4K35A

The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
719
structure length
719
Chain Sequence
DDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEAPLLTYAYAHHLTSIDDSNVKRTDMTLQSATKGPMTALVGNEWTLRETELSPVEWLPLQAAPNPTTINEIMTEINKDIASNYTQETAKEDNYFSGKGLQKFAMLALILNKSDQTQLRNPELAQIALDKLKAAFLPYLQNEQADPFRYDTLYKGIVAKAGLPTSMGGTDDLSAEFGHSYYSDHHYHQGYFVVTAAIIHHLDPTWNADRLKAWTEALIRDVNNANDGDEYFAAFRNWDWFAGHSWAGGIKPDGALDGRDQESVPESVNFYWGAKLWGLATGNTPLTKLASLQLAVTKRTTYEYFWMLDGNKNRPENIVRNKVIGIYFEQKTDYTTYFGRFLEYIHGIQQLPMTPELMEYIRTPEFVSQEWDEKLGAIAPTVQSPWAGVLYLNYAIINPAEAYPALRKVQMDDGQTRSYSLYLTATRPHFFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
pubmed doi rcsb
source organism Rhizomucor miehei
molecule tags Hydrolase
molecule keywords glycoside hydrolase family 81 endo-beta-1,3-glucanase
total genus 246
structure length 719
sequence length 719
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain
A PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1170 Mainly Alpha Orthogonal Bundle Helix Hairpins glycoside hydrolase family 81 endo-[beta] glucanase 4k35A03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4k35A04
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 4k35A02
3EJSA 1EDKA 1U7MA 2B88A 1MFTA 2KIKA 3MZWB 5DJTB 2KZJA 1BDDA 1R34A 3BUDA 5CBOA 2QRXA 3DDFA 3PH0A 1Q2NA 2M0BA 4ASVA 2F7PA 1U7JA 4HB1A 5DJUB 2F1AA 5K5GB 1LT1A 3BVXA 2M5AA 1TQVA 4EYYQ 1DEEG 3FXDA 4HKZH 2WMMA 4JBZA 3D4YA 4GOEA 1QWNA 2WYIA 5KBPA 2UWJE 2OTKE 1H0TB 4BXLA 2SPZA 3RGUA 3EJQA 1ZXGA 4ZMDA 1EDLA 2LXCB 2FYVA 3CV5A 1Y47A 3FXEA 1EC5A 1JM0A 4CPGA 2F1BA 1PS3A 5EFWB 3BUQA 1H0TA 3BVVA 3MHVA 1S3JA 1QWUA 1HXKA 4IOIH 3DDGA 3DX1A 2F7RA 2LXBA 2M5AB 2OW6A 2ALWA 1LP1A 4GOFA 2K3RA 1NVOA 3D51A 3BUBA 3D52A 2B87A 2QVAA 2KS1B 4GODA 1EDIA 3BUIA 1O7DD 4NPEA 1LP1B 2R44A 1OVUA 2OW7A 2KUBA 1R33A 4NPFX 3ZDMA 3BLBA 1X0TA 1TQWA 2B89A 4KJMA 1JMBA 4MN4C 4K35A 3DX4A 3EJPA 1TQTA 4HJGH 4NPDA 3D4ZA 2P58A 2HR3A 1OVRA 2KI7B 3BUPA 3BVUA 3DX2A 4K3AA 3DX0A 1BDCA 2RKLA 3DX3A 3BVTA 4ZNCA 4ASWA 1TQSA 3EJTA 1HTYA 3BVWA 2B87B 2F7QA 2F7OA 2WYHA 1EDJA 1QX1A 2JWDA 1SS1A 2KZIA 3CZSA 2F18A 3LVTA 3D50A 4WWIA 5CBNA 1OVVA 2I8DA 1FC2C 1ZW0A 3S1KA 2LR2A 3QWOC 1HWWA 3CZNA 3EJRA 3EJUA 1TQUA 2ZAEB 2Q1KA 5C39A
chains in the Genus database with same CATH superfamily
2OQEA 2X7RB 5CBGA 2RNBA 1K9MW 1J2JB 1NR1A 3DYPA 1U7MA 3OM3B 1VQPP 2H94A 3WMM0 1KN7A 4J7KA 1VQNV 1GAXA 2XU6A 2OOVA 4B3SO 3T2PA 3L4FA 2UXCB 2H3OA 1NYHA 4B3RB 2V4DA 1LTJC 1D2DA 3H1IE 4I0XB 2KG7B 1SQBK 3ICXA 1Y8AA 1NTZG 5E79H 1DF5A 1Y67A 2FB5A 2QDOA 2L5GB 2RN0A 2F1AA 2X0LA 3JSVC 2Q67A 5IWAO 1SZTA 3BVXA 2BOCC 5IYCO 5K1XA 3JD3A 2Q8VA 2ZR3A 1K73Q 3ZS8C 1V7WA 4X20B 2QE7G 1H8HG 2OCCC 2YDEA 1VQLV 4GKJO 2UWJE 4ZI7B 1OX3A 5APVA 1SQPJ 1K1XA 4YIOA 1NU1H 1YF2A 1DIPA 5ITZB 4AQRD 1IZ3A 1JQ0A 1Q7YW 4MTOA 2E75C 3PRJA 1IFPA 3IAYA 3CCEV 2H43A 2CAZC 2PYJA 4IOIH 1VQ9P 3DDGA 5JH7B 1L4AB 1UG9A 5AVWB 5LXTA 3LW5H 3MHSC 3L71J 3B8EB 4EFEA 4DV1B 4CS3A 4EI2A 1JOYA 2EIKB 1NGMB 4DUXA 1SQBH 2JWAA 2P4VA 4UFCA 2XOKG 2HG5D 1IZNB 2IJJA 1L0NG 4G27B 1LR1A 2KUBA 2QIWA 4DO2A 1SQXJ 5AW1B 1WRGA 1X0TA 3AE8C 3RYHB 1L0ND 4DUYB 1BZKA 3IJ4A 1N36B 4JI2O 4J5TA 3KQGA 5IDJA 1T5EA 5IE9A 2WT7A 3CPWO 3OW2O 3D4ZA 1N32B 3T1YB 1K4CC 3AG1B 4DR6O 1H89A 4CH3A 2M8RA 4DR5O 1EXIA 2DMXA 1RQVA 4HNAA 4FM2A 2WPRA 4FLUA 1BGYE 1JFFB 2E2UA 1YIJV 3G9RA 1IU7A 2B87B 3K0DA 2Q9LA 3AE2C 4RO0A 5J2UA 2WSFH 2WLJA 3BA9A 3E8FA 4FNQA 2IPPA 1NTKH 4DR7O 1N7RA 4JI5O 1RP3B 1Z2GA 2ZIMA 1K8AQ 3D50A 1W7CA 4MVQA 2OGUA 3JCZA 2Q4PA 1KYOH 2XNXA 1S1CX 3E7KA 1NKGA 2W8ZA 2JRIA 5B66Z 1JJ2U 2WVXB 2RN9A 3ACTA 3JD2A 1HWWA 2WGQA 1TVKA 4FM1A 3MD0A 3P8CD 3L72D 2W0QA 3EFFK 2YXQB 4WY4B 1WAZA 3CCQP 3HD7C 1TQUA 1F4AA 2C11A 2CWTA 3K06A 1FE6A 3JAKA 3RL0C 5LGTA 1DX7A 1QR9A 3GHGA 3WA2X 2OIEA 3OFNG 3SPHA 1QLEC 2QM4A 1J1DC 2IJIA 2A0LA 3MZWB 3VDAA 1KB9F 1I94O 1KD1W 1NTZD 1XI1A 4I55B 3PH0A 3K5BA 1VQ4P 4OWFA 4JI6O 3T2OA 2QSAA 1NSXA 4TV9B 1SQQE 3J7HA 3FX0A 1FS0E 1ZL8B 3ZMUA 5KLVE 1JZ3A 3SXXA 4H37A 2PY5A 2LW1A 3SYPA 1N34O 3FAVA 3NMDA 3FXDA 4PDRA 2Y69B 1FDIA 1DEBA 2BCCG 2GHYA 2E76B 4GOEA 1RWGA 2AXCA 4GUNA 4N23A 2Z5IA 5IYDO 3M0AA 3MUDA 5TISE 1JZ5A 3K59A 2P4KA 5TJHA 1JVMA 4NEIA 1OW7A 4JV5O 2LKMA 1J1EC 3UQ8A 2RQ6A 3CV5A 1KP2A 2HLDG 3GG2A 4J7JA 3OT7A 1USDA 1PS3A 1OJHA 1W59A 2P7TC 3AK2A 4KXRA 3K9SA 4LFAO 2N1TA 1IBLB 2AXTH 3R2PA 3Q3DA 3CJHA 5JJNB 4LGDE 1Z5WA 2CFLA 1NU1J 4EFBA 5IYZB 2ALWA 5L3DA 1RWHA 1XEQA 3TF5A 3FGAD 3D51A 2QEXP 4FLTA 3SGIA 3C1LA 1T3UA 2R3CA 3PHLA 2G3AA 4BRYB 3IMHA 1SQXE 2CFDA 2QJYC 1WMPA 3B2EE 3BAAA 1XQ8A 3B5NB 2OYIC 1VEWA 5J2TB 3CCJV 2JK5C 5AW7B 1C82A 3CRQA 4I9QA 1FU1A 1KB9D 1PP9D 2WW1A 3NR7A 3DX4A 4YPCA 1N8RW 3K0GA 2P58A 2HFED 1N73C 4H44D 3BRTB 2JDIH 3NBJA 3BATA 4QE7A 4H13C 1AI7A 1ZX3A 5FLXN 3S3XA 2ITAA 3T2MA 1OZ0A 5LYJA 1MMZA 2DYRB 5LOVA 3CXHH 1ZLLA 1TUBB 4B08A 3CCLV 5EZYB 4H0LB 1JTHA 1M1JA 4W80A 5B5EE 5CCHC 4I7ZB 4JYBA 1MKMA 2EJRA 1B3QA 1T8ZA 1IXBA 1PM9A 3KZIH 4FLXA 2WCOA 4AQYO 1FZEA 3VMZA 2CGOA 3CC4V 2FFDB 2EILC 4WFAV 1JZ2A 4WF9V 2I1KA 1NTMK 2BEZF 4N3YB 1VQ5P 1KILE 1IBKB 2QWOB 1FYJA 2ARHA 2KSDA 1F1SA 2OOVC 1J5EB 2Q7EA 1PZQA 3KPEA 1AVLA 4OGQC 1VF5B 3P30A 2XN0A 3FFQA 3MI6A 3CCRV 5J2UB 4FK5C 2KKWA 3NREA 3ETGA 1AJPA 3M9BA 1PP9E 2OTLP 1MABG 3VQVA 1TU3F 3UO2A 3HTKA 3MHHC 3G6BA 1FAFA 3GHGC 1GL2D 1XNRB 2JEXA 3X40A 2WMMA 1VP7A 1MV8A 2YO3A 1NS4A 1GO3F 1N36O 4JI2B 2OARA 1M90Q 1HNXO 4PHZA 5KJ7D 2ZVOB 1I94B 4KP4A 4I2LC 4H44B 4K8ZA 4U7OA 1OW8A 3NTNA 1JY2P 1S5LE 1LF6A 5E1QA 2JP3A 3S4CA 2F4VB 3RSYA 1S77D 1JCCA 1CPYA 3KCYA 4JF3A 2D2CC 2ZE5A 1JY3N 4DR2B 4O9BA 3WUUA 1OJOA 1WMNA 3IFMA 3GB7C 4TV9A 1HXKA 5B66H 2F7RA 3SX1A 4DCKA 3AEEC 2OW6A 1H2LA 2P90A 3CCVP 2GTAA 3CC7V 1V55B 3J80N 2DWEC 2A06H 1R5LA 3T4ZA 3WIRA 2XHNA 1PL5A 3OS7A 1OXZA 3TGUJ 1EKMA 1Q5OA 3RFRA 1GK4A 3E89A 3CCSV 2GUZA 1AV4A 1IQXA 1KORA 3WUTA 2P67A 3G4SP 1EQ7A 2Y0IA 1OCRB 2XT9A 4DUYO 3U1AA 5LHHA 2OTLV 3ABMB 4AILC 3ABLB 2K9JB 1SS3A 4AUWA 3QNEA 3TNUB 2OYHC 1ZMEC 3CRMA 2QE7H 1DH3A 4DV2O 1I08A 1M9NA 3DX3A 1JA8A 3THOA 5EIBD 2B9ZA 3CWBD 3L74G 3ECQA 4I55A 3ZN1A 5D5QA 3TNUA 3QO8A 5CCGD 2CG0A 1EDJA 1KB9I 4DV3O 5KHJA 1OJMA 4ZOLB 4PD4E 4B3SB 2Z0AA 3R65A 2NNUA 1KFNA 1M57B 4GLXA 1W0KG 1QVGO 1F7YA 2PRRA 4WWIA 4IFDK 1PPJD 3RK3E 4GX2A 1MUUA 3IC9A 5CA0B 2WSSH 4P9OA 2Y0CA 4RQEA 1L0LK 1JY3O 3S1KA 4XBFA 2W6AA 1Y9BA 3ZHQA 1YJNV 2EADA 3E8BA 4DUZB 3Q2YA 4I0XA 2OYQA 3WB1A 1ZP0C 2Y0PA 3VSNA 2WSCH 3H1JG 1GD2E 4LFBB 4K8XA 5HFMA 1NSUA 4WB4A 1IXMA 1AR4A 5AVTB 2KIKA 3BS6A 2NPSD 2ZD9A 5CB4A 4TQDA 4PA7A 4C7UA 3H1LE 3HE4B 1G2CB 1KD1Q 1L0LE 4LC1A 3LSUA 1YQ3C 2IU3A 3G67A 2ZT9D 1GN4A 4BIUA 1ZRTE 3I3DA 3LIEA 3H9VA 4JTAB 2UUBB 1AROP 1S4XA 2M5AA 2WW2A 3VD9A 3E1F1 1O9HA 4DR2O 1PP9G 3VMXA 2WW0A 1RFYA 3H1HG 5A1AA 3N2KB 3RYIA 4I4TA 3D4YA 3CSXA 1QWNA 4DJGA 4O4LA 1H8AA 3VSMA 4EDFA 3W68A 1IFIA 1NU1G 1G1JA 3JATB 3GW6A 1CI6B 2DE0X 5E1AC 4YJ2B 3L9DA 2UXNA 2LFRA 3FB8C 2N1TC 1BT8A 2YXYA 3L74D 3G6EP 3H25A 1ZTEA 3O9OA 1NSZA 4JYAB 3X3ZA 4KTPA 2KNCA 3CWBE 1GTOA 2YEVB 1L0NJ 3SFDC 4FFBA 3BCCH 3BUQA 2P5OA 2YNYA 4LR3A 4DR1B 2WPQA 4B86A 4PD4D 3SWYA 2E5LO 2KS1A 3AEDC 1I5YA 2EZOA 1JYVA 3W7TA 4PI0A 3Q4HA 3L72E 5IJ0B 2ZCEA 3ZRVA 2Q6QA 4X66O 2GUVA 1NVPB 1SIHA 4EB6A 1KILB 3SPJA 5IJ9A 2F66C 2QKCA 3HKCB 3O6QA 3D71A 1I7FA 4GODA 3IN6A 1S9KE 3BASA 1BE3G 4DV7B 3ZMSA 1SFCC 1FZFA 3MUZ1 4FFKA 1PV3A 1OCCB 3TETA 4BZGA 4KFMA 1P7BA 1AJNA 3STZC 3RL0g 4RESB 3A24A 1RF1A 1TQWA 1SQQD 3H1ID 2YI9A 2VQEO 1S76D 2ODMA 4H0LC 3L35A 3BUPA 3DX2A 3E1RA 1TGOA 3JASB 3FD9A 5GTHZ 2UXBB 2AEMA 3T09A 4ZNCA 4DV5B 1XTGB 3CC2P 4RUEA 4BWNA 3S4DA 5H5NA 2GDSA 4C7NB 3DSQA 5A9GA 4R6ZA 1FZGA 1IFDA 3UM7A 1OJNA 4PDMA 5KHGA 2F18A 3JYCA 2YIBA 1VQ8P 2JKPA 1VF5C 5CMZA 2JKEA 5KX5A 2W6JH 1S0VA 1JX9A 2YXLA 4AQYB 2YKPA 4JI1B 3U1CA 3SJBC 2Y9ZA 1RE3A 1H54A 2JEEA 1EBOA 1PNLA 5B1OA 2CTRA 2IM9A 2KP8A 5JJEB 4PDVA 4OPHA 1SQPH 3CXHI 3L72G 4DOJA 4XDJA 2C9LY 3A0RA 3HIGA 1Z45A 3M7MX 3M0DA 4F6EA 2QJPB 4ASVA 1Q6HA 1BCCE 5LHGA 2CH7A 3AE4C 3S9OA 1GH6A 4HB1A 4TV8A 5KKZB 4UB8Z 1JY2O 5BZBA 5B3SB 3SYQA 2NZ2A 1U57A 2WSCJ 2ETNA 4DXWA 4N78E 5K5GB 3RRSA 2OWOA 1SQXK 2LQTA 3LNNA 1RY3A 3H1LH 1SQQG 1XOUA 4DV1O 2QJKB 4DT0A 4TUYA 1BE3E 2DYSB 2BT3A 2MKVA 3UIAA 3CD6P 2HJFC 1ZL8A 4L76A 3L75G 1HNXB 1NJIQ 1LF9A 3AG7A 3CCJP 1Y74A 1XUQA 2QTSA 2GUZB 2WITA 5LBQA 2V4HA 3BY6A 2YMYA 2HODA 1BGYD 1Y47A 1XMQO 3RWRD 5KA6A 2WVYA 1GMGA 2QM8A 2QG4A 1G2CA 1BCCH 2CH7B 5JWPA 3RBXA 5EBMC 4W4LA 1PX3A 1K9MQ 4J9ZB 1KQSO 4H44C 1ZRTD 1V7VA 5EC2C 4GOFA 1XDCA 3D52A 2JDIG 1VARA 4BW9A 1L7JA 1YSCA 5DEDA 3VP9A 1SQQJ 3SSUA 1B04A 2WQYC 1M56D 3G3ZA 3CCLP 2ZQ0A 5CN0A 2R44A 1CI6A 4YXWH 1OVUA 1YBKA 2IU0A 2IBZH 3HKDB 3I55P 3OMNB 3T0DA 3FKSG 3UKMA 1NTME 2FUTA 3ZRXA 3CL3D 3KZIZ 4XDKA 2A45H 1MN0A 2AHYA 1MZ9A 1W5CE 2R70A 5KAIZ 3OMAB 2BTQB 1SQVK 3T4DA 2YS8A 1M57C 1KC8W 1AQ5A 1EM1A 2CWVA 2HEPA 1GK9A 1RE4A 1VQKP 1K3EA 2OQEC 3SYCA 4LF4B 2HLOA 5TISH 1HN1A 2GTSA 1WPBA 1L2PA 3OUFA 1R5SA 5AVZB 4RUFA 3L70G 1L4AD 5CB4B 1KQFB 1NKDA 1FD9A 2DJVA 2F7OA 3RK2B 1YJWP 3T2QA 4FJCC 2WLIA 3FB6C 1T2KD 2Q7GA 3II6A 2F93B 5BMVB 1PKXA 3AE5C 3DC5A 1N8RQ 2BTQA 1EZVE 2GUSA 3A0BE 3C3TA 3AEGC 1YEWA 2K9YA 4LF7O 5IYBO 2ATKC 3ZRSA 1GN2A 2WSEJ 4R7CA 4CH5A 4EV2A 1DD4A 5AG2A 4O4IA 1L7KA 1TUEB 5JVDB 2WOFA 1BCCJ 5JMDA 2K37A 1RSOA 2ZR2A 3CB2A 1AJQA 3R4YA 3DDFA 1IDSA 1URQA 4F4LA 2FKWB 2HVJC 4U3JA 4O4IB 5LGNA 2UXDB 2YXRB 1XMQB 3TYYA 2ZE6A 1PIXA 2ZYDA 1V54B 4EIJA 3CXHE 1CW5A 4CZZA 3JD1A 3UCSC 2BASA 4W7YA 3M06A 2GM4A 1Q8IA 2FYZA 1RW9A 2BCCH 2QKAA 1MG1A 2LFSA 3HD7B 2RMKB 1HWYA 3FB7C 2QM7A 1VF6C 2XTAA 4B3RO 1OHHG 3KDPB 1SC5B 1SFCA 3N7NA 1H0TB 2YFNA 4UCSA 4LFBO 3E35A 2SPZA 3SR2C 3ZHTA 1KECA 3F5HA 1RJOA 1K92A 3BVOA 1YITP 4J10A 1EC5A 1NTKG 1IBLO 2YFOA 3AG2C 3ZCCA 3LDEA 5GTHE 3LOYA 1FZAA 4X1IA 1L0LH 4KFFA 3A0OA 2WLLB 2IJHA 4A7PA 1VQLP 1N9EA 4UB8H 3E7JA 3JSLA 5L8RJ 2XUMA 1EZVD 3OA7A 2WA4A 2R5DA 1NS0A 4UVAA 3CPWU 1LT9B 4TSFG 1GN3A 4JI7B 3BLCA 2Q0AA 3LIDA 1JCHA 3V4WA 2KYVA 1CEZA 2WVRA 1H38A 1FXKB 5EIBC 3RYFA 2P2UA 1Q81Q 3IC7A 3SFEC 4RKUJ 1QVFO 3FWNA 5H6RA 2Q5UA 5FPOA 4UB8E 2K9JA 4RJTA 1M1KW 4Z2WA 3K03A 4LCUC 1NO4A 2HJDA 1LWUA 2WA3A 1FZCA 1MMYA 3SWFA 3PJSK 4WCEV 4PV1B 1BCCG 4NTXA 5AW4B 2JJ2G 1GW3A 1IFMA 4LF9O 1OVRA 1L1FA 3OW2U 4GT1A 2YO2A 2E2VA 3FYIB 1U96A 1VQOV 1RH5B 1KMIZ 5L3BA 4D6TD 2CTPA 5AVUB 2IYOA 1X4TA 2WAMA 4U3FH 5K1PA 1QALA 1MOFA 1M90W 2WOHA 1Y66A 3B40A 2HG5C 1VQMV 4BIOA 3DECA 4NXNO 3S3WA 1VQ8V 5APYA 4LH7A 2NPSC 3VDBA 2JWDA 3VD4A 2HYNA 4PD4I 3CZSA 1NS8A 1HR0O 2WSEH 4FVMA 4UCRA 5GTIZ 1YITV 1W4NA 4IL6Z 1YHQP 3I3EA 1HNZB 2M3EA 1X22A 3MUY1 4L87A 2I8DA 2YXHA 1HTLC 1I5XA 2CE4A 3JCUZ 4OH8B 1M1JC 3T1HO 3TGUE 3EJSA 4AHCA 2DW4A 4J80A 1N7QA 2DYSC 1F23A 4O2BB 4H13B 1AI5A 1Q6IA 1Q82W 4EV5A 4DV6O 1GK6A 3BUDA 1NHLA 4BZEA 1S5LX 2E3CA 3L73E 2R9AA 4TT3G 4JI4O 3PTZA 2BRWA 3HR0A 2CTQA 2AZ0A 5GONA 5B1BC 3L72J 3Q1NA 5CJ0A 1QAFA 2CIQA 3SJQC 3IFXA 2IFMA 1NSVA 3GVMA 3HD7D 3JAWA 1JO5A 2KB1A 3KXDA 3RL0D 1AB3A 3NXSA 4XA4A 1S5LZ 5AVXB 2EZPA 3HKBA 1PNMA 1JPXA 5JJJB 1URQD 1DYUA 1LTIC 3AEFC 1PL0A 2BCCE 3I5CA 1P84E 2Y0EA 3TK1A 4NYKA 5IY5B 3T1CA 1HGVA 1N73B 1PD3A 1LXMA 3CXHF 1IFNA 3RK3C 3UT5B 2K88A 3MV11 1OCCC 2OYOA 2YKOA 2CUGA 3L73H 3HKCA 2W27A 3CWBG 2UU9B 1NSMA 4LP8A 1RKYA 4BWAA 3F7YC 1LTGC 5KMGB 1XHXA 1DK1A 4X1KA 1SERA 1LTBC 4D6TH 4X62O 4DV0O 1L0LJ 3B5ND 3ACSA 2OTJV 3AG1C 1KUQA 4JI0O 1QCEA 4YXDC 5AW6B 3CCUP 1VQPV 4F6RB 1L0NK 3JATA 1O7DD 5M1BA 1VMGA 4GIFA 1J95A 3DXRA 3IF4A 3JCUH 1X79B 3TCUA 5BY1A 2UUAO 3AE1C 1KTMA 4JYYA 1H2GA 1BCCD 3WA3A 2ZE8A 4LF9B 2ZNIA 2ZYGA 4TWKA 4IL6H 3QFYA 2ITCC 2KXPB 4Y99C 4I6MC 1B6QA 2XAJA 3CMEV 2WW3A 4UVCA 1NU1E 2IYPA 2C2AA 3E22A 2Q73A 3ASNB 2R32A 4FMTA 2V1DA 1QL2A 4UB6H 1YYCA 2N05A 2KLUA 1YJWV 4G28B 4DW0A 2O01N 2Y69C 1SVFA 4ZKUA 1KILA 3L72H 2F7QA 1H8EG 1URQB 3JASA 5JQGA 4JYCA 2LGQA 4ABMA 1Q86W 3U59A 4GKKO 1VQ7P 1XMOO 3LNMB 1FJGB 3HI7A 4JI3B 3H1LG 3DXRB 2ZXWB 1YTZI 2MJZA 2CQTA 5AW9B 3CX5F 3CD6V 3ALAA 5LOVB 1ZR2A 2R5BA 3H1JE 4ZKIA 1KFMA 3A3YB 1SO0A 2M6YA 2FYUE 2N9YB 1YQ2A 2OCCB 2Q7CA 3CCMV 2P1JA 1E79H 3K5NA 4JAAA 2FYUG 3T1YO 4L75A 2LJ2A 4JV5B 2XV5A 1KV4A 1NTZK 4QIWF 1SQPG 4LBEC 3QFZA 2I1JA 2YKQA 1SQBG 3L73J 5FPRA 3L75J 1X9VA 1NS7A 1R34A 1HR0B 2E76C 2VQFO 2KLVA 1EZJA 3M91A 1XREA 3FAVB 2M0BA 3Q5RA 1QL1A 2WLLA 1SQPK 2PNCA 4TUYB 3FYEB 4C7NA 1R1BA 5CA1A 4MTXA 1QX8A 2FYUK 3ZJZA 3G80A 1RSOB 2UXDO 3USSA 1K05A 2Q6AA 5BU5A 1D6UA 1LVNA 4NXMO 1I8QA 2Q1FA 4WFGA 1IURA 1XNQO 5KUKA 1MA1A 4M3LA 3CLQA 1RE4C 4Z1MH 4WFFA 1GDTA 2P06A 3K5TA 3AMOA 4LF5O 1ENVA 2GBOA 3E1IA 3JAKB 1NS2A 3H1JJ 1D7MA 3H1KD 4OGQD 2HPCA 2QWRB 1FJPA 1R6NA 1K1WA 2WZSA 3HKEB 4TOIA 1YTFB 5KLVH 5IWAB 1E5WA 3FXEA 1FZCB 4HZ3A 5AVYB 1OIPA 1NSRA 1SZXA 2HHHB 4UV9A 5E79E 3BVVA 5APTA 3W7SA 3ASOB 2DYRC 5LGUA 2IJKA 1PV0A 4CS4A 3BCCJ 1KB9H 3H1LD 1GL2C 2RDCA 2LXBA 3M8AA 1EN5A 1NQTA 1S2EA 3B5NA 4L74A 3MWXA 5KJ7C 1N7OA 1P84F 4D6TE 2Y9YA 3H1HJ 2B87A 5CA3A 2VWJA 3AG3C 4FLYA 1Q82Q 1FZBA 4ZKPA 1FOSF 1EDIA 2FYUD 4O4JB 1L4AC 2Q68A 1XTCC 2A06G 1TU5A 4NPEA 2JEUA 1Y76A 1A32A 2XHBA 5CCGA 4MVOA 2O57A 2D2CD 1Y4MA 4U7NA 3CCVV 1VQOP 3E8GA 3CMAP 4DR6B 2VS0A 1SQBJ 3L73G 2EX3A 2HR3A 1OCZC 3LDDA 3CXHD 3CRRA 3PLNA 1A02F 4QJFB 3H1KH 1Q43A 3D3IA 1URFA 5J9PC 5LMNO 3WVFA 3V2NA 1PFIA 1L8DA 2RKLA 4LNUB 3DYMA 1W2ZA 3TGUD 2WLIB 3MP7B 4P30A 3BVTA 4BZHA 3ZN0A 4ASWA 4RWUA 4NKGB 1W3YA 3TGUG 3N2GB 1KILC 1CXZB 5E79Z 5APXA 1AJYA 2WZ7A 1YJNP 5TISZ 3M99B 1CZQA 2ZE7A 2FFDA 3I56V 2BSKA 2K1EA 1RM1C 3JARB 2E74C 2LO1A 1LJ2A 3C9IA 1S9KD 4MMIA 5J2TA 3LVTA 1I0HA 5CBNA 4J11A 2K9PA 1OVVA 1DGSA 1NU1D 1SA0B 2JGDB 3L75D 4QE9A 1ZW0A 1JMKC 2LR2A 1PGOA 4UCOA 5F2VO 5LP6A 3TXSA 1Q6UA 3E2EA 4MW8A 3D36C 2PFXA 1XL4A 4WBNB 1IVXA 2UXBO 2F4VO 2XAQA 1MFTA 1AI4A 2F23A 1V55C 1P84D 2KZJA 3WUVA 2EIMB 5KAFH 3W7WA 1GU5A 2FKXA 4R50A 1U97A 2ZT9B 4B7EA 4JI8O 3KZIE 2NPSA 3OR6C 5LMUO 1AP6A 2L35A 4N21A 4EKWA 4PJ0H 3APQA 2XDJA 3G6EV 5EYPB 1VQKV 5IYZA 3H1JD 4JZGA 2WSFJ 1DD3A 1RPOA 2G38A 1MZEA 1GKFA 4K0KB 5DECA 1SA0A 3VD5A 1SNZA 1KC8Q 4LFCO 3G71P 3T08A 1DP0A 2E2TA 2B9BA 3OTOO 4FLWA 2E5YA 1J0NA 1N0NA 4X64O 1NSSA 1SP4A 2X6BA 3ZRWB 2MK3A 2QA4V 1QVFU 1EDLA 3H1JH 4NTWA 3HKBB 2CK3H 3BRCA 1CP9A 3SDLA 3Q4HB 3M0DC 3V5BA 2XAHA 3T0AA 1BGYJ 3QTCA 3L36A 1JCDA 4RNLA 2CPBA 3X3YA 3MHVA 1N7NA 2VWKA 5KKZC 4BAYA 4D7TA 3HUSB 4UCTA 3H1IH 5ITZA 4JZ2A 1J1EB 5EYPA 1RF0A 2FYNB 2DWDC 3HTKB 3R66A 3SWKA 3CX5I 1OCOB 2N9BA 2HTAA 4ZHQB 4FNPA 5B1AC 1NVOA 1KKDA 2IZ1A 4WVZA 5L3GA 1Z5VA 3ASNC 4DW1A 2N1TD 2PUSA 3RVZA 1L4AA 2C0WA 1EZVG 3A0HZ 3H32A 2HHHO 4FM0A 1H2NA 3WU2Z 2LGWA 4RAIA 2J5UA 5KLVD 2M7WA 1LUVA 1YHQV 3ABKC 2A7WA 3ETDA 5LP6C 4Y28J 5CJ4A 4OK4A 5KLVG 5IJ9B 2DOSA 4LH6A 2G8YA 3EQ2A 3RN4A 4B7KA 2VQFB 3L73D 4I1LA 3TJTA 1HBWA 2LW7A 4MN4C 1K8AW 4K35A 1X1HA 1R6TA 3K5MA 2Z5UA 2ZVNB 4XE5B 1JZ7A 2ZXWC 3I55V 1FXHA 3ZHRA 1S5LH 2O01J 1JUNA 2PYLA 2X03A 2LP7A 2WWWA 4K3AA 1NI8A 1FOSE 4OJZA 1JYNA 1VQ6P 1QLEB 1FPOA 3W67A 1TQSA 1WNSA 1IBKO 2UUCB 3QH9A 1FFXB 2ZFCA 1ORQC 2WYHA 3AEAC 3D8CA 2EBOA 1FKAO 4I9WA 4I50B 1YCIA 1J5EO 2BOBC 5H2FZ 4CS2A 1NH2D 4GKKB 3RYCA 4P2ZA 1LURA 1TAEA 2AGAA 2ZDIC 3TXQA 2UUAB 3C8VA 1COWG 4H0LD 2ZL8A 1ZOYC 1GM9A 1GW4A 3OGCC 2EJ7A 3J7AU 1SQFA 4DK1A 1LTJB 4O4HB 4JI0B 2JGUA 3VOUA 2YIUC 3L70E 2B88A 1NJIW 2AZ2A 2IZ0A 2QTOA 2R72A 1SIIA 4DV2B 2OQQA 2RH0A 3PGBA 4LF6O 2JR8A 1GRJA 5BR8O 3RGBA 1OCRC 4X1YA 3WFAA 1U7JA 4X65B 5DJUB 2XZRA 3X41A 1XHZA 1VF5D 3BABA 2Q69A 3RK3D 1GL2A 1M1KQ 3RK2D 2IBZI 2DQ3A 1QU7A 3HIIA 4YHHO 5KA5A 1D5NA 1DEEG 3RK3B 1ZN5A 4GZRB 3CC4P 2WYIA 1LTJA 5KBPA 4MVSA 4H33A 4Q20A 1GM8A 2ZQMA 1VQ6V 3U0ZA 1VL2A 3CX5H 1DLBA 3GHGB 2WLKA 3HKDA 1PGPA 3EJTA 3P8MC 2W6BA 1SLQA 1AVYA 3BFRA 4PV1D 1NAYA 2LXCB 4ASUG 3GMAA 1HUCA 1HW7A 