1 A;  4N23 A;  1SQB J;  4H0L B;  2M8R A;  4ZKI A;  2GTS A;  5AVR B;  4KT0 J;  1KIL C;  4JI2 B;  4PA3 A;  3E89 A;  1R8E A;  2YIA A;  2XU6 A;  4LF5 B;  3FWL A;  1O7D D;  5BMV A;  1I94 B;  2ZIM A;  4RJT A;  1VQ5 V;  1FDM A;  1SP4 A;  1BHA A;  3CZJ A;  4P9O A;  1BCC G;  3AG1 B;  3L72 J;  3ZRV A;  1BQZ A;  2EBO A;  1KQS U;  3ITK A;  4EV2 A;  1N7L A;  2YKP A;  1Q82 Q;  1QWU A;  2QVA A;  4EB6 B;  4BZH A;  5CCH A;  2KSE A;  2FKW B;  2R5B A;  3EJQ A;  1O9G A;  2X7R B;  3A3Y B;  1HWT C;  2YIB D;  2JGD A;  2N04 A;  1HN1 A;  2YXY A;  1LR1 A;  3SPI A;  4GX2 A;  1OW8 A;  1YZB A;  3N2K B;  3DX4 A;  3T0U A;  3A0R A;  1D6Y A;  2EIN B;  3JSN A;  1L4A B;  1HGZ A;  1PGJ A;  5HFL A;  1K05 A;  1X1I A;  2ZE7 A;  3L73 D;  1R6K A;  2O01 H;  3WG7 B;  4TQD A;  1S4X A;  3BGA A;  2GUS A;  4NTW A;  2E24 A;  1S5L E;  2YO2 A;  4AHC A;  3CCJ V;  3CCM V;  2P4K A;  3ACS A;  1HTY A;  1MMZ A;  1LTA C;  1JZ3 A;  2VRS A;  1SQV D;  1AFO A;  3SDL A;  3C3T A;  3OB8 A;  1K1W A;  2WW0 A;  2QWP B;  3OEH G;  1E79 H;  1YIJ P;  1QAL A;  2RNB A;  2HVK C;  4DK1 A;  1AVK A;  1WMN A;  3U1A A;  5KBP A;  2Y69 C;  3QTC A;  2OOV C;  3KZI E;  3ZS8 C;  5EIB D;  3PRJ A;  1BE3 D;  5KAF E;  1G1X B;  3HKC A;  1NTM E;  1OVR A;  2DJV A;  5EK0 A;  3I3E A;  4IIJ B;  3B77 A;  1KQS O;  5B1B B;  1N7S D;  3NR7 A;  3HII A;  4GT1 A;  2UXD O;  3SX1 A;  4BZG A;  2EAC A;  3ZRW A;  1K5Q A;  1M5I A;  2ZFC A;  4XE5 B;  2HG5 C;  5C8Y A;  2D2C C;  4RUF A;  1NVO A;  3CL3 D;  2ZJS E;  4FFK A;  2OQQ A;  1X1J A;  3L71 D;  1BGY J;  1NH4 A;  1H54 A;  1BCC E;  2BCC J;  3CJH A;  5AW8 B;  1ZAU A;  3BAA A;  1SFC D;  1SQP D;  3O9O A;  5K5G B;  1LOH A;  1CEZ A;  5AVU B;  3SEP A;  5JMD A;  4DR7 B;  1ZME C;  2E76 C;  2NNU A;  2KXP B;  2LGQ A;  2W27 A;  1URF A;  3H32 B;  1N34 B;  2OIE A;  4ZHQ A;  2B89 A;  2Q73 A;  3I5C A;  2E42 A;  3TGU D;  3OUF A;  1R3L C;  2AXT Z;  3CZS A;  3DSQ A;  1S5H C;  3L74 D;  2BSK A;  1NTK E;  3A0O A;  2JDI G;  4GX5 A;  4GX1 A;  1SQB E;  1FZG A;  1OCC C;  1W3Y A;  1PGO A;  3JC2 2;  3JAR B;  4O4J B;  4B7E A;  1TQW A;  3CSX A;  3WU2 Z;  1BT8 A;  4LF6 O;  4CH6 A;  3V4W A;  4D6T J;  1YJW P;  1LT9 C;  3N27 A;  1WMO A;  3BVX A;  2ZXW B;  2KNC B;  4L75 A;  3Q1M A;  3M99 B;  1FZB A;  1NU1 G;  1JMK C;  1TUB A;  4NXN B;  2CG1 A;  3VD7 A;  1HM2 A;  2PI5 A;  1LTT C;  3HUS B;  4OX9 O;  1JYV A;  1EBO A;  4ZI7 A;  3I55 V;  3LSS A;  2KLV A;  1FJP A;  1FJK A;  2X0L A;  3L72 E;  4YY3 O;  1MV8 A;  5KKZ B;  3I56 V;  3LSU A;  1M57 D;  2IDB A;  2OW7 A;  3RK3 B;  2CTR A;  4FK5 C;  1AI7 A;  3NXS A;  4LF9 O;  1P4R A;  4X1Y A;  1IDS A;  2HOD B;  4K3A A;  3VOP A;  1VIB A;  2AGA A;  3SFD C;  4FMT A;  1P84 I;  3AK1 A;  3F5H A;  2XV5 A;  5AVW B;  2KG7 B;  5CMU A;  2R9I A;  1NR1 A;  3FGA D;  1GO3 F;  3K5B A;  3STL C;  4XBF A;  1QL2 A;  5B5E H;  1QNM A;  3H1H D;  2ZVN B;  1V54 B;  4ZNC A;  2FB5 A;  2F1A A;  4IHJ B;  1IC2 A;  3EJU A;  5LMN O;  1R6T A;  2H3O A;  4LH7 A;  1KIL A;  1OJO A;  1J1D B;  2BEQ D;  5EC2 C;  2ZIN A;  1JOV A;  3L73 H;  3BAS A;  2IJJ A;  4RO2 A;  3G6B A;  3PJS K;  3NJX A;  3O6Q B;  2AHZ A;  1JMB A;  4MVR A;  4X1K A;  1XDC A;  2W6B A;  1OZH A;  1SQV H;  3GWO A;  5L3E A;  2N1T B;  3ZMZ A;  4IL6 E;  2WVY A;  1W4N A;  2RN9 A;  5B3S B;  1XMO O;  1JX9 A;  3AEF C;  3VP8 A;  2R9R B;  3QO5 A;  1Z5V A;  2A45 G;  4H13 C;  1VQ9 P;  2NPS C;  3RYC A;  3THO A;  4DR4 O;  1NT2 B;  1L0N G;  5CA3 A;  1R3J C;  1BE3 H;  3ASN C;  4TUY A;  1OXZ A;  3RGB A;  4PA7 A;  2RDC A;  2FYZ A;  3HR0 A;  2K88 A;  3NMD A;  3NBB A;  3L75 J;  4FFB B;  4WFG A;  2YKO A;  4JAA A;  5CBN A;  1LTJ B;  3VYI A;  4FNT A;  3H1I G;  3K04 A;  3ECQ A;  2ZE8 A;  3RFR A;  5JCO C;  1JYN A;  4OH8 B;  5FNV B;  1RKY A;  2IFM A;  3P3N A;  1X9V A;  3RK2 C;  2OYI C;  2HVJ C;  5E79 Z;  2XND G;  5KLV H;  2HHH O;  4FM0 A;  4X62 O;  3IAP A;  1WMP A;  3QO7 A;  3SSU A;  4AI8 A;  5IYD O;  1P84 E;  2OW6 A;  1G4Y B;  2R9A A;  2OOV A;  4O2B A;  3CWB H;  4OK2 A;  3TGU H;  1OCO C;  1XOU A;  1OW6 A;  3AEA C;  3L74 H;  1N36 O;  1AR5 A;  4DR6 O;  2WO0 A;  2Y4T A;  5CCG C;  1FFT B;  1NSM A;  1AV1 A;  4JI0 B;  4MTG A;  3FB8 C;  4JAS A;  2UXD B;  1P84 F;  3N2G A;  1G1I A;  3AE4 C;  3ABK C;  1WP7 A;  3W67 A;  3A24 A;  1KOR A;  1RWH A;  1OIP A;  