4K35A

The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
719
structure length
719
Chain Sequence
DDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEAPLLTYAYAHHLTSIDDSNVKRTDMTLQSATKGPMTALVGNEWTLRETELSPVEWLPLQAAPNPTTINEIMTEINKDIASNYTQETAKEDNYFSGKGLQKFAMLALILNKSDQTQLRNPELAQIALDKLKAAFLPYLQNEQADPFRYDTLYKGIVAKAGLPTSMGGTDDLSAEFGHSYYSDHHYHQGYFVVTAAIIHHLDPