4K35A

The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
719
structure length
719
Chain Sequence
DDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEAPLLTYAYAHHLTSIDDSNVKRTDMTLQSATKGPMTALVGNEWTLRETELSPVEWLPLQAAPNPTTINEIMTEINKDIASNYTQETAKEDNYFSGKGLQKFAMLALILNKSDQTQLRNPELAQIALDKLKAAFLPYLQNEQADPFRYDTLYKGIVAKAGLPTSMGGTDDLSAEFGHSYYSDHHYHQGYFVVTAAIIHHLDPTWNADRLKAWTEALIRDVNNANDGDEYFAAFRNWDWFAGHSWAGGIKPDGALDGRDQESVPESVNFYWGAKLWGLATGNTPLTKLASLQLAVTKRTTYEYFWMLDGNKNRPENIVRNKVIGIYFEQKTDYTTYFGRFLEYIHGIQQLPMTPELMEYIRTPEFVSQEWDEKLGAIAPTVQSPWAGVLYLNYAIINPAEAYPALRKVQMDDGQTRSYSLYLTATRPHFFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
pubmed doi rcsb
source organism Rhizomucor miehei
molecule tags Hydrolase
molecule keywords glycoside hydrolase family 81 endo-beta-1,3-glucanase
total genus 246
structure length 719
sequence length 719
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain
A PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1170 Mainly Alpha Orthogonal Bundle Helix Hairpins glycoside hydrolase family 81 endo-[beta] glucanase 4k35A03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4k35A04
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 4k35A02
2KZIA 2ALWA 2P58A 1LT1A 4NPFX 3BVWA 2UWJE 3BUDA 3LVTA 2JWDA 1U7MA 1TQVA 3BVVA 2B87A 2OTKE 1TQSA 3D4YA 1R34A 4HJGH 4ASVA 3DX0A 1H0TA 2K3RA 3BUPA 5KBPA 3D50A 5EFWB 1OVUA 5CBOA 2F7RA 5C39A 1BDCA 1HTYA 2M0BA 2RKLA 2I8DA 4EYYQ 4ZMDA 1MFTA 2LR2A 3CV5A 3DX4A 4GOFA 2OW6A 1R33A 3BUIA 3DX2A 4K35A 1X0TA 3BUBA 3DDFA 1TQWA 3FXDA 1HWWA 5K5GB 4MN4C 1EDLA 2ZAEB 2KZJA 1FC2C 2M5AB 2B87B 1O7DD 1OVRA 4BXLA 1QWNA 1QX1A 2F1BA 2KUBA 1EDIA 3QWOC 5DJUB 2QVAA 1HXKA 3MHVA 4NPEA 1QWUA 2KI7B 1TQUA 4KJMA 5CBNA 2F7OA 2WYIA 1PS3A 3BVUA 3CZSA 2KIKA 4IOIH 4ZNCA 2KS1B 3EJTA 1NVOA 3ZDMA 3EJSA 1LP1B 3D52A 3DX1A 2FYVA 4K3AA 1TQTA 4GODA 3RGUA 3D4ZA 2R44A 1JMBA 1H0TB 1JM0A 3PH0A 4HKZH 3EJPA 3EJUA 2F18A 3BUQA 4HB1A 1ZXGA 3BVXA 2F7QA 3BVTA 1EDKA 4JBZA 2HR3A 2SPZA 2WYHA 3EJQA 2B88A 4GOEA 2WMMA 2M5AA 1Q2NA 3MZWB 3BLBA 3D51A 4ASWA 1EDJA 4CPGA 2LXCB 2B89A 3DX3A 3DDGA 4WWIA 1OVVA 2F7PA 1ZW0A 1Y47A 3EJRA 2F1AA 2Q1KA 1SS1A 5DJTB 1U7JA 1BDDA 2QRXA 1S3JA 3S1KA 2LXBA 4NPDA 1EC5A 2OW7A 3CZNA 1DEEG 1LP1A 3FXEA
chains in the Genus database with same CATH superfamily
2WLMA 2ZNIA 2KZIA 2JS3A 4FLTA 4AQYO 1RW9A 1KTMA 3D3IA 1XMQB 2UWJE 1I7FA 2IJKA 3BRCA 1USEA 4J7JA 1R34A 5JVDB 1SRYA 1HNWB 1UIXA 2EIJC 2X0LA 3SYOA 1H0TA 4TV8A 1NSUA 3B77A 3FB7C 1VQKV 2E5YA 3M91A 3JAKA 1YJ9V 4PJ0E 3SJQC 4JI5B 4ZMDA 3OMAB 1KD1Q 2CTRA 1BE3J 3CCRP 3CV5A 4UB8H 3SWKA 1W6GA 1NU1E 2Y0IA 2AW9A 1SFCA 1AJPA 3AEDC 2LFSA 2CIRA 1PNMA 3X3XA 3ASNC 2YXLA 1NZ6A 1NH4A 2WPDG 2KZJA 4J80A 1VF7A 3ICXA 2CPSA 3HR0A 3H1IG 3VQVA 1SQQK 1J1EB 2BEZF 1NKDA 1QL2A 2E22A 3CCQP 3E8HA 4O2AA 2WWWA 3OUSA 2CG0A 1L0LD 3KDPB 4LBEC 3K3WA 2BOCC 1WB8A 1E1QG 4PA9A 2L35A 3ZRVA 3HIGA 3CX5H 4QJFB 3NREA 1RP3B 2Q8VA 4G2KA 3GG2A 2XKMA 3BCCD 1H2KA 1Y6XA 1XQ8A 5KAIZ 5H6RA 1FZEA 1YIJP 2ITDC 3T1HO 2OYIC 4J7ZA 3ZBHA 2F43G 3MTUE 2Y69B 1KP2A 3CYOA 4AILC 1FAFA 1LVNA 1A2VA 2MK3A 4H33A 1XMOB 1SQPD 1TQTA 1AVLA 3L70D 1ZX3A 1WJZA 1L0LJ 3B4SA 3EVKA 4IT5A 2A06D 4JGSA 1VQLV 1J95A 3LSQA 1OCZC 3ZJZA 3L75D 3ABLB 3G6EV 1PPJE 1QGKB 1H89A 2P2UA 4P2ZA 1I8QA 1W3YA 1HP8A 2PYLA 3CC2P 1RWGA 3RBXA 4EB6B 5IT9N 3ABLC 5IJ9B 1M4UA 2O57A 3PP5A 1QX8A 4MVUA 1EN5A 3H1HE 1SQQE 2MKVA 3T1CA 4JI4O 1BCCD 5CJ4A 2LQTA 2ZVNB 1Z5WA 5HFMA 5EIBC 5E1QA 4JTAB 2PTMA 3D51A 2QWNB 4YJ2A 1RF0A 2YIBD 1VQPP 4YTPC 4FFBB 5KMGB 1PL0A 3CD6P 4Z1VA 1FXKA 3CZJA 2YC0A 1Q43A 2PP6A 4JI3B 4KT0J 3QFZA 3H1JH 1M90Q 3K9AA 4DR6O 1K1YA 4PI0A 2F1AA 3NTNA 4KHXA 4WB4A 3B8EB 3H1JJ 3TY1A 3ACTA 4D6TH 1XILA 1DEEG 4ZHQA 1S5JA 3FXEA 5JVDA 4DR2O 2D1WA 1VQMP 3S4DA 1Z5VA 1IVSA 3LVTA 4DV3O 4O4HB 1TQVA 2A9HA 4FNTA 4LFCO 2B87A 3OUFA 4DR3O 1NSZA 4FLXA 3JAKB 4HJGH 5JWPA 3T0AA 1W0KG 1ZR2A 3ZHUA 1CSBA 1K05A 1O9GA 4RKUJ 3HKDB 2P10A 1QQCA 3CS5A 5L3GA 3ZHSA 5C39A 1VDFA 2JJ1G 3S3XA 1R5SA 2H7HA 1N7SA 3KN4A 4DV2B 2OCCC 3H01A 1LTGC 4UFCA 3E35A 3BCCH 1F23A 1CPYA 2J59M 2Q7EA 4EIJA 2P67A 2FYZA 4K35A 1VF5C 2VQFB 2QIWA 1LGHB 1T5EA 1QU7A 1VQ9P 1TQWA 1QLEC 4FLZA 4PA3A 4NXMO 3W7XA 2HEPA 4DR3B 1RQUA 1FKAO 3GF7A 4XA4A 4YJ3B 1NU1H 1OCRB 3B71A 3T2PA 1VF5B 4FJCC 2ZKOA 3HD7A 1A02F 1SQQJ 2YNYA 5LGTA 2ZE6A 4XBFA 2CDYA 2Y4UA 5CCGC 1JB0J 4NPEA 1SQQH 1AQTA 4KHPB 1FDIA 1YYCA 2YXYA 2Y73A 2CIQA 4W7YA 1ULVA 3H1KE 3JSNA 1NH2D 1YI2P 1VQ7P 4EV2A 4ZNCA 3ZRSA 3EJTA 3OB8A 3ZDMA 3EJSA 4UB8Z 1IO4A 3CHXA 1US6A 2WVZA 1ORQC 2PF4E 5JQGB 1LT9A 2ZR3A 5AVQB 5AVTB 1RWFA 2K1AA 5JH7A 5E79E 4ICGA 4O4IB 1VQ5P 1L0LK 5AW0B 3KKYA 1R3LC 1H0TB 3BY6A 4X1YA 3AEFC 3FGAD 4BW9A 3BRTB 3RYIA 3CRCA 3VOPA 2P5OA 4I2LC 2QTSA 4NXMB 1P4RA 3Q2YA 2HHHB 4WY4D 2Q69A 4J42A 4BTWA 4UXNA 2Z0AA 3SYAA 4JBZA 1AVYA 2FYUE 4FZ0A 5IYDO 3B5NC 4TV9A 3TGUE 2E75B 2OYHB 3ASNB 4LFAO 2CAZC 3TGUD 3OMIB 2IYPA 5KKZC 1Q2NA 3T97B 1ZLLA 2M7WA 1JZ3A 2HP8A 3T1HB 1OFCX 2ARHA 1HWTC 2JKPA 4O2AB 4N78E 1WP7A 2IBZG 5KA5A 3VMZA 5LP6C 4F6RB 1G1XB 4LFCB 1L0LG 1NYHA 2BCCD 4DV4O 3ITKA 1AV1A 1NH2B 2CFGA 3K59A 2M8RA 2CWUA 4ZKIA 5KLVE 2CUGA 4IL6X 1W2BO 4KTPA 1TAEA 3E8BA 4PA6A 1Q7YW 1DF5A 4JYAO 1EFRG 2QKSA 5K1XA 3A0RA 3L70G 4PD4H 3SDLA 3DSQA 5IYCO 3MUZ1 5CA0B 1BSMA 1FXVA 3DTUB 4DR6B 2XAGA 2OTKE 3N9HA 2DWDC 1HGVA 1LR1A 3CEIA 3PJSK 2YO3A 3BUPA 2QWPB 5KBPA 3L37A 5KAIH 5BMVB 1SQQD 4WF9V 2CFDA 2YFNA 2WT7B 1SQBG 5BVZA 4BWNA 1YQ4C 2K9JA 4JI8O 1YBKA 3M9HA 3BUIA 2HYNA 2YDEA 4HNAB 3CRMA 4MTGA 2QSIA 3AE9C 2CPBA 1H8HG 2WW3A 3T0DA 1H8EG 3ALAA 1W2BU 2LFRA 2GSMB 4LF5O 3KZIH 1O7DD 1SQXG 2I1KA 3QWOC 4X89A 4KFEA 4YJ2B 4H13D 5GONB 1H2GA 3CCJV 2UXDB 2P7TC 2E74D 4X8AA 3AG4C 1HMUA 2PI4A 2DMXA 1TQUA 3NBBA 1V7XA 3Q5RA 4LF6O 3A24A 4LNUA 2WOFA 5HFLA 3U11A 3IAPA 4DR1O 1SQPG 1KKDA 2D2CC 3BCCE 2JO1A 3VBBA 4O4IA 1FZFA 1L4AB 4NB5A 3HTKA 4L73A 1PL5A 1NVPB 2XSGA 4KTRA 2ADPA 3R4YA 3ZCCA 4GKGA 3RK2B 4JI7B 4HAMA 1KD1W 4WBNA 4BTXA 3K9SA 1N7SC 3L72G 2YI9A 2Q7HA 2CGNA 2JGUA 3CCVP 1IQYA 1MABG 2AEMA 4K8ZA 2QJYB 4KP4A 4B7EA 2L6LA 1JYXA 2Y0EA 2A7WA 2FYNC 3CXHI 4F6EA 1N7SB 3BHPA 2I1JA 4BZHA 4I55A 4H37A 4JAVA 4YHHB 3UO3A 2Q67A 2OIEA 2IFNA 3F89A 4J41A 4DRXA 3HD7C 3T97A 3APOA 4DV5B 2W0XA 5CA1B 2YIUB 4DUVA 2UUBO 1JZ2A 2ODMA 1JJ2U 3AECC 3H1HD 1SQPJ 3RK3C 1GDTA 3RYFA 2Z5UA 2Q3EA 4TLFA 4H0LD 2Q6AA 4ASWA 2J58A 4L75A 4WY4B 1YGAA 4FIPC 3I3EA 1OHHG 3BRVB 3T1YO 3JD1A 2HPCB 3ZX6A 3T0UA 3ETEA 1QVGO 3O9OA 5H2FE 3V2NA 3SEPA 3CCRV 2YICA 2QWOB 2P4VA 1M1JA 1SF9A 1CI6A 1OW6A 1QBZA 1G2CA 3S4CA 2QM4A 1KFMA 2YIDA 1M1KQ 1SETA 1HWYA 5H5NA 4GKKB 4EFBA 1ENVA 2G38A 1EZVG 1KILA 5AVSB 2DYRB 3FB8C 1N33O 1SQPE 2Q9LA 1SC5B 4R50A 1K73W 3BVVA 5JQGA 1LT9B 2RN9A 3AE8C 1K8AQ 2OYIA 5AW3B 3J7HA 3JD4A 4TT3G 3RK2C 5A2QN 1H38A 3CJHB 3G6BA 4TWKA 3SXXA 5B3SB 1XEQA 2YMKA 1CEZA 3MHSC 1GN3A 3C3SA 4XDKA 1BCCJ 1IFIA 4DR5O 2I8DA 2EIJB 2Y4TA 4DR5B 4W7ZA 3QG5A 2WLNA 4U3JA 4O2BB 1YF2A 3E7KA 1RE4C 4Y99C 4EFEA 3RL0D 1IBKB 2GUZA 3JD0A 1NTMD 2FFDC 1PFIA 4TV9B 1GK4A 2EJRA 2F4VB 1OCOB 1IBMO 3K5LA 2F1BA 3O6QA 1BL8A 2YXHA 1WB7A 5BU5A 3BPZA 2F1MA 4LFBO 2YX9A 2KI7B 4W4LA 1RH5B 3G6EP 1FDMA 1NS8A 2QE7G 4KJMA 1T2KD 1FZCC 3SPGA 1PS3A 3B5NB 3BVUA 1L4AA 2EULA 2QA4V 3H1IJ 3CC2V 3ZMTA 1S72V 3K06A 4J9ZB 3EWKA 4C7RA 2EJ7A 3WIRA 4AHCA 2OTJV 1Q6IA 3ZN1A 1JX9A 1L0NE 2GTAA 5B1OA 5AVRB 2W6JH 2ZXXA 3H1IH 4KFDA 1JEKA 5CCHD 3K79A 1EXJA 2ZD9A 4IYIA 1K5QA 4TTGA 1YJWP 5TISE 2HODA 3UT5A 5CA0A 3TXQA 4J11A 2MJZA 3GF3A 4R8CA 1N7QA 1EZVE 4LH6A 1VQPV 1EKMA 1EZVH 1RF1B 4B08A 3ZMSA 2WLIB 3K08A 3CCMP 4EI2A 2N04A 4I55B 1S5LX 3AG1C 1Z45A 4DV7B 5GW7A 3SPCA 1EZJA 5BR8O 1HNXB 2WT7A 3CMAP 4JTCB 4DRXB 3M9BA 4C46A 1JY2N 1AI5A 3WB0A 1PP9H 1URQD 2CISA 1QLEB 1JVMA 1VQMV 3E2EA 3QH9A 3MUDA 2HVJC 2ZVOB 1SQXD 4QGPA 3CCUV 5APTA 5F2VO 3DYMA 1SFCD 1YJNP 2UU9B 1SFCC 1KECA 2Q0AA 4C7UA 