2WLHA 4CPGA 1GM7A 1IBMO 4FPPA 1WP7A 2KG7A 4XDLA 3T97B 5EK0A 1R3KC 4BW5A 2Y4TA 1KQGB 4DUVA 1S3JA 2Z5HA 1BE3J 5IY5C 4UCUA 3B71A 4DR4B 5KLIC 1S72P 3P8CE 4IL6X 2H7HA 2HODB 1YVWA 2M5AB 5B1NA 2IH3C 4B3MO 3OB8A 3RVYA 2XKMA 1LP1A 1JEKA 5C8YB 1M56B 3J81N 4KFDA 2K3RA 2V7QH 1G6UA 3WG7B 2Q9IA 4JGSA 3OAAG 3BVHA 4IGGA 3CZJA 2FXPA 5LYJB 4I4TB 1VQ7V 4WY4D 2D73A 1ZUQA 2ZYAA 2BSKB 4FLZA 2W6IG 5EZYA 1JTHB 1W2BO 1KZUB 3BLBA 3A2AA 3N27A 2W83C 3CI9A 1PX4A 3UO3A 2E75B 1K5QA 1OWAA 2B89A 1G1XB 2YUAA 1NTZE 2A9HA 1YJ9V 3CCQV 1YDXA 1YQ4C 5KAFZ 2E74B 2PF4E 3FX7A 3L75E 3CJHB 3A0HE 4HBNA 3OAKA 5JH7A 2OYHA 3L71G 1F4MA 3GWOA 5LA6B 3N9HA 2CPSA 4B3TO 4BR6A 4W4KA 2Y48A 4K0KO 3TSIA 4LF7B 4U3FJ 1H88A 1NOHA 1EN6A 5AW2B 4CH4A 3L74J 2YIAA 3U10A 1NKNA 3DYOA 1V54C 4CH6A 4BRYA 4PELA 2OYHB 3SJAC 4U3JB 3EVKA 1KBHA 2JIZG 1SQQH 3H1IG 1QR8A 1GU4A 3AFJA 2GA1A 1NTMJ 1IVVA 3TY1A 3EJUA 1HM3A 2WT7B 2ZAEB 2CFKA 1EFRG 3DC6A 2Q1KA 2QR4A 4ZI7A 4BIZA 1JR9A 1SFCB 5KTBA 3STLC 3E83A 2F43G 1N0JA 1R73A 3V4QA 5EC1C 2GSMB 1EZVH 1H2SB 3A0BH 4UB6E 3H1KJ 4WFBV 5BU8B 2YEVA 4TTGA 4X9QA 1YXBA 4U7JA 5KLIB 5B66E 1Q3EA 4UUJC 1KKCA 3AE6C 1T2KC 2IBZG 1Q86Q 2VRSA 1K4DC 4WBNA 4AYCA 4MVUA 3VP8A 4O2AB 3D6ZA 1N2DC 1YI2P 3BCCD 1LT1A 1CSBA 2C9NY 1LGHB 3B8NA 1JRQA 1MFZA 3OR7C 1FXKC 4IHJA 1V9PA 2QEXV 5AVRB 1YJ9P 1YGAA 2CWUA 2XSGA 3T0BA 3X42A 1P84H 4HYOA 1RWFA 2ZJSE 4FZ1A 3U11A 1ROPA 1F4HA 1BMFG 3KN4A 4LFCB 2OTKE 3ETQA 2HP8A 3L70H 4X66B 1XNQB 3WIQA 4KT0J 4BXLA 4IYHA 5B5EZ 5C93A 1K33A 3ABUA 3ZHVA 2OCHA 3CC2V 3CMAV 1RWAA 3DTUB 3OTFA 3ZX6A 3I5DA 1MMMA 2UUCO 3B77A 1QGKB 3FWLA 2EAEA 5CMUA 1FDMA 3ZIAG 5L3CA 4JASA 2IH1C 4DRXB 3F7VC 3ABKB 5APWA 2NLJC 3LW5J 3NBBA 3D6YA 1FZCC 3K9AA 1SQBE 1NS1A 1UPGA 1S5JA 4IHJB 4X1IB 3AEBC 2E22A 3JALB 2ITDC 1SRYA 1WJZA 3H01A 2B5UA 4JAVA 1L0LD 2R3SA 1LNQA 3DGEA 3KIIA 3MV01 5LXTB 4JTDB 1KILD 3QVNA 1F4NA 3WFVA 4ZHQA 1NTZJ 2A79B 1RE3C 2CFWA 3HUSC 5APSA 5HFLA 3HE5A 2E74D 4TLFA 5B5EH 2C0XA 3ZHSA 3P7KA 1MZFA 3EJPA 4NPDA 4RO2A 1Y76B 1M8OB 1LTAC 1WN7A 2KI7B 2YX9A 3A2FA 3IAQA 2CG1A 3ZMTA 2NRGA 2WPVB 1M93A 1JOVA 3L74E 1SQVH 1X8YA 5CBFA 4FLVA 5C8YA 2H88C 3CS5A 4U3FE 3IR9A 4NVPA 3A0HH 3HE4A 4E2LA 1KP3A 1JY2N 2MW2B 2EILB 4HYTB 4IIJB 2WLNA 2UU9O 2X6CA 1H2MA 3Q5PA 3E86A 1XL6A 4FNUA 2HVKC 3D70A 4FNTA 4LFAB 3AG2B 3QWOC 4FNRA 3EJRA 1R3JC 3WU2H 4IIJA 2P22C 5DN6G 3AK1A 4CC5A 1Y74B 3WB2A 1TXKA 5CA0A 1SQVE 3ML0A 5CHXA 3CHXA 1JZ8A 1BDDA 1RHZB 3L75H 2D1WA 1AVKA 2YI8A 3KG2A 2WO0A 1W2EA 1AR5A 1YZBA 4X89A 2WSSG 2YMKA 3CC7P 5LMUB 4UB6Z 1JMMA 2KQXA 4JBZA 1KQLA 3O6QB 3V2QA 1SQXH 2KNCB 4MW3A 2Y74A 2AEFA 3L71D 4FFBB 1VQ9V 2WPDG 2XASA 2UXCO 2CIRA 2NR5A 1BE3H 3AK3A 1SESA 3JAWB 4Y99B 4FIPC 3RGUA 4OVNF 1IBMB 1RF1B 3OEEG 4JTCB 3AE3C 1FBMA 3AEIA 4UFZA 4YY3B 2NPSB 2ZXQA 1FJKA 5A2QN 4R4LA 3E22B 1US6A 1T3JA 3A7OA 3I3BA 2W6JG 1JZ6A 1AA0A 3H1LJ 2FMLA 3CE2A 5AVQB 2B1IA 2JKVA 1KSIA 1URQC 2QSIA 2IFNA 1LXKA 4B3MB 1PPJE 3BUBA 1N33B 4NXNB 3TDKA 2WVZA 3L70D 2QKSA 5EBWC 1SQVD 2ZIOA 4JI1O 2KS1B 3V2PA 1G1IA 2YICA 4LF8O 1LP1B 2FYUJ 1IK9A 2CFGA 1X1IA 1QLNA 3P3PA 1QHTA 1D5AA 4YJ3A 1HNZO 2E5TA 1OACA 3ZBHA 3V6IA 4UCVA 4KJMA 4JI3O 3E8HA 4N78D 1XMOB 1EXJA 3D3QA 4R8CA 2Q7HA 2OTJP 1VF7A 3BCCG 3JCUE 1HN0A 4MS2A 2BTOA 3LSQA 2XAGA 1SQBD 5KAIE 3BVUA 3VN0A 1NT2B 2ADPA 4I50A 5CBHA 3B5NC 2OYIB 1JYWA 1JNMA 3H1HH 2RDYA 1NTKK 1IVSA 3AG3B 2QGNA 1QLED 4JI7O 2WPSA 1OFCX 2FXMA 1AP5A 1QX1A 4Q6GA 4BZFA 1GTWA 5B3SC 3QDEA 1PP9H 4LF6B 3H1KG 4YJ3B 2AW9A 4GCZA 1NTMH 4BTYA 2YSUB 2JS3A 4QPJA 3HE5B 2Q3IA 5AVSB 4TQFA 3RK2C 3I56P 2BE3A 2D2CB 4UVBA 1KQSU 1HDJA 1R8EA 1VQ4V 4KHPO 5AW5B 1E79G 2W0FC 3NJVA 2C10A 3Q1MA 1EDKA 4X64B 4EEQA 1N7SC 3P32A 2KB7P 4HNAB 1WLEA 4QMAA 5CA1B 4MMHA 5KHKA 1E1QG 4QGPA 4W7ZA 5CCHA 4JI5B 2QWQB 1Q2NA 1K97A 3HB3B 1W6GA 4PDLA 3G4SV 2ZM6B 2KOGA 2P7JA 1D6ZA 5H6QA 3RYCB 1KYOF 3B09A 1BSMA 2KSEA 1SF9A 5KX5B 3FB5C 2A45I 2IX7C 3VOPA 1MMXA 3T0UA 1OW6A 1K34A 1EZVI 2EINB 1PGJA 2IDBA 1N32O 1AV1A 4JPZB 3LUTB 2PI4A 1N73A 1K1YA 1SQPD 3IAOA 5LHIA 1RQUA 2P10A 3CWBJ 1IQYA 5DM6V 2E76D 5JMFA 4GX1A 3MDSA 5L3FA 5AW3B 3EJQA 5FNVB 1VQMP 4IYIA 1ZLZA 1QAKA 4UXNA 2E24A 2WLMA 1OMIA 2F1BA 1QNMA 2QJPC 4GX0A 3K5OA 1BHAA 4X8AA 1P84I 3O8ZA 3Q5SA 3T1HB 3HKEA 3QO5A 1XILA 2V7QG 1NVPD 3ETEA 1WA8A 4F6RA 2HFEC 4D6TG 1SQVG 2EULA 2XN2A 2H89C 3A8TA 3L71H 2N1TB 3ABVC 2QVAA 3GF7A 1HH0A 2JVDA 2FXOA 3RYIB 4U3FD 3JC22 3X3XA 4BTWA 4L73A 4U3FG 3VQXA 1HJ0A 4DV5O 2OW7A 5KUMA 4NPFX 1PU4A 3APOA 3MIWA 4J42A 4DR3O 1AQTA 2AXTE 3JALA 4I7ZC 2Y73A 1LUWA 5GTHH 4FNVA 1FFTB 3VD3A 1W6CA 2JGDA 2O1JA 2Z3YA 1CB8A 3BHPA 1K04A 4PD4H 5H9CA 3K58A 3S4AA 1IK7A 3MGNA 3QG0A 3HPLC 3VMAA 4NTYA 1B06A 3CYOA 4DYLA 1BL8A 3CX5E 4GX5A 2GV9A 3WB0A 1SQPE 3H1HE 1RWCA 4LF8B 5IJ0A 1MSWD 4DV7O 1IC2A 1M1JB 3K3WA 4JF7A 3BA8A 3OE7G 1YTZT 1HTYA 3BVWA 4PA3A 1FS0G 2XN1A 1UFIA 4X62B 4DV0B 4LNUA 1SS1A 4KTRA 4TT3H 3ABMC 2BCCJ 4JI8B 3ABTA 2CGNA 1NH2B 4DR3B 4KFEA 1P49A 4DR1O 4JQ0D 1SQQK 4YY3O 3CZNA 2O01H 1SPUA 3HD7A 3QF7A 1QQCA 1TA8A 1JY3P 5AVVB 1IFJA 4DV4B 1HNWB 3C3SA 2JJ1G 2OYIA 4DUWA 2CDYA 5FL7G 4PD4F 2N04A 4MSWC 2Q3EA 1BSHA 1M5IA 4PA9A 2E42A 3CXCU 1M4UA 2H8PD 1T6AA 3EHBB 3CCUV 5KAIH 1NTKD 2P6JA 1SQVJ 2FBWC 3BGAA 1D6YA 3OEHG 4YXWG 2B1GA 3VMYA 4J41A 1R3LC 3CWBH 3KKYA 1BQZA 3S4BA 4EYYQ 2QA4P 5D5PA 3OGIB 2ZINA 1UI7A 1HWTC 4D7SA 4FNSA 1H2KA 4IFMA 1BQ0A 5JCOC 1K73W 2ZNJA 3ZMZA 1UIIA 2KK7A 3VYIA 1FDOA 2BRPA 4GKJB 3RYHA 5JVDA 3B8MA 3CEIA 4BTXA 2Y0DA 2PTMA 1KYOE 3KHUA 3RW0A 4OX9B 1R6KA 5EFWB 1WT6A 3L37A 1G8MA 1ZSPA 4UV8A 3ZMVA 2WDAA 2IBZE 1HMUA 3CCSP 2QWNB 3VDCA 1JB0J 3KCXA 1FAVA 1N33O 5GTIH 1UI8A 4DRXA 1JFFA 2AHZA 1FFXA 1DF4A 4KHPB 2HTBA 4IT5A 1UIXA 1HF9A 3BUIA 3AE9C 1WMOA 4WFHA 3BPZA 2CK3G 2E75D 1R33A 1Q90D 1R3IC 3N4XA 5CCGC 1HM2A 3OBAA 5FNVA 5IT9N 2DQ0A 3K5LA 4XFJA 1FXKA 3RYFB 2BRVX 1VIBA 4HJGH 1Y6XA 4WY4A 1EGUA 4O4HA 1PGQA 1AVMA 3SYOA 1WB8A 3MTUE 2QWPB 5H2FH 3AE7C 2EIJB 3AG4B 5APUA 2JJLA 1MMUA 1X1JA 2EACA 1S5HC 3M9HA 1BDCA 4DR4O 1GZLA 1OCOC 4MVMA 1A02J 1MNGA 2QJKC 2UXXA 3CP1A 4LF4O 3L71E 3LDCA 2ADQB 2ZDIA 2FY8A 3VBBA 1Z56A 4JI4B 3F5WC 2KZIA 2AEJA 1GL2B 3RBZA 5LP6B 1NU1K 4GKGA 4A5UB 3OUSA 3EFGA 3MPHA 1G4YB 2FL4A 4FZ0A 2ZT9C 1F9GA 5AW0B 3X2QB 3W7UA 3VD7A 4MTGA 3O65A 1NAFA 1BHBA 2JS5A 4YHHB 4LLHA 3H1HD 1QVGU 1WP8A 4PA4A 2OT5A 4EOTA 1QEXA 4HAMA 2FYNC 2O3JA 5BVZA 1A2VA 3VQYA 2WVXA 2YIBD 2EINC 5GONB 5B1AB 3SPGA 3CX5D 2HKOA 5DJTB 3H1KE 5CBOA 2QRXA 3JD0A 2JKAA 1YIJP 2F7PA 1IVWA 4LWSB 4X88A 2Q5ZA 4QNHB 1PL4A 4PJ0E 3JSNA 3NJXA 2N74A 5AW8B 4CC6A 3SEPA 4ZBMA 2PGGA 2PP6A 1BS3A 4O4LB 1V7XA 5KMGA 4B3TB 1AILA 4MT8A 1L0LG 2K1AA 1P7GA 2OIGA 4X1KB 2PZSA 1N7SB 1YI2V 1J1DB 2YIUB 4N6JA 3SPIA 1HP8A 4L8JA 3ITKA 3UT5A 1O9GA 4QPKA 1W2BU 1Q7YQ 1GMJA 1ZXGA 3AECC 1IVUA 3S4RA 1SFCD 4RQFA 1ULVA 1VPCA 2FYVA 3A5TA 4KHXA 2EIJC 1PNKA 3AG4C 3EXAA 1J0MA 3W7XA 4NXMB 2BEQD 4JPRA 1L0NH 2W0XA 4LWSA 1NTKE 1US1A 3K57A 2DN9A 4YIPA 2QJYB 4MVRA 4DR5B 1RF1C 5LA6A 4C46A 3H32B 3H1IJ 2CISA 2X6AA 1XBLA 5KLVJ 3B4SA 3CCEP 1WMKA 1BGYH 4X20A 3TGUH 3JAMN 3CRCA 4C7RA 5KLVK 1ZWIC 4JAUA 1TUBA 4PV1C 3K25A 1S72V 3X2QC 3K08A 4YJ2A 3SYAA 3ZDMA 3VTPC 3V2RA 4EB6B 2EABA 5BMVA 1NR7A 1W0JG 3QG5A 3AFLA 1SKVA 2YIDA 3M9QA 1VDFA 4DK0A 3HRNA 3K04A 4Z1VA 3OD4A 3A0BZ 4CBCA 1KYOD 2EIKC 1RPRA 1NH4A 3EWKA 3HUSA 1SQGA 5JCOA 3DX0A 1KYOI 3ZHUA 2R9RB 2IBZD 5KHIA 1LT9C 4WY4C 1BSNA 1OCZB 3LSSA 1JOCA 4MTFA 1N7SD 3RL0B 3WU2E 2CTWA 4X65O 3MUDC 4JI6B 4DR7B 2FFDC 4IFFA 4G2KA 4O2AA 1NTZH 1HGZA 1E1RG 2NN4A 1JZ4A 2JO1A 4DV6B 1ZR4A 1USEA 2W90A 2J58A 1RF0C 4YTPC 3PP5A 1PP9J 2A3QA 5JQGB 4GYCB 4OX9O 1N7PA 2Z4EA 2AXTZ 3ZEDA 2A45G 1NBMG 1RM1B 1SETA 4OGQB 4Z1MG 1HMWA 1KU9A 1OZHA 4H13D 1QBZA 1EN4A 5L3EA 1AI6A 3BEHA 3SJCC 1SQXD 1IX9A 1LTTC 4OXSA 3ZRWA 1AFOA 3IAPA 5GTIE 3RT3C 1DTOA 2F1MA 3WG7C 2DW3A 1JYXA 3PN1A 1LWUC 2CQSA 5H2FE 5APQA 5CCHD 2YC0A 3ASOC 3OMIB 3F89A 2POHA 4DV3B 1NTMD 2RMZA 3DCDA 4MVZA 1OV9A 1N34B 1NTMG 2ZXEB 1TQVA 2EIMC 2L6LA 1BGYG 1LT9A 1AR1B 2FUQA 4HKZH 5KJ7A 3OTOB 4ZIBA 2VQEB 2ZKOA 5GW7A 4LF5B 1FXVA 4PA6A 2VRZA 4D6TJ 2IW5A 4P9PA 1WPXA 3H6PA 1Q81W 2A06D 3T97A 1VQ5V 1HNWO 4KL1A 1M56C 1UJWB 2FYUH 4O2BA 4NR1A 4ZMDA 1N86A 2F95B 2XNDG 3D36A 1WA8B 1JM0A 4IL6E 3CMEP 1OJPA 3AMOB 4R4MA 2D3OW 1L0NE 1H0TA 4AQ0A 4X1YB 3OJAB 3CCRP 1QWUA 2ZXXA 1N4CA 4TV8B 5B1BB 3VQWA 1HVVA 2Y4UA 1IO4A 3E80A 3DX1A 2L91A 3QO7A 5KAFE 3KYQA 4WFEA 4ICGA 1LTSC 1M57D 2O1KA 1WB7A 3JD4A 2PI5A 3C90A 5BXZA 1NZ6A 2QJ1A 1VQNP 2FTKA 4DZOA 1PPJH 3MAQA 1P4RA 2V7QJ 4KUMA 3L74H 3L70J 3G71V 5LL6Y 1THZA 2M3BA 1ZV8A 2E43A 4OK2A 2J59M 3ABLC 4OPAA 2HPCB 2BCCD 2UUBO 2XNDH 3BCCE 3GLMA 1JMBA 1TVKB 1AVOA 1TQTA 1YTFD 3CCMP 5LMNB 3GF3A 5KHHA 1GN6A 1HJBA 4GDOA 3N2GA 1N7LA 4I5SA 2PAJA 2PGDA 1LOHA 4NB5A 1LWUB 2XAFA 3IGAC 4ZOLA 1XNRO 2A06E 1IJDB 4PJ0Z 4AI8A 4JYAO 4WBAA 2RCVA 2KSJA 2WTYA 2R9IA 1NTKJ 1PPJG 4O4JA 1NKZB 2ZM6O 2H8PC 5EBLC 3K79A 4PI2A 4J7ZA 1X59A 1KB9E 5BR8B 3NFQA 2RJZA 2Q0OC 1BE3D 2E5LB 3BRVB 3CRAA 1ZAUA 2ILMA 1VF6A 1FJGO 4DUZO 4E4EA 3SPCA 1F51A 1K5SA 1FC2C 1N7SA 1K7DA 3GWKC 3N2KA 3P3NA 4DV4O 1W5ZA 4HH2A 3JARA 4J9YB 1JJOA 1M7LA 1NWQA 1SQXG 1MSDA 3F5TA 5C39A
chains in the Genus database with same CATH topology
3EJSA 1EDKA 1U7MA 2B88A 1MFTA 2KIKA 3MZWB 5DJTB 2KZJA 1BDDA 1R34A 3BUDA 5CBOA 2QRXA 3DDFA 3PH0A 1Q2NA 2M0BA 4ASVA 2F7PA 1U7JA 4HB1A 5DJUB 2F1AA 5K5GB 1LT1A 3BVXA 2M5AA 1TQVA 4EYYQ 1DEEG 3FXDA 4HKZH 2WMMA 4JBZA 3D4YA 4GOEA 1QWNA 2WYIA 5KBPA 2UWJE 2OTKE 1H0TB 4BXLA 2SPZA 3RGUA 3EJQA 1ZXGA 4ZMDA 1EDLA 2LXCB 2FYVA 3CV5A 1Y47A 3FXEA 1EC5A 1JM0A 4CPGA 2F1BA 1PS3A 5EFWB 3BUQA 1H0TA 3BVVA 3MHVA 1S3JA 1QWUA 1HXKA 4IOIH 3DDGA 3DX1A 2F7RA 2LXBA 2M5AB 2OW6A 2ALWA 1LP1A 4GOFA 2K3RA 1NVOA 3D51A 3BUBA 3D52A 2B87A 2QVAA 2KS1B 4GODA 1EDIA 3BUIA 1O7DD 4NPEA 1LP1B 2R44A 1OVUA 2OW7A 2KUBA 1R33A 4NPFX 3ZDMA 3BLBA 1X0TA 1TQWA 2B89A 4KJMA 1JMBA 4MN4C 4K35A 3DX4A 3EJPA 1TQTA 4HJGH 4NPDA 3D4ZA 2P58A 2HR3A 1OVRA 2KI7B 3BUPA 3BVUA 3DX2A 4K3AA 3DX0A 1BDCA 2RKLA 3DX3A 3BVTA 4ZNCA 4ASWA 1TQSA 3EJTA 1HTYA 3BVWA 2B87B 2F7QA 2F7OA 2WYHA 1EDJA 1QX1A 2JWDA 1SS1A 2KZIA 3CZSA 2F18A 3LVTA 3D50A 4WWIA 5CBNA 1OVVA 2I8DA 1FC2C 1ZW0A 3S1KA 2LR2A 3QWOC 1HWWA 3CZNA 3EJRA 3EJUA 1TQUA 2ZAEB 2Q1KA 5C39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJS A;  1EDK A;  1U7M A;  2B88 A;  1MFT A;  2KIK A;  3MZW B;  5DJT B;  2KZJ A;  1BDD A;  1R34 A;  3BUD A;  5CBO A;  2QRX A;  3DDF A;  3PH0 A;  1Q2N A;  2M0B A;  4ASV A;  2F7P A;  1U7J A;  4HB1 A;  5DJU B;  2F1A A;  5K5G B;  1LT1 A;  3BVX A;  2M5A A;  1TQV A;  4EYY Q;  1DEE G;  3FXD A;  4HKZ H;  2WMM A;  4JBZ A;  3D4Y A;  4GOE A;  1QWN A;  2WYI A;  5KBP A;  2UWJ E;  2OTK E;  1H0T B;  4BXL A;  2SPZ A;  3RGU A;  3EJQ A;  1ZXG A;  4ZMD A;  1EDL A;  2LXC B;  2FYV A;  3CV5 A;  1Y47 A;  3FXE A;  1EC5 A;  1JM0 A;  4CPG A;  2F1B A;  1PS3 A;  5EFW B;  3BUQ A;  1H0T A;  3BVV A;  3MHV A;  1S3J A;  1QWU A;  1HXK A;  4IOI H;  3DDG A;  3DX1 A;  2F7R A;  2LXB A;  2M5A B;  2OW6 A;  2ALW A;  1LP1 A;  4GOF A;  2K3R A;  1NVO A;  3D51 A;  3BUB A;  3D52 A;  2B87 A;  2QVA A;  2KS1 B;  4GOD A;  1EDI A;  3BUI A;  1O7D D;  4NPE A;  1LP1 B;  2R44 A;  1OVU A;  2OW7 A;  2KUB A;  1R33 A;  4NPF X;  3ZDM A;  3BLB A;  1X0T A;  1TQW A;  2B89 A;  4KJM A;  1JMB A;  4MN4 C;  4K35 A;  3DX4 A;  3EJP A;  1TQT A;  4HJG H;  4NPD A;  3D4Z A;  2P58 A;  2HR3 A;  1OVR A;  2KI7 B;  3BUP A;  3BVU A;  3DX2 A;  4K3A A;  3DX0 A;  1BDC A;  2RKL A;  3DX3 A;  3BVT A;  4ZNC A;  4ASW A;  1TQS A;  3EJT A;  1HTY A;  3BVW A;  2B87 B;  2F7Q A;  2F7O A;  2WYH A;  1EDJ A;  1QX1 A;  2JWD A;  1SS1 A;  2KZI A;  3CZS A;  2F18 A;  3LVT A;  3D50 A;  4WWI A;  5CBN A;  1OVV A;  2I8D A;  1FC2 C;  1ZW0 A;  3S1K A;  2LR2 A;  3QWO C;  1HWW A;  3CZN A;  3EJR A;  3EJU A;  1TQU A;  2ZAE B;  2Q1K A;  5C39 A; 
#chains in the Genus database with same CATH topology
 2OQE A;  2X7R B;  5CBG A;  2RNB A;  1K9M W;  1J2J B;  1NR1 A;  3DYP A;  1U7M A;  3OM3 B;  1VQP P;  2H94 A;  3WMM 0;  1KN7 A;  4J7K A;  1VQN V;  1GAX A;  2XU6 A;  2OOV A;  4B3S O;  3T2P A;  3L4F A;  2UXC B;  2H3O A;  1NYH A;  4B3R B;  2V4D A;  1LTJ C;  1D2D A;  3H1I E;  4I0X B;  2KG7 B;  1SQB K;  3ICX A;  1Y8A A;  1NTZ G;  5E79 H;  1DF5 A;  1Y67 A;  2FB5 A;  2QDO A;  2L5G B;  2RN0 A;  2F1A A;  2X0L A;  3JSV C;  2Q67 A;  5IWA O;  1SZT A;  3BVX A;  2BOC C;  5IYC O;  5K1X A;  3JD3 A;  2Q8V A;  2ZR3 A;  1K73 Q;  3ZS8 C;  1V7W A;  4X20 B;  2QE7 G;  1H8H G;  2OCC C;  2YDE A;  1VQL V;  4GKJ O;  2UWJ E;  4ZI7 B;  1OX3 A;  5APV A;  1SQP J;  1K1X A;  4YIO A;  1NU1 H;  1YF2 A;  1DIP A;  5ITZ B;  4AQR D;  1IZ3 A;  1JQ0 A;  1Q7Y W;  4MTO A;  2E75 C;  3PRJ A;  1IFP A;  3IAY A;  3CCE V;  2H43 A;  2CAZ C;  2PYJ A;  4IOI H;  1VQ9 P;  3DDG A;  5JH7 B;  1L4A B;  1UG9 A;  5AVW B;  5LXT A;  3LW5 H;  3MHS C;  3L71 J;  3B8E B;  4EFE A;  4DV1 B;  4CS3 A;  4EI2 A;  1JOY A;  2EIK B;  1NGM B;  4DUX A;  1SQB H;  2JWA A;  2P4V A;  4UFC A;  2XOK G;  2HG5 D;  1IZN B;  2IJJ A;  1L0N G;  4G27 B;  1LR1 A;  2KUB A;  2QIW A;  4DO2 A;  1SQX J;  5AW1 B;  1WRG A;  1X0T A;  3AE8 C;  3RYH B;  1L0N D;  4DUY B;  1BZK A;  3IJ4 A;  1N36 B;  4JI2 O;  4J5T A;  3KQG A;  5IDJ A;  1T5E A;  5IE9 A;  2WT7 A;  3CPW O;  3OW2 O;  3D4Z A;  1N32 B;  3T1Y B;  1K4C C;  3AG1 B;  4DR6 O;  1H89 A;  4CH3 A;  2M8R A;  4DR5 O;  1EXI A;  2DMX A;  1RQV A;  4HNA A;  4FM2 A;  2WPR A;  4FLU A;  1BGY E;  1JFF B;  2E2U A;  1YIJ V;  3G9R A;  1IU7 A;  2B87 B;  3K0D A;  2Q9L A;  3AE2 C;  4RO0 A;  5J2U A;  2WSF H;  2WLJ A;  3BA9 A;  3E8F A;  4FNQ A;  2IPP A;  1NTK H;  4DR7 O;  1N7R A;  4JI5 O;  1RP3 B;  1Z2G A;  2ZIM A;  1K8A Q;  3D50 A;  1W7C A;  4MVQ A;  2OGU A;  3JCZ A;  2Q4P A;  1KYO H;  2XNX A;  1S1C X;  3E7K A;  1NKG A;  2W8Z A;  2JRI A;  5B66 Z;  1JJ2 U;  2WVX B;  2RN9 A;  3ACT A;  3JD2 A;  1HWW A;  2WGQ A;  1TVK A;  4FM1 A;  3MD0 A;  3P8C D;  3L72 D;  2W0Q A;  3EFF K;  2YXQ B;  4WY4 B;  1WAZ A;  3CCQ P;  3HD7 C;  1TQU A;  1F4A A;  2C11 A;  2CWT A;  3K06 A;  1FE6 A;  3JAK A;  3RL0 C;  5LGT A;  1DX7 A;  1QR9 A;  3GHG A;  3WA2 X;  2OIE A;  3OFN G;  3SPH A;  1QLE C;  2QM4 A;  1J1D C;  2IJI A;  2A0L A;  3MZW B;  3VDA A;  1KB9 F;  1I94 O;  1KD1 W;  1NTZ D;  1XI1 A;  4I55 B;  3PH0 A;  3K5B A;  1VQ4 P;  4OWF A;  4JI6 O;  3T2O A;  2QSA A;  1NSX A;  4TV9 B;  1SQQ E;  3J7H A;  3FX0 A;  1FS0 E;  1ZL8 B;  3ZMU A;  5KLV E;  1JZ3 A;  3SXX A;  4H37 A;  2PY5 A;  2LW1 A;  3SYP A;  1N34 O;  3FAV A;  3NMD A;  3FXD A;  4PDR A;  2Y69 B;  1FDI A;  1DEB A;  2BCC G;  2GHY A;  2E76 B;  4GOE A;  1RWG A;  2AXC A;  4GUN A;  4N23 A;  2Z5I A;  5IYD O;  3M0A A;  3MUD A;  5TIS E;  1JZ5 A;  3K59 A;  2P4K A;  5TJH A;  1JVM A;  4NEI A;  1OW7 A;  4JV5 O;  2LKM A;  1J1E C;  3UQ8 A;  2RQ6 A;  3CV5 A;  1KP2 A;  2HLD G;  3GG2 A;  4J7J A;  3OT7 A;  1USD A;  1PS3 A;  1OJH A;  1W59 A;  2P7T C;  3AK2 A;  4KXR A;  3K9S A;  4LFA O;  2N1T A;  1IBL B;  2AXT H;  3R2P A;  3Q3D A;  3CJH A;  5JJN B;  4LGD E;  1Z5W A;  2CFL A;  1NU1 J;  4EFB A;  5IYZ B;  2ALW A;  5L3D A;  1RWH A;  1XEQ A;  3TF5 A;  3FGA D;  3D51 A;  2QEX P;  4FLT A;  3SGI A;  3C1L A;  1T3U A;  2R3C A;  3PHL A;  2G3A A;  4BRY B;  3IMH A;  1SQX E;  2CFD A;  2QJY C;  1WMP A;  3B2E E;  3BAA A;  1XQ8 A;  3B5N B;  2OYI C;  1VEW A;  5J2T B;  3CCJ V;  2JK5 C;  5AW7 B;  1C82 A;  3CRQ A;  4I9Q A;  1FU1 A;  1KB9 D;  1PP9 D;  2WW1 A;  3NR7 A;  3DX4 A;  4YPC A;  1N8R W;  3K0G A;  2P58 A;  2HFE D;  1N73 C;  4H44 D;  3BRT B;  2JDI H;  3NBJ A;  3BAT A;  4QE7 A;  4H13 C;  1AI7 A;  1ZX3 A;  5FLX N;  3S3X A;  2ITA A;  3T2M A;  1OZ0 A;  5LYJ A;  1MMZ A;  2DYR B;  5LOV A;  3CXH H;  1ZLL A;  1TUB B;  4B08 A;  3CCL V;  5EZY B;  4H0L B;  1JTH A;  1M1J A;  4W80 A;  5B5E E;  5CCH C;  4I7Z B;  4JYB A;  1MKM A;  2EJR A;  1B3Q A;  1T8Z A;  1IXB A;  1PM9 A;  3KZI H;  4FLX A;  2WCO A;  4AQY O;  1FZE A;  3VMZ A;  2CGO A;  3CC4 V;  2FFD B;  2EIL C;  4WFA V;  1JZ2 A;  4WF9 V;  2I1K A;  1NTM K;  2BEZ F;  4N3Y B;  1VQ5 P;  1KIL E;  1IBK B;  2QWO B;  1FYJ A;  2ARH A;  2KSD A;  1F1S A;  2OOV C;  1J5E B;  2Q7E A;  1PZQ A;  3KPE A;  1AVL A;  4OGQ C;  1VF5 B;  3P30 A;  2XN0 A;  3FFQ A;  3MI6 A;  3CCR V;  5J2U B;  4FK5 C;  2KKW A;  3NRE A;  3ETG A;  1AJP A;  3M9B A;  1PP9 E;  2OTL P;  1MAB G;  3VQV A;  1TU3 F;  3UO2 A;  3HTK A;  3MHH C;  3G6B A;  1FAF A;  3GHG C;  1GL2 D;  1XNR B;  2JEX A;  3X40 A;  2WMM A;  1VP7 A;  1MV8 A;  2YO3 A;  1NS4 A;  1GO3 F;  1N36 O;  4JI2 B;  2OAR A;  1M90 Q;  1HNX O;  4PHZ A;  5KJ7 D;  2ZVO B;  1I94 B;  4KP4 A;  4I2L C;  4H44 B;  4K8Z A;  4U7O A;  1OW8 A;  3NTN A;  1JY2 P;  1S5L E;  1LF6 A;  5E1Q A;  2JP3 A;  3S4C A;  2F4V B;  3RSY A;  1S77 D;  1JCC A;  1CPY A;  3KCY A;  4JF3 A;  2D2C C;  2ZE5 A;  1JY3 N;  4DR2 B;  4O9B A;  3WUU A;  1OJO A;  1WMN A;  3IFM A;  3GB7 C;  4TV9 A;  1HXK A;  5B66 H;  2F7R A;  3SX1 A;  4DCK A;  3AEE C;  2OW6 A;  1H2L A;  2P90 A;  3CCV P;  2GTA A;  3CC7 V;  1V55 B;  3J80 N;  2DWE C;  2A06 H;  1R5L A;  3T4Z A;  3WIR A;  2XHN A;  1PL5 A;  3OS7 A;  1OXZ A;  3TGU J;  1EKM A;  1Q5O A;  3RFR A;  1GK4 A;  3E89 A;  3CCS V;  2GUZ A;  1AV4 A;  1IQX A;  1KOR A;  3WUT A;  2P67 A;  3G4S P;  1EQ7 A;  2Y0I A;  1OCR B;  2XT9 A;  4DUY O;  3U1A A;  5LHH A;  2OTL V;  3ABM B;  4AIL C;  3ABL B;  2K9J B;  1SS3 A;  4AUW A;  3QNE A;  3TNU B;  2OYH C;  1ZME C;  3CRM A;  2QE7 H;  1DH3 A;  4DV2 O;  1I08 A;  1M9N A;  3DX3 A;  1JA8 A;  3THO A;  5EIB D;  2B9Z A;  3CWB D;  3L74 G;  3ECQ A;  4I55 A;  3ZN1 A;  5D5Q A;  3TNU A;  3QO8 A;  5CCG D;  2CG0 A;  1EDJ A;  1KB9 I;  4DV3 O;  5KHJ A;  1OJM A;  4ZOL B;  4PD4 E;  4B3S B;  2Z0A A;  3R65 A;  2NNU A;  1KFN A;  1M57 B;  4GLX A;  1W0K G;  1QVG O;  1F7Y A;  2PRR A;  4WWI A;  4IFD K;  1PPJ D;  3RK3 E;  4GX2 A;  1MUU A;  3IC9 A;  5CA0 B;  2WSS H;  4P9O A;  2Y0C A;  4RQE A;  1L0L K;  1JY3 O;  3S1K A;  4XBF A;  2W6A A;  1Y9B A;  3ZHQ A;  1YJN V;  2EAD A;  3E8B A;  4DUZ B;  3Q2Y A;  4I0X A;  2OYQ A;  3WB1 A;  1ZP0 C;  2Y0P A;  3VSN A;  2WSC H;  3H1J G;  1GD2 E;  4LFB B;  4K8X A;  5HFM A;  1NSU A;  4WB4 A;  1IXM A;  1AR4 A;  5AVT B;  2KIK A;  3BS6 A;  2NPS D;  2ZD9 A;  5CB4 A;  4TQD A;  4PA7 A;  4C7U A;  3H1L E;  3HE4 B;  1G2C B;  1KD1 Q;  1L0L E;  4LC1 A;  3LSU A;  1YQ3 C;  2IU3 A;  3G67 A;  2ZT9 D;  1GN4 A;  4BIU A;  1ZRT E;  3I3D A;  3LIE A;  3H9V A;  4JTA B;  2UUB B;  1ARO P;  1S4X A;  2M5A A;  2WW2 A;  3VD9 A;  3E1F 1;  1O9H A;  4DR2 O;  1PP9 G;  3VMX A;  2WW0 A;  1RFY A;  3H1H G;  5A1A A;  3N2K B;  3RYI A;  4I4T A;  3D4Y A;  3CSX A;  1QWN A;  4DJG A;  4O4L A;  1H8A A;  3VSM A;  4EDF A;  3W68 A;  1IFI A;  1NU1 G;  1G1J A;  3JAT B;  3GW6 A;  1CI6 B;  2DE0 X;  5E1A C;  4YJ2 B;  3L9D A;  2UXN A;  2LFR A;  3FB8 C;  2N1T C;  1BT8 A;  2YXY A;  3L74 D;  3G6E P;  3H25 A;  1ZTE A;  3O9O A;  1NSZ A;  4JYA B;  3X3Z A;  4KTP A;  2KNC A;  3CWB E;  1GTO A;  2YEV B;  1L0N J;  3SFD C;  4FFB A;  3BCC H;  3BUQ A;  2P5O A;  2YNY A;  4LR3 A;  4DR1 B;  2WPQ A;  4B86 A;  4PD4 D;  3SWY A;  2E5L O;  2KS1 A;  3AED C;  1I5Y A;  2EZO A;  1JYV A;  3W7T A;  4PI0 A;  3Q4H A;  3L72 E;  5IJ0 B;  2ZCE A;  3ZRV A;  2Q6Q A;  4X66 O;  2GUV A;  1NVP B;  1SIH A;  4EB6 A;  1KIL B;  3SPJ A;  5IJ9 A;  2F66 C;  2QKC A;  3HKC B;  3O6Q A;  3D71 A;  1I7F A;  4GOD A;  3IN6 A;  1S9K E;  3BAS A;  1BE3 G;  4DV7 B;  3ZMS A;  1SFC C;  1FZF A;  3MUZ 1;  4FFK A;  1PV3 A;  1OCC B;  3TET A;  4BZG A;  4KFM A;  1P7B A;  1AJN A;  3STZ C;  3RL0 g;  4RES B;  3A24 A;  1RF1 A;  1TQW A;  1SQQ D;  3H1I D;  2YI9 A;  2VQE O;  1S76 D;  2ODM A;  4H0L C;  3L35 A;  3BUP A;  3DX2 A;  3E1R A;  1TGO A;  3JAS B;  3FD9 A;  5GTH Z;  2UXB B;  2AEM A;  3T09 A;  4ZNC A;  4DV5 B;  1XTG B;  3CC2 P;  4RUE A;  4BWN A;  3S4D A;  5H5N A;  2GDS A;  4C7N B;  3DSQ A;  5A9G A;  4R6Z A;  1FZG A;  1IFD A;  3UM7 A;  1OJN A;  4PDM A;  5KHG A;  2F18 A;  3JYC A;  2YIB A;  1VQ8 P;  2JKP A;  1VF5 C;  5CMZ A;  2JKE A;  5KX5 A;  2W6J H;  1S0V A;  1JX9 A;  2YXL A;  4AQY B;  2YKP A;  4JI1 B;  3U1C A;  3SJB C;  2Y9Z A;  1RE3 A;  1H54 A;  2JEE A;  1EBO A;  1PNL A;  5B1O A;  2CTR A;  2IM9 A;  2KP8 A;  5JJE B;  4PDV A;  4OPH A;  1SQP H;  3CXH I;  3L72 G;  4DOJ A;  4XDJ A;  2C9L Y;  3A0R A;  3HIG A;  1Z45 A;  3M7M X;  3M0D A;  4F6E A;  2QJP B;  4ASV A;  1Q6H A;  1BCC E;  5LHG A;  2CH7 A;  3AE4 C;  3S9O A;  1GH6 A;  4HB1 A;  4TV8 A;  5KKZ B;  4UB8 Z;  1JY2 O;  5BZB A;  5B3S B;  3SYQ A;  2NZ2 A;  1U57 A;  2WSC J;  2ETN A;  4DXW A;  4N78 E;  5K5G B;  3RRS A;  2OWO A;  1SQX K;  2LQT A;  3LNN A;  1RY3 A;  3H1L H;  1SQQ G;  1XOU A;  4DV1 O;  2QJK B;  4DT0 A;  4TUY A;  1BE3 E;  2DYS B;  2BT3 A;  2MKV A;  3UIA A;  3CD6 P;  2HJF C;  1ZL8 A;  4L76 A;  3L75 G;  1HNX B;  1NJI Q;  1LF9 A;  3AG7 A;  3CCJ P;  1Y74 A;  1XUQ A;  2QTS A;  2GUZ B;  2WIT A;  5LBQ A;  2V4H A;  3BY6 A;  2YMY A;  2HOD A;  1BGY D;  1Y47 A;  1XMQ O;  3RWR D;  5KA6 A;  2WVY A;  1GMG A;  2QM8 A;  2QG4 A;  1G2C A;  1BCC H;  2CH7 B;  5JWP A;  3RBX A;  5EBM C;  4W4L A;  1PX3 A;  1K9M Q;  4J9Z B;  1KQS O;  4H44 C;  1ZRT D;  1V7V A;  5EC2 C;  4GOF A;  1XDC A;  3D52 A;  2JDI G;  1VAR A;  4BW9 A;  1L7J A;  1YSC A;  5DED A;  3VP9 A;  1SQQ J;  3SSU A;  1B04 A;  2WQY C;  1M56 D;  3G3Z A;  3CCL P;  2ZQ0 A;  5CN0 A;  2R44 A;  1CI6 A;  4YXW H;  1OVU A;  1YBK A;  2IU0 A;  2IBZ H;  3HKD B;  3I55 P;  3OMN B;  3T0D A;  3FKS G;  3UKM A;  1NTM E;  2FUT A;  3ZRX A;  3CL3 D;  3KZI Z;  4XDK A;  2A45 H;  1MN0 A;  2AHY A;  1MZ9 A;  1W5C E;  2R70 A;  5KAI Z;  3OMA B;  2BTQ B;  1SQV K;  3T4D A;  2YS8 A;  1M57 C;  1KC8 W;  1AQ5 A;  1EM1 A;  2CWV A;  2HEP A;  1GK9 A;  1RE4 A;  1VQK P;  1K3E A;  2OQE C;  3SYC A;  4LF4 B;  2HLO A;  5TIS H;  1HN1 A;  2GTS A;  1WPB A;  1L2P A;  3OUF A;  1R5S A;  5AVZ B;  4RUF A;  3L70 G;  1L4A D;  5CB4 B;  1KQF B;  1NKD A;  1FD9 A;  2DJV A;  2F7O A;  3RK2 B;  1YJW P;  3T2Q A;  4FJC C;  2WLI A;  3FB6 C;  1T2K D;  2Q7G A;  3II6 A;  2F93 B;  5BMV B;  1PKX A;  3AE5 C;  3DC5 A;  1N8R Q;  2BTQ A;  1EZV E;  2GUS A;  3A0B E;  3C3T A;  3AEG C;  1YEW A;  2K9Y A;  4LF7 O;  5IYB O;  2ATK C;  3ZRS A;  1GN2 A;  2WSE J;  4R7C A;  4CH5 A;  4EV2 A;  1DD4 A;  5AG2 A;  4O4I A;  1L7K A;  1TUE B;  5JVD B;  2WOF A;  1BCC J;  5JMD A;  2K37 A;  1RSO A;  2ZR2 A;  3CB2 A;  1AJQ A;  3R4Y A;  3DDF A;  1IDS A;  1URQ A;  4F4L A;  2FKW B;  2HVJ C;  4U3J A;  4O4I B;  5LGN A;  2UXD B;  2YXR B;  1XMQ B;  3TYY A;  2ZE6 A;  1PIX A;  2ZYD A;  1V54 B;  4EIJ A;  3CXH E;  1CW5 A;  4CZZ A;  3JD1 A;  3UCS C;  2BAS A;  4W7Y A;  3M06 A;  2GM4 A;  1Q8I A;  2FYZ A;  1RW9 A;  2BCC H;  2QKA A;  1MG1 A;  2LFS A;  3HD7 B;  2RMK B;  1HWY A;  3FB7 C;  2QM7 A;  1VF6 C;  2XTA A;  4B3R O;  1OHH G;  3KDP B;  1SC5 B;  1SFC A;  3N7N A;  1H0T B;  2YFN A;  4UCS A;  4LFB O;  3E35 A;  2SPZ A;  3SR2 C;  3ZHT A;  1KEC A;  3F5H A;  1RJO A;  1K92 A;  3BVO A;  1YIT P;  4J10 A;  1EC5 A;  1NTK G;  1IBL O;  2YFO A;  3AG2 C;  3ZCC A;  3LDE A;  5GTH E;  3LOY A;  1FZA A;  4X1I A;  1L0L H;  4KFF A;  3A0O A;  2WLL B;  2IJH A;  4A7P A;  1VQL P;  1N9E A;  4UB8 H;  3E7J A;  3JSL A;  5L8R J;  2XUM A;  1EZV D;  3OA7 A;  2WA4 A;  2R5D A;  1NS0 A;  4UVA A;  3CPW U;  1LT9 B;  4TSF G;  1GN3 A;  4JI7 B;  3BLC A;  2Q0A A;  3LID A;  1JCH A;  3V4W A;  2KYV A;  1CEZ A;  2WVR A;  1H38 A;  1FXK B;  5EIB C;  3RYF A;  2P2U A;  1Q81 Q;  3IC7 A;  3SFE C;  4RKU J;  1QVF O;  3FWN A;  5H6R A;  2Q5U A;  5FPO A;  4UB8 E;  2K9J A;  4RJT A;  1M1K W;  4Z2W A;  3K03 A;  4LCU C;  1NO4 A;  2HJD A;  1LWU A;  2WA3 A;  1FZC A;  1MMY A;  3SWF A;  3PJS K;  4WCE V;  4PV1 B;  1BCC G;  4NTX A;  5AW4 B;  2JJ2 G;  1GW3 A;  1IFM A;  4LF9 O;  1OVR A;  1L1F A;  3OW2 U;  4GT1 A;  2YO2 A;  2E2V A;  3FYI B;  1U96 A;  1VQO V;  1RH5 B;  1KMI Z;  5L3B A;  4D6T D;  2CTP A;  5AVU B;  2IYO A;  1X4T A;  2WAM A;  4U3F H;  5K1P A;  1QAL A;  1MOF A;  1M90 W;  2WOH A;  1Y66 A;  3B40 A;  2HG5 C;  1VQM V;  4BIO A;  3DEC A;  4NXN O;  3S3W A;  1VQ8 V;  5APY A;  4LH7 A;  2NPS C;  3VDB A;  2JWD A;  3VD4 A;  2HYN A;  4PD4 I;  3CZS A;  1NS8 A;  1HR0 O;  2WSE H;  4FVM A;  4UCR A;  5GTI Z;  1YIT V;  1W4N A;  4IL6 Z;  1YHQ P;  3I3E A;  1HNZ B;  2M3E A;  1X22 A;  3MUY 1;  4L87 A;  2I8D A;  2YXH A;  1HTL C;  1I5X A;  2CE4 A;  3JCU Z;  4OH8 B;  1M1J C;  3T1H O;  3TGU E;  3EJS A;  4AHC A;  2DW4 A;  4J80 A;  1N7Q A;  2DYS C;  1F23 A;  4O2B B;  4H13 B;  1AI5 A;  1Q6I A;  1Q82 W;  4EV5 A;  4DV6 O;  1GK6 A;  3BUD A;  1NHL A;  4BZE A;  1S5L X;  2E3C A;  3L73 E;  2R9A A;  4TT3 G;  4JI4 O;  3PTZ A;  2BRW A;  3HR0 A;  2CTQ A;  2AZ0 A;  5GON A;  5B1B C;  3L72 J;  3Q1N A;  5CJ0 A;  1QAF A;  2CIQ A;  3SJQ C;  3IFX A;  2IFM A;  1NSV A;  3GVM A;  3HD7 D;  3JAW A;  1JO5 A;  2KB1 A;  3KXD A;  3RL0 D;  1AB3 A;  3NXS A;  4XA4 A;  1S5L Z;  5AVX B;  2EZP A;  3HKB A;  1PNM A;  1JPX A;  5JJJ B;  1URQ D;  1DYU A;  1LTI C;  3AEF C;  1PL0 A;  2BCC E;  3I5C A;  1P84 E;  2Y0E A;  3TK1 A;  4NYK A;  5IY5 B;  3T1C A;  1HGV A;  1N73 B;  1PD3 A;  1LXM A;  3CXH F;  1IFN A;  3RK3 C;  3UT5 B;  2K88 A;  3MV1 1;  1OCC C;  2OYO A;  2YKO A;  2CUG A;  3L73 H;  3HKC A;  2W27 A;  3CWB G;  2UU9 B;  1NSM A;  4LP8 A;  1RKY A;  4BWA A;  3F7Y C;  1LTG C;  5KMG B;  1XHX A;  1DK1 A;  4X1K A;  1SER A;  1LTB C;  4D6T H;  4X62 O;  4DV0 O;  1L0L J;  3B5N D;  3ACS A;  2OTJ V;  3AG1 C;  1KUQ A;  4JI0 O;  1QCE A;  4YXD C;  5AW6 B;  3CCU P;  1VQP V;  4F6R B;  1L0N K;  3JAT A;  1O7D D;  5M1B A;  1VMG A;  4GIF A;  1J95 A;  3DXR A;  3IF4 A;  3JCU H;  1X79 B;  3TCU A;  5BY1 A;  2UUA O;  3AE1 C;  1KTM A;  4JYY A;  1H2G A;  1BCC D;  3WA3 A;  2ZE8 A;  4LF9 B;  2ZNI A;  2ZYG A;  4TWK A;  4IL6 H;  3QFY A;  2ITC C;  2KXP B;  4Y99 C;  4I6M C;  1B6Q A;  2XAJ A;  3CME V;  2WW3 A;  4UVC A;  1NU1 E;  2IYP A;  2C2A A;  3E22 A;  2Q73 A;  3ASN B;  2R32 A;  4FMT A;  2V1D A;  1QL2 A;  4UB6 H;  1YYC A;  2N05 A;  2KLU A;  1YJW V;  4G28 B;  4DW0 A;  2O01 N;  2Y69 C;  1SVF A;  4ZKU A;  1KIL A;  3L72 H;  2F7Q A;  1H8E G;  1URQ B;  3JAS A;  5JQG A;  4JYC A;  2LGQ A;  4ABM A;  1Q86 W;  3U59 A;  4GKK O;  1VQ7 P;  1XMO O;  3LNM B;  1FJG B;  3HI7 A;  4JI3 B;  3H1L G;  3DXR B;  2ZXW B;  1YTZ I;  2MJZ A;  2CQT A;  5AW9 B;  3CX5 F;  3CD6 V;  3ALA A;  5LOV B;  1ZR2 A;  2R5B A;  3H1J E;  4ZKI A;  1KFM A;  3A3Y B;  1SO0 A;  2M6Y A;  2FYU E;  2N9Y B;  1YQ2 A;  2OCC B;  2Q7C A;  3CCM V;  2P1J A;  1E79 H;  3K5N A;  4JAA A;  2FYU G;  3T1Y O;  4L75 A;  2LJ2 A;  4JV5 B;  2XV5 A;  1KV4 A;  1NTZ K;  4QIW F;  1SQP G;  4LBE C;  3QFZ A;  2I1J A;  2YKQ A;  1SQB G;  3L73 J;  5FPR A;  3L75 J;  1X9V A;  1NS7 A;  1R34 A;  1HR0 B;  2E76 C;  2VQF O;  2KLV A;  1EZJ A;  3M91 A;  1XRE A;  3FAV B;  2M0B A;  3Q5R A;  1QL1 A;  2WLL A;  1SQP K;  2PNC A;  4TUY B;  3FYE B;  4C7N A;  1R1B A;  5CA1 A;  4MTX A;  1QX8 A;  2FYU K;  3ZJZ A;  3G80 A;  1RSO B;  2UXD O;  3USS A;  1K05 A;  2Q6A A;  5BU5 A;  1D6U A;  1LVN A;  4NXM O;  1I8Q A;  2Q1F A;  4WFG A;  1IUR A;  1XNQ O;  5KUK A;  1MA1 A;  4M3L A;  3CLQ A;  1RE4 C;  4Z1M H;  4WFF A;  1GDT A;  2P06 A;  3K5T A;  3AMO A;  4LF5 O;  1ENV A;  2GBO A;  3E1I A;  3JAK B;  1NS2 A;  3H1J J;  1D7M A;  3H1K D;  4OGQ D;  2HPC A;  2QWR B;  1FJP A;  1R6N A;  1K1W A;  2WZS A;  3HKE B;  4TOI A;  1YTF B;  5KLV H;  5IWA B;  1E5W A;  3FXE A;  1FZC B;  4HZ3 A;  5AVY B;  1OIP A;  1NSR A;  1SZX A;  2HHH B;  4UV9 A;  5E79 E;  3BVV A;  5APT A;  3W7S A;  3ASO B;  2DYR C;  5LGU A;  2IJK A;  1PV0 A;  4CS4 A;  3BCC J;  1KB9 H;  3H1L D;  1GL2 C;  2RDC A;  2LXB A;  3M8A A;  1EN5 A;  1NQT A;  1S2E A;  3B5N A;  4L74 A;  3MWX A;  5KJ7 C;  1N7O A;  1P84 F;  4D6T E;  2Y9Y A;  3H1H J;  2B87 A;  5CA3 A;  2VWJ A;  3AG3 C;  4FLY A;  1Q82 Q;  1FZB A;  4ZKP A;  1FOS F;  1EDI A;  2FYU D;  4O4J B;  1L4A C;  2Q68 A;  1XTC C;  2A06 G;  1TU5 A;  4NPE A;  2JEU A;  1Y76 A;  1A32 A;  2XHB A;  5CCG A;  4MVO A;  2O57 A;  2D2C D;  1Y4M A;  4U7N A;  3CCV V;  1VQO P;  3E8G A;  3CMA P;  4DR6 B;  2VS0 A;  1SQB J;  3L73 G;  2EX3 A;  2HR3 A;  1OCZ C;  3LDD A;  3CXH D;  3CRR A;  3PLN A;  1A02 F;  4QJF B;  3H1K H;  1Q43 A;  3D3I A;  1URF A;  5J9P C;  5LMN O;  3WVF A;  3V2N A;  1PFI A;  1L8D A;  2RKL A;  4LNU B;  3DYM A;  1W2Z A;  3TGU D;  2WLI B;  3MP7 B;  4P30 A;  3BVT A;  4BZH A;  3ZN0 A;  4ASW A;  4RWU A;  4NKG B;  1W3Y A;  3TGU G;  3N2G B;  1KIL C;  1CXZ B;  5E79 Z;  5APX A;  1AJY A;  2WZ7 A;  1YJN P;  5TIS Z;  3M99 B;  1CZQ A;  2ZE7 A;  2FFD A;  3I56 V;  2BSK A;  2K1E A;  1RM1 C;  3JAR B;  2E74 C;  2LO1 A;  1LJ2 A;  3C9I A;  1S9K D;  4MMI A;  5J2T A;  3LVT A;  1I0H A;  5CBN A;  4J11 A;  2K9P A;  1OVV A;  1DGS A;  1NU1 D;  1SA0 B;  2JGD B;  3L75 D;  4QE9 A;  1ZW0 A;  1JMK C;  2LR2 A;  1PGO A;  4UCO A;  5F2V O;  5LP6 A;  3TXS A;  1Q6U A;  3E2E A;  4MW8 A;  3D36 C;  2PFX A;  1XL4 A;  4WBN B;  1IVX A;  2UXB O;  2F4V O;  2XAQ A;  1MFT A;  1AI4 A;  2F23 A;  1V55 C;  1P84 D;  2KZJ A;  3WUV A;  2EIM B;  5KAF H;  3W7W A;  1GU5 A;  2FKX A;  4R50 A;  1U97 A;  2ZT9 B;  4B7E A;  4JI8 O;  3KZI E;  2NPS A;  3OR6 C;  5LMU O;  1AP6 A;  2L35 A;  4N21 A;  4EKW A;  4PJ0 H;  3APQ A;  2XDJ A;  3G6E V;  5EYP B;  1VQK V;  5IYZ A;  3H1J D;  4JZG A;  2WSF J;  1DD3 A;  1RPO A;  2G38 A;  1MZE A;  1GKF A;  4K0K B;  5DEC A;  1SA0 A;  3VD5 A;  1SNZ A;  1KC8 Q;  4LFC O;  3G71 P;  3T08 A;  1DP0 A;  2E2T A;  2B9B A;  3OTO O;  4FLW A;  2E5Y A;  1J0N A;  1N0N A;  4X64 O;  1NSS A;  1SP4 A;  2X6B A;  3ZRW B;  2MK3 A;  2QA4 V;  1QVF U;  1EDL A;  3H1J H;  4NTW A;  3HKB B;  2CK3 H;  3BRC A;  1CP9 A;  3SDL A;  3Q4H B;  3M0D C;  3V5B A;  2XAH A;  3T0A A;  1BGY J;  3QTC A;  3L36 A;  1JCD A;  4RNL A;  2CPB A;  3X3Y A;  3MHV A;  1N7N A;  2VWK A;  5KKZ C;  4BAY A;  4D7T A;  3HUS B;  4UCT A;  3H1I H;  5ITZ A;  4JZ2 A;  1J1E B;  5EYP A;  1RF0 A;  2FYN B;  2DWD C;  3HTK B;  3R66 A;  3SWK A;  3CX5 I;  1OCO B;  2N9B A;  2HTA A;  4ZHQ B;  4FNP A;  5B1A C;  1NVO A;  1KKD A;  2IZ1 A;  4WVZ A;  5L3G A;  1Z5V A;  3ASN C;  4DW1 A;  2N1T D;  2PUS A;  3RVZ A;  1L4A A;  2C0W A;  1EZV G;  3A0H Z;  3H32 A;  2HHH O;  4FM0 A;  1H2N A;  3WU2 Z;  2LGW A;  4RAI A;  2J5U A;  5KLV D;  2M7W A;  1LUV A;  1YHQ V;  3ABK C;  2A7W A;  3ETD A;  5LP6 C;  4Y28 J;  5CJ4 A;  4OK4 A;  5KLV G;  5IJ9 B;  2DOS A;  4LH6 A;  2G8Y A;  3EQ2 A;  3RN4 A;  4B7K A;  2VQF B;  3L73 D;  4I1L A;  3TJT A;  1HBW A;  2LW7 A;  4MN4 C;  1K8A W;  4K35 A;  1X1H A;  1R6T A;  3K5M A;  2Z5U A;  2ZVN B;  4XE5 B;  1JZ7 A;  2ZXW C;  3I55 V;  1FXH A;  3ZHR A;  1S5L H;  2O01 J;  1JUN A;  2PYL A;  2X03 A;  2LP7 A;  2WWW A;  4K3A A;  1NI8 A;  1FOS E;  4OJZ A;  1JYN A;  1VQ6 P;  1QLE B;  1FPO A;  3W67 A;  1TQS A;  1WNS A;  1IBK O;  2UUC B;  3QH9 A;  1FFX B;  2ZFC A;  1ORQ C;  2WYH A;  3AEA C;  3D8C A;  2EBO A;  1FKA O;  4I9W A;  4I50 B;  1YCI A;  1J5E O;  2BOB C;  5H2F Z;  4CS2 A;  1NH2 D;  4GKK B;  3RYC A;  4P2Z A;  1LUR A;  1TAE A;  2AGA A;  2ZDI C;  3TXQ A;  2UUA B;  3C8V A;  1COW G;  4H0L D;  2ZL8 A;  1ZOY C;  1GM9 A;  1GW4 A;  3OGC C;  2EJ7 A;  3J7A U;  1SQF A;  4DK1 A;  1LTJ B;  4O4H B;  4JI0 B;  2JGU A;  3VOU A;  2YIU C;  3L70 E;  2B88 A;  1NJI W;  2AZ2 A;  2IZ0 A;  2QTO A;  2R72 A;  1SII A;  4DV2 B;  2OQQ A;  2RH0 A;  3PGB A;  4LF6 O;  2JR8 A;  1GRJ A;  5BR8 O;  3RGB A;  1OCR C;  4X1Y A;  3WFA A;  1U7J A;  4X65 B;  5DJU B;  2XZR A;  3X41 A;  1XHZ A;  1VF5 D;  3BAB A;  2Q69 A;  