1K97 A;  1GN4 A;  2QIW A;  1JFF A;  3AK3 A;  3B2E E;  1PP9 G;  2CTP A;  1Y74 A;  3CC7 V;  4PDL A;  2W6J H;  2EIK C;  3BUP A;  2BT3 A;  2X03 A;  3RN4 A;  2MK3 A;  3R2P A;  2A7W A;  5IJ0 B;  2PGG A;  3VQW A;  1PPJ H;  3I5D A;  3IFX A;  2ZT9 D;  3KN4 A;  5LHG A;  1THZ A;  5H5N A;  4I50 A;  3K0G A;  4KHX A;  2C10 A;  1YHQ P;  1N86 A;  4GKK O;  1L0N E;  3EJS A;  3MDS A;  3SYA A;  4WCE V;  2F7R A;  2JKV A;  3KG2 A;  3K57 A;  1VQ7 V;  1YJN V;  4BR6 A;  3KII A;  1SS3 A;  1ZRT D;  1LT9 A;  2YS8 A;  3DX0 A;  2Z5H A;  4QGP A;  4FNV A;  1VQ6 P;  2FYU E;  1PNK A;  1RWA A;  1PV0 A;  3WIR A;  3C3S A;  3S4D A;  3B8M A;  4PDM A;  3LW5 H;  1V55 B;  1Q8I A;  2ZE6 A;  1FE6 A;  2UUC O;  1JOY A;  1RP3 B;  4W7Y A;  1ZTE A;  1S5L X;  3BCC D;  4YY3 B;  1QR9 A;  4DRX B;  1NTZ D;  2WVR A;  1WPX A;  4OGQ D;  2NZ2 A;  3USS A;  2W0F C;  2GUZ A;  2J58 A;  2WLJ A;  4J80 A;  2UUA B;  3C8V A;  2Q9I A;  1E79 G;  4CC6 A;  3CCU V;  1MSW D;  1SS1 A;  5TIS H;  1Z56 A;  2WSS H;  3FAV A;  3DDF A;  1OVV A;  3CX5 E;  2C11 A;  4UB8 H;  3N9H A;  4JYC A;  1RSO B;  1URQ C;  4L74 A;  1VQN P;  2KS1 B;  3EJR A;  3HIG A;  1JPX A;  5APS A;  2E3C A;  1TAE A;  2YXR B;  1T3J A;  1VDF A;  2Y0C A;  3JSV C;  1GTO A;  4WFB V;  1IQX A;  4JAU A;  3JAK A;  4LWS A;  1Y67 A;  3Q4H B;  1EDI A;  2QR4 A;  3E8H A;  2LJ2 A;  3D3Q A;  4UVC A;  4X88 A;  1AVM A;  3E8G A;  1LTI C;  1SQQ G;  1L0L G;  1GTW A;  2BEZ F;  2RMK B;  1VF5 C;  3GB7 C;  3OFN G;  4UCU A;  4DV3 O;  2PUS A;  1DYU A;  2QJP C;  2XDJ A;  1N7S B;  3GW6 A;  1T2K C;  4JI8 O;  2AXC A;  2I1K A;  5AW0 B;  1LGH B;  4ZKP A;  5CJ0 A;  4NVP A;  1TU3 F;  2QE7 H;  1RH5 B;  2NPS A;  5EBM C;  3HD7 B;  1HWY A;  1ROP A;  3JAS B;  4GIF A;  3K59 A;  4LFA O;  2QGN A;  3BUI A;  2OQE C;  4O9B A;  1HWW A;  5APY A;  3T4Z A;  3JSL A;  1ZWI C;  4JZ2 A;  2PRR A;  1W5C E;  2RDY A;  3DC5 A;  1SFC B;  4YJ3 A;  5LYJ B;  2AEJ A;  3Q5S A;  1MZE A;  2LR2 A;  3G6E P;  4I55 A;  5JCO A;  1IX9 A;  4J41 A;  4DUZ O;  3X3Z A;  3G9R A;  2WSC H;  4JGS A;  2A06 G;  5A1A A;  2OYI A;  1KV4 A;  2FML A;  4ZIB A;  1PU4 A;  1MMU A;  2HHH B;  4NPE A;  2CFG A;  3CRA A;  4YXW H;  3OA7 A;  3ETQ A;  2BOB C;  1SLQ A;  5CBG A;  1H38 A;  1PL5 A;  3AG3 C;  1GU5 A;  4DUV A;  1PL4 A;  5KMG B;  4DV2 B;  2DQ0 A;  3OMI B;  2CPS A;  2RMZ A;  2WZS A;  1QVF U;  4B3T O;  1FXK C;  4KFM A;  4JF7 A;  2GM4 A;  1PX4 A;  1HM3 A;  3DXR A;  2CWT A;  5CCG A;  1LTG C;  3QDE A;  5APT A;  1M57 B;  5IT9 N;  2VWK A;  1BE3 J;  4WY4 C;  1BGY D;  2ZM6 B;  2YEV B;  2BCC D;  1XHX A;  1COW G;  4YHH B;  1AR4 A;  4J7Z A;  4Z1M G;  1XUQ A;  5AW1 B;  4H33 A;  1GL2 B;  3TET A;  1L0L E;  3L73 G;  3HE5 A;  3CEI A;  2N74 A;  4F6E A;  1SQX D;  4HZ3 A;  4Z1V A;  2PY5 A;  1LNQ A;  3P8C E;  3BCC H;  2DWE C;  4XA4 A;  1NS0 A;  3AG4 B;  2K1A A;  5KLV J;  1NTZ H;  1WN7 A;  1EM1 A;  3H25 A;  4U7J A;  2H94 A;  1D5A A;  2ZYD A;  1XIL A;  2ZNJ A;  4J9Y B;  4EKW A;  4D6T D;  3MHH C;  2E75 D;  3MD0 A;  3DX3 A;  1GMJ A;  4IL6 X;  2LW1 A;  1JY2 N;  2JIZ G;  1J2J B;  3AEE C;  1JTH A;  4JI5 O;  4WWI A;  1TVK B;  3T97 A;  3CWB J;  1M93 A;  1Q43 A;  4MMI A;  1NR7 A;  2ITD C;  2AEF A;  2Y4U A;  1W6G A;  2Y0E A;  4AQ0 A;  4JI4 O;  4GOF A;  1QR8 A;  4GKG A;  1Q86 W;  4BRY B;  3TCU A;  4PV1 D;  1QVF O;  2B1G A;  4C7U A;  1YSC A;  4Y99 C;  1XNR B;  1K34 A;  1VQ5 P;  4UCR A;  1H89 A;  4R8C A;  3L70 J;  4UB6 H;  3F7Y C;  3L71 G;  3FYE B;  4PD4 D;  1N0J A;  3WFA A;  3ASO C;  1T8Z A;  1LWU C;  1YHQ V;  1SQP G;  2Q3I A;  4I6M C;  2QJY C;  1JY3 P;  3S4C A;  1AI5 A;  5GTH H;  2Q6Q A;  1N32 B;  5JJE B;  3OE7 G;  3K5N A;  3VDA A;  1HGV A;  3LDC A;  3MAQ A;  1URQ A;  4X8A A;  4TV9 B;  4X66 O;  3MZW B;  2WPR A;  1RWF A;  2IM9 A;  3A0H H;  5J2T B;  1VQ6 V;  3FXE A;  4JTA B;  1M1J C;  3EJT A;  3ABM B;  3EFF K;  4NR1 A;  3CC4 V;  3T1Y B;  4K0K B;  4P9P A;  3VP9 A;  2EIM C;  1RF1 C;  3AE7 C;  3L73 E;  3V2N A;  4NXM O;  3LUT B;  5IY5 C;  5KAI E;  2JK5 C;  3GVM A;  3BAT A;  4L87 A;  4DV3 B;  4DJG A;  3LW5 J;  1DGS A;  2ZIO A;  5CCH C;  1SQV E;  2H88 C;  4DV0 O;  1DIP A;  4JI8 B;  1TA8 A;  4PA4 A;  3L75 D;  1R3K C;  3RL0 g;  3DDG A;  1S5L Z;  2CTW A;  1W2E A;  4H0L C;  2JS5 A;  4EEQ A;  2BRP A;  2D73 A;  4DV7 O;  1GM9 A;  4AQY O;  