2WQYC 4PV1D 4IYHA 4CPGA 1SA0A 1NO4A 3DDGA 3P30A 4OH8B 1SVFA 2KP8A 1L0LE 2R3CA 2YXRB 1URQC 3K25A 2Q1KA 1SQVG 3A8TA 1F4AA 3VD4A 3SFDC 2H94A 4JI2B 1NBMG 2QRXA 2OW7A 1KQSU 4B3SB 2FY8A 1L7KA 2EZPA 4I0XA 3HKCA 5AW6B 3U1AA 2X6BA 1VQ9V 1FAVA 1Q6HA 2P58A 3AG3B 2ZXEB 1RF0C 2FL4A 1NS7A 1UI8A 2UXCO 1K04A 3TGUJ 3IFXA 1BHAA 2AZ0A 4CH5A 1S0VA 3T1YB 3W68A 4OK4A 3VYIA 3JCUE 1N0JA 3ZS8C 2ATKC 3D6ZA 1K1WA 1QVGU 4KUMA 3CCEP 5CCHC 4U3FE 1K92A 2WLKA 1OJHA 3CCLP 3L75E 3T4DA 1YJ9P 1BGYE 1JMMA 2ZE7A 2OGUA 2WITA 3F7VC 1KB9F 2H88C 3A0OA 4OXSA 1H2LA 3HRNA 1T2KC 2LGQA 2IJHA 2JGDA 3LUTB 5BXZA 3U10A 5APUA 2QTOA 1GK6A 4JI6B 1SQBJ 3HUSA 3AMOB 5K5GB 2ZYGA 5KKZB 2W0QA 2YS8A 5IYZA 1OZ0A 5CA1A 4UUJC 1QWNA 4LWSA 2AGAA 3MDSA 3PHLA 3JARB 2QVAA 3AE7C 3MHVA 1QWUA 4JI7O 3K5MA 3RL0C 1LWUB 1UFIA 2WOHA 2WVYA 4DR4O 1DIPA 1J1EC 2X6CA 2KSJA 1BQ0A 2F7OA 1BZKA 3OGIB 1AVKA 3M8AA 3MWXA 5LMNO 3VQWA 2KB1A 2OYOA 2XV5A 4PJ0H 1G2CB 1ZUQA 3MUDC 2B5UA 3HKBB 2A79B 3LW5H 1DD4A 3L74G 3L75H 3Q1NA 2KS1A 4R4MA 3AFLA 3AG3C 3DYPA 3WIQA 1K9MW 3SWYA 3LW5J 4YXWH 3RK2D 5JJJB 3CXHD 1YVWA 2R44A 1NHLA 1BQZA 2WZSA 2WSFH 1XNQB 1NTME 1VQLP 3VOUA 1IXMA 1E1RG 3DYOA 1AJQA 2QJPC 2RMKB 5JMFA 4B3MO 3GVMA 4PA4A 2HVKC 1I94B 1XL4A 2PGDA 2OIGA 3ABUA 4U3JB 3K57A 2Q4PA 4O2BA 1V55B 1OIPA 3IAYA 4UCOA 3L9DA 2XHBA 1NSSA 5IWAB 4RQEA 2GUZB 1SQPK 2DOSA 4P30A 2E5TA 1OV9A 3CMEP 1S76D 3B8MA 1PX3A 1MNGA 2NLJC 4H0LC 1FFXB 2FYUG 3BLBA 2XAQA 4K8XA 3OE7G 4FNVA 2FFDA 3O6QB 4BZGA 1JCDA 4A7PA 1LXMA 1FJKA 3HD7D 1ZR4A 4Q6GA 1Q81Q 2GBOA 3E1F1 3VSMA 3JD2A 2B1GA 3ASOC 3RL0B 3KCYA 1XNRB 2Z3YA 5LP6A 1S3JA 1FZCB 1AR4A 1OACA 2FUQA 4OGQB 3L74D 2OWOA 1PGOA 1WAZA 3E80A 3BUDA 4U7OA 4C7NB 3H32A 3L73J 3G71P 1COWG 2ZIOA 1I5XA 3H1HJ 1N7SD 2QR4A 1SQXJ 3D4YA 2PY5A 2IU3A 5B1AC 1FDOA 3O65A 1JTHB 3L73H 2Y0PA 2ZDIA 1N9EA 2XTAA 1LOHA 3F5WC 1I5YA 3WU2E 1RF1A 2CK3G 5B1BB 4NTXA 1K9MQ 4TUYB 4EYYQ 2D2CD 3H1IE 2C0XA 1NTMG 4RUEA 3WUTA 4D7SA 1M7LA 3X3ZA 2JDIH 4LF9B 3VDCA 2KLUA 2JS5A 3K5NA 3H1JE 3SYQA 1SQFA 2XT9A 3LIDA 4LWSB 4DJGA 1HH0A 3JARA 3AEBC 1FC2C 3J80N 3W67A 1W6CA 1AFOA 1JO5A 1L2PA 1QX1A 3LNNA 2KUBA 5DN6G 3WMM0 5H6QA 2Z5HA 2OQEC 3RSYA 5B1NA 2H8PD 4OX9O 1BSHA 4GX2A 1VQ4P 4CC6A 4QIWF 4XDJA 2FYUH 4TSFG 5LHGA 1IFMA 3R65A 2W6IG 2BSKB 3T2OA 2WW0A 2KS1B 1S77D 3S4AA 3BLCA 4X20B 1AP5A 3H1JG 3HUSC 4XDLA 1SFCB 4UCSA 4OGQC 4I0XB 1Q3EA 1DD3A 2BTQB 3OR7C 4X88A 1TA8A 3PN1A 1GL2B 4KHPO 3NFQA 5IWAO 4MMHA 1O9HA 4LF8O 3V2RA 1VQ5V 1H54A 1QR8A 1S2EA 2Q5ZA 3EHBB 1H2SB 1Q86Q 1N86A 2CTPA 1HR0O 1NTKG 2OTJP 4ZI7B 2LW7A 3QNEA 4WFHA 3FYIB 3VD5A 1NTKH 2M6YA 3J81N 1IC2A 4O9BA 2IH3C 5CB4A 1NAYA 5EZYA 3GHGA 1WA8A 4PDLA 1YJWV 3L74H 1S5HC 2GHYA 2VQFO 2KYVA 4X64O 4N6JA 4AUWA 2XHNA 4X66O 1R3KC 2W6AA 3JYCA 1PNLA 1D6YA 2Q9IA 2B88A 3AMOA 4QPJA 4ABMA 5IYZB 1HJ0A 3WB2A 3L73D 2V4HA 3HE5B 1SIIA 4I5SA 1PGPA 2ZYAA 4L8JA 4WWIA 2XAHA 2KLVA 5CBGA 4JYYA 1KYOI 5ITZA 3V2QA 4CC5A 4R6ZA 2ZT9D 1F7YA 3OGCC 3KXDA 2AEFA 3CSXA 5DJTB 1U7JA 1M57B 4WY4C 1B3QA 2Q1FA 5B5EH 4DR2B 4MTXA 4C7NA 3CZNA 3JALA 1EBOA 4EB6A 2W6BA 5KUMA 1QLNA 1BE3E 4NPFX 1M90W 2GA1A 3WU2H 5KLIB 1XNRO 1CB8A 1GK9A 1M57C 1L0NH 5LL6Y 3QTCA 1YXBA 4TQFA 3L74E 5IDJA 3SFEC 2C2AA 3C1LA 1L0NJ 3ETQA 4YIOA 3D50A 2QG4A 4J5TA 4OJZA 1PNKA 1KV4A 1UJWB 1HTYA 1PX4A 3JAWA 1Y76A 1NKGA 2N74A 5FPRA 3A0HZ 1BE3D 4LGDE 1LUVA 2C11A 2AHZA 5DECA 1KQLA 4ZIBA 1S72P 1R6TA 4EEQA 4JQ0D 3CRAA 1PP9J 2ZXWB 4EKWA 4WFGA 1X9VA 1FOSE 3L71D 3A3YB 3SJBC 4F4LA 5CCGD 2F23A 2B87B 4A5UB 2OYHC 4PD4F 3OTOO 1D6ZA 1PGJA 2GDSA 1XNQO 1NI8A 1US1A 3H6PA 1I0HA 1HJBA 2FFDB 2XAFA 4P9OA 3JC22 4OPAA 1QLED 3CCJP 1QR9A 1RSOA 4JYBA 1Y4MA 3H1ID 3UCSC 5A9GA 1VF5D 3VD9A 2IJIA 3EXAA 3VSNA 3KG2A 3SJAC 3Q3DA 2BTQA 4N23A 4OPHA 3K58A 4B86A 3IC7A 1L1FA 1GAXA 2WA3A 1KORA 2N1TA 3LSSA 3BAAA 1Q86W 3B40A 2FXMA 2UXBO 4UB6Z 5DEDA 3L75G 4UB8E 5APXA 4ZI7A 4WFEA 3N7NA 1FOSF 1LTJC 1QEXA 1V7WA 1JM0A 1PP9D 3GHGB 3FAVB 4PHZA 1URQB 5B5EE 1VMGA 2ZDIC 3STZC 4DUYO 3BUQA 2YKOA 1WNSA 1JOVA 5B66H 1RWAA 1GH6A 5C8YA 4BZEA 5IY5C 4U7JA 1MSWD 1AI6A 1MZFA 2WO0A 1L0ND 4DUZB 3PGBA 2BT3A 1DLBA 1L8DA 1P7BA 2NZ2A 2WMMA 2IBZD 3L71G 1VQ6V 4ZOLB 1S9KD 3P3PA 1KKCA 3CP1A 4X1YB 2YIUC 3RK3E 3CCEV 1LWUC 3WUUA 1XI1A 2C9NY 2ZNJA 4LCUC 3PTZA 3V6IA 4MTFA 1HNZB 1G6UA 1XMQO 3ACSA 1NTKE 3AG2C 3TETA 2GM4A 2UUCO 4X62O 1IBMB 2R5DA 2P1JA 2F4VO 3E22B 2OYHA 4IFDK 1QALA 1X4TA 3CXHE 4DV0O 3LSUA 5J2UB 1EGUA 3UO2A 1G8MA 2PUSA 1OVUA 5CBOA 2XNDH 3JATB 2Q3IA 3IFMA 4Y28J 4NTWA 1NTMH 4F6RA 3K5BA 1VQKP 3NBJA 3S3WA 1GKFA 5KLVD 2JRIA 3CCSP 2CWVA 3HIIA 3T2QA 5BU8B 3CC7P 3ZHTA 2ZM6B 3CE2A 3VTPC 3DDFA 5IY5B 1EZVI 1NR1A 1W5CE 3AEEC 2BOBC 3DCDA 1FS0E 1QAFA 3VD7A 2NNUA 2A06E 2WGQA 1BGYG 4DV7O 1N34B 1T6AA 1RSOB 3M0DA 4ASUG 5DJUB 3HE5A 4CS4A 2RNBA 5M1BA 2E5LO 5AW2B 1I08A 4WFAV 1IZ3A 3SPJA 2JKEA 3CPWO 2WYIA 2WSEH 5ITZB 2WVXB 5KUKA 4NKGB 2N1TB 5J9PC 1GU5A 4FNPA 3CXHH 3NJXA 5L3DA 1U57A 3ETDA 4LF7O 2QA4P 3CC4V 3IJ4A 1RE3C 2Y74A 5KHJA 1JRQA 4CH4A 1K1XA 4RUFA 3RVYA 1FZBA 1JY3P 3FX0A 3FYEB 1N73A 4FNRA 3GWOA 4UCTA 4CH3A 1NU1J 4MVMA 2B1IA 3KCXA 1FZAA 3FAVA 3QO7A 4N3YB 1OCRC 1SQVH 3M0AA 4JV5B 4U3FJ 4I50B 2CWTA 5B1BC 5GONA 1NVPD 3VDAA 1M57D 4QNHB 2WA4A 3OJAB 3L72H 1N34O 3SPIA 4RO2A 1QVFU 5L3FA 2ZT9B 3CRRA 2F18A 2YI8A 4B3RB 2Q6QA 3BA9A 2CFKA 1VP7A 1ZXGA 2WSCJ 1JZ6A 5KX5A 2DW4A 3SPHA 3G4SV 1A32A 1IVXA 2ZT9C 1OCCB 3FX7A 1KFNA 3C8VA 2E2UA 2SPZA 4ZOLA 4Y99B 3N27A 5B3SC 5LMUB 3QF7A 4RESB 3JSVC 3QO5A 3O8ZA 4MW3A 4JTDB 3CWBG 3CCUP 1KYOE 1BS3A 5KJ7C 1R6KA 2LXCB 3B2EE 1P84H 3N2KA 2R32A 1YCIA 2XZRA 4GX5A 4WVZA 1L0LH 3N2GA 3QVNA 4IHJB 5EBWC 2LGWA 3RFRA 1FBMA 5D5PA 5L3EA 1TGOA 1ZRTD 1SS1A 3NR7A 5AVYB 4X62B 2AHYA 4NVPA 4JI1B 1PP9E 1ZMEC 2UUCB 1GN4A 3UM7A 1EN6A 2VQEO 3JCZA 5LHHA 5EBLC 2HKOA 4LF4O 3CWBE 1N7OA 2WLLB 3ASOB 1HBWA 2ZL8A 3TDKA 1HNZO 2E2VA 1J1DC 1U7MA 2WPSA 1MMMA 3B09A 4MTOA 1RPRA 4BIOA 1AA0A 3RYHA 2E76C 2XAJA 2WDAA 2CFLA 2HPCA 1AJYA 3M06A 2N9BA 3M9QA 3U0ZA 4OGQD 1FFTB 4FMTA 1W2EA 2EABA 2WW1A 2HLDG 2KSDA 2KQXA 2QM8A 1NGMB 1KILC 1GO3F 3L35A 1XBLA 5AW4B 3EQ2A 3S4RA 5CHXA 1X0TA 1P84I 1NS2A 4D6TJ 2EZOA 2H8PC 4IIJB 3A0BE 1WPXA 1ZLZA 4DUYB 1V7VA 1LJ2A 3JAMN 1YZBA 1JY3N 2DW3A 2YSUB 2V7QJ 2OTLP 1NTZH 3N4XA 1X1IA 2DQ3A 4N21A 5EYPA 1EDIA 4JYAB 5LYJA 2BE3A 1SQXE 4TV8B 2F66C 5KLVK 2DQ0A 4DV4B 4PDMA 1ZAUA 4U3FG 1K8AW 1PGQA 2QWQB 5AVXB 2WPQA 4Z1MG 2KNCB 3X41A 1HVVA 4DR1B 4IL6H 2W0FC 1KMIZ 1IBLO 3TNUB 4I4TB 1JNMA 1ZV8A 4IFMA 4LF6B 4AYCA 1W2ZA 1AVMA 3CWBJ 4RQFA 2AEJA 1VIBA 2P7JA 3MV11 3FKSG 1J5EO 4M3LA 2UXDO 4X1IB 1P84D 3WA2X 4X64B 3BABA 2BRVX 5J2UA 1KB9D 2JDIG 3EJUA 1NS4A 1M56B 1SNZA 1NQTA 2ZR2A 1IX9A 3WU2Z 4LH7A 3OEHG 1BE3G 3BVTA 4IL6Z 4FNUA 2P6JA 1M9NA 1IK9A 4FFKA 3UIAA 1FU1A 5KLVG 1FZGA 3I56P 2K88A 2H89C 3B8NA 2YXQB 1MZEA 2R9RB 1VQ8P 1NU1D 3N2GB 2HLOA 1IFPA 2LJ2A 3CMEV 2CE4A 5GTIZ 3IR9A 2BRWA 3CPWU 3ABKC 1FXKC 2JKVA 2ZYDA 3ZIAG 1P84F 2IZ1A 1UIIA 1JQ0A 1U96A 3P32A 1H2NA 1GM7A 3EJRA 2ZIMA 3M0DC 1KZUB 1PZQA 2YMYA 3CX5D 1YHQP 3HPLC 5AW5B 4R4LA 1THZA 1HF9A 1VEWA 1OWAA 3GB7C 5JCOA 3TK1A 3PRJA 1VQ6P 1B04A 3L71E 1S5LH 3E86A 1N7RA 2B9ZA 3RYHB 2QKCA 1YSCA 3HD7B 1SQPH 4IFFA 2WTYA 3L70H 3S4BA 2QJKC 1NOHA 2P22C 1ZP0C 1UI7A 1F1SA 4PD4E 3RT3C 1IVWA 1XDCA 3AG4B 3MGNA 1M1JC 1UG9A 1DX7A 4JAAA 2RN0A 5AW9B 1PPJG 5EC1C 4L74A 4N78D 3L71H 4LFAB 3GW6A 2LKMA 4DV2O 1RFYA 2X6AA 1DYUA 1XOUA 2NRGA 3HB3B 1XL6A 1KC8W 2QKAA 3HKCB 4GCZA 2FMLA 2P4KA 1VQOP 2UXNA 3OMNB 3A7OA 1YTZT 3X42A 3AE3C 5EYPB 3I5CA 3IC9A 1FS0G 4YIPA 2FYUD 3H1KG 1EDLA 3F5TA 3EFFK 3E8GA 1RHZB 3WG7B 1R73A 4O4HA 1XREA 1KYOD 3CCSV 4U3FD 4LF8B 2K9YA 1AP6A 1HDJA 4GYCB 3II6A 2EINB 1MZ9A 1CW5A 1QNMA 3H1JD 1ROPA 2JKAA 3DC5A 1VQ4V 4HYOA 2BCCH 1PL4A 2JIZG 5CA3A 1FD9A 1FXHA 3R2PA 3TNUA 3MD0A 3E83A 2YUAA 4I4TA 1P49A 1F9GA 3Q1MA 2EADA 3MIWA 5E1AC 4J9YB 4L87A 2ZJSE 1KU9A 5H9CA 4BWAA 2ZQMA 1N4CA 2IFMA 4K3AA 1NTKD 2UXXA 2R72A 1W7CA 4FNQA 