3RK3 D;  1GL2 A;  1M1K Q;  3RK2 D;  2IBZ I;  2DQ3 A;  1QU7 A;  3HII A;  4YHH O;  5KA5 A;  1D5N A;  1DEE G;  3RK3 B;  1ZN5 A;  4GZR B;  3CC4 P;  2WYI A;  1LTJ A;  5KBP A;  4MVS A;  4H33 A;  4Q20 A;  1GM8 A;  2ZQM A;  1VQ6 V;  3U0Z A;  1VL2 A;  3CX5 H;  1DLB A;  3GHG B;  2WLK A;  3HKD A;  1PGP A;  3EJT A;  3P8M C;  2W6B A;  1SLQ A;  1AVY A;  3BFR A;  4PV1 D;  1NAY A;  2LXC B;  4ASU G;  3GMA A;  1HUC A;  1HW7 A;  2WLH A;  4CPG A;  1GM7 A;  1IBM O;  4FPP A;  1WP7 A;  2KG7 A;  4XDL A;  3T97 B;  5EK0 A;  1R3K C;  4BW5 A;  2Y4T A;  1KQG B;  4DUV A;  1S3J A;  2Z5H A;  1BE3 J;  5IY5 C;  4UCU A;  3B71 A;  4DR4 B;  5KLI C;  1S72 P;  3P8C E;  4IL6 X;  2H7H A;  2HOD B;  1YVW A;  2M5A B;  5B1N A;  2IH3 C;  4B3M O;  3OB8 A;  3RVY A;  2XKM A;  1LP1 A;  1JEK A;  5C8Y B;  1M56 B;  3J81 N;  4KFD A;  2K3R A;  2V7Q H;  1G6U A;  3WG7 B;  2Q9I A;  4JGS A;  3OAA G;  3BVH A;  4IGG A;  3CZJ A;  2FXP A;  5LYJ B;  4I4T B;  1VQ7 V;  4WY4 D;  2D73 A;  1ZUQ A;  2ZYA A;  2BSK B;  4FLZ A;  2W6I G;  5EZY A;  1JTH B;  1W2B O;  1KZU B;  3BLB A;  3A2A A;  3N27 A;  2W83 C;  3CI9 A;  1PX4 A;  3UO3 A;  2E75 B;  1K5Q A;  1OWA A;  2B89 A;  1G1X B;  2YUA A;  1NTZ E;  2A9H A;  1YJ9 V;  3CCQ V;  1YDX A;  1YQ4 C;  5KAF Z;  2E74 B;  2PF4 E;  3FX7 A;  3L75 E;  3CJH B;  3A0H E;  4HBN A;  3OAK A;  5JH7 A;  2OYH A;  3L71 G;  1F4M A;  3GWO A;  5LA6 B;  3N9H A;  2CPS A;  4B3T O;  4BR6 A;  4W4K A;  2Y48 A;  4K0K O;  3TSI A;  4LF7 B;  4U3F J;  1H88 A;  1NOH A;  1EN6 A;  5AW2 B;  4CH4 A;  3L74 J;  2YIA A;  3U10 A;  1NKN A;  3DYO A;  1V54 C;  4CH6 A;  4BRY A;  4PEL A;  2OYH B;  3SJA C;  4U3J B;  3EVK A;  1KBH A;  2JIZ G;  1SQQ H;  3H1I G;  1QR8 A;  1GU4 A;  3AFJ A;  2GA1 A;  1NTM J;  1IVV A;  3TY1 A;  3EJU A;  1HM3 A;  2WT7 B;  2ZAE B;  2CFK A;  1EFR G;  3DC6 A;  2Q1K A;  2QR4 A;  4ZI7 A;  4BIZ A;  1JR9 A;  1SFC B;  5KTB A;  3STL C;  3E83 A;  2F43 G;  1N0J A;  1R73 A;  3V4Q A;  5EC1 C;  2GSM B;  1EZV H;  1H2S B;  3A0B H;  4UB6 E;  3H1K J;  4WFB V;  5BU8 B;  2YEV A;  4TTG A;  4X9Q A;  1YXB A;  4U7J A;  5KLI B;  5B66 E;  1Q3E A;  4UUJ C;  1KKC A;  3AE6 C;  1T2K C;  2IBZ G;  1Q86 Q;  2VRS A;  1K4D C;  4WBN A;  4AYC A;  4MVU A;  3VP8 A;  4O2A B;  3D6Z A;  1N2D C;  1YI2 P;  3BCC D;  1LT1 A;  1CSB A;  2C9N Y;  1LGH B;  3B8N A;  1JRQ A;  1MFZ A;  3OR7 C;  1FXK C;  4IHJ A;  1V9P A;  2QEX V;  5AVR B;  1YJ9 P;  1YGA A;  2CWU A;  2XSG A;  3T0B A;  3X42 A;  1P84 H;  4HYO A;  1RWF A;  2ZJS E;  4FZ1 A;  3U11 A;  1ROP A;  1F4H A;  1BMF G;  3KN4 A;  4LFC B;  2OTK E;  3ETQ A;  2HP8 A;  3L70 H;  4X66 B;  1XNQ B;  3WIQ A;  4KT0 J;  4BXL A;  4IYH A;  5B5E Z;  5C93 A;  1K33 A;  3ABU A;  3ZHV A;  2OCH A;  3CC2 V;  3CMA V;  1RWA A;  3DTU B;  3OTF A;  3ZX6 A;  3I5D A;  1MMM A;  2UUC O;  3B77 A;  1QGK B;  3FWL A;  2EAE A;  5CMU A;  1FDM A;  3ZIA G;  5L3C A;  4JAS A;  2IH1 C;  4DRX B;  3F7V C;  3ABK B;  5APW A;  2NLJ C;  3LW5 J;  3NBB A;  3D6Y A;  1FZC C;  3K9A A;  1SQB E;  1NS1 A;  1UPG A;  1S5J A;  4IHJ B;  4X1I B;  3AEB C;  2E22 A;  3JAL B;  2ITD C;  1SRY A;  1WJZ A;  3H01 A;  2B5U A;  4JAV A;  1L0L D;  2R3S A;  1LNQ A;  3DGE A;  3KII A;  3MV0 1;  5LXT B;  4JTD B;  1KIL D;  3QVN A;  1F4N A;  3WFV A;  4ZHQ A;  1NTZ J;  2A79 B;  1RE3 C;  2CFW A;  3HUS C;  5APS A;  5HFL A;  3HE5 A;  2E74 D;  4TLF A;  5B5E H;  2C0X A;  3ZHS A;  3P7K A;  1MZF A;  3EJP A;  4NPD A;  4RO2 A;  1Y76 B;  1M8O B;  1LTA C;  1WN7 A;  2KI7 B;  2YX9 A;  3A2F A;  3IAQ A;  2CG1 A;  3ZMT A;  2NRG A;  2WPV B;  1M93 A;  1JOV A;  3L74 E;  1SQV H;  1X8Y A;  5CBF A;  4FLV A;  5C8Y A;  2H88 C;  3CS5 A;  4U3F E;  3IR9 A;  4NVP A;  3A0H H;  3HE4 A;  4E2L A;  1KP3 A;  1JY2 N;  2MW2 B;  2EIL B;  4HYT B;  4IIJ B;  2WLN A;  2UU9 O;  2X6C A;  1H2M A;  3Q5P A;  3E86 A;  1XL6 A;  4FNU A;  2HVK C;  3D70 A;  4FNT A;  4LFA B;  3AG2 B;  3QWO C;  4FNR A;  3EJR A;  1R3J C;  3WU2 H;  4IIJ A;  2P22 C;  5DN6 G;  3AK1 A;  4CC5 A;  1Y74 B;  3WB2 A;  1TXK A;  5CA0 A;  1SQV E;  3ML0 A;  5CHX A;  3CHX A;  1JZ8 A;  1BDD A;  1RHZ B;  3L75 H;  2D1W A;  1AVK A;  2YI8 A;  3KG2 A;  2WO0 A;  1W2E A;  1AR5 A;  1YZB A;  4X89 A;  2WSS G;  2YMK A;  3CC7 P;  5LMU B;  4UB6 Z;  1JMM A;  2KQX A;  4JBZ A;  1KQL A;  3O6Q B;  3V2Q A;  1SQX H;  2KNC B;  4MW3 A;  2Y74 A;  2AEF A;  3L71 D;  4FFB B;  1VQ9 V;  2WPD G;  2XAS A;  2UXC O;  2CIR A;  2NR5 A;  1BE3 H;  3AK3 A;  1SES A;  3JAW B;  4Y99 B;  4FIP C;  3RGU A;  4OVN F;  1IBM B;  1RF1 B;  3OEE G;  4JTC B;  3AE3 C;  1FBM A;  3AEI A;  4UFZ A;  4YY3 B;  2NPS B;  2ZXQ A;  1FJK A;  5A2Q N;  4R4L A;  3E22 B;  1US6 A;  1T3J A;  3A7O A;  3I3B A;  2W6J G;  1JZ6 A;  1AA0 A;  3H1L J;  2FML A;  3CE2 A;  5AVQ B;  2B1I A;  2JKV A;  1KSI A;  1URQ C;  2QSI A;  2IFN A;  1LXK A;  4B3M B;  1PPJ E;  3BUB A;  1N33 B;  4NXN B;  3TDK A;  2WVZ A;  3L70 D;  2QKS A;  5EBW C;  1SQV D;  2ZIO A;  4JI1 O;  2KS1 B;  3V2P A;  1G1I A;  2YIC A;  4LF8 O;  1LP1 B;  2FYU J;  1IK9 A;  2CFG A;  1X1I A;  1QLN A;  3P3P A;  1QHT A;  1D5A A;  4YJ3 A;  1HNZ O;  2E5T A;  1OAC A;  3ZBH A;  3V6I A;  4UCV A;  4KJM A;  4JI3 O;  3E8H A;  4N78 D;  1XMO B;  1EXJ A;  3D3Q A;  4R8C A;  2Q7H A;  2OTJ P;  1VF7 A;  3BCC G;  3JCU E;  1HN0 A;  4MS2 A;  2BTO A;  3LSQ A;  2XAG A;  1SQB D;  5KAI E;  3BVU A;  3VN0 A;  1NT2 B;  2ADP A;  4I50 A;  5CBH A;  3B5N C;  2OYI B;  1JYW A;  1JNM A;  3H1H H;  2RDY A;  1NTK K;  1IVS A;  3AG3 B;  2QGN A;  1QLE D;  4JI7 O;  2WPS A;  1OFC X;  2FXM A;  1AP5 A;  1QX1 A;  4Q6G A;  4BZF A;  1GTW A;  5B3S C;  3QDE A;  1PP9 H;  4LF6 B;  3H1K G;  4YJ3 B;  2AW9 A;  4GCZ A;  1NTM H;  4BTY A;  2YSU B;  2JS3 A;  4QPJ A;  3HE5 B;  2Q3I A;  5AVS B;  4TQF A;  3RK2 C;  3I56 P;  2BE3 A;  2D2C B;  4UVB A;  1KQS U;  1HDJ A;  1R8E A;  1VQ4 V;  4KHP O;  5AW5 B;  1E79 G;  2W0F C;  3NJV A;  2C10 A;  3Q1M A;  1EDK A;  4X64 B;  4EEQ A;  1N7S C;  3P32 A;  2KB7 P;  4HNA B;  1WLE A;  4QMA A;  5CA1 B;  4MMH A;  5KHK A;  1E1Q G;  4QGP A;  4W7Z A;  5CCH A;  4JI5 B;  2QWQ B;  1Q2N A;  1K97 A;  3HB3 B;  1W6G A;  4PDL A;  3G4S V;  2ZM6 B;  2KOG A;  2P7J A;  1D6Z A;  5H6Q A;  3RYC B;  1KYO F;  3B09 A;  1BSM A;  2KSE A;  1SF9 A;  5KX5 B;  3FB5 C;  2A45 I;  2IX7 C;  3VOP A;  1MMX A;  3T0U A;  1OW6 A;  1K34 A;  1EZV I;  2EIN B;  1PGJ A;  2IDB A;  1N32 O;  1AV1 A;  4JPZ B;  3LUT B;  2PI4 A;  1N73 A;  1K1Y A;  1SQP D;  3IAO A;  5LHI A;  1RQU A;  2P10 A;  3CWB J;  1IQY A;  5DM6 V;  2E76 D;  5JMF A;  4GX1 A;  3MDS A;  5L3F A;  5AW3 B;  3EJQ A;  5FNV B;  1VQM P;  4IYI A;  1ZLZ A;  1QAK A;  4UXN A;  2E24 A;  2WLM A;  1OMI A;  2F1B A;  1QNM A;  2QJP C;  4GX0 A;  3K5O A;  1BHA A;  4X8A A;  1P84 I;  3O8Z A;  3Q5S A;  3T1H B;  3HKE A;  3QO5 A;  1XIL A;  2V7Q G;  1NVP D;  3ETE A;  1WA8 A;  4F6R A;  2HFE C;  4D6T G;  1SQV G;  2EUL A;  2XN2 A;  2H89 C;  3A8T A;  3L71 H;  2N1T B;  3ABV C;  2QVA A;  3GF7 A;  1HH0 A;  2JVD A;  2FXO A;  3RYI B;  4U3F D;  3JC2 2;  3X3X A;  4BTW A;  4L73 A;  4U3F G;  3VQX A;  1HJ0 A;  4DV5 O;  2OW7 A;  5KUM A;  4NPF X;  1PU4 A;  3APO A;  3MIW A;  4J42 A;  4DR3 O;  1AQT A;  2AXT E;  3JAL A;  4I7Z C;  2Y73 A;  1LUW A;  5GTH H;  4FNV A;  1FFT B;  3VD3 A;  1W6C A;  2JGD A;  2O1J A;  2Z3Y A;  1CB8 A;  3BHP A;  1K04 A;  4PD4 H;  5H9C A;  3K58 A;  3S4A A;  1IK7 A;  3MGN A;  3QG0 A;  3HPL C;  3VMA A;  4NTY A;  1B06 A;  3CYO A;  4DYL A;  1BL8 A;  3CX5 E;  4GX5 A;  2GV9 A;  3WB0 A;  1SQP E;  3H1H E;  1RWC A;  4LF8 B;  5IJ0 A;  1MSW D;  4DV7 O;  1IC2 A;  1M1J B;  3K3W A;  4JF7 A;  3BA8 A;  3OE7 G;  1YTZ T;  1HTY A;  3BVW A;  4PA3 A;  1FS0 G;  2XN1 A;  1UFI A;  4X62 B;  4DV0 B;  4LNU A;  1SS1 A;  4KTR A;  4TT3 H;  3ABM C;  2BCC J;  4JI8 B;  3ABT A;  2CGN A;  1NH2 B;  4DR3 B;  4KFE A;  1P49 A;  4DR1 O;  4JQ0 D;  1SQQ K;  4YY3 O;  3CZN A;  2O01 