2P22 C;  2QJK B;  2OQE A;  1B04 A;  2W6I G;  5BR8 B;  1BE3 E;  1KB9 D;  1SKV A;  1ZP0 C;  4ABM A;  3E7J A;  4PHZ A;  1WLE A;  1BGY H;  2Q68 A;  1ZL8 B;  3H1H G;  2BCC H;  5GTI H;  3BVO A;  2ZT9 B;  3AG1 C;  4BW5 A;  2AEM A;  5KAF Z;  4YJ2 A;  1JMM A;  1S77 D;  2ALW A;  2Q0A A;  1IVW A;  2OT5 A;  3UM7 A;  4P2Z A;  5BVZ A;  1TU5 A;  1SQX H;  1MMY A;  4NEI A;  5KLV E;  2PTM A;  2KZI A;  5IWA O;  3L71 E;  4DV6 O;  5APU A;  5IYZ A;  4EFB A;  2XZR A;  2XAH A;  1YTF D;  3KCY A;  1E5W A;  1SQP E;  3T0D A;  3DX2 A;  3TF5 A;  2M5A A;  2YC0 A;  3S4A A;  3T2M A;  4GYC B;  1GZL A;  3KKY A;  2EIN C;  5CBF A;  1L4A C;  3HPL C;  1H8E G;  1FXK A;  3H1K H;  1OCR B;  3TGU E;  3S3X A;  1NH2 D;  2K37 A;  3L74 E;  2OYH B;  4QIW F;  3WG7 C;  5IJ9 A;  3EQ2 A;  1ARO P;  5CB4 A;  2Q3E A;  4WY4 A;  1LT1 A;  2CH7 B;  1L0N K;  4OGQ B;  1JZ5 A;  1X8Y A;  4IFF A;  4FIP C;  4C7R A;  2WOH A;  4CH3 A;  3CD6 P;  2EIJ B;  2WPV B;  1F23 A;  4R50 A;  2JWD A;  2FUT A;  3ETG A;  3TDK A;  1Q6H A;  4TQF A;  5J2U B;  1T6A A;  1R33 A;  1JZ6 A;  2LO1 A;  4ZOL B;  4DCK A;  1SES A;  2FXO A;  4BXL A;  1DEE G;  2FYU K;  3O65 A;  1JY2 P;  2WSC J;  1X1H A;  4JI1 B;  4H44 D;  1HR0 O;  2XAQ A;  3OD4 A;  5A2Q N;  1KSI A;  5KX5 B;  2OYQ A;  4PD4 H;  2YMY A;  2YXQ B;  3K08 A;  5GON B;  4R7C A;  2VQF B;  4HAM A;  3PGB A;  1HNX O;  1IO4 A;  3SPC A;  5B1B C;  4ASW A;  4JI3 B;  3WB1 A;  2BTQ A;  1US1 A;  2FYN B;  4NPD A;  3X42 A;  4JI5 B;  2QWQ B;  3JD4 A;  1EXI A;  3HKE A;  5CA0 A;  1FJG O;  3H1H E;  4KHP O;  1J1E B;  3HE4 A;  2ZYG A;  3OTO B;  2NLJ C;  4JI4 B;  2GV9 A;  4EFE A;  2IBZ D;  2GA1 A;  1JY3 O;  3R65 A;  4FNR A;  1IBM B;  3OEE G;  2D2C D;  1K9M W;  1YEW A;  4UVB A;  4UCO A;  2XHB A;  2E74 B;  2HTA A;  5EBL C;  2IPP A;  4LNU A;  1NAF A;  4BZE A;  3E83 A;  2AXT H;  3CPW U;  1D5N A;  3CYO A;  1FU1 A;  1LWU A;  3CXH H;  1X0T A;  2Z5U A;  2E76 D;  2MJZ A;  4FNP A;  4DV4 O;  1NTM G;  1NTZ J;  1PZQ A;  1XL6 A;  3FKS G;  3U11 A;  5TIS E;  3AMO A;  1I5Y A;  2WW1 A;  4UB8 E;  3U10 A;  3STZ C;  1Z2G A;  2P7T C;  2ZXW C;  1DTO A;  1IUR A;  1KQL A;  3CME V;  4OXS A;  1MSD A;  2WLI A;  5AVY B;  1MNG A;  3BVT A;  3AE8 C;  1KB9 H;  1A32 A;  2YID A;  4IL6 Z;  1M1J A;  4RKU J;  4DV1 O;  3HTK A;  2Q67 A;  1JCD A;  3EHB B;  1RF1 A;  1FZC B;  4DR5 B;  3RK3 C;  3ZED A;  2JO1 A;  4BTY A;  2IFN A;  1NJI Q;  4IYH A;  4MVQ A;  4NXM B;  2UUB O;  4JTD B;  2ZXX A;  4U3F H;  3CRM A;  4HNA A;  2LGW A;  3NFQ A;  2JEX A;  1KZU B;  1VQM P;  3ZBH A;  1F4M A;  2YIU C;  4DV0 B;  3D71 A;  1NTK G;  1N73 B;  3E2E A;  5KA5 A;  1V54 C;  1IK7 A;  1SQB G;  4K8X A;  4LF8 O;  5APQ A;  3H1L H;  1YF2 A;  3JAM N;  1J1D C;  3VMY A;  4AQY B;  1VQO P;  1C82 A;  3B5N B;  1EGU A;  1EZJ A;  4ICG A;  2YMK A;  3T2Q A;  1VQ4 P;  3QG5 A;  3SYP A;  3CPW O;  1RW9 A;  1UI8 A;  1NGM B;  4XDK A;  4DUX A;  1RFY A;  1AVO A;  1S9K D;  3CRC A;  5L8R J;  2JKP A;  4TWK A;  3H9V A;  1TXK A;  1HP8 A;  5AVT B;  3MWX A;  2E75 B;  4AIL C;  2QJ1 A;  2WSF H;  5KUK A;  2WZ7 A;  3L72 G;  5KHI A;  2N1T C;  3NJV A;  3AG2 B;  1KU9 A;  2K9J B;  2OCH A;  5JH7 B;  1HVV A;  4DOJ A;  2ADQ B;  4CS4 A;  5B3S C;  4DXW A;  4EB6 A;  3CC7 P;  3TNU B;  1SQQ K;  2WIT A;  1L0L K;  2QA4 V;  1O9H A;  1YJ9 V;  5IWA B;  2B9B A;  5AW4 B;  1MG1 A;  3J7A U;  1Q82 W;  3SWF A;  4X20 B;  4G28 B;  3RYI B;  2QEX V;  4NTX A;  4WBN B;  3ZRW B;  4JAV A;  1IBK O;  3CRQ A;  1N7R A;  2YX9 A;  3VD3 A;  4PV1 B;  1LTJ C;  4H13 D;  4H37 A;  1L4A A;  4LH6 A;  1Y8A A;  2NPS D;  4JTC B;  3IMH A;  3CE2 A;  2HJD A;  2CGO A;  1YJN P;  1JY2 O;  1VQ7 P;  1M56 D;  3AFJ A;  1I8Q A;  1GRJ A;  3M9B A;  3BRC A;  1I0H A;  3E8B A;  3UKM A;  1Y76 B;  3FYI B;  1AI4 A;  3ZMU A;  1NVP D;  1ZRT E;  1K1Y A;  5KLV D;  3II6 A;  1EDJ A;  5KJ7 D;  1YQ4 C;  4N78 D;  1CZQ A;  5CMZ A;  1AJY A;  2IBZ H;  1FXV A;  4MT8 A;  5KHG A;  1WRG A;  2QG4 A;  2RKL A;  4DR2 O;  2JGU A;  1M90 Q;  2NRG A;  2H8P D;  3CWB D;  1HH0 A;  1SQX J;  3BCC E;  1NTZ E;  4IIJ A;  1SER A;  4JYA O;  3R66 A;  4F4L A;  4IT5 A;  3CCU P;  1XRE A;  3OTF A;  4BIU A;  1HNX B;  4I0X B;  3ZN1 A;  3G71 V;  1NU1 J;  3E22 B;  1QX8 A;  3MGN A;  1N8R Q;  3OT7 A;  3H01 A;  3IC7 A;  1G2C B;  1NBM G;  2K1E A;  4F6R A;  1TUE B;  