3JASB 1DEBA 4JI4B 1TUEB 2D2CB 5KAIE 4GIFA 2P06A 1KILE 1NT2B 3U59A 4BW5A 1PV0A 1YTFB 3OBAA 3IGAC 4H13B 3NJVA 2A45H 3CC4P 1W0JG 1NTMJ 2O1JA 1K33A 4UVBA 3KIIA 5LOVB 1LTJB 1YTZI 2ETNA 1IFDA 4MW8A 1KB9E 5CMZA 3MUY1 5B1AB 2CH7A 3MI6A 4LF9O 4RAIA 2YEVB 3KZIE 3AE1C 2CK3H 3CD6V 4IIJA 2KKWA 4GOEA 3W7WA 4PV1C 1EXIA 5BMVA 3MZWB 1K4DC 4DZOA 3LDEA 2C10A 2UUAO 1IBLB 1L7JA 2YIBA 1E5WA 5EK0A 2DE0X 2K9JB 2CQSA 3BCCJ 5LMNB 1ZW0A 1NSMA 3HKEA 1GZLA 5JJEB 1LTTC 3RYIB 5KAFH 3D6YA 4XFJA 4PI2A 2O01H 2WPRA 3MPHA 1GN2A 2DYSC 3D8CA 1R6NA 3L73E 3L72E 2LO1A 3J7AU 3T2MA 1G4YB 2JWAA 2KNCA 2ALWA 2O01J 3BVWA 1Q81W 3VQYA 1JOYA 3CX5I 2YIAA 2R9AA 1SESA 2Q7GA 3OFNG 3L4FA 1EN4A 2AZ2A 1Q82Q 4JI3O 5CJ0A 3USSA 1SQBD 3SYCA 1N8RQ 4U3FH 2K3RA 3KYQA 4X1IA 5EFWB 3K03A 2KG7A 2QEXV 3P3NA 2LP7A 4L76A 5L3BA 2HFEC 2ILMA 5KAFZ 2N1TC 2RKLA 5LXTB 4D6TE 4FPPA 2P90A 4GOFA 3H1KD 1XUQA 3HTKB 2QE7H 5LGUA 1EM1A 1K3EA 1I94O 4HYTB 2WAMA 3MP7B 2OQQA 1FE6A 3TGUH 4FM0A 2IU0A 1XHZA 5JMDA 1JCHA 4CH6A 2LW1A 4DW0A 2OQEA 1E79G 2ITCC 2HG5D 3ZRXA 1V55C 1N36O 3X2QC 3ABMC 2A0LA 2J5UA 1HN1A 3K0GA 1XHXA 4BRYB 1NS1A 3R66A 2EBOA 3G4SP 3A2AA 1SQVD 1DF4A 1IXBA 3CRQA 4BTYA 3IF4A 3X2QB 3VD3A 1MKMA 2UU9O 1M93A 3RYFB 4PD4D 4K0KO 5B66E 3A5TA 3E89A 4BIUA 4DR4B 4D6TG 3HI7A 5LMUO 3RGUA 2QJKB 4H44B 3P7KA 1X1HA 1J0NA 1JMBA 1LTSC 1SERA 5LOVA 1LTJA 5B5EZ 1NSXA 2ZQ0A 3A0HE 1M1JB 1MMXA 1OCOC 1CI6B 3C90A 2QJ1A 2BSKA 3CCMV 4DT0A 1F4HA 2E75C 1ZSPA 1AJNA 3SSUA 5CCGA 2RMZA 1NSVA 2EACA 4X20A 2WZ7A 4JZGA 4B7KA 1VQNV 4LNUB 2JK5C 3CMAV 4G28B 4B3TO 2OYIB 3W7TA 3ZMUA 2OOVC 2E2TA 3RVZA 2Y69C 1GM8A 1GN6A 1NJIW 4DK1A 4IGGA 1QHTA 4DK0A 3BEHA 1GL2A 5IYBO 2KSEA 3OM3B 3V4WA 3PLNA 4WCEV 2WSFJ 3AG7A 3OEEG 4GZRB 3RK3D 4DYLA 3VN0A 4WBNB 1S1CX 3GWKC 2BEQD 2KK7A 5H2FZ 3RW0A 3H25A 3WFVA 3CWBD 5AVVB 3CX5F 3FWLA 5K1PA 5IE9A 3AK1A 1VPCA 2Y9ZA 5CB4B 2QJPB 2X03A 1K4CC 2Y9YA 2G3AA 1EC5A 1VL2A 1U97A 4LF4B 2VQEB 3RL0g 2R3SA 1R8EA 1LF6A 4BZFA 3RN4A 1F51A 3ZMZA 1B06A 4O4JA 1AROP 1TUBA 2X7RB 3D36C 3ZRWA 4GLXA 1V54C 1BSNA 4FNSA 2R70A 3H1LD 3A2FA 3DX0A 2AXCA 4NEIA 4JYCA 1EZVD 4FLUA 2O1KA 4H44C 2YKQA 2VRZA 1JA8A 2BTOA 1IVVA 1Y74B 5FNVB 2PYJA 2JJLA 4FM2A 1MFTA 3VMAA 3AE5C 4JAUA 3P8CD 2HTBA 4ZBMA 1AVOA 1LUWA 1HMWA 2OW6A 1DP0A 1WMKA 1RE4A 1LTBC 3DX2A 1GM9A 1WLEA 3ECQA 4X1KA 1L0NG 1MA1A 2Q68A 4P9PA 4DV0B 2Q7CA 4HBNA 2E74C 2HODB 2FXPA 4FK5C 1NU1G 3NMDA 4HH2A 3FXDA 4IL6E 2YEVA 3H1HH 3KZIZ 5BR8B 1SQXH 4B3RO 1KILB 4H13C 1HN0A 2QM7A 1OJMA 2KB7P 1SPUA 5LHIA 1IJDB 2XN1A 2XUMA 4BIZA 1OJNA 4JV5O 4BRYA 3SYPA 4JF7A 2OARA 3JAWB 3X40A 1L4AC 1QCEA 5CBNA 3OAAG 3TF5A 3HE4A 2BCCG 3AK3A 1IFJA 1H8AA 3X3YA 1LF9A 2RJZA 3I56V 2OCHA 2V1DA 3L72D 2JJ2G 5BZBA 1JR9A 1K7DA 5AW8B 3AEIA 3BVOA 2IYOA 2UUBB 1MOFA 1SQVE 2K1EA 4PDRA 1OXZA 4UCRA 3CI9A 3ABKB 1SA0B 1JUNA 3D4ZA 1QAKA 4B3TB 4YXDC 1Y8AA 3AEAC 4FFBA 5KMGA 1NR7A 1SS3A 2IW5A 5IJ0A 5KHGA 3OA7A 2BRPA 4BAYA 3M7MX 1RM1B 3LOYA 3ZHRA 2ZFCA 3D36A 3FD9A 3QG0A 4D7TA 4KFMA 3L71J 2A45G 1T8ZA 1SZTA 3H9VA 5LXTA 3G3ZA 1WMNA 3DXRA 1RM1C 3BASA 2XOKG 3BFRA 2W83C 1KC8Q 2CQTA 1EDKA 3ZHVA 1NAFA 1M56C 2HR3A 3ZHQA 1VARA 4PELA 2G8YA 4W4KA 2UXBB 2Y0CA 1F4NA 4FLVA 1AI4A 1SQXK 1F4MA 4DUXA 2IH1C 1GL2D 1GL2C 2N05A 3FB5C 1EDJA 4TQDA 3FFQA 3HKDA 5AW1B 2EX3A 3B5ND 2N9YB 1M56D 4JI0O 5FL7G 1NTKJ 1IK7A 2PGGA 1Y47A 4I6MC 5AVUB 1MMZA 3V5BA 2FXOA 2BCCJ 3P8MC 4DCKA 2JGDB 3S1KA 1S4XA 3D3QA 3K04A 4JF3A 3LDCA 2QGNA 1MG1A 2OYQA 1VQOV 4KL1A 4CS2A 2CGOA 4CZZA 5DM6V 3OTOB 3BS6A 1K97A 3QFYA 2FBWC 1Y9BA 5CBFA 2EIKC 3KPEA 1USDA 4YJ3A 4LF5B 4TT3H 1OW7A 4UVCA 1XTCC 2ZXQA 5LA6A 3ABMB 3OW2O 3G71V 1KYOF 1GD2E 1IURA 1JZ5A 2Y48A 3JCUZ 1LNQA 1J2JB 4WFFA 2M0BA 4JI8B 3NXSA 4UB6H 3OW2U 2JEUA 2D3OW 2RQ6A 1DH3A 3K5OA 1DTOA 2ITAA 1R33A 3A0BZ 3HKBA 1Q8IA 1YQ2A 1NWQA 3VP9A 1L4AD 2YFOA 1KYOH 3G80A 4UVAA 1SQVK 1H2MA 1D2DA 4PV1B 1RPOA 1N7NA 1NTZE 5JH7B 1JZ7A 1A02J 1OVRA 4BXLA 4I1LA 3L36A 1G1IA 4DR7O 4MMIA 3CCQV 2OTLV 1L0NK 2CFWA 4GT1A 1KQGB 3HE4B 1JYWA 3WA3A 1JYVA 4E4EA 1GRJA 2XNXA 5C93A 3CB2A 4UFZA 2WSSG 1MSDA 1Q5OA 3A0HH 3I3BA 4OVNF 3CZSA 1VF6A 4IOIH 1N0NA 1BGYJ 3OAKA 1RWHA 1YITP 3MAQA 1SZXA 2EIMC 2AXTH 3F5HA 4GKJO 2A06G 3VQXA 1BGYH 1IU7A 2ZXWC 1KB9H 2CG1A 3RK3B 2DN9A 4H44D 4O4JB 3G9RA 3IAQA 1TUBB 1N36B 1R3IC 1SQBE 1W5ZA 3ZRWB 3HUSB 2HJDA 1LXKA 4NXNB 2CTQA 1N7LA 1WMPA 2E42A 3D70A 4DV6O 2KOGA 2HHHO 3PH0A 4BR6A 3DXRB 3EJPA 4E2LA 1T3UA 1GW4A 2A3QA 1Y74A 5FNVA 3ZEDA 1WT6A 5KHHA 2WVXA 2QDOA 3BVXA 1LWUA 5E79Z 1HR0B 3F7YC 1FJGO 4Q20A 2KXPB 3SJCC 5KLIC 3I55P 1CXZB 4X1KB 2IM9A 2MW2B 4RJTA 2WLHA 3Q5SA 1P7GA 1JZ4A 1ZTEA 1KP3A 2DWEC 2WPVB 3KQGA 3LDDA 1VQ8V 2IBZE 5EIBD 1K34A 3C3TA 1MN0A 4I50A 2B89A 5KAFE 3QDEA 3DX3A 2EILB 4W80A 3DECA 2QEXP 1OVVA 3CXHF 1BCCG 3WB1A 2CTWA 4I7ZB 3AE6C 4EDFA 2F7PA 4MVZA 4QE9A 2FTKA 3OR6C 1BCCH 2W6JG 4X65B 3BVHA 1PV3A 1BDDA 1YHQV 2E75D 2LXBA 4NPDA 1X8YA 2V7QG 4HNAA 1SQBH 3W7SA 4OX9B 2QJYC 1W4NA 4ZKPA 1RJOA 1M1KW 3SGIA 5LA6B 2Z4EA 1X59A 4EV5A 2JWDA 4MVRA 2R5BA 1AILA 1KQSO 4D6TD 2NPSB 5CBHA 3H1KH 3CCLV 1KB9I 1FFXA 3N2KB 5IJ0B 2UUAB 3KHUA 3AE4C 3VMYA 3H1KJ 3MHHC 2DJVA 1MMYA 1WN7A 3SWFA 2R9IA 1X1JA 4X66B 1D6UA 3L75J 3DGEA 1HGZA 5EC2C 4JASA 1GU4A 5LP6B 1FZCA 3BUBA 4XE5B 1OZHA 2PNCA 2HG5C 3TYYA 2YKPA 5BY1A 1HWWA 2FUTA 4Z2WA 1TVKA 2GUSA 2M5AB 2ZE5A 2ZAEB 4AQRD 4KFFA 5L8RJ 4DV3B 1RQVA 1X79B 2E3CA 1LT9C 3H32B 2BASA 4WFBV 1N73C 1RKYA 4G27B 3GHGC 1AR5A 1PD3A 1IFNA 1JTHA 2WSSH 5GTIH 2Y0DA 3STLC 3BA8A 5EZYB 1SO0A 3U1CA 1WA8B 1W59A 3ML0A 3GLMA 4I7ZC 3V4QA 2JEEA 3D71A 2KIKA 1UPGA 4UB6E 1T3JA 1OCCC 3L70E 1JMKC 1URFA 2VS0A 1RY3A 1NVOA 2N1TD 4NR1A 2HFED 3D52A 4MVOA 5E79H 1S5LE 1K73Q 2FYUK 1PP9G 2PRRA 1ZOYC 1D5AA 1KN7A 4MVQA 2IDBA 4I9QA 3T0BA 4NYKA 4WY4A 5AVZB 5LYJB 1H88A 1OJPA 2GV9A 1VF6C 4HZ3A 2IBZI 1J0MA 1Q82W 2WSEJ 2E24A 1HTLC 4HB1A 1BE3H 1FYJA 1LTAC 1N8RW 4JPZB 5KTBA 5JCOC 1R3JC 3CX5E 4DV6B 3SR2C 1WRGA 4H0LB 1YDXA 5TISZ 4LR3A 2PZSA 2D73A 1YTFD 1M5IA 3BATA 1BMFG 4RWUA 4TOIA 4NXNO 1J5EB 3EJQA 1NU1K 5AW7B 1BT8A 5J2TB 2VWKA 1XMOO 1HUCA 5KA6A 2FKWB 2E76B 3CJHA 1LTIC 3P8CE 5A1AA 2W90A 3OTFA 1KSIA 1PM9A 3OS7A 4YPCA 1R5LA 1WMOA 4LP8A 1AR1B 1YQ3C 2WSCH 2H43A 3AE2C 3G67A 1JY3O 2L5GB 4DW1A 2WW2A 5TISH 4PDVA 1LP1A 1R1BA 1TU5A 2E74B 1LT1A 1ZN5A 3VMXA 4JPRA 4DR7B 3ZN0A 2NPSA 5GTHH 4X65O 3JSLA 2HTAA 1Y66A 5GTHE 3AG2B 1TQSA 1K5SA 1PKXA 1Z2GA 2Q0OC 2GUVA 2L91A 3CLQA 4ASVA 5TJHA 2Q5UA 2HJFC 1ZL8B 1DK1A 2E43A 4J7KA 4LC1A 4PJ0Z 1OW8A 2F7RA 2M3BA 4DUWA 4KXRA 1SKVA 1NKNA 4Z1MH 3I5DA 1Z56A 5CN0A 2EAEA 2FYNB 2K37A 1OCZB 1JFFB 2O01N 2W27A 5KHIA 2LR2A 3B5NA 1M8OB 4JI5O 4YXWG 5D5QA 1AB3A 3T08A 3EFGA 2PI5A 4OK2A 2PAJA 1FJGB 3AK2A 1OX3A 2ZCEA 3JALB 2IJJA 3WUVA 2JEXA 1HNWO 3CL3D 3K0DA 3CC7V 4B3MB 1NTZG 4MN4C 2FKXA 1NTMK 3UT5B 1NSRA 2UXCB 2IBZH 4MS2A 1JZ8A 1IVUA 1YIJV 1GTWA 1AV4A 2ZINA 2XN0A 1URQA 3AEGC 2VRSA 3E8FA 2WLIA 5CMUA 1HXKA 1GTOA 2EILC 4JI2O 5APSA 2RDCA 5L3CA 4UCVA 3C9IA 1JCCA 4JI0B 1Y76B 4GKJB 2WVRA 2GTSA 3IMHA 2NR5A 2ZE8A 4RNLA 2RCVA 2DYRC 1GW3A 1N7PA 1Q90D 1PPJH 2EIKB 3FWNA 1NTKK 1FJPA 1MV8A 4I9WA 2V7QH 1JY2O 4GODA 2C0WA 1E79H 3Q4HB 3K5TA 1JPXA 2Q73A 2AXTZ 1SIHA 3ABTA 2C9LY 1DGSA 1OMIA 1SP4A 4QE7A 2NPSC 3TJTA 2F95B 1NTZK 4PD4I 1MMUA 1PU4A 4MSWC 2AXTE 3APQA 1ZRTE 5KLVJ 2QWRB 3I3DA 2XN2A 4JI6O 2A45I 1AQ5A 1VQ7V 1YI2V 5H2FH 2F7QA 3MV01 3RBZA 5KLVH 3QO8A 3LIEA 3H1HG 1AI7A 1IZNB 2YO2A 3OD4A 3L73G 4J10A 1N2DC 1KUQA 1XTGB 2POHA 1VQNP 3OT7A 1KBHA 2OOVA 3CWBH 1NJIQ 3JASA 1TVKB 2M5AA 1C82A 4R7CA 2RDYA 1ZWIC 3WFAA 1SQGA 1GMJA 4UV8A 3BGAA 1IDSA 4QMAA 1SQVJ 4O4LB 4FZ1A 2PFXA 3A0BH 3H1LJ 1JY2P 3I55V 3RYCB 3RWRD 4FLWA 5JJNB 3ZMVA 1GMGA 3L72J 3H1LH 5APVA 1RF1C 2E5LB 2JR8A 3THOA 4AQYB 5EBMC 2CH7B 1HM2A 4B3SO 3BCCG 4JI1O 3UKMA 5C8YB 1Y67A 1V9PA 5KJ7A 5AVWB 1SQQG 2NPSD 2F93B 2EINC 3WG7C 2M3EA 3VP8A 1IQXA 1N32O 5LBQA 3M99B 3TCUA 1D7MA 4X9QA 4YY3O 4DO2A 3AG1B 1WP8A 2ZM6O 1J1DB 1SLQA 