H;  1SPU A;  3HD7 A;  3QF7 A;  1QQC A;  1TA8 A;  1JY3 P;  5AVV B;  1IFJ A;  4DV4 B;  1HNW B;  3C3S A;  2JJ1 G;  2OYI A;  4DUW A;  2CDY A;  5FL7 G;  4PD4 F;  2N04 A;  4MSW C;  2Q3E A;  1BSH A;  1M5I A;  4PA9 A;  2E42 A;  3CXC U;  1M4U A;  2H8P D;  1T6A A;  3EHB B;  3CCU V;  5KAI H;  1NTK D;  2P6J A;  1SQV J;  2FBW C;  3BGA A;  1D6Y A;  3OEH G;  4YXW G;  2B1G A;  3VMY A;  4J41 A;  1R3L C;  3CWB H;  3KKY A;  1BQZ A;  3S4B A;  4EYY Q;  2QA4 P;  5D5P A;  3OGI B;  2ZIN A;  1UI7 A;  1HWT C;  4D7S A;  4FNS A;  1H2K A;  4IFM A;  1BQ0 A;  5JCO C;  1K73 W;  2ZNJ A;  3ZMZ A;  1UII A;  2KK7 A;  3VYI A;  1FDO A;  2BRP A;  4GKJ B;  3RYH A;  5JVD A;  3B8M A;  3CEI A;  4BTX A;  2Y0D A;  2PTM A;  1KYO E;  3KHU A;  3RW0 A;  4OX9 B;  1R6K A;  5EFW B;  1WT6 A;  3L37 A;  1G8M A;  1ZSP A;  4UV8 A;  3ZMV A;  2WDA A;  2IBZ E;  1HMU A;  3CCS P;  2QWN B;  3VDC A;  1JB0 J;  3KCX A;  1FAV A;  1N33 O;  5GTI H;  1UI8 A;  4DRX A;  1JFF A;  2AHZ A;  1FFX A;  1DF4 A;  4KHP B;  2HTB A;  4IT5 A;  1UIX A;  1HF9 A;  3BUI A;  3AE9 C;  1WMO A;  4WFH A;  3BPZ A;  2CK3 G;  2E75 D;  1R33 A;  1Q90 D;  1R3I C;  3N4X A;  5CCG C;  1HM2 A;  3OBA A;  5FNV A;  5IT9 N;  2DQ0 A;  3K5L A;  4XFJ A;  1FXK A;  3RYF B;  2BRV X;  1VIB A;  4HJG H;  1Y6X A;  4WY4 A;  1EGU A;  4O4H A;  1PGQ A;  1AVM A;  3SYO A;  1WB8 A;  3MTU E;  2QWP B;  5H2F H;  3AE7 C;  2EIJ B;  3AG4 B;  5APU A;  2JJL A;  1MMU A;  1X1J A;  2EAC A;  1S5H C;  3M9H A;  1BDC A;  4DR4 O;  1GZL A;  1OCO C;  4MVM A;  1A02 J;  1MNG A;  2QJK C;  2UXX A;  3CP1 A;  4LF4 O;  3L71 E;  3LDC A;  2ADQ B;  2ZDI A;  2FY8 A;  3VBB A;  1Z56 A;  4JI4 B;  3F5W C;  2KZI A;  2AEJ A;  1GL2 B;  3RBZ A;  5LP6 B;  1NU1 K;  4GKG A;  4A5U B;  3OUS A;  3EFG A;  3MPH A;  1G4Y B;  2FL4 A;  4FZ0 A;  2ZT9 C;  1F9G A;  5AW0 B;  3X2Q B;  3W7U A;  3VD7 A;  4MTG A;  3O65 A;  1NAF A;  1BHB A;  2JS5 A;  4YHH B;  4LLH A;  3H1H D;  1QVG U;  1WP8 A;  4PA4 A;  2OT5 A;  4EOT A;  1QEX A;  4HAM A;  2FYN C;  2O3J A;  5BVZ A;  1A2V A;  3VQY A;  2WVX A;  2YIB D;  2EIN C;  5GON B;  5B1A B;  3SPG A;  3CX5 D;  2HKO A;  5DJT B;  3H1K E;  5CBO A;  2QRX A;  3JD0 A;  2JKA A;  1YIJ P;  2F7P A;  1IVW A;  4LWS B;  4X88 A;  2Q5Z A;  4QNH B;  1PL4 A;  4PJ0 E;  3JSN A;  3NJX A;  2N74 A;  5AW8 B;  4CC6 A;  3SEP A;  4ZBM A;  2PGG A;  2PP6 A;  1BS3 A;  4O4L B;  1V7X A;  5KMG A;  4B3T B;  1AIL A;  4MT8 A;  1L0L G;  2K1A A;  1P7G A;  2OIG A;  4X1K B;  2PZS A;  1N7S B;  1YI2 V;  1J1D B;  2YIU B;  4N6J A;  3SPI A;  1HP8 A;  4L8J A;  3ITK A;  3UT5 A;  1O9G A;  4QPK A;  1W2B U;  1Q7Y Q;  1GMJ A;  1ZXG A;  3AEC C;  1IVU A;  3S4R A;  1SFC D;  4RQF A;  1ULV A;  1VPC A;  2FYV A;  3A5T A;  4KHX A;  2EIJ C;  1PNK A;  3AG4 C;  3EXA A;  1J0M A;  3W7X A;  4NXM B;  2BEQ D;  4JPR A;  1L0N H;  2W0X A;  4LWS A;  1NTK E;  1US1 A;  3K57 A;  2DN9 A;  4YIP A;  2QJY B;  4MVR A;  4DR5 B;  1RF1 C;  5LA6 A;  4C46 A;  3H32 B;  3H1I J;  2CIS A;  2X6A A;  1XBL A;  5KLV J;  3B4S A;  3CCE P;  1WMK A;  1BGY H;  4X20 A;  3TGU H;  3JAM N;  3CRC A;  4C7R A;  5KLV K;  1ZWI C;  4JAU A;  1TUB A;  4PV1 C;  3K25 A;  1S72 V;  3X2Q C;  3K08 A;  4YJ2 A;  3SYA A;  3ZDM A;  3VTP C;  3V2R A;  4EB6 B;  2EAB A;  5BMV A;  1NR7 A;  1W0J G;  3QG5 A;  3AFL A;  1SKV A;  2YID A;  3M9Q A;  1VDF A;  4DK0 A;  3HRN A;  3K04 A;  4Z1V A;  3OD4 A;  3A0B Z;  4CBC A;  1KYO D;  2EIK C;  1RPR A;  1NH4 A;  3EWK A;  3HUS A;  1SQG A;  5JCO A;  3DX0 A;  1KYO I;  3ZHU A;  2R9R B;  2IBZ D;  5KHI A;  1LT9 C;  4WY4 C;  1BSN A;  1OCZ B;  3LSS A;  1JOC A;  4MTF A;  1N7S D;  3RL0 B;  3WU2 E;  2CTW A;  4X65 O;  3MUD C;  4JI6 B;  4DR7 B;  2FFD C;  4IFF A;  4G2K A;  4O2A A;  1NTZ H;  1HGZ A;  1E1R G;  2NN4 A;  1JZ4 A;  2JO1 A;  4DV6 B;  1ZR4 A;  1USE A;  2W90 A;  2J58 A;  1RF0 C;  4YTP C;  3PP5 A;  1PP9 J;  2A3Q A;  5JQG B;  4GYC B;  4OX9 O;  1N7P A;  2Z4E A;  2AXT Z;  3ZED A;  2A45 G;  1NBM G;  1RM1 B;  1SET A;  4OGQ B;  4Z1M G;  1HMW A;  1KU9 A;  1OZH A;  4H13 D;  1QBZ A;  1EN4 A;  5L3E A;  1AI6 A;  3BEH A;  3SJC C;  1SQX D;  1IX9 A;  1LTT C;  4OXS A;  3ZRW A;  1AFO A;  3IAP A;  5GTI E;  3RT3 C;  1DTO A;  2F1M A;  3WG7 C;  2DW3 A;  1JYX A;  3PN1 A;  1LWU C;  2CQS A;  5H2F E;  5APQ A;  5CCH D;  2YC0 A;  3ASO C;  3OMI B;  3F89 A;  2POH A;  4DV3 B;  1NTM D;  2RMZ A;  3DCD A;  4MVZ A;  1OV9 A;  1N34 B;  1NTM G;  2ZXE B;  1TQV A;  2EIM C;  2L6L A;  1BGY G;  1LT9 A;  1AR1 B;  2FUQ A;  4HKZ H;  5KJ7 A;  3OTO B;  4ZIB A;  2VQE B;  2ZKO A;  5GW7 A;  4LF5 B;  1FXV A;  4PA6 A;  2VRZ A;  4D6T J;  2IW5 A;  4P9P A;  1WPX A;  3H6P A;  1Q81 W;  2A06 D;  3T97 A;  1VQ5 V;  1HNW O;  4KL1 A;  1M56 C;  1UJW B;  2FYU H;  4O2B A;  4NR1 A;  4ZMD A;  1N86 A;  2F95 B;  2XND G;  3D36 A;  1WA8 B;  1JM0 A;  4IL6 E;  3CME P;  1OJP A;  3AMO B;  4R4M A;  2D3O W;  1L0N E;  1H0T A;  4AQ0 A;  4X1Y B;  3OJA B;  3CCR P;  1QWU A;  2ZXX A;  1N4C A;  4TV8 B;  5B1B B;  3VQW A;  1HVV A;  2Y4U A;  1IO4 A;  3E80 A;  3DX1 A;  2L91 A;  3QO7 A;  5KAF E;  3KYQ A;  4WFE A;  4ICG A;  1LTS C;  1M57 D;  2O1K A;  1WB7 A;  3JD4 A;  2PI5 A;  3C90 A;  5BXZ A;  1NZ6 A;  2QJ1 A;  1VQN P;  2FTK A;  4DZO A;  1PPJ H;  3MAQ A;  1P4R A;  2V7Q J;  4KUM A;  3L74 H;  3L70 J;  3G71 V;  5LL6 Y;  1THZ A;  2M3B A;  1ZV8 A;  2E43 A;  4OK2 A;  2J59 M;  3ABL C;  4OPA A;  2HPC B;  2BCC D;  2UUB O;  2XND H;  3BCC E;  3GLM A;  1JMB A;  1TVK B;  1AVO A;  1TQT A;  1YTF D;  3CCM P;  5LMN B;  3GF3 A;  5KHH A;  1GN6 A;  1HJB A;  4GDO A;  3N2G A;  1N7L A;  4I5S A;  2PAJ A;  2PGD A;  1LOH A;  4NB5 A;  1LWU B;  2XAF A;  3IGA C;  4ZOL A;  1XNR O;  2A06 E;  1IJD B;  4PJ0 Z;  4AI8 A;  4JYA O;  4WBA A;  2RCV A;  2KSJ A;  2WTY A;  2R9I A;  1NTK J;  1PPJ G;  4O4J A;  1NKZ B;  2ZM6 O;  2H8P C;  5EBL C;  3K79 A;  4PI2 A;  4J7Z A;  1X59 A;  1KB9 E;  5BR8 B;  3NFQ A;  2RJZ A;  2Q0O C;  1BE3 D;  2E5L B;  3BRV B;  3CRA A;  1ZAU A;  2ILM A;  1VF6 A;  1FJG O;  4DUZ O;  4E4E A;  3SPC A;  1F51 A;  1K5S A;  1FC2 C;  1N7S A;  1K7D A;  3GWK C;  3N2K A;  3P3N A;  4DV4 O;  1W5Z A;  4HH2 A;  3JAR A;  4J9Y B;  1JJO A;  1M7L A;  1NWQ A;  1SQX G;  1MSD A;  3F5T A;  5C39 A; 
#chains in the Genus database with same CATH homology
 3EJS A;  1EDK A;  1U7M A;  2B88 A;  1MFT A;  2KIK A;  3MZW B;  5DJT B;  2KZJ A;  1BDD A;  1R34 A;  3BUD A;  5CBO A;  2QRX A;  3DDF A;  3PH0 A;  1Q2N A;  2M0B A;  4ASV A;  2F7P A;  1U7J A;  4HB1 A;  5DJU B;  2F1A A;  5K5G B;  1LT1 A;  3BVX A;  2M5A A;  1TQV A;  4EYY Q;  1DEE G;  3FXD A;  4HKZ H;  2WMM A;  4JBZ A;  3D4Y A;  4GOE A;  1QWN A;  2WYI A;  5KBP A;  2UWJ E;  2OTK E;  1H0T B;  4BXL A;  2SPZ A;  3RGU A;  3EJQ A;  1ZXG A;  4ZMD A;  1EDL A;  2LXC B;  2FYV A;  3CV5 A;  1Y47 A;  3FXE A;  1EC5 A;  1JM0 A;  4CPG A;  2F1B A;  1PS3 A;  5EFW B;  3BUQ A;  1H0T A;  3BVV A;  3MHV A;  1S3J A;  1QWU A;  1HXK A;  4IOI H;  3DDG A;  3DX1 A;  2F7R A;  2LXB A;  2M5A B;  2OW6 A;  2ALW A;  1LP1 A;  4GOF A;  2K3R A;  1NVO A;  3D51 A;  3BUB A;  3D52 A;  2B87 A;  2QVA A;  2KS1 B;  4GOD A;  1EDI A;  3BUI A;  1O7D D;  4NPE A;  1LP1 B;  2R44 A;  1OVU A;  2OW7 A;  2KUB A;  1R33 A;  4NPF X;  3ZDM A;  3BLB A;  1X0T A;  1TQW A;  2B89 A;  4KJM A;  1JMB A;  4MN4 C;  4K35 A;  3DX4 A;  3EJP A;  1TQT A;  4HJG H;  4NPD A;  3D4Z A;  2P58 A;  2HR3 A;  1OVR A;  2KI7 B;  3BUP A;  3BVU A;  3DX2 A;  4K3A A;  3DX0 A;  1BDC A;  2RKL A;  3DX3 A;  3BVT A;  4ZNC A;  4ASW A;  1TQS A;  3EJT A;  1HTY A;  3BVW A;  2B87 B;  2F7Q A;  2F7O A;  2WYH A;  1EDJ A;  1QX1 A;  2JWD A;  1SS1 A;  2KZI A;  3CZS A;  2F18 A;  3LVT A;  3D50 A;  4WWI A;  5CBN A;  1OVV A;  2I8D A;  1FC2 C;  1ZW0 A;  3S1K A;  2LR2 A;  3QWO C;  1HWW A;  3CZN A;  3EJR A;  3EJU A;  1TQU A;  2ZAE B;  2Q1K A;  5C39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...