1WA8 B;  2UXC O;  4LR3 A;  3W7X A;  3BPZ A;  1K8A W;  3CD6 V;  3GMA A;  1R34 A;  3H1K J;  3M91 A;  4W80 A;  2WYH A;  5CCG D;  3IAQ A;  1AP5 A;  5C93 A;  5H2F Z;  5EC1 C;  1EQ7 A;  4R4M A;  2LW7 A;  2PNC A;  3L70 D;  3CB2 A;  3KQG A;  1RQV A;  2PF4 E;  3ABL B;  3RVY A;  2ODM A;  3JYC A;  3CCR V;  3CCQ P;  2KI7 B;  4X1Y B;  4LF7 B;  1UIX A;  5D5P A;  1FZE A;  1SET A;  2OTJ V;  3ZMV A;  1RE4 C;  1LUW A;  3H32 A;  2F1M A;  2WLL B;  1PPJ D;  3WB0 A;  1IVU A;  4GZR B;  4MN4 C;  1H2M A;  4KXR A;  4DUY O;  1L8D A;  1ZXG A;  4UB6 E;  1Q81 W;  3EWK A;  4JI6 O;  2Q7G A;  4JV5 B;  1E1Q G;  3JAR A;  5AVX B;  4O4J A;  2AZ2 A;  4ZBM A;  5ITZ B;  4YIP A;  1MMM A;  1JM0 A;  1SQV K;  3AEI A;  2KYV A;  2L91 A;  5GTH E;  3M8A A;  4D6T G;  1S2E A;  2CK3 H;  4I9Q A;  3NTN A;  3HKD B;  2KNC A;  4CZZ A;  1YQ3 C;  4L73 A;  3H1J D;  3HUS A;  2B87 B;  3Q3D A;  5AW5 B;  3A0H E;  1ZLL A;  1V55 C;  3LNN A;  4DV1 B;  2JJL A;  3MPH A;  1YTF B;  5JJJ B;  2WVX B;  5FPR A;  2CIR A;  1N7N A;  2FYV A;  3X3X A;  3RL0 D;  3QNE A;  4FJC C;  3CMA V;  1AVL A;  1NKN A;  1HJB A;  1KFN A;  4RUE A;  2ZQ0 A;  3T09 A;  1NH2 B;  2HOD A;  2V7Q G;  3APO A;  1WPB A;  2Z3Y A;  3JAW B;  1AJN A;  5LA6 B;  3N4X A;  1JZ8 A;  3F89 A;  3BVV A;  1TQV A;  3NBJ A;  4LP8 A;  4FPP A;  1GK9 A;  3OGC C;  1PNL A;  3W7U A;  3JCU Z;  1KFM A;  3K06 A;  4IHJ A;  3PHL A;  1SQP K;  1YXB A;  2O3J A;  4PD4 I;  1YDX A;  1B06 A;  1LP1 B;  1VEW A;  1MOF A;  4H44 B;  1IVS A;  2R5D A;  3T08 A;  2FYU G;  4W4L A;  5EIB C;  3O6Q A;  1U97 A;  3PTZ A;  1MFT A;  3JCZ A;  2WSE J;  3M9Q A;  1BGY E;  2B1I A;  5GTI E;  2BCC E;  2CE4 A;  1N7S C;  1OHH G;  1IBL O;  3PN1 A;  4CBC A;  2N1T A;  2WOF A;  5B1N A;  2ARH A;  3ZHS A;  1SIH A;  3CRR A;  1VQM V;  2HPC B;  4FNQ A;  3DTU B;  5AW2 B;  4KP4 A;  3ABT A;  3RT3 C;  3B4S A;  4B3S O;  1YI2 P;  1Y66 A;  1NWQ A;  3S3W A;  1SQX E;  1ZSP A;  1QGK B;  3KHU A;  5KA6 A;  2HEP A;  3UQ8 A;  3HD7 C;  3M7M X;  4U3F J;  2FY8 A;  4FM1 A;  1VQP V;  2F23 A;  2P1J A;  1SA0 B;  4O4I B;  2XN2 A;  1PD3 A;  2E2V A;  4DR1 O;  4FFB A;  3G67 A;  1VQO V;  2BAS A;  1SFC C;  3L75 G;  1LTJ A;  1IBK B;  4UV9 A;  2M3B A;  1VQ4 V;  5CHX A;  4D6T E;  1RJO A;  3CXH I;  1F4A A;  5FNV A;  1PP9 J;  2JJ2 G;  3H1L J;  1BDD A;  2D1W A;  2EAB A;  4DV5 O;  2P06 A;  3U0Z A;  3L70 H;  3ZRX A;  2Y0P A;  4JI7 O;  1GW4 A;  3OW2 U;  1F1S A;  2IJK A;  2WA4 A;  1QVG U;  5GW7 A;  4UCV A;  1KB9 I;  2HLO A;  2GDS A;  3DGE A;  4I50 B;  4J11 A;  1EZV D;  3AEB C;  2WSF J;  2KIK A;  1PNM A;  3SJQ C;  2KOG A;  2XT9 A;  3O8Z A;  1ZW0 A;  2JKA A;  1CI6 B;  3TYY A;  3MUD C;  1MN0 A;  1Q7Y Q;  2G8Y A;  3X2Q B;  1Y47 A;  2DW3 A;  3E7K A;  4PD4 E;  4JYA B;  2FXM A;  3RYF B;  1M57 C;  2P10 A;  3S9O A;  1D6U A;  3T0A A;  3JAL B;  4OPA A;  2QWR B;  3FX0 A;  3S4R A;  4FLT A;  5CA1 B;  5B66 E;  2EZP A;  1SF9 A;  4LF6 B;  3A0B Z;  3BHP A;  5LXT B;  1VQ8 P;  1GL2 C;  5AW9 B;  3H1J H;  4EOT A;  1HXK A;  1F9G A;  4WY4 D;  1V7X A;  4CH4 A;  4OX9 B;  1FAF A;  1AJP A;  2Y0I A;  3CC4 P;  1RY3 A;  1IZN B;  2HTB A;  3DYP A;  3AG4 C;  2KB7 P;  2WLN A;  4PD4 F;  5IJ0 A;  3DC6 A;  3GWK C;  3K5O A;  1DD3 A;  1RE4 A;  4QMA A;  4QE9 A;  1KC8 W;  1NS4 A;  1NKG A;  3M06 A;  1Q5O A;  2QKA A;  3AEG C;  1EN4 A;  4LF9 B;  2ZL8 A;  1K4C C;  1AVY A;  1XMQ O;  1UJW B;  4DUY B;  4AYC A;  1SNZ A;  2YDE A;  2HP8 A;  2P90 A;  1KEC A;  4FNS A;  1GDT A;  1QVG O;  5K1X A;  5JQG B;  4TT3 H;  4GX0 A;  3WUV A;  3L75 E;  5LOV B;  2PZS A;  3T1H O;  5KAI Z;  4B7K A;  4TV8 B;  2W90 A;  2N05 A;  1JY3 N;  4KJM A;  1GN3 A;  4I4T B;  4P30 A;  1FZF A;  3DCD A;  5LMN B;  2RQ6 A;  5IE9 A;  3VMZ A;  2YIB A;  5DM6 V;  2GTA A;  3CCQ V;  1KB9 E;  5B1A B;  5M1B A;  4DRX A;  2JP3 A;  1QBZ A;  1KYO H;  1R5S A;  3UCS C;  1KD1 Q;  1D2D A;  1N7Q A;  3CXH F;  2HYN A;  4NB5 A;  3ABU A;  4OWF A;  2QSI A;  4UCS A;  1PGP A;  2HKO A;  1IVV A;  3RRS A;  3K3W A;  1OJH A;  1BSH A;  1PL0 A;  3RW0 A;  3T2O A;  1UI7 A;  1NS1 A;  1RSO A;  4O4L B;  1M56 B;  4U3F E;  5C39 A;  4DUW A;  3SYQ A;  1XMO B;  2KS1 A;  5AW3 B;  2IBZ I;  3BA8 A;  4PI2 A;  1OW7 A;  1JJ2 U;  2YI8 A;  1DF4 A;  1NVP B;  2L5G B;  1R6N A;  1LF6 A;  1KB9 F;  4DR4 B;  1K4D C;  1HW7 A;  4G27 B;  1RM1 B;  2XKM A;  1H2L A;  1H2G A;  3ZMS A;  2WQY C;  1NTM K;  1QEX A;  3Q4H A;  2JS3 A;  1DLB A;  4AUW A;  5LGN A;  1FBM A;  4B3R O;  2WPS A;  2CIS A;  2ZYA A;  2C9L Y;  4I9W A;  5KHJ A;  3DEC A;  2RN0 A;  1N7S A;  4X64 O;  1IBL B;  1I5X A;  4X62 B;  4XDL A;  1OCO B;  4FLU A;  4B3M O;  2K3R A;  1ORQ C;  2Y74 A;  3E1F 1;  1EZV H;  3FB7 C;  1WB8 A;  1MAB G;  1FDO A;  2QM7 A;  1N7O A;  1JZ2 A;  1DD4 A;  4B3S B;  2QTS A;  1S72 V;  1XNQ O;  3F5W C;  3HD7 A;  3JAS A;  4YXD C;  1J0M A;  2QJK C;  5CCH D;  2CFL A;  1I08 A;  4R4L A;  2DYR B;  4OPH A;  2M3E A;  1N36 B;  4FLX A;  3A7O A;  1SFC A;  2YKQ A;  5DN6 G;  5B1O A;  1IFN A;  4DR6 B;  1NYH A;  1P49 A;  5K1P A;  2ZDI C;  1XQ8 A;  2H89 C;  2PGD A;  4X89 A;  1NTK K;  1H8H G;  2ZT9 C;  2JKE A;  2QWO B;  1SQB K;  1U7J A;  4GCZ A;  1FFX B;  1XL4 A;  2EIK B;  3Q5P A;  1NS8 A;  3RGU A;  3SJC C;  1CB8 A;  2FTK A;  5FLX N;  1H0T B;  2UWJ E;  1V7V A;  2B9Z A;  3CV5 A;  4WFF A;  4X1I B;  2JRI A;  3BA9 A;  1OFC X;  1JNM A;  3VQX A;  2F93 B;  1YI2 V;  3HI7 A;  2OCC B;  2KUB A;  2IBZ E;  3T1C A;  4L8J A;  1NU1 D;  3WFV A;  4EYY Q;  3BUD A;  1SQV G;  4GDO A;  4YIO A;  2DN9 A;  3R4Y A;  2A9H A;  5KMG A;  1FZA A;  2Q7H A;  2YIC A;  2F1B A;  4DYL A;  2Q4P A;  3MUD A;  1OCR C;  2H43 A;  3WA2 X;  2OAR A;  2IH3 C;  3H1K D;  3VSN A;  2GUV A;  2OYH C;  4QPK A;  1BCC H;  4GKK B;  3SJA C;  2XAS A;  3RL0 B;  3BY6 A;  1HDJ A;  1EDL A;  3G4S V;  4OGQ C;  3UO3 A;  2YEV A;  3HKB B;  4NYK A;  1BE3 G;  4UFC A;  4O4H B;  5AVZ B;  1MA1 A;  1SZT A;  2EIJ C;  1L4A D;  4WB4 A;  2HR3 A;  3EXA A;  3IC9 A;  3VTP C;  1TGO A;  1QLE D;  3AE9 C;  3CME P;  1QAK A;  3A5T A;  4EI2 A;  2Y9Z A;  1GL2 A;  1A02 J;  1H8A A;  2OTL V;  4LCU C;  2ETN A;  3JD3 A;  4TOI A;  3K58 A;  4PJ0 H;  1Q3E A;  3X40 A;  1WJZ A;  2LQT A;  5EZY B;  5TIS Z;  1NS2 A;  3B8N A;  4KTP A;  4RNL A;  4UB8 Z;  1U7M A;  3BLC A;  2UUC B;  5KLV G;  4PDV A;  5LMU O;  3X41 A;  1J95 A;  4TSF G;  1XTG B;  2FYN C;  1NZ6 A;  2JJ1 G;  1XEQ A;  1TVK A;  4Q20 A;  2QTO A;  1GK6 A;  2ITC C;  3CWB G;  1VF7 A;  2CAZ C;  1IXM A;  3TGU G;  1R73 A;  2XTA A;  2KB1 A;  3L74 G;  1G6U A;  1GMG A;  2FFD B;  3SXX A;  3EVK A;  1VQ8 V;  2E2U A;  2KLU A;  2ZAE B;  1J1E C;  5B5E E;  1GU4 A;  3Q2Y A;  1K1X A;  5APX A;  3GHG B;  4BRY A;  1CW5 A;  3BS6 A;  1KKD A;  1K73 Q;  3I3D A;  2F4V O;  1QL1 A;  3ZHV A;  2AW9 A;  1BZK A;  5L3B A;  4DR3 O;  2Q7C A;  3G3Z A;  1F4H A;  3M0D C;  5E1Q A;  5DED A;  2E74 C;  3H1J J;  1YIT V;  1QU7 A;  3SPH A;  1S9K E;  3H1I D;  5DJT B;  2QM8 A;  3P3P A;  1SQG A;  1NAY A;  2W6J G;  3AK2 A;  1HJ0 A;  5EFW B;  1JZ4 A;  1GW3 A;  3CXH D;  3QWO C;  2E22 A;  3SR2 C;  4JI2 O;  5JMF A;  2C2A A;  4FLZ A;  1R3I C;  4X65 O;  2QA4 P;  3FX7 A;  1OAC A;  3QFZ A;  4LF5 O;  4TV9 A;  3V4Q A;  1YJ9 P;  1FXH A;  4KFE A;  3UO2 A;  1PPJ G;  1PS3 A;  5EYP B;  2W8Z A;  1OV9 A;  2Q1F A;  4U7O A;  4EDF A;  1VMG A;  5KUM A;  3MIW A;  3ZJZ A;  2QEX P;  3VDB A;  5J2T A;  4U3J B;  1VQL V;  1OJP A;  4LFA B;  2Q8V A;  1USD A;  1JCH A;  2F7O A;  3H6P A;  1M1K Q;  1FZC C;  1VAR A;  3SWK A;  4QE7 A;  1KIL D;  5LP6 B;  3ICX A;  1D7M A;  2IZ0 A;  3KZI Z;  2V1D A;  4DUZ B;  2JDI H;  2P58 A;  3DYM A;  1GK4 A;  3L35 A;  3SYO A;  3P7K A;  1NQT A;  2GSM B;  1H2S B;  4YPC A;  3PH0 A;  4U3F D;  2XN0 A;  1OVU A;  2EIL B;  3RK3 D;  1OCZ B;  1I7F A;  4O2A B;  3EFG A;  3A8T A;  4N78 E;  3V6I A;  1KP3 A;  4B3M B;  1N73 C;  4J5T A;  1LUV A;  1NU1 H;  2A0L A;  4GKJ O;  1ZR4 A;  5AW7 B;  2R3S A;  1PP9 D;  1X59 A;  2ZCE A;  1SPU A;  2WSS G;  3H1L D;  3W7W A;  4WY4 B;  1HF9 A;  3B5N C;  3CCS P;  3CWB E;  3D4Z A;  1GH6 A;  1F7Y A;  4B3T B;  4AQR D;  1UG9 A;  3G71 P;  2FUQ A;  5FL7 G;  3KPE A;  2ZDI A;  1ZL8 A;  1IFD A;  1IVX A;  1CP9 A;  4OK4 A;  2O1K A;  1V9P A;  2E75 C;  2C0X A;  1D6Z A;  2P5O A;  3AG2 C;  2FKX A;  3JD2 A;  3D51 A;  4LC1 A;  3RYH B;  2CFD A;  4I5S A;  4DT0 A;  5FPO A;  3L70 E;  3CCR P;  5JVD B;  3IJ4 A;  3AE5 C;  1QLN A;  1IJD B;  3IAO A;  1PV3 A;  1OX3 A;  2N1T D;  2OTJ P;  2H7H A;  1NKD A;  4B08 A;  3ML0 A;  5AG2 A;  2I1J A;  2CG0 A;  1KYO I;  4PV1 C;  1U96 A;  2QWN B;  1NI8 A;  1PPJ E;  4LFB O;  2WT7 B;  2WCO A;  3ZN0 A;  2OYH A;  1K9M Q;  2QE7 G;  3UT5 B;  3UIA A;  2BTO A;  3TXQ A;  2CH7 A;  1IU7 A;  3WIQ A;  1U57 A;  2ZXQ A;  3MHS C;  3B40 A;  2EX3 A;  2HFE C;  3JAT A;  5J2U A;  3M9H A;  1N2D C;  2A45 H;  4ZOL A;  4UB6 Z;  5BY1 A;  1FC2 C;  5H6Q A;  1OMI A;  1L0N H;  3K5M A;  4LGD E;  3H1J E;  1YBK A;  4L76 A;  2HG5 D;  2PI4 A;  4C7N B;  3ASO B;  1AR1 B;  2XHN A;  5GTH Z;  1UII A;  3CMA P;  1M7L A;  2QJY B;  2DE0 X;  5L3F A;  2V4H A;  5KX5 A;  3H1I H;  5GON A;  4RQE A;  2L6L A;  4UV8 A;  1GM8 A;  1WAZ A;  4BAY A;  4YXW G;  1SQQ D;  4NXN O;  1HN0 A;  3A0H Z;  3J81 N;  2ZXE B;  3AE6 C;  1NSS A;  2XND H;  3D3I A;  3HTK B;  2QKS A;  1RHZ B;  1EZV I;  3WU2 H;  4X66 B;  2WDA A;  3BLB A;  1VF6 C;  2XAF A;  5BMV B;  1FKA O;  3AE3 C;  1AP6 A;  2WSE H;  3HUS C;  1BCC J;  3V2P A;  5H2F H;  1N0N A;  2OWO A;  2K9P A;  1HMU A;  5IY5 B;  3CX5 H;  2LXB A;  5KKZ C;  2ZKO A;  2Y48 A;  2F4V B;  4X9Q A;  3QVN A;  3M0D A;  3RSY A;  4FLY A;  3WB2 A;  2Q7E A;  2ZVO B;  1SO0 A;  1RF0 C;  2JGD B;  3FXD A;  3MV0 1;  2NR5 A;  2LFS A;  1KYO E;  4LBE C;  1HNZ O;  4BZF A;  1P7B A;  3SYC A;  2V4D A;  1JYW A;  4JYB A;  2M6Y A;  3CCV V;  3BCC G;  3U1C A;  1TQU A;  1L1F A;  3SPJ A;  1NTZ G;  2A06 D;  2E5Y A;  3TSI A;  4X65 B;  1VL2 A;  4MVS A;  4UVA A;  1PP9 H;  1VQP P;  5GTI Z;  3BRV B;  1IFM A;  4DV7 B;  3QH9 A;  3T0B A;  3TJT A;  1T5E A;  4R6Z A;  4FLV A;  3PP5 A;  4FNU A;  1AQ5 A;  2QSA A;  1KYO F;  1FZC A;  5CBH A;  2GHY A;  1YTZ T;  2E5L O;  4DO2 A;  1K5S A;  2D3O W;  4NPF X;  1S5J A;  1Q6I A;  5APV A;  1LUR A;  2IJI A;  1OZ0 A;  1IFJ A;  4FM2 A;  1W2B U;  2CDY A;  1EN5 A;  1MMX A;  4J42 A;  4N21 A;  2WPD G;  1N9E A;  1SVF A;  3HKC B;  1NJI W;  2YXH A;  4J7K A;  3ZRS A;  4M3L A;  4DV6 B;  5L3C A;  1N73 A;  1QLE B;  1FYJ A;  1NHL A;  4GKJ B;  1EZV E;  5H9C A;  4CH5 A;  3JCU H;  3N2K A;  2XSG A;  1W2Z A;  2PAJ A;  3B5N A;  3GF7 A;  2XAG A;  1CPY A;  5C8Y B;  4H44 C;  3RWR D;  4KUM A;  2X6A A;  1G1J A;  1QX1 A;  1NSU A;  1KTM A;  2SPZ A;  3CJH B;  4XDJ A;  1JZ7 A;  4HYO A;  1IK9 A;  3TXS A;  5E79 H;  3CCE V;  5JH7 A;  2K9J A;  4PI0 A;  1W59 A;  1VQK P;  4ZHQ B;  4FZ1 A;  1Y6X A;  3TNU A;  5KLI B;  3RK2 D;  4A7P A;  2W0X A;  2BSK B;  4JI0 O;  5KTB A;  1K8A Q;  5B66 Z;  4X20 A;  3RYI A;  1GN6 A;  1HR0 B;  1M4U A;  4WBN A;  2IX7 C;  2ZQM A;  1K3E A;  4F6R B;  2VQE O;  3CCS V;  3D6Z A;  1SQQ H;  1DX7 A;  1L0L H;  1W2B O;  2MKV A;  1JO5 A;  1IFP A;  1CXZ B;  4LFB B;  3HD7 D;  2KP8 A;  1TUB B;  3ZX6 A;  4A5U B;  3RVZ A;  3AFL A;  4KFF A;  2IU0 A;  1GN2 A;  4G2K A;  4I7Z B;  4D7T A;  4ZI7 B;  2P4V A;  4E2L A;  1Y76 A;  1SC5 B;  1PX3 A;  3TY1 A;  2R32 A;  4K35 A;  2I8D A;  2OTK E;  2HLD G;  2DYS B;  2JVD A;  5KHK A;  2WMM A;  1Q81 Q;  4UUJ C;  1FJG B;  3ETE A;  4KHP B;  3BVW A;  1BGY G;  2BCC G;  3VD9 A;  2F18 A;  4RES B;  1KMI Z;  2WAM A;  1LTS C;  3HRN A;  4PJ0 E;  4E4E A;  3LDE A;  5A9G A;  3JD0 A;  2P6J A;  3FB6 C;  1SQX G;  4CPG A;  4WFH A;  3X2Q C;  1SZX A;  1M90 W;  1JEK A;  1FD9 A;  4I0X A;  4TTG A;  3E22 A;  2BRV X;  3E8F A;  2A06 H;  1G2C A;  3E1I A;  1KIL B;  4Y28 J;  1TQT A;  3CCL P;  2Y9Y A;  4DV4 B;  1AQT A;  1WA8 A;  4QPJ A;  1BQ0 A;  3D8C A;  3OR7 C;  2DOS A;  5AW6 B;  1VF6 A;  2XOK G;  1N8R W;  1IFI A;  3A0B H;  3H1K G;  1Q90 D;  3K03 A;  3OR6 C;  3DX1 A;  4X1K B;  4EIJ A;  2J59 M;  2UUA O;  5LHH A;  2ZR2 A;  1KQG B;  2V7Q J;  1JVM A;  1NSR A;  4JQ0 D;  1GL2 D;  1FS0 G;  2WLL A;  2W6A A;  2WVZ A;  1JA8 A;  4RQF A;  2WW2 A;  2YIU B;  1L0N J;  2X6B A;  1RF0 A;  3RYC B;  2UUB B;  3KYQ A;  1X79 B;  3ZHU A;  4OVN F;  3ZIA G;  2OGU A;  4TUY B;  2KSJ A;  2KG7 A;  1HNZ B;  4BWN A;  3CLQ A;  1NKZ B;  5APW A;  3LIE A;  3BEH A;  4UXN A;  4MSW C;  5ITZ A;  3H1I J;  4Z1M H;  1MZF A;  5IYC O;  4KTR A;  5KLV K;  3WMM 0;  1N4C A;  1ULV A;  1S72 P;  1IXB A;  2XNX A;  1DEB A;  2FYU J;  1JUN A;  3HKD A;  1PIX A;  2FL4 A;  1L2P A;  2W0Q A;  2EJ7 A;  5KAI H;  1LXK A;  4LF8 B;  2YFN A;  1URQ D;  2B87 A;  4JBZ A;  3AEC C;  1WMK A;  1W5Z A;  4BIO A;  2Y73 A;  2BOC C;  4BW9 A;  1OWA A;  2B88 A;  2X6C A;  2WVX A;  2R3C A;  5B1A C;  3V5B A;  1WP8 A;  4UFZ A;  1PGQ A;  1QCE A;  4LF4 O;  4LFC O;  3T4D A;  2E5L B;  1KYO D;  2G3A A;  2JWA A;  3CC2 P;  2WYI A;  2Y69 B;  1TQS A;  2WA3 A;  4O2B B;  3JAW A;  3FWN A;  2A45 I;  1VF5 D;  1M56 C;  5LA6 A;  4GLX A;  1H2K A;  2AHY A;  3MUZ 1;  2Q9L A;  1RE3 C;  1ZLZ A;  3IN6 A;  1T2K D;  3QFY A;  5KJ7 C;  1NU1 E;  4FVM A;  2KK7 A;  1RM1 C;  2Z4E A;  3VD5 A;  3BFR A;  2YSU B;  4CS3 A;  2F7Q A;  3N2G B;  3E1R A;  1LP1 A;  4MW8 A;  2UU9 O;  2D2C B;  2G38 A;  1YVW A;  3MUY 1;  3L71 H;  3H1K E;  1JFF B;  3G4S P;  2H8P C;  3KXD A;  1Y74 B;  3CS5 A;  1N7P A;  1J5E O;  1SQP H;  2CPB A;  2VRZ A;  1S76 D;  3OJA B;  4TLF A;  2ZNI A;  2K9Y A;  4IFD K;  4DV2 O;  2E76 B;  5L3D A;  1QQC A;  2OTL P;  2UXN A;  3L36 A;  1B6Q A;  1FS0 E;  3MTU E;  2B5U A;  1NSX A;  2HPC A;  2CQT A;  5DEC A;  5H6R A;  3E86 A;  1B3Q A;  5L3G A;  1WB7 A;  1EDK A;  1AI6 A;  2WLK A;  3CX5 I;  4DR2 B;  5EBW C;  2ZM6 O;  1OCC B;  1SA0 A;  2IYO A;  4U3F G;  4O4I A;  2DYR C;  2IJH A;  1VP7 A;  3CHX A;  3N7N A;  4YHH O;  1PFI A;  2EZO A;  2F7P A;  1LT9 B;  2VQE B;  2NN4 A;  1JQ0 A;  1KUQ A;  3ZDM A;  2PFX A;  1IQY A;  5HFM A;  4WVZ A;  2Z5I A;  2O01 J;  1MFZ A;  1KC8 Q;  3W7S A;  1YIJ V;  3H1L G;  3QF7 A;  5KHH A;  2UXC B;  1XBL A;  1Y4M A;  1HTL C;  5LGT A;  2CWU A;  1NTM D;  1RPR A;  2IU3 A;  3AE1 C;  3RBX A;  1VQK V;  3A2A A;  4Q6G A;  2OYO A;  3I3B A;  2ADP A;  2GUZ B;  2OCC C;  2Q5Z A;  1VPC A;  1WT6 A;  3FAV B;  3U59 A;  4ZMD A;  1AA0 A;  1YIT P;  1CI6 A;  1MKM A;  4QNH B;  2IYP A;  5B5E Z;  3WVF A;  2DQ3 A;  1Z5W A;  4WFA V;  3H1H H;  3GG2 A;  2PYJ A;  3L9D A;  3H1I E;  1NSZ A;  1FOS E;  3RYF A;  3WA3 A;  1QHT A;  4JI6 B;  1BCC D;  2AXT E;  1BHB A;  3JAL A;  3RL0 C;  1KKC A;  3OW2 O;  1H88 A;  3CXH E;  1R1B A;  1Q7Y W;  1PM9 A;  4PEL A;  2XAJ A;  3JAK B;  4LWS B;  5CA1 A;  4JZG A;  1XNR O;  3PLN A;  3V2Q A;  3ABV C;  2Q69 A;  3D50 A;  1SQQ J;  5AVS B;  1L0L J;  5TJH A;  5LXT A;  2PYL A;  2R72 A;  5LL6 Y;  1G8M A;  1US6 A;  4Z2W A;  3WU2 E;  4WF9 V;  1VQL P;  3L4F A;  4ASU G;  3D4Y A;  4MTO A;  2M7W A;  4NKG B;  1NTK D;  3WUU A;  1YQ2 A;  3C1L A;  3CP1 A;  1SQB D;  5H2F E;  4YTP C;  3FFQ A;  1N32 O;  1FOS F;  3F5T A;  1Q2N A;  3HB3 B;  2QM4 A;  2IH1 C;  3ZHT A;  1KIL E;  4GOD A;  4NTY A;  4H13 B;  1FPO A;  4JYY A;  1KN7 A;  5JWP A;  1YJW V;  1ZN5 A;  2IBZ G;  2NPS B;  1A2V A;  1HNW O;  2EAD A;  3ASN B;  2QKC A;  2GBO A;  1OJN A;  2E2T A;  2WTY A;  3CCL V;  3VN0 A;  3L72 D;  1E1R G;  3ZMT A;  5JQG A;  3T1Y O;  4RWU A;  4K0K O;  3L37 A;  3RK3 E;  4YJ3 B;  2WGQ A;  1YYC A;  5LOV A;  2FFD C;  1J0N A;  4I55 B;  4TV8 A;  4HYT B;  1SRY A;  1KBH A;  4ZKU A;  3CX5 F;  4I4T A;  2C9N Y;  3GHG C;  4UCT A;  3ABM C;  1PP9 E;  3VMA A;  2CFW A;  1SQF A;  3FB5 C;  3OS7 A;  3RK2 B;  2OYI B;  2MW2 B;  3H1L E;  4XFJ A;  3Q1N A;  4MTX A;  2E5T A;  2Y0D A;  3D6Y A;  2KKW A;  3JD1 A;  4DK0 A;  4LF4 B;  4LFC B;  1YTZ I;  1LF9 A;  2A3Q A;  2A79 B;  3NRE A;  1BDC A;  3SGI A;  4MW3 A;  3AG7 A;  5BR8 O;  4O4L A;  1KD1 W;  2AZ0 A;  2E74 D;  2L35 A;  4PA9 A;  1XHZ A;  3MV1 1;  1EXJ A;  1YCI A;  3LVT A;  1S5L H;  4GUN A;  3DXR B;  1RE3 A;  4BIZ A;  3IFM A;  2UXX A;  1K04 A;  3BVU A;  2YUA A;  1N33 O;  5KJ7 A;  5AVQ B;  2RH0 A;  2EUL A;  4DR1 B;  5LYJ A;  3JCU E;  3ABK B;  2O01 N;  3VQV A;  4H0L D;  1NTZ K;  3L73 J;  5CN0 A;  2UU9 B;  3T2P A;  5LP6 C;  4RO0 A;  3VSM A;  1AB3 A;  4C46 A;  2CK3 G;  3HE5 B;  3ZHQ A;  4HKZ H;  3KZI H;  4QJF B;  3CC2 V;  2DW4 A;  1P7G A;  1J5E B;  3IGA C;  5KAF H;  3EJP A;  1NTM H;  2ILM A;  1VQ9 V;  3OAK A;  1HBW A;  3VOU A;  1SQV J;  4DV5 B;  1Q6U A;  2RCV A;  2EIL C;  3CI9 A;  1OCZ C;  4JI7 B;  3K5T A;  3MHV A;  2BE3 A;  3OM3 B;  5E79 E;  3J7H A;  3VMX A;  3OMN B;  1LTB C;  2KZJ A;  1SII A;  1FDI A;  1WNS A;  1Y9B A;  3ZCC A;  1BS3 A;  5LBQ A;  1JTH B;  3OUS A;  4PDR A;  3T97 B;  3KCX A;  2YNY A;  3M0A A;  3K9A A;  4IYI A;  1Q86 Q;  1DH3 A;  4DW0 A;  2WPQ A;  2YO3 A;  2F66 C;  4MVU A;  5JJN B;  5IDJ A;  1X22 A;  2LFR A;  4CC5 A;  1P84 D;  1SQQ E;  3ETD A;  4K8Z A;  3MP7 B;  1GAX A;  4HB1 A;  2CWV A;  3D36 C;  4J9Z B;  3LOY A;  4JF3 A;  4JI1 O;  2POH A;  2Q0O C;  3B5N D;  1FFX A;  3S4B A;  2UXB O;  3ACT A;  3GF3 A;  2WLH A;  2ZE5 A;  1H0T A;  4J10 A;  1F4N A;  4X1I A;  1W0J G;  3L71 J;  1NTK H;  3WUT A;  2VQF O;  4IGG A;  4I2L C;  1SQB H;  2YXL A;  4JI3 O;  3RBZ A;  3D52 A;  1SQP J;  2N9Y B;  2CFK A;  3SWY A;  2JR8 A;  5DJU B;  2E43 A;  1RWC A;  2LP7 A;  3C9I A;  1LVN A;  1W7C A;  2RJZ A;  4WBA A;  4BTW A;  4HH2 A;  2EJR A;  4DZO A;  4N3Y B;  1GD2 E;  4IFM A;  2DWD C;  1URQ B;  1T3U A;  4FLW A;  3TGU J;  1UFI A;  1JRQ A;  1QWN A;  2XN1 A;  3K25 A;  3L74 J;  3VBB A;  3ZHR A;  4MVZ A;  2FBW C;  1F51 A;  1XMQ B;  5BXZ A;  2P67 A;  3CCV P;  2Q1K A;  3OTO O;  2R44 A;  3L72 H;  2Z0A A;  3P30 A;  3HKB A;  5BU8 B;  1X4T A;  4O4H A;  2KQX A;  1IBM O;  2A06 E;  1W0K G;  4MVO A;  3T1H B;  1KP2 A;  2QDO A;  3BAB A;  1VF5 B;  1JR9 A;  1NO4 A;  3A0B E;  3W7T A;  1L0N D;  5EZY A;  2F95 B;  3IAY A;  1YGA A;  3X3Y A;  2ZR3 A;  2QJP B;  1EN6 A;  1DP0 A;  3IR9 A;  2HFE D;  1HUC A;  1IZ3 A;  2WW3 A;  4WFE A;  1S0V A;  3APQ A;  2LXC B;  2QRX A;  4DW1 A;  3BVH A;  1ZUQ A;  3L70 G;  2CTQ A;  2FYU D;  5IYB O;  2DMX A;  3SPG A;  1HNW B;  5E1A C;  2VS0 A;  2VWJ A;  1I94 O;  2JEU A;  3C90 A;  3CZN A;  4HBN A;  3H1H J;  2FFD A;  4DR5 O;  1CSB A;  1SQX K;  1JJO A;  4HJG H;  3CCJ P;  3CCM P;  2CQS A;  2Q6A A;  3P8M C;  4PA6 A;  3GHG A;  4IL6 H;  4YJ2 B;  1NU1 K;  1EFR G;  3VD4 A;  3CX5 D;  1GKF A;  1LJ2 A;  1HMW A;  3AED C;  4JPR A;  3LDD A;  1XTC C;  3AE2 C;  4B3R B;  4MMH A;  1RPO A;  3H1J G;  1K73 W;  5IYZ B;  2OIG A;  4CS2 A;  1VQN V;  1USE A;  4I1L A;  5AVV B;  3KDP B;  3CCE P;  3IF4 A;  1MZ9 A;  3E35 A;  3K0D A;  4N6J A;  1K7D A;  3AG3 B;  2M5A B;  4X64 B;  5CBO A;  3P32 A;  1BL8 A;  1XI1 A;  1JB0 J;  2M0B A;  4GOE A;  1BSM A;  1FXK B;  1M9N A;  5F2V O;  5EYP A;  2R70 A;  3TK1 A;  1GM7 A;  5IJ9 B;  1NS7 A;  5CB4 B;  1XNQ B;  1RWG A;  4U3J A;  1N33 B;  3CXC U;  3BUB A;  5LHI A;  4BTX A;  2KSD A;  2CIQ A;  4IOI H;  1P84 H;  2YFO A;  2BRW A;  1R5L A;  3B71 A;  4TT3 G;  1ZOY C;  4MVM A;  1EC5 A;  5LP6 A;  3VDC A;  2FXP A;  1JOC A;  2ATK C;  2WWW A;  3K9S A;  4LLH A;  1M1K W;  1BSN A;  2CUG A;  3G80 A;  3K79 A;  4BWA A;  4D6T H;  4O2A A;  1K33 A;  2ITA A;  3B8E B;  1FAV A;  1BMF G;  4KFD A;  4W4K A;  1QLE C;  2P7J A;  2BTQ B;  3OBA A;  3LSQ A;  1W6C A;  4MS2 A;  3G6E V;  1NSV A;  2HJF C;  3E80 A;  2Q5U A;  1UPG A;  2N9B A;  4B86 A;  3OMA B;  4U7N A;  3HKE B;  5LGU A;  1A02 F;  1L7J A;  4KL1 A;  1L7K A;  3LNM B;  4OJZ A;  4JPZ B;  2XUM A;  1RQU A;  3JAT B;  5CA0 B;  3QO8 A;  1V7W A;  3SFE C;  3BUQ A;  3HE4 B;  2EAE A;  3GLM A;  4PJ0 Z;  2V7Q H;  3I55 P;  3D36 A;  3S1K A;  2O1J A;  4DR7 O;  2F43 G;  4J7J A;  1AIL A;  1AV4 A;  4RAI A;  4Y99 B;  3I56 P;  3A2F A;  2UXB B;  5BU5 A;  1N34 O;  1H2N A;  1M8O B;  1S3J A;  3RYH A;  1OJM A;  5KLI C;  4LNU B;  3F7V C;  4ASV A;  3QG0 A; 
#chains in the Genus database with same CATH homology
 2WMM A;  1OVR A;  1U7J A;  2LXB A;  2LXC B;  2QRX A;  3BVW A;  2B87 B;  3RGU A;  1LT1 A;  1HXK A;  1BDC A;  1H0T B;  2F18 A;  2UWJ E;  2P58 A;  3CV5 A;  5CBN A;  3EJR A;  1EDK A;  2FYV A;  2JWD A;  4GOF A;  3PH0 A;  1R33 A;  3FXD A;  1OVU A;  1EDI A;  3LVT A;  4CPG A;  2KUB A;  1NVO A;  4EYY Q;  3BUD A;  3BVU A;  4BXL A;  1TQU A;  1DEE G;  2F7P A;  3CZN A;  3ZDM A;  1TQT A;  4HJG H;  2F1B A;  5K5G B;  3BVV A;  1TQV A;  3D4Z A;  2OW6 A;  4ASW A;  1EDL A;  2B89 A;  4HKZ H;  4NPD A;  3DX1 A;  3CZS A;  3EJP A;  3MZW B;  2HR3 A;  4KJM A;  3BUI A;  2I8D A;  1LP1 B;  4NPF X;  1HWW A;  3MHV A;  2M5A B;  3FXE A;  3D51 A;  2KZJ A;  4ZMD A;  1TQW A;  5CBO A;  1MFT A;  2LR2 A;  2M0B A;  3EJT A;  4GOE A;  3BVX A;  1EDJ A;  1U7M A;  4ASV A;  2RKL A;  1O7D D;  3BUB A;  4NPE A;  5C39 A;  3BUP A;  4IOI H;  3D50 A;  2OW7 A;  4HB1 A;  1EC5 A;  1X0T A;  2B87 A;  4JBZ A;  1QX1 A;  4WWI A;  1QWU A;  1H0T A;  2QVA A;  3DDG A;  2B88 A;  4K3A A;  3D4Y A;  3EJQ A;  2SPZ A;  2ZAE B;  3EJS A;  2F7R A;  3D52 A;  1R34 A;  2WYH A;  1BDD A;  1FC2 C;  1Q2N A;  3BVT A;  5DJU B;  2WYI A;  3DX4 A;  4ZNC A;  1TQS A;  4GOD A;  2F1A A;  3EJU A;  3DX0 A;  1QWN A;  5DJT B;  2KI7 B;  2K3R A;  2ALW A;  2Q1K A;  2R44 A;  5EFW B;  3QWO C;  1JMB A;  2KIK A;  1HTY A;  1ZW0 A;  4MN4 C;  3BUQ A;  2KZI A;  1ZXG A;  2F7Q A;  1PS3 A;  3S1K A;  1LP1 A;  1Y47 A;  3BLB A;  1SS1 A;  2M5A A;  3DX2 A;  3DDF A;  1OVV A;  1S3J A;  5KBP A;  3DX3 A;  1JM0 A;  2F7O A;  4K35 A;  2OTK E;  2KS1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...