4NTYA 5FLXN 1BDCA 1NKZB 4U7NA 1RE3A 1FPOA 3HKEB 2FYUJ 3E1IA 3DX4A 4AQ0A 5GTHZ 3Q5PA 1KQFB 2XASA 2EIMB 1YITV 2FB5A 5IJ9A 1TU3F 1Q6UA 5APQA 1MUUA 1WPBA 5GTIE 2NN4A 1PPJD 2VWJA 2B9BA 4FLYA 1MFZA 4LLHA 1HM3A 2BCCE 4GUNA 1N32B 4CBCA 4MVSA 4DXWA 1HNXO 3L70J 3VDBA 3T09A 1P84E 3LNMB 5J2TA 2QSAA 4DV1B 3E22A 3WVFA 4GKKO 3ETGA 1CP9A 2IPPA 2KG7B 1QVFO 1BGYD 1BHBA 2IZ0A 5CCHA 5KX5B 1NS0A 2RH0A 1JYNA 1LURA 3JATA 3S9OA 1KILD 3IN6A 1CZQA 2W8ZA 4ZHQB 3L74J 4QPKA 2XNDG 4LF7B 5FPOA 4EOTA 1LP1B 1D5NA 3Q4HA 3AFJA 5B66Z 3DX1A 2FYVA 1EQ7A 2V4DA 1RWCA 4UV9A 2E76D 4DOJA 4DV5O 2XDJA 4DUZO 4GDOA 1B6QA 4LFBB 3JCUH 2K9PA 4FM1A 5APWA 4IHJA 1Q7YQ 3E7JA 1HW7A 1G1JA 1ZL8A 4AI8A 3T4ZA 1NTZJ 4ZKUA 2DYSB 4DV1O 4FVMA 2O3JA 4HKZH 4YHHO 1SQBK 2OCCB 4GX1A 2XU6A 2WLJA 2WCOA 1JFFA 1IBKO 3W7UA 1V54B 2H3OA 1BCCE 1S5LZ 2ADQB 2JVDA 2WLLA 4MT8A 3TGUG 1S9KE 4PA7A 5LGNA 2WYHA 3UQ8A 4GX0A 1X22A 2JP3A 1YJNV 3JD3A 2IX7C 3V2PA 3ABVC 1N73B 3SX1A 5KHKA 5KJ7D 4JZ2A 4O4LA 4K0KB 1NTZD 4UCUA 3RYCA 3H1LE 3RGBA 4YY3B 2A06H 4RO0A 1TXKA 4CS3A 3CXCU 1JOCA 3E1RA 4OWFA 3CCVV 3TSIA 1QL1A 1OJOA 4WBAA 4TUYA 5AG2A 2Z5IA 3GMAA 1JJOA 3FB6C 2OT5A 3DC6A 1N33B 3IAOA 3RRSA 1FXKB 3TXSA 3H1LG 1YEWA 1PIXA 5APYA
chains in the Genus database with same CATH topology
2KZIA 2ALWA 2P58A 1LT1A 4NPFX 3BVWA 2UWJE 3BUDA 3LVTA 2JWDA 1U7MA 1TQVA 3BVVA 2B87A 2OTKE 1TQSA 3D4YA 1R34A 4HJGH 4ASVA 3DX0A 1H0TA 2K3RA 3BUPA 5KBPA 3D50A 5EFWB 1OVUA 5CBOA 2F7RA 5C39A 1BDCA 1HTYA 2M0BA 2RKLA 2I8DA 4EYYQ 4ZMDA 1MFTA 2LR2A 3CV5A 3DX4A 4GOFA 2OW6A 1R33A 3BUIA 3DX2A 4K35A 1X0TA 3BUBA 3DDFA 1TQWA 3FXDA 1HWWA 5K5GB 4MN4C 1EDLA 2ZAEB 2KZJA 1FC2C 2M5AB 2B87B 1O7DD 1OVRA 4BXLA 1QWNA 1QX1A 2F1BA 2KUBA 1EDIA 3QWOC 5DJUB 2QVAA 1HXKA 3MHVA 4NPEA 1QWUA 2KI7B 1TQUA 4KJMA 5CBNA 2F7OA 2WYIA 1PS3A 3BVUA 3CZSA 2KIKA 4IOIH 4ZNCA 2KS1B 3EJTA 1NVOA 3ZDMA 3EJSA 1LP1B 3D52A 3DX1A 2FYVA 4K3AA 1TQTA 4GODA 3RGUA 3D4ZA 2R44A 1JMBA 1H0TB 1JM0A 3PH0A 4HKZH 3EJPA 3EJUA 2F18A 3BUQA 4HB1A 1ZXGA 3BVXA 2F7QA 3BVTA 1EDKA 4JBZA 2HR3A 2SPZA 2WYHA 3EJQA 2B88A 4GOEA 2WMMA 2M5AA 1Q2NA 3MZWB 3BLBA 3D51A 4ASWA 1EDJA 4CPGA 2LXCB 2B89A 3DX3A 3DDGA 4WWIA 1OVVA 2F7PA 1ZW0A 1Y47A 3EJRA 2F1AA 2Q1KA 1SS1A 5DJTB 1U7JA 1BDDA 2QRXA 1S3JA 3S1KA 2LXBA 4NPDA 1EC5A 2OW7A 3CZNA 1DEEG 1LP1A 3FXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZI A;  2ALW A;  2P58 A;  1LT1 A;  4NPF X;  3BVW A;  2UWJ E;  3BUD A;  3LVT A;  2JWD A;  1U7M A;  1TQV A;  3BVV A;  2B87 A;  2OTK E;  1TQS A;  3D4Y A;  1R34 A;  4HJG H;  4ASV A;  3DX0 A;  1H0T A;  2K3R A;  3BUP A;  5KBP A;  3D50 A;  5EFW B;  1OVU A;  5CBO A;  2F7R A;  5C39 A;  1BDC A;  1HTY A;  2M0B A;  2RKL A;  2I8D A;  4EYY Q;  4ZMD A;  1MFT A;  2LR2 A;  3CV5 A;  3DX4 A;  4GOF A;  2OW6 A;  1R33 A;  3BUI A;  3DX2 A;  4K35 A;  1X0T A;  3BUB A;  3DDF A;  1TQW A;  3FXD A;  1HWW A;  5K5G B;  4MN4 C;  1EDL A;  2ZAE B;  2KZJ A;  1FC2 C;  2M5A B;  2B87 B;  1O7D D;  1OVR A;  4BXL A;  1QWN A;  1QX1 A;  2F1B A;  2KUB A;  1EDI A;  3QWO C;  5DJU B;  2QVA A;  1HXK A;  3MHV A;  4NPE A;  1QWU A;  2KI7 B;  1TQU A;  4KJM A;  5CBN A;  2F7O A;  2WYI A;  1PS3 A;  3BVU A;  3CZS A;  2KIK A;  4IOI H;  4ZNC A;  2KS1 B;  3EJT A;  1NVO A;  3ZDM A;  3EJS A;  1LP1 B;  3D52 A;  3DX1 A;  2FYV A;  4K3A A;  1TQT A;  4GOD A;  3RGU A;  3D4Z A;  2R44 A;  1JMB A;  1H0T B;  1JM0 A;  3PH0 A;  4HKZ H;  3EJP A;  3EJU A;  2F18 A;  3BUQ A;  4HB1 A;  1ZXG A;  3BVX A;  2F7Q A;  3BVT A;  1EDK A;  4JBZ A;  2HR3 A;  2SPZ A;  2WYH A;  3EJQ A;  2B88 A;  4GOE A;  2WMM A;  2M5A A;  1Q2N A;  3MZW B;  3BLB A;  3D51 A;  4ASW A;  1EDJ A;  4CPG A;  2LXC B;  2B89 A;  3DX3 A;  3DDG A;  4WWI A;  1OVV A;  2F7P A;  1ZW0 A;  1Y47 A;  3EJR A;  2F1A A;  2Q1K A;  1SS1 A;  5DJT B;  1U7J A;  1BDD A;  2QRX A;  1S3J A;  3S1K A;  2LXB A;  4NPD A;  1EC5 A;  2OW7 A;  3CZN A;  1DEE G;  1LP1 A;  3FXE A; 
#chains in the Genus database with same CATH topology
 2WLM A;  2ZNI A;  2KZI A;  2JS3 A;  4FLT A;  4AQY O;  1RW9 A;  1KTM A;  3D3I A;  1XMQ B;  2UWJ E;  1I7F A;  2IJK A;  3BRC A;  1USE A;  4J7J A;  1R34 A;  5JVD B;  1SRY A;  1HNW B;  1UIX A;  2EIJ C;  2X0L A;  3SYO A;  1H0T A;  4TV8 A;  1NSU A;  3B77 A;  3FB7 C;  1VQK V;  2E5Y A;  3M91 A;  3JAK A;  1YJ9 V;  4PJ0 E;  3SJQ C;  4JI5 B;  4ZMD A;  3OMA B;  1KD1 Q;  2CTR A;  1BE3 J;  3CCR P;  3CV5 A;  4UB8 H;  3SWK A;  1W6G A;  1NU1 E;  2Y0I A;  2AW9 A;  1SFC A;  1AJP A;  3AED C;  2LFS A;  2CIR A;  1PNM A;  3X3X A;  3ASN C;  2YXL A;  1NZ6 A;  1NH4 A;  2WPD G;  2KZJ A;  4J80 A;  1VF7 A;  3ICX A;  2CPS A;  3HR0 A;  3H1I G;  3VQV A;  1SQQ K;  1J1E B;  2BEZ F;  1NKD A;  1QL2 A;  2E22 A;  3CCQ P;  3E8H A;  4O2A A;  2WWW A;  3OUS A;  2CG0 A;  1L0L D;  3KDP B;  4LBE C;  3K3W A;  2BOC C;  1WB8 A;  1E1Q G;  4PA9 A;  2L35 A;  3ZRV A;  3HIG A;  3CX5 H;  4QJF B;  3NRE A;  1RP3 B;  2Q8V A;  4G2K A;  3GG2 A;  2XKM A;  3BCC D;  1H2K A;  1Y6X A;  1XQ8 A;  5KAI Z;  5H6R A;  1FZE A;  1YIJ P;  2ITD C;  3T1H O;  2OYI C;  4J7Z A;  3ZBH A;  2F43 G;  3MTU E;  2Y69 B;  1KP2 A;  3CYO A;  4AIL C;  1FAF A;  1LVN A;  1A2V A;  2MK3 A;  4H33 A;  1XMO B;  1SQP D;  1TQT A;  1AVL A;  3L70 D;  1ZX3 A;  1WJZ A;  1L0L J;  3B4S A;  3EVK A;  4IT5 A;  2A06 D;  4JGS A;  1VQL V;  1J95 A;  3LSQ A;  1OCZ C;  3ZJZ A;  3L75 D;  3ABL B;  3G6E V;  1PPJ E;  1QGK B;  1H89 A;  2P2U A;  4P2Z A;  1I8Q A;  1W3Y A;  1HP8 A;  2PYL A;  3CC2 P;  1RWG A;  3RBX A;  4EB6 B;  5IT9 N;  3ABL C;  5IJ9 B;  1M4U A;  2O57 A;  3PP5 A;  1QX8 A;  4MVU A;  1EN5 A;  3H1H E;  1SQQ E;  2MKV A;  3T1C A;  4JI4 O;  1BCC D;  5CJ4 A;  2LQT A;  2ZVN B;  1Z5W A;  5HFM A;  5EIB C;  5E1Q A;  4JTA B;  2PTM A;  3D51 A;  2QWN B;  4YJ2 A;  1RF0 A;  2YIB D;  1VQP P;  4YTP C;  4FFB B;  5KMG B;  1PL0 A;  3CD6 P;  4Z1V A;  1FXK A;  3CZJ A;  2YC0 A;  1Q43 A;  2PP6 A;  4JI3 B;  4KT0 J;  3QFZ A;  3H1J H;  1M90 Q;  3K9A A;  4DR6 O;  1K1Y A;  4PI0 A;  2F1A A;  3NTN A;  4KHX A;  4WB4 A;  3B8E B;  3H1J J;  3TY1 A;  3ACT A;  4D6T H;  1XIL A;  1DEE G;  4ZHQ A;  1S5J A;  3FXE A;  5JVD A;  4DR2 O;  2D1W A;  1VQM P;  3S4D A;  1Z5V A;  1IVS A;  3LVT A;  4DV3 O;  4O4H B;  1TQV A;  2A9H A;  4FNT A;  4LFC O;  2B87 A;  3OUF A;  4DR3 O;  1NSZ A;  4FLX A;  3JAK B;  4HJG H;  5JWP A;  3T0A A;  1W0K G;  1ZR2 A;  3ZHU A;  1CSB A;  1K05 A;  1O9G A;  4RKU J;  3HKD B;  2P10 A;  1QQC A;  3CS5 A;  5L3G A;  3ZHS A;  5C39 A;  1VDF A;  2JJ1 G;  3S3X A;  1R5S A;  2H7H A;  1N7S A;  3KN4 A;  4DV2 B;  2OCC C;  3H01 A;  1LTG C;  4UFC A;  3E35 A;  3BCC H;  1F23 A;  1CPY A;  2J59 M;  2Q7E A;  4EIJ A;  2P67 A;  2FYZ A;  4K35 A;  1VF5 C;  2VQF B;  2QIW A;  1LGH B;  1T5E A;  1QU7 A;  1VQ9 P;  1TQW A;  1QLE C;  4FLZ A;  4PA3 A;  4NXM O;  3W7X A;  2HEP A;  4DR3 B;  1RQU A;  1FKA O;  3GF7 A;  4XA4 A;  4YJ3 B;  1NU1 H;  1OCR B;  3B71 A;  3T2P A;  1VF5 B;  4FJC C;  2ZKO A;  3HD7 A;  1A02 F;  1SQQ J;  2YNY A;  5LGT A;  2ZE6 A;  4XBF A;  2CDY A;  2Y4U A;  5CCG C;  1JB0 J;  4NPE A;  1SQQ H;  1AQT A;  4KHP B;  1FDI A;  1YYC A;  2YXY A;  2Y73 A;  2CIQ A;  4W7Y A;  1ULV A;  3H1K E;  3JSN A;  1NH2 D;  1YI2 P;  1VQ7 P;  4EV2 A;  4ZNC A;  3ZRS A;  3EJT A;  3OB8 A;  3ZDM A;  3EJS A;  4UB8 Z;  1IO4 A;  3CHX A;  1US6 A;  2WVZ A;  1ORQ C;  2PF4 E;  5JQG B;  1LT9 A;  2ZR3 A;  5AVQ B;  5AVT B;  1RWF A;  2K1A A;  5JH7 A;  5E79 E;  4ICG A;  4O4I B;  1VQ5 P;  1L0L K;  5AW0 B;  3KKY A;  1R3L C;  1H0T B;  3BY6 A;  4X1Y A;  3AEF C;  3FGA D;  4BW9 A;  3BRT B;  3RYI A;  3CRC A;  3VOP A;  2P5O A;  4I2L C;  2QTS A;  4NXM B;  1P4R A;  3Q2Y A;  2HHH B;  4WY4 D;  2Q69 A;  4J42 A;  4BTW A;  4UXN A;  2Z0A A;  3SYA A;  4JBZ A;  1AVY A;  2FYU E;  4FZ0 A;  5IYD O;  3B5N C;  4TV9 A;  3TGU E;  2E75 B;  2OYH B;  3ASN B;  4LFA O;  2CAZ C;  3TGU D;  3OMI B;  2IYP A;  5KKZ C;  1Q2N A;  3T97 B;  1ZLL A;  2M7W A;  1JZ3 A;  2HP8 A;  3T1H B;  1OFC X;  2ARH A;  1HWT C;  2JKP A;  4O2A B;  4N78 E;  1WP7 A;  2IBZ G;  5KA5 A;  3VMZ A;  5LP6 C;  4F6R B;  1G1X B;  4LFC B;  1L0L G;  1NYH A;  2BCC D;  4DV4 O;  3ITK A;  1AV1 A;  1NH2 B;  2CFG A;  3K59 A;  2M8R A;  2CWU A;  4ZKI A;  5KLV E;  2CUG A;  4IL6 X;  1W2B O;  4KTP A;  1TAE A;  3E8B A;  4PA6 A;  1Q7Y W;  1DF5 A;  4JYA O;  1EFR G;  2QKS A;  5K1X A;  3A0R A;  3L70 G;  4PD4 H;  3SDL A;  3DSQ A;  5IYC O;  3MUZ 1;  5CA0 B;  1BSM A;  1FXV A;  3DTU B;  4DR6 B;  2XAG A;  2OTK E;  3N9H A;  2DWD C;  1HGV A;  1LR1 A;  3CEI A;  3PJS K;  2YO3 A;  3BUP A;  2QWP B;  5KBP A;  3L37 A;  5KAI H;  5BMV B;  1SQQ D;  4WF9 V;  2CFD A;  2YFN A;  2WT7 B;  1SQB G;  5BVZ A;  4BWN A;  1YQ4 C;  2K9J A;  4JI8 O;  1YBK A;  3M9H A;  3BUI A;  2HYN A;  2YDE A;  4HNA B;  3CRM A;  4MTG A;  2QSI A;  3AE9 C;  2CPB A;  1H8H G;  2WW3 A;  3T0D A;  1H8E G;  3ALA A;  1W2B U;  2LFR A;  2GSM B;  4LF5 O;  3KZI H;  1O7D D;  1SQX G;  2I1K A;  3QWO C;  4X89 A;  4KFE A;  4YJ2 B;  4H13 D;  5GON B;  1H2G A;  3CCJ V;  2UXD B;  2P7T C;  2E74 D;  4X8A A;  3AG4 C;  1HMU A;  2PI4 A;  2DMX A;  1TQU A;  3NBB A;  1V7X A;  3Q5R A;  4LF6 O;  3A24 A;  4LNU A;  2WOF A;  5HFL A;  3U11 A;  3IAP A;  4DR1 O;  1SQP G;  1KKD A;  2D2C C;  3BCC E;  2JO1 A;  3VBB A;  4O4I A;  1FZF A;  1L4A B;  4NB5 A;  3HTK A;  4L73 A;  1PL5 A;  1NVP B;  2XSG A;  4KTR A;  2ADP A;  3R4Y A;  3ZCC A;  4GKG A;  3RK2 B;  4JI7 B;  4HAM A;  1KD1 W;  4WBN A;  4BTX A;  3K9S A;  1N7S C;  3L72 G;  2YI9 A;  2Q7H A;  2CGN A;  2JGU A;  3CCV P;  1IQY A;  1MAB G;  2AEM A;  4K8Z A;  2QJY B;  4KP4 A;  4B7E A;  2L6L A;  1JYX A;  2Y0E A;  2A7W A;  2FYN C;  3CXH I;  4F6E A;  1N7S B;  3BHP A;  2I1J A;  4BZH A;  4I55 A;  4H37 A;  4JAV A;  4YHH B;  3UO3 A;  2Q67 A;  2OIE A;  2IFN A;  3F89 A;  4J41 A;  4DRX A;  3HD7 C;  3T97 A;  3APO A;  4DV5 B;  2W0X A;  5CA1 B;  2YIU B;  4DUV A;  2UUB O;  1JZ2 A;  2ODM A;  1JJ2 U;  3AEC C;  3H1H D;  1SQP J;  3RK3 C;  1GDT A;  3RYF A;  2Z5U A;  2Q3E A;  4TLF A;  4H0L D;  2Q6A A;  4ASW A;  2J58 A;  4L75 A;  4WY4 B;  1YGA A;  4FIP C;  3I3E A;  1OHH G;  3BRV B;  3T1Y O;  3JD1 A;  2HPC B;  3ZX6 A;  3T0U A;  3ETE A;  1QVG O;  3O9O A;  5H2F E;  3V2N A;  3SEP A;  3CCR V;  2YIC A;  2QWO B;  2P4V A;  1M1J A;  1SF9 A;  1CI6 A;  1OW6 A;  1QBZ A;  1G2C A;  3S4C A;  2QM4 A;  1KFM A;  2YID A;  1M1K Q;  1SET A;  1HWY A;  5H5N A;  4GKK B;  4EFB A;  1ENV A;  2G38 A;  1EZV G;  1KIL A;  5AVS B;  2DYR B;  3FB8 C;  1N33 O;  1SQP E;  2Q9L A;  1SC5 B;  4R50 A;  1K73 W;  3BVV A;  5JQG A;  1LT9 B;  2RN9 A;  3AE8 C;  1K8A Q;  2OYI A;  5AW3 B;  3J7H A;  3JD4 A;  4TT3 G;  3RK2 C;  5A2Q N;  1H38 A;  3CJH B;  3G6B A;  4TWK A;  3SXX A;  5B3S B;  1XEQ A;  2YMK A;  1CEZ A;  3MHS C;  1GN3 A;  3C3S A;  4XDK A;  1BCC J;  1IFI A;  4DR5 O;  2I8D A;  2EIJ B;  2Y4T A;  4DR5 B;  4W7Z A;  3QG5 A;  2WLN A;  4U3J A;  4O2B B;  1YF2 A;  3E7K A;  1RE4 C;  4Y99 C;  4EFE A;  3RL0 D;  1IBK B;  2GUZ A;  3JD0 A;  1NTM D;  2FFD C;  1PFI A;  4TV9 B;  1GK4 A;  2EJR A;  2F4V B;  1OCO B;  1IBM O;  3K5L A;  2F1B A;  3O6Q A;  1BL8 A;  2YXH A;  1WB7 A;  5BU5 A;  3BPZ A;  2F1M A;  4LFB O;  2YX9 A;  2KI7 B;  4W4L A;  1RH5 B;  3G6E P;  1FDM A;  1NS8 A;  2QE7 G;  4KJM A;  1T2K D;  1FZC C;  3SPG A;  1PS3 A;  3B5N B;  3BVU A;  1L4A A;  2EUL A;  2QA4 V;  3H1I J;  3CC2 V;  3ZMT A;  1S72 V;  3K06 A;  4J9Z B;  3EWK A;  4C7R A;  2EJ7 A;  3WIR A;  4AHC A;  2OTJ V;  1Q6I A;  3ZN1 A;  1JX9 A;  1L0N E;  2GTA A;  5B1O A;  5AVR B;  2W6J H;  2ZXX A;  3H1I H;  4KFD A;  1JEK A;  5CCH D;  3K79 A;  1EXJ A;  2ZD9 A;  4IYI A;  1K5Q A;  4TTG A;  1YJW P;  5TIS E;  2HOD A;  3UT5 A;  5CA0 A;  3TXQ A;  4J11 A;  2MJZ A;  3GF3 A;  4R8C A;  1N7Q A;  1EZV E;  4LH6 A;  1VQP V;  1EKM A;  1EZV H;  1RF1 B;  4B08 A;  3ZMS A;  2WLI B;  3K08 A;  3CCM P;  4EI2 A;  2N04 A;  4I55 B;  1S5L X;  3AG1 C;  1Z45 A;  4DV7 B;  5GW7 A;  3SPC A;  1EZJ A;  5BR8 O;  1HNX B;  2WT7 A;  3CMA P;  4JTC B;  4DRX B;  3M9B A;  4C46 A;  1JY2 N;  1AI5 A;  3WB0 A;  1PP9 H;  1URQ D;  2CIS A;  1QLE B;  1JVM A;  1VQM V;  3E2E A;  3QH9 A;  3MUD A;  2HVJ C;  2ZVO B;  1SQX D;  4QGP A;  3CCU V;  5APT A;  5F2V O;  3DYM A;  1SFC D;  1YJN P;  2UU9 B;  1SFC C;  1KEC A;  2Q0A A;  4C7U A;  2WQY C;  4PV1 D;  4IYH A;  4CPG A;  1SA0 A;  1NO4 A;  3DDG A;  3P30 A;  4OH8 B;  1SVF A;  2KP8 A;  1L0L E;  2R3C A;  2YXR B;  1URQ C;  3K25 A;  2Q1K A;  1SQV G;  3A8T A;  1F4A A;  3VD4 A;  3SFD C;  2H94 A;  4JI2 B;  1NBM G;  2QRX A;  2OW7 A;  1KQS U;  4B3S B;  2FY8 A;  1L7K A;  2EZP A;  4I0X A;  3HKC A;  5AW6 B;  3U1A A;  2X6B A;  1VQ9 V;  1FAV A;  1Q6H A;  2P58 A;  3AG3 B;  2ZXE B;  1RF0 C;  2FL4 A;  1NS7 A;  1UI8 A;  2UXC O;  1K04 A;  3TGU J;  3IFX A;  1BHA A;  2AZ0 A;  4CH5 A;  1S0V A;  3T1Y B;  3W68 A;  4OK4 A;  3VYI A;  3JCU E;  1N0J A;  3ZS8 C;  2ATK C;  3D6Z A;  1K1W A;  1QVG U;  4KUM A;  3CCE P;  5CCH C;  4U3F E;  1K92 A;  2WLK A;  1OJH A;  3CCL P;  3L75 E;  3T4D A;  1YJ9 P;  1BGY E;  1JMM A;  2ZE7 A;  2OGU A;  2WIT A;  3F7V C;  1KB9 F;  2H88 C;  3A0O A;  4OXS A;  1H2L A;  3HRN A;  1T2K C;  2LGQ A;  2IJH A;  2JGD A;  3LUT B;  5BXZ A;  3U10 A;  5APU A;  2QTO A;  1GK6 A;  4JI6 B;  1SQB J;  3HUS A;  3AMO B;  5K5G B;  2ZYG A;  5KKZ B;  2W0Q A;  2YS8 A;  5IYZ A;  1OZ0 A;  5CA1 A;  4UUJ C;  1QWN A;  4LWS A;  2AGA A;  3MDS A;  3PHL A;  3JAR B;  2QVA A;  3AE7 C;  3MHV A;  1QWU A;  4JI7 O;  3K5M A;  3RL0 C;  1LWU B;  1UFI A;  2WOH A;  2WVY A;  4DR4 O;  1DIP A;  1J1E C;  2X6C A;  2KSJ A;  1BQ0 A;  2F7O A;  1BZK A;  3OGI B;  1AVK A;  3M8A A;  3MWX A;  5LMN O;  3VQW A;  2KB1 A;  2OYO A;  2XV5 A;  4PJ0 H;  1G2C B;  1ZUQ A;  3MUD C;  2B5U A;  3HKB B;  2A79 B;  3LW5 H;  1DD4 A;  3L74 G;  3L75 H;  3Q1N A;  2KS1 A;  4R4M A;  3AFL A;  3AG3 C;  3DYP A;  3WIQ A;  1K9M W;  3SWY A;  3LW5 J;  4YXW H;  3RK2 D;  5JJJ B;  3CXH D;  1YVW A;  2R44 A;  1NHL A;  1BQZ A;  2WZS A;  2WSF H;  1XNQ B;  1NTM E;  1VQL P;  3VOU A;  1IXM A;  1E1R G;  3DYO A;  1AJQ A;  2QJP C;  2RMK B;  5JMF A;  4B3M O;  3GVM A;  4PA4 A;  2HVK C;  1I94 B;  1XL4 A;  2PGD A;  2OIG A;  3ABU A;  4U3J B;  3K57 A;  2Q4P A;  4O2B A;  1V55 B;  1OIP A;  3IAY A;  4UCO A;  3L9D A;  2XHB A;  1NSS A;  5IWA B;  4RQE A;  2GUZ B;  1SQP K;  2DOS A;  4P30 A;  2E5T A;  1OV9 A;  3CME P;  1S76 D;  3B8M A;  1PX3 A;  1MNG A;  2NLJ C;  4H0L C;  1FFX B;  2FYU G;  3BLB A;  2XAQ A;  4K8X A;  3OE7 G;  4FNV A;  2FFD A;  3O6Q B;  4BZG A;  1JCD A;  4A7P A;  1LXM A;  1FJK A;  3HD7 D;  1ZR4 A;  4Q6G A;  1Q81 Q;  2GBO A;  3E1F 1;  3VSM A;  3JD2 A;  2B1G A;  3ASO C;  3RL0 B;  3KCY A;  1XNR B;  2Z3Y A;  5LP6 A;  1S3J A;  1FZC B;  1AR4 A;  1OAC A;  2FUQ A;  4OGQ B;  3L74 D;  2OWO A;  1PGO A;  1WAZ A;  3E80 A;  3BUD A;  4U7O A;  4C7N B;  3H32 A;  3L73 J;  3G71 P;  1COW G;  2ZIO A;  1I5X A;  3H1H J;  1N7S D;  2QR4 A;  1SQX J;  3D4Y A;  2PY5 A;  2IU3 A;  5B1A C;  1FDO A;  3O65 A;  1JTH B;  3L73 H;  2Y0P A;  2ZDI A;  1N9E A;  2XTA A;  1LOH A;  3F5W C;  1I5Y A;  3WU2 E;  1RF1 A;  2CK3 G;  5B1B B;  4NTX A;  1K9M Q;  4TUY B;  4EYY Q;  2D2C D;  3H1I E;  2C0X A;  1NTM G;  4RUE A;  3WUT A;  4D7S A;  1M7L A;  3X3Z A;  2JDI H;  4LF9 B;  3VDC A;  2KLU A;  2JS5 A;  3K5N A;  3H1J E;  3SYQ A;  1SQF A;  2XT9 A;  3LID A;  4LWS B;  4DJG A;  1HH0 A;  3JAR A;  3AEB C;  1FC2 C;  3J80 N;  3W67 A;  1W6C A;  1AFO A;  1JO5 A;  1L2P A;  1QX1 A;  3LNN A;  2KUB A;  5DN6 G;  3WMM 0;  5H6Q A;  2Z5H A;  2OQE C;  3RSY A;  5B1N A;  2H8P D;  4OX9 O;  1BSH A;  4GX2 A;  1VQ4 P;  4CC6 A;  4QIW F;  4XDJ A;  2FYU H;  4TSF G;  5LHG A;  1IFM A;  3R65 A;  2W6I G;  2BSK B;  3T2O A;  2WW0 A;  2KS1 B;  1S77 D;  3S4A A;  3BLC A;  4X20 B;  1AP5 A;  3H1J G;  3HUS C;  4XDL A;  1SFC B;  4UCS A;  4OGQ C;  4I0X B;  1Q3E A;  1DD3 A;  2BTQ B;  3OR7 C;  4X88 A;  1TA8 A;  3PN1 A;  1GL2 B;  4KHP O;  3NFQ A;  5IWA O;  4MMH A;  1O9H A;  4LF8 O;  3V2R A;  1VQ5 V;  1H54 A;  1QR8 A;  1S2E A;  2Q5Z A;  3EHB B;  1H2S B;  1Q86 Q;  1N86 A;  2CTP A;  1HR0 O;  1NTK G;  2OTJ P;  4ZI7 B;  2LW7 A;  3QNE A;  4WFH A;  3FYI B;  3VD5 A;  1NTK H;  2M6Y A;  3J81 N;  1IC2 A;  4O9B A;  2IH3 C;  5CB4 A;  1NAY A;  5EZY A;  3GHG A;  1WA8 A;  4PDL A;  1YJW V;  3L74 H;  1S5H C;  2GHY A;  2VQF O;  2KYV A;  4X64 O;  4N6J A;  4AUW A;  2XHN A;  4X66 O;  1R3K C;  2W6A A;  3JYC A;  1PNL A;  1D6Y A;  2Q9I A;  2B88 A;  3AMO A;  4QPJ A;  4ABM A;  5IYZ B;  1HJ0 A;  3WB2 A;  3L73 D;  2V4H A;  3HE5 B;  1SII A;  4I5S A;  1PGP A;  2ZYA A;  4L8J A;  4WWI A;  2XAH A;  2KLV A;  5CBG A;  4JYY A;  1KYO I;  5ITZ A;  3V2Q A;  4CC5 A;  4R6Z A;  2ZT9 D;  1F7Y A;  3OGC C;  3KXD A;  2AEF A;  3CSX A;  5DJT B;  1U7J A;  1M57 B;  4WY4 C;  1B3Q A;  2Q1F A;  5B5E H;  4DR2 B;  4MTX A;  4C7N A;  3CZN A;  3JAL A;  1EBO A;  4EB6 A;  2W6B A;  5KUM A;  1QLN A;  1BE3 E;  4NPF X;  1M90 W;  2GA1 A;  3WU2 H;  5KLI B;  1XNR O;  1CB8 A;  1GK9 A;  1M57 C;  1L0N H;  5LL6 Y;  3QTC A;  1YXB A;  4TQF A;  3L74 E;  5IDJ A;  3SFE C;  2C2A A;  3C1L A;  1L0N J;  3ETQ A;  4YIO A;  3D50 A;  2QG4 A;  4J5T A;  4OJZ A;  1PNK A;  1KV4 A;  1UJW B;  1HTY A;  1PX4 A;  3JAW A;  1Y76 A;  1NKG A;  2N74 A;  5FPR A;  3A0H Z;  1BE3 D;  4LGD E;  1LUV A;  2C11 A;  2AHZ A;  5DEC A;  1KQL A;  4ZIB A;  1S72 P;  1R6T A;  4EEQ A;  4JQ0 D;  3CRA A;  1PP9 J;  2ZXW B;  4EKW A;  4WFG A;  1X9V A;  1FOS E;  3L71 D;  3A3Y B;  3SJB C;  4F4L A;  5CCG D;  2F23 A;  2B87 B;  4A5U B;  2OYH C;  4PD4 F;  3OTO O;  1D6Z A;  1PGJ A;  2GDS A;  1XNQ O;  1NI8 A;  1US1 A;  3H6P A;  1I0H A;  1HJB A;  2FFD B;  2XAF A;  4P9O A;  3JC2 2;  4OPA A;  1QLE D;  3CCJ P;  1QR9 A;  1RSO A;  4JYB A;  1Y4M A;  3H1I D;  3UCS C;  5A9G A;  1VF5 D;  3VD9 A;  2IJI A;  3EXA A;  3VSN A;  3KG2 A;  3SJA C;  3Q3D A;  2BTQ A;  4N23 A;  4OPH A;  3K58 A;  4B86 A;  3IC7 A;  1L1F A;  1GAX A;  2WA3 A;  1KOR A;  2N1T A;  3LSS A;  3BAA A;  1Q86 W;  3B40 A;  2FXM A;  2UXB O;  4UB6 Z;  5DED A;  3L75 G;  4UB8 E;  5APX A;  4ZI7 A;  4WFE A;  3N7N A;  1FOS F;  1LTJ C;  1QEX A;  1V7W A;  1JM0 A;  1PP9 D;  3GHG B;  3FAV B;  4PHZ A;  1URQ B;  5B5E E;  1VMG A;  2ZDI C;  3STZ C;  4DUY O;  3BUQ A;  2YKO A;  1WNS A;  1JOV A;  5B66 H;  1RWA A;  1GH6 A;  5C8Y A;  4BZE A;  5IY5 C;  4U7J A;  1MSW D;  1AI6 A;  1MZF A;  2WO0 A;  1L0N D;  4DUZ B;  3PGB A;  2BT3 A;  1DLB A;  1L8D A;  1P7B A;  2NZ2 A;  2WMM A;  2IBZ D;  3L71 G;  1VQ6 V;  4ZOL B;  1S9K D;  3P3P A;  1KKC A;  3CP1 A;  4X1Y B;  2YIU C;  3RK3 E;  3CCE V;  1LWU C;  3WUU A;  1XI1 A;  2C9N Y;  2ZNJ A;  4LCU C;  3PTZ A;  3V6I A;  4MTF A;  1HNZ B;  1G6U A;  1XMQ O;  3ACS A;  1NTK E;  3AG2 C;  3TET A;  2GM4 A;  2UUC O;  4X62 O;  1IBM B;  2R5D A;  2P1J A;  2F4V O;  3E22 B;  2OYH A;  4IFD K;  1QAL A;  1X4T A;  3CXH E;  4DV0 O;  3LSU A;  5J2U B;  1EGU A;  3UO2 A;  1G8M A;  2PUS A;  1OVU A;  5CBO A;  2XND H;  3JAT B;  2Q3I A;  3IFM A;  4Y28 J;  4NTW A;  1NTM H;  4F6R A;  3K5B A;  1VQK P;  3NBJ A;  3S3W A;  1GKF A;  5KLV D;  2JRI A;  3CCS P;  2CWV A;  3HII A;  3T2Q A;  5BU8 B;  3CC7 P;  3ZHT A;  2ZM6 B;  3CE2 A;  3VTP C;  3DDF A;  5IY5 B;  1EZV I;  1NR1 A;  1W5C E;  3AEE C;  2BOB C;  3DCD A;  1FS0 E;  1QAF A;  3VD7 A;  2NNU A;  2A06 E;  2WGQ A;  1BGY G;  4DV7 O;  1N34 B;  1T6A A;  1RSO B;  3M0D A;  4ASU G;  5DJU B;  3HE5 A;  4CS4 A;  2RNB A;  5M1B A;  2E5L O;  5AW2 B;  1I08 A;  4WFA V;  1IZ3 A;  3SPJ A;  2JKE A;  3CPW O;  2WYI A;  2WSE H;  5ITZ B;  2WVX B;  5KUK A;  4NKG B;  2N1T B;  5J9P C;  1GU5 A;  4FNP A;  3CXH H;  3NJX A;  5L3D A;  1U57 A;  3ETD A;  4LF7 O;  2QA4 P;  3CC4 V;  3IJ4 A;  1RE3 C;  2Y74 A;  5KHJ A;  1JRQ A;  4CH4 A;  1K1X A;  4RUF A;  3RVY A;  1FZB A;  1JY3 P;  3FX0 A;  3FYE B;  1N73 A;  4FNR A;  3GWO A;  4UCT A;  4CH3 A;  1NU1 J;  4MVM A;  2B1I A;  3KCX A;  1FZA A;  3FAV A;  3QO7 A;  4N3Y B;  1OCR C;  1SQV H;  3M0A A;  4JV5 B;  4U3F J;  4I50 B;  2CWT A;  5B1B C;  5GON A;  1NVP D;  3VDA A;  1M57 D;  4QNH B;  2WA4 A;  3OJA B;  3L72 H;  1N34 O;  3SPI A;  4RO2 A;  1QVF U;  5L3F A;  2ZT9 B;  3CRR A;  2F18 A;  2YI8 A;  4B3R B;  2Q6Q A;  3BA9 A;  2CFK A;  1VP7 A;  1ZXG A;  2WSC J;  1JZ6 A;  5KX5 A;  2DW4 A;  3SPH A;  3G4S V;  1A32 A;  1IVX A;  2ZT9 C;  1OCC B;  3FX7 A;  1KFN A;  3C8V A;  2E2U A;  2SPZ A;  4ZOL A;  4Y99 B;  3N27 A;  5B3S C;  5LMU B;  3QF7 A;  4RES B;  3JSV C;  3QO5 A;  3O8Z A;  4MW3 A;  4JTD B;  3CWB G;  3CCU P;  1KYO E;  1BS3 A;  5KJ7 C;  1R6K A;  2LXC B;  3B2E E;  1P84 H;  3N2K A;  2R32 A;  1YCI A;  2XZR A;  4GX5 A;  4WVZ A;  1L0L H;  3N2G A;  3QVN A;  4IHJ B;  5EBW C;  2LGW A;  3RFR A;  1FBM A;  5D5P A;  5L3E A;  1TGO A;  1ZRT D;  1SS1 A;  3NR7 A;  5AVY B;  4X62 B;  2AHY A;  4NVP A;  4JI1 B;  1PP9 E;  1ZME C;  2UUC B;  1GN4 A;  3UM7 A;  1EN6 A;  2VQE O;  3JCZ A;  5LHH A;  5EBL C;  2HKO A;  4LF4 O;  3CWB E;  1N7O A;  2WLL B;  3ASO B;  1HBW A;  2ZL8 A;  3TDK A;  1HNZ O;  2E2V A;  1J1D C;  1U7M A;  2WPS A;  1MMM A;  3B09 A;  4MTO A;  1RPR A;  4BIO A;  1AA0 A;  3RYH A;  2E76 C;  2XAJ A;  2WDA A;  2CFL A;  2HPC A;  1AJY A;  3M06 A;  2N9B A;  3M9Q A;  3U0Z A;  4OGQ D;  1FFT B;  4FMT A;  1W2E A;  2EAB A;  2WW1 A;  2HLD G;  2KSD A;  2KQX A;  2QM8 A;  1NGM B;  1KIL C;  1GO3 F;  3L35 A;  1XBL A;  5AW4 B;  3EQ2 A;  3S4R A;  5CHX A;  1X0T A;  1P84 I;  1NS2 A;  4D6T J;  2EZO A;  2H8P C;  4IIJ B;  3A0B E;  1WPX A;  1ZLZ A;  4DUY B;  1V7V A;  1LJ2 A;  3JAM N;  1YZB A;  1JY3 N;  2DW3 A;  2YSU B;  2V7Q J;  2OTL P;  1NTZ H;  3N4X A;  1X1I A;  2DQ3 A;  4N21 A;  5EYP A;  1EDI A;  4JYA B;  5LYJ A;  2BE3 A;  1SQX E;  4TV8 B;  2F66 C;  5KLV K;  2DQ0 A;  4DV4 B;  4PDM A;  1ZAU A;  4U3F G;  1K8A W;  1PGQ A;  2QWQ B;  5AVX B;  2WPQ A;  4Z1M G;  2KNC B;  3X41 A;  1HVV A;  4DR1 B;  4IL6 H;  2W0F C;  1KMI Z;  1IBL O;  3TNU B;  4I4T B;  1JNM A;  1ZV8 A;  4IFM A;  4LF6 B;  4AYC A;  1W2Z A;  1AVM A;  3CWB J;  4RQF A;  2AEJ A;  1VIB A;  2P7J A;  3MV1 1;  3FKS G;  1J5E O;  4M3L A;  2UXD O;  4X1I B;  1P84 D;  3WA2 X;  4X64 B;  3BAB A;  2BRV X;  5J2U A;  1KB9 D;  2JDI G;  3EJU A;  1NS4 A;  1M56 B;  1SNZ A;  1NQT A;  2ZR2 A;  1IX9 A;  3WU2 Z;  4LH7 A;  3OEH G;  1BE3 G;  3BVT A;  4IL6 Z;  4FNU A;  2P6J A;  1M9N A;  1IK9 A;  4FFK A;  3UIA A;  1FU1 A;  5KLV G;  1FZG A;  3I56 P;  2K88 A;  2H89 C;  3B8N A;  2YXQ B;  1MZE A;  2R9R B;  1VQ8 P;  1NU1 D;  3N2G B;  2HLO A;  1IFP A;  2LJ2 A;  3CME V;  2CE4 A;  5GTI Z;  3IR9 A;  2BRW A;  3CPW U;  3ABK C;  1FXK C;  2JKV A;  2ZYD A;  3ZIA G;  1P84 F;  2IZ1 A;  1UII A;  1JQ0 A;  1U96 A;  3P32 A;  1H2N A;  1GM7 A;  3EJR A;  2ZIM A;  3M0D C;  1KZU B;  1PZQ A;  2YMY A;  3CX5 D;  1YHQ P;  3HPL C;  5AW5 B;  4R4L A;  1THZ A;  1HF9 A;  1VEW A;  1OWA A;  3GB7 C;  5JCO A;  3TK1 A;  3PRJ A;  1VQ6 P;  1B04 A;  3L71 E;  1S5L H;  3E86 A;  1N7R A;  2B9Z A;  3RYH B;  2QKC A;  1YSC A;  3HD7 B;  1SQP H;  4IFF A;  2WTY A;  3L70 H;  3S4B A;  2QJK C;  1NOH A;  2P22 C;  1ZP0 C;  1UI7 A;  1F1S A;  4PD4 E;  3RT3 C;  1IVW A;  1XDC A;  3AG4 B;  3MGN A;  1M1J C;  1UG9 A;  1DX7 A;  4JAA A;  2RN0 A;  5AW9 B;  1PPJ G;  5EC1 C;  4L74 A;  4N78 D;  3L71 H;  4LFA B;  3GW6 A;  2LKM A;  4DV2 O;  1RFY A;  2X6A A;  1DYU A;  1XOU A;  2NRG A;  3HB3 B;  1XL6 A;  1KC8 W;  2QKA A;  3HKC B;  4GCZ A;  2FML A;  2P4K A;  1VQO P;  2UXN A;  3OMN B;  3A7O A;  1YTZ T;  3X42 A;  3AE3 C;  5EYP B;  3I5C A;  3IC9 A;  1FS0 G;  4YIP A;  2FYU D;  3H1K G;  1EDL A;  3F5T A;  3EFF K;  3E8G A;  1RHZ B;  3WG7 B;  1R73 A;  4O4H A;  1XRE A;  1KYO D;  3CCS V;  4U3F D;  4LF8 B;  2K9Y A;  1AP6 A;  1HDJ A;  4GYC B;  3II6 A;  2EIN B;  1MZ9 A;  1CW5 A;  1QNM A;  3H1J D;  1ROP A;  2JKA A;  3DC5 A;  1VQ4 V;  4HYO A;  2BCC H;  1PL4 A;  2JIZ G;  5CA3 A;  1FD9 A;  1FXH A;  3R2P A;  3TNU A;  3MD0 A;  3E83 A;  2YUA A;  4I4T A;  1P49 A;  1F9G A;  3Q1M A;  2EAD A;  3MIW A;  5E1A C;  4J9Y B;  4L87 A;  2ZJS E;  1KU9 A;  5H9C A;  4BWA A;  2ZQM A;  1N4C A;  2IFM A;  4K3A A;  1NTK D;  2UXX A;  2R72 A;  1W7C A;  4FNQ A;  3JAS B;  1DEB A;  4JI4 B;  1TUE B;  2D2C B;  5KAI E;  4GIF A;  2P06 A;  1KIL E;  1NT2 B;  3U59 A;  4BW5 A;  1PV0 A;  1YTF B;  3OBA A;  3IGA C;  4H13 B;  3NJV A;  2A45 H;  3CC4 P;  1W0J G;  1NTM J;  2O1J A;  1K33 A;  4UVB A;  3KII A;  5LOV B;  1LTJ B;  1YTZ I;  2ETN A;  1IFD A;  4MW8 A;  1KB9 E;  5CMZ A;  3MUY 1;  5B1A B;  2CH7 A;  3MI6 A;  4LF9 O;  4RAI A;  2YEV B;  3KZI E;  3AE1 C;  2CK3 H;  3CD6 V;  4IIJ A;  2KKW A;  4GOE A;  3W7W A;  4PV1 C;  1EXI A;  5BMV A;  3MZW B;  1K4D C;  4DZO A;  3LDE A;  2C10 A;  2UUA O;  1IBL B;  1L7J A;  2YIB A;  1E5W A;  5EK0 A;  2DE0 X;  2K9J B;  2CQS A;  3BCC J;  5LMN B;  1ZW0 A;  1NSM A;  3HKE A;  1GZL A;  5JJE B;  1LTT C;  3RYI B;  5KAF H;  3D6Y A;  4XFJ A;  4PI2 A;  2O01 H;  2WPR A;  3MPH A;  1GN2 A;  2DYS C;  3D8C A;  1R6N A;  3L73 E;  3L72 E;  2LO1 A;  3J7A U;  3T2M A;  1G4Y B;  2JWA A;  2KNC A;  2ALW A;  2O01 J;  3BVW A;  1Q81 W;  3VQY A;  1JOY A;  3CX5 I;  2YIA A;  2R9A A;  1SES A;  2Q7G A;  3OFN G;  3L4F A;  1EN4 A;  2AZ2 A;  1Q82 Q;  4JI3 O;  5CJ0 A;  3USS A;  1SQB D;  3SYC A;  1N8R Q;  4U3F H;  2K3R A;  3KYQ A;  4X1I A;  5EFW B;  3K03 A;  2KG7 A;  2QEX V;  3P3N A;  2LP7 A;  4L76 A;  5L3B A;  2HFE C;  2ILM A;  5KAF Z;  2N1T C;  2RKL A;  5LXT B;  4D6T E;  4FPP A;  2P90 A;  4GOF A;  3H1K D;  1XUQ A;  3HTK B;  2QE7 H;  5LGU A;  1EM1 A;  1K3E A;  1I94 O;  4HYT B;  2WAM A;  3MP7 B;  2OQQ A;  1FE6 A;  3TGU H;  4FM0 A;  2IU0 A;  1XHZ A;  5JMD A;  1JCH A;  4CH6 A;  2LW1 A;  4DW0 A;  2OQE A;  1E79 G;  2ITC C;  2HG5 D;  3ZRX A;  1V55 C;  1N36 O;  3X2Q C;  3ABM C;  2A0L A;  2J5U A;  1HN1 A;  3K0G A;  1XHX A;  4BRY B;  1NS1 A;  3R66 A;  2EBO A;  3G4S P;  3A2A A;  1SQV D;  1DF4 A;  1IXB A;  3CRQ A;  4BTY A;  3IF4 A;  3X2Q B;  3VD3 A;  1MKM A;  2UU9 O;  1M93 A;  3RYF B;  4PD4 D;  4K0K O;  5B66 E;  3A5T A;  3E89 A;  4BIU A;  4DR4 B;  4D6T G;  3HI7 A;  5LMU O;  3RGU A;  2QJK B;  4H44 B;  3P7K A;  1X1H A;  1J0N A;  1JMB A;  1LTS C;  1SER A;  5LOV A;  1LTJ A;  5B5E Z;  1NSX A;  2ZQ0 A;  3A0H E;  1M1J B;  1MMX A;  1OCO C;  1CI6 B;  3C90 A;  2QJ1 A;  2BSK A;  3CCM V;  4DT0 A;  1F4H A;  2E75 C;  1ZSP A;  1AJN A;  3SSU A;  5CCG A;  2RMZ A;  1NSV A;  2EAC A;  4X20 A;  2WZ7 A;  4JZG A;  4B7K A;  1VQN V;  4LNU B;  2JK5 C;  3CMA V;  4G28 B;  4B3T O;  2OYI B;  3W7T A;  3ZMU A;  2OOV C;  2E2T A;  3RVZ A;  2Y69 C;  1GM8 A;  1GN6 A;  1NJI W;  4DK1 A;  4IGG A;  1QHT A;  4DK0 A;  3BEH A;  1GL2 A;  5IYB O;  2KSE A;  3OM3 B;  3V4W A;  3PLN A;  4WCE V;  2WSF J;  3AG7 A;  3OEE G;  4GZR B;  3RK3 D;  4DYL A;  3VN0 A;  4WBN B;  1S1C X;  3GWK C;  2BEQ D;  2KK7 A;  5H2F Z;  3RW0 A;  3H25 A;  3WFV A;  3CWB D;  5AVV B;  3CX5 F;  3FWL A;  5K1P A;  5IE9 A;  3AK1 A;  1VPC A;  2Y9Z A;  5CB4 B;  2QJP B;  2X03 A;  1K4C C;  2Y9Y A;  2G3A A;  1EC5 A;  1VL2 A;  1U97 A;  4LF4 B;  2VQE B;  3RL0 g;  2R3S A;  1R8E A;  1LF6 A;  4BZF A;  3RN4 A;  1F51 A;  3ZMZ A;  1B06 A;  4O4J A;  1ARO P;  1TUB A;  2X7R B;  3D36 C;  3ZRW A;  4GLX A;  1V54 C;  1BSN A;  4FNS A;  2R70 A;  3H1L D;  3A2F A;  3DX0 A;  2AXC A;  4NEI A;  4JYC A;  1EZV D;  4FLU A;  2O1K A;  4H44 C;  2YKQ A;  2VRZ A;  1JA8 A;  2BTO A;  1IVV A;  1Y74 B;  5FNV B;  2PYJ A;  2JJL A;  4FM2 A;  1MFT A;  3VMA A;  3AE5 C;  4JAU A;  3P8C D;  2HTB A;  4ZBM A;  1AVO A;  1LUW A;  1HMW A;  2OW6 A;  1DP0 A;  1WMK A;  1RE4 A;  1LTB C;  3DX2 A;  1GM9 A;  1WLE A;  3ECQ A;  4X1K A;  1L0N G;  1MA1 A;  2Q68 A;  4P9P A;  4DV0 B;  2Q7C A;  4HBN A;  2E74 C;  2HOD B;  2FXP A;  4FK5 C;  1NU1 G;  3NMD A;  4HH2 A;  3FXD A;  4IL6 E;  2YEV A;  3H1H H;  3KZI Z;  5BR8 B;  1SQX H;  4B3R O;  1KIL B;  4H13 C;  1HN0 A;  2QM7 A;  1OJM A;  2KB7 P;  1SPU A;  5LHI A;  1IJD B;  2XN1 A;  2XUM A;  4BIZ A;  1OJN A;  4JV5 O;  4BRY A;  3SYP A;  4JF7 A;  2OAR A;  3JAW B;  3X40 A;  1L4A C;  1QCE A;  5CBN A;  3OAA G;  3TF5 A;  3HE4 A;  2BCC G;  3AK3 A;  1IFJ A;  1H8A A;  3X3Y A;  1LF9 A;  2RJZ A;  3I56 V;  2OCH A;  2V1D A;  3L72 D;  2JJ2 G;  5BZB A;  1JR9 A;  1K7D A;  5AW8 B;  3AEI A;  3BVO A;  2IYO A;  2UUB B;  1MOF A;  1SQV E;  2K1E A;  4PDR A;  1OXZ A;  4UCR A;  3CI9 A;  3ABK B;  1SA0 B;  1JUN A;  3D4Z A;  1QAK A;  4B3T B;  4YXD C;  1Y8A A;  3AEA C;  4FFB A;  5KMG A;  1NR7 A;  1SS3 A;  2IW5 A;  5IJ0 A;  5KHG A;  3OA7 A;  2BRP A;  4BAY A;  3M7M X;  1RM1 B;  3LOY A;  3ZHR A;  2ZFC A;  3D36 A;  3FD9 A;  3QG0 A;  4D7T A;  4KFM A;  3L71 J;  2A45 G;  1T8Z A;  1SZT A;  3H9V A;  5LXT A;  3G3Z A;  1WMN A;  3DXR A;  1RM1 C;  3BAS A;  2XOK G;  3BFR A;  2W83 C;  1KC8 Q;  2CQT A;  1EDK A;  3ZHV A;  1NAF A;  1M56 C;  2HR3 A;  3ZHQ A;  1VAR A;  4PEL A;  2G8Y A;  4W4K A;  2UXB B;  2Y0C A;  1F4N A;  4FLV A;  1AI4 A;  1SQX K;  1F4M A;  4DUX A;  2IH1 C;  1GL2 D;  1GL2 C;  2N05 A;  3FB5 C;  1EDJ A;  4TQD A;  3FFQ A;  3HKD A;  5AW1 B;  2EX3 A;  3B5N D;  2N9Y B;  1M56 D;  4JI0 O;  5FL7 G;  1NTK J;  1IK7 A;  2PGG A;  1Y47 A;  4I6M C;  5AVU B;  1MMZ A;  3V5B A;  2FXO A;  2BCC J;  3P8M C;  4DCK A;  2JGD B;  3S1K A;  1S4X A;  3D3Q A;  3K04 A;  4JF3 A;  3LDC A;  2QGN A;  1MG1 A;  2OYQ A;  1VQO V;  4KL1 A;  4CS2 A;  2CGO A;  4CZZ A;  5DM6 V;  3OTO B;  3BS6 A;  1K97 A;  3QFY A;  2FBW C;  1Y9B A;  5CBF A;  2EIK C;  3KPE A;  1USD A;  4YJ3 A;  4LF5 B;  4TT3 H;  1OW7 A;  4UVC A;  1XTC C;  2ZXQ A;  5LA6 A;  3ABM B;  3OW2 O;  3G71 V;  1KYO F;  1GD2 E;  1IUR A;  1JZ5 A;  2Y48 A;  3JCU Z;  1LNQ A;  1J2J B;  4WFF A;  2M0B A;  4JI8 B;  3NXS A;  4UB6 H;  3OW2 U;  2JEU A;  2D3O W;  2RQ6 A;  1DH3 A;  3K5O A;  1DTO A;  2ITA A;  1R33 A;  3A0B Z;  3HKB A;  1Q8I A;  1YQ2 A;  1NWQ A;  3VP9 A;  1L4A D;  2YFO A;  1KYO H;  3G80 A;  4UVA A;  1SQV K;  1H2M A;  1D2D A;  4PV1 B;  1RPO A;  1N7N A;  1NTZ E;  5JH7 B;  1JZ7 A;  1A02 J;  1OVR A;  4BXL A;  4I1L A;  3L36 A;  1G1I A;  4DR7 O;  4MMI A;  3CCQ V;  2OTL V;  1L0N K;  2CFW A;  4GT1 A;  1KQG B;  3HE4 B;  1JYW A;  3WA3 A;  1JYV A;  4E4E A;  1GRJ A;  2XNX A;  5C93 A;  3CB2 A;  4UFZ A;  2WSS G;  1MSD A;  1Q5O A;  3A0H H;  3I3B A;  4OVN F;  3CZS A;  1VF6 A;  4IOI H;  1N0N A;  1BGY J;  3OAK A;  1RWH A;  1YIT P;  3MAQ A;  1SZX A;  2EIM C;  2AXT H;  3F5H A;  4GKJ O;  2A06 G;  3VQX A;  1BGY H;  1IU7 A;  2ZXW C;  1KB9 H;  2CG1 A;  3RK3 B;  2DN9 A;  4H44 D;  4O4J B;  3G9R A;  3IAQ A;  1TUB B;  1N36 B;  1R3I C;  1SQB E;  1W5Z A;  3ZRW B;  3HUS B;  2HJD A;  1LXK A;  4NXN B;  2CTQ A;  1N7L A;  1WMP A;  2E42 A;  3D70 A;  4DV6 O;  2KOG A;  2HHH O;  3PH0 A;  4BR6 A;  3DXR B;  3EJP A;  4E2L A;  1T3U A;  1GW4 A;  2A3Q A;  1Y74 A;  5FNV A;  3ZED A;  1WT6 A;  5KHH A;  2WVX A;  2QDO A;  3BVX A;  1LWU A;  5E79 Z;  1HR0 B;  3F7Y C;  1FJG O;  4Q20 A;  2KXP B;  3SJC C;  5KLI C;  3I55 P;  1CXZ B;  4X1K B;  2IM9 A;  2MW2 B;  4RJT A;  2WLH A;  3Q5S A;  1P7G A;  1JZ4 A;  1ZTE A;  1KP3 A;  2DWE C;  2WPV B;  3KQG A;  3LDD A;  1VQ8 V;  2IBZ E;  5EIB D;  1K34 A;  3C3T A;  1MN0 A;  4I50 A;  2B89 A;  5KAF E;  3QDE A;  3DX3 A;  2EIL B;  4W80 A;  3DEC A;  2QEX P;  1OVV A;  3CXH F;  1BCC G;  3WB1 A;  2CTW A;  4I7Z B;  3AE6 C;  4EDF A;  2F7P A;  4MVZ A;  4QE9 A;  2FTK A;  3OR6 C;  1BCC H;  2W6J G;  4X65 B;  3BVH A;  1PV3 A;  1BDD A;  1YHQ V;  2E75 D;  2LXB A;  4NPD A;  1X8Y A;  2V7Q G;  4HNA A;  1SQB H;  3W7S A;  4OX9 B;  2QJY C;  1W4N A;  4ZKP A;  1RJO A;  1M1K W;  3SGI A;  5LA6 B;  2Z4E A;  1X59 A;  4EV5 A;  2JWD A;  4MVR A;  2R5B A;  1AIL A;  1KQS O;  4D6T D;  2NPS B;  5CBH A;  3H1K H;  3CCL V;  1KB9 I;  1FFX A;  3N2K B;  5IJ0 B;  2UUA B;  3KHU A;  3AE4 C;  3VMY A;  3H1K J;  3MHH C;  2DJV A;  1MMY A;  1WN7 A;  3SWF A;  2R9I A;  1X1J A;  4X66 B;  1D6U A;  3L75 J;  3DGE A;  1HGZ A;  5EC2 C;  4JAS A;  1GU4 A;  5LP6 B;  1FZC A;  3BUB A;  4XE5 B;  1OZH A;  2PNC A;  2HG5 C;  3TYY A;  2YKP A;  5BY1 A;  1HWW A;  2FUT A;  4Z2W A;  1TVK A;  2GUS A;  2M5A B;  2ZE5 A;  2ZAE B;  4AQR D;  4KFF A;  5L8R J;  4DV3 B;  1RQV A;  1X79 B;  2E3C A;  1LT9 C;  3H32 B;  2BAS A;  4WFB V;  1N73 C;  1RKY A;  4G27 B;  3GHG C;  1AR5 A;  1PD3 A;  1IFN A;  1JTH A;  2WSS H;  5GTI H;  2Y0D A;  3STL C;  3BA8 A;  5EZY B;  1SO0 A;  3U1C A;  1WA8 B;  1W59 A;  3ML0 A;  3GLM A;  4I7Z C;  3V4Q A;  2JEE A;  3D71 A;  2KIK A;  1UPG A;  4UB6 E;  1T3J A;  1OCC C;  3L70 E;  1JMK C;  1URF A;  2VS0 A;  1RY3 A;  1NVO A;  2N1T D;  4NR1 A;  2HFE D;  3D52 A;  4MVO A;  5E79 H;  1S5L E;  1K73 Q;  2FYU K;  1PP9 G;  2PRR A;  1ZOY C;  1D5A A;  1KN7 A;  4MVQ A;  2IDB A;  4I9Q A;  3T0B A;  4NYK A;  4WY4 A;  5AVZ B;  5LYJ B;  1H88 A;  1OJP A;  2GV9 A;  1VF6 C;  4HZ3 A;  2IBZ I;  1J0M A;  1Q82 W;  2WSE J;  2E24 A;  1HTL C;  4HB1 A;  1BE3 H;  1FYJ A;  1LTA C;  1N8R W;  4JPZ B;  5KTB A;  5JCO C;  1R3J C;  3CX5 E;  4DV6 B;  3SR2 C;  1WRG A;  4H0L B;  1YDX A;  5TIS Z;  4LR3 A;  2PZS A;  2D73 A;  1YTF D;  1M5I A;  3BAT A;  1BMF G;  4RWU A;  4TOI A;  4NXN O;  1J5E B;  3EJQ A;  1NU1 K;  5AW7 B;  1BT8 A;  5J2T B;  2VWK A;  1XMO O;  1HUC A;  5KA6 A;  2FKW B;  2E76 B;  3CJH A;  1LTI C;  3P8C E;  5A1A A;  2W90 A;  3OTF A;  1KSI A;  1PM9 A;  3OS7 A;  4YPC A;  1R5L A;  1WMO A;  4LP8 A;  1AR1 B;  1YQ3 C;  2WSC H;  2H43 A;  3AE2 C;  3G67 A;  1JY3 O;  2L5G B;  4DW1 A;  2WW2 A;  5TIS H;  4PDV A;  1LP1 A;  1R1B A;  1TU5 A;  2E74 B;  1LT1 A;  1ZN5 A;  3VMX A;  4JPR A;  4DR7 B;  3ZN0 A;  2NPS A;  5GTH H;  4X65 O;  3JSL A;  2HTA A;  1Y66 A;  5GTH E;  3AG2 B;  1TQS A;  1K5S A;  1PKX A;  1Z2G A;  2Q0O C;  2GUV A;  2L91 A;  3CLQ A;  4ASV A;  5TJH A;  2Q5U A;  2HJF C;  1ZL8 B;  1DK1 A;  2E43 A;  4J7K A;  4LC1 A;  4PJ0 Z;  1OW8 A;  2F7R A;  2M3B A;  4DUW A;  4KXR A;  1SKV A;  1NKN A;  4Z1M H;  3I5D A;  1Z56 A;  5CN0 A;  2EAE A;  2FYN B;  2K37 A;  1OCZ B;  1JFF B;  2O01 N;  2W27 A;  5KHI A;  2LR2 A;  3B5N A;  1M8O B;  4JI5 O;  4YXW G;  5D5Q A;  1AB3 A;  3T08 A;  3EFG A;  2PI5 A;  4OK2 A;  2PAJ A;  1FJG B;  3AK2 A;  1OX3 A;  2ZCE A;  3JAL B;  2IJJ A;  3WUV A;  2JEX A;  1HNW O;  3CL3 D;  3K0D A;  3CC7 V;  4B3M B;  1NTZ G;  4MN4 C;  2FKX A;  1NTM K;  3UT5 B;  1NSR A;  2UXC B;  2IBZ H;  4MS2 A;  1JZ8 A;  1IVU A;  1YIJ V;  1GTW A;  1AV4 A;  2ZIN A;  2XN0 A;  1URQ A;  3AEG C;  2VRS A;  3E8F A;  2WLI A;  5CMU A;  1HXK A;  1GTO A;  2EIL C;  4JI2 O;  5APS A;  2RDC A;  5L3C A;  4UCV A;  3C9I A;  1JCC A;  4JI0 B;  1Y76 B;  4GKJ B;  2WVR A;  2GTS A;  3IMH A;  2NR5 A;  2ZE8 A;  4RNL A;  2RCV A;  2DYR C;  1GW3 A;  1N7P A;  1Q90 D;  1PPJ H;  2EIK B;  3FWN A;  1NTK K;  1FJP A;  1MV8 A;  4I9W A;  2V7Q H;  1JY2 O;  4GOD A;  2C0W A;  1E79 H;  3Q4H B;  3K5T A;  1JPX A;  2Q73 A;  2AXT Z;  1SIH A;  3ABT A;  2C9L Y;  1DGS A;  1OMI A;  1SP4 A;  4QE7 A;  2NPS C;  3TJT A;  2F95 B;  1NTZ K;  4PD4 I;  1MMU A;  1PU4 A;  4MSW C;  2AXT E;  3APQ A;  1ZRT E;  5KLV J;  2QWR B;  3I3D A;  2XN2 A;  4JI6 O;  2A45 I;  1AQ5 A;  1VQ7 V;  1YI2 V;  5H2F H;  2F7Q A;  3MV0 1;  3RBZ A;  5KLV H;  3QO8 A;  3LIE A;  3H1H G;  1AI7 A;  1IZN B;  2YO2 A;  3OD4 A;  3L73 G;  4J10 A;  1N2D C;  1KUQ A;  1XTG B;  2POH A;  1VQN P;  3OT7 A;  1KBH A;  2OOV A;  3CWB H;  1NJI Q;  3JAS A;  1TVK B;  2M5A A;  1C82 A;  4R7C A;  2RDY A;  1ZWI C;  3WFA A;  1SQG A;  1GMJ A;  4UV8 A;  3BGA A;  1IDS A;  4QMA A;  1SQV J;  4O4L B;  4FZ1 A;  2PFX A;  3A0B H;  3H1L J;  1JY2 P;  3I55 V;  3RYC B;  3RWR D;  4FLW A;  5JJN B;  3ZMV A;  1GMG A;  3L72 J;  3H1L H;  5APV A;  1RF1 C;  2E5L B;  2JR8 A;  3THO A;  4AQY B;  5EBM C;  2CH7 B;  1HM2 A;  4B3S O;  3BCC G;  4JI1 O;  3UKM A;  5C8Y B;  1Y67 A;  1V9P A;  5KJ7 A;  5AVW B;  1SQQ G;  2NPS D;  2F93 B;  2EIN C;  3WG7 C;  2M3E A;  3VP8 A;  1IQX A;  1N32 O;  5LBQ A;  3M99 B;  3TCU A;  1D7M A;  4X9Q A;  4YY3 O;  4DO2 A;  3AG1 B;  1WP8 A;  2ZM6 O;  1J1D B;  1SLQ A;  4NTY A;  5FLX N;  1BDC A;  1NKZ B;  4U7N A;  1RE3 A;  1FPO A;  3HKE B;  2FYU J;  3E1I A;  3DX4 A;  4AQ0 A;  5GTH Z;  3Q5P A;  1KQF B;  2XAS A;  2EIM B;  1YIT V;  2FB5 A;  5IJ9 A;  1TU3 F;  1Q6U A;  5APQ A;  1MUU A;  1WPB A;  5GTI E;  2NN4 A;  1PPJ D;  2VWJ A;  2B9B A;  4FLY A;  1MFZ A;  4LLH A;  1HM3 A;  2BCC E;  4GUN A;  1N32 B;  4CBC A;  4MVS A;  4DXW A;  1HNX O;  3L70 J;  3VDB A;  3T09 A;  1P84 E;  3LNM B;  5J2T A;  2QSA A;  4DV1 B;  3E22 A;  3WVF A;  4GKK O;  3ETG A;  1CP9 A;  2IPP A;  2KG7 B;  1QVF O;  1BGY D;  1BHB A;  2IZ0 A;  5CCH A;  5KX5 B;  1NS0 A;  2RH0 A;  1JYN A;  1LUR A;  3JAT A;  3S9O A;  1KIL D;  3IN6 A;  1CZQ A;  2W8Z A;  4ZHQ B;  3L74 J;  4QPK A;  2XND G;  4LF7 B;  5FPO A;  4EOT A;  1LP1 B;  1D5N A;  3Q4H A;  3AFJ A;  5B66 Z;  3DX1 A;  2FYV A;  1EQ7 A;  2V4D A;  1RWC A;  4UV9 A;  2E76 D;  4DOJ A;  4DV5 O;  2XDJ A;  4DUZ O;  4GDO A;  1B6Q A;  4LFB B;  3JCU H;  2K9P A;  4FM1 A;  5APW A;  4IHJ A;  1Q7Y Q;  3E7J A;  1HW7 A;  1G1J A;  1ZL8 A;  4AI8 A;  3T4Z A;  1NTZ J;  4ZKU A;  2DYS B;  4DV1 O;  4FVM A;  2O3J A;  4HKZ H;  4YHH O;  1SQB K;  2OCC B;  4GX1 A;  2XU6 A;  2WLJ A;  2WCO A;  1JFF A;  1IBK O;  3W7U A;  1V54 B;  2H3O A;  1BCC E;  1S5L Z;  2ADQ B;  2JVD A;  2WLL A;  4MT8 A;  3TGU G;  1S9K E;  4PA7 A;  5LGN A;  2WYH A;  3UQ8 A;  4GX0 A;  1X22 A;  2JP3 A;  1YJN V;  3JD3 A;  2IX7 C;  3V2P A;  3ABV C;  1N73 B;  3SX1 A;  5KHK A;  5KJ7 D;  4JZ2 A;  4O4L A;  4K0K B;  1NTZ D;  4UCU A;  3RYC A;  3H1L E;  3RGB A;  4YY3 B;  2A06 H;  4RO0 A;  1TXK A;  4CS3 A;  3CXC U;  1JOC A;  3E1R A;  4OWF A;  3CCV V;  3TSI A;  1QL1 A;  1OJO A;  4WBA A;  4TUY A;  5AG2 A;  2Z5I A;  3GMA A;  1JJO A;  3FB6 C;  2OT5 A;  3DC6 A;  1N33 B;  3IAO A;  3RRS A;  1FXK B;  3TXS A;  3H1L G;  1YEW A;  1PIX A;  5APY A; 
#chains in the Genus database with same CATH homology
 2KZI A;  2ALW A;  2P58 A;  1LT1 A;  4NPF X;  3BVW A;  2UWJ E;  3BUD A;  3LVT A;  2JWD A;  1U7M A;  1TQV A;  3BVV A;  2B87 A;  2OTK E;  1TQS A;  3D4Y A;  1R34 A;  4HJG H;  4ASV A;  3DX0 A;  1H0T A;  2K3R A;  3BUP A;  5KBP A;  3D50 A;  5EFW B;  1OVU A;  5CBO A;  2F7R A;  5C39 A;  1BDC A;  1HTY A;  2M0B A;  2RKL A;  2I8D A;  4EYY Q;  4ZMD A;  1MFT A;  2LR2 A;  3CV5 A;  3DX4 A;  4GOF A;  2OW6 A;  1R33 A;  3BUI A;  3DX2 A;  4K35 A;  1X0T A;  3BUB A;  3DDF A;  1TQW A;  3FXD A;  1HWW A;  5K5G B;  4MN4 C;  1EDL A;  2ZAE B;  2KZJ A;  1FC2 C;  2M5A B;  2B87 B;  1O7D D;  1OVR A;  4BXL A;  1QWN A;  1QX1 A;  2F1B A;  2KUB A;  1EDI A;  3QWO C;  5DJU B;  2QVA A;  1HXK A;  3MHV A;  4NPE A;  1QWU A;  2KI7 B;  1TQU A;  4KJM A;  5CBN A;  2F7O A;  2WYI A;  1PS3 A;  3BVU A;  3CZS A;  2KIK A;  4IOI H;  4ZNC A;  2KS1 B;  3EJT A;  1NVO A;  3ZDM A;  3EJS A;  1LP1 B;  3D52 A;  3DX1 A;  2FYV A;  4K3A A;  1TQT A;  4GOD A;  3RGU A;  3D4Z A;  2R44 A;  1JMB A;  1H0T B;  1JM0 A;  3PH0 A;  4HKZ H;  3EJP A;  3EJU A;  2F18 A;  3BUQ A;  4HB1 A;  1ZXG A;  3BVX A;  2F7Q A;  3BVT A;  1EDK A;  4JBZ A;  2HR3 A;  2SPZ A;  2WYH A;  3EJQ A;  2B88 A;  4GOE A;  2WMM A;  2M5A A;  1Q2N A;  3MZW B;  3BLB A;  3D51 A;  4ASW A;  1EDJ A;  4CPG A;  2LXC B;  2B89 A;  3DX3 A;  3DDG A;  4WWI A;  1OVV A;  2F7P A;  1ZW0 A;  1Y47 A;  3EJR A;  2F1A A;  2Q1K A;  1SS1 A;  5DJT B;  1U7J A;  1BDD A;  2QRX A;  1S3J A;  3S1K A;  2LXB A;  4NPD A;  1EC5 A;  2OW7 A;  3CZN A;  1DEE G;  1LP1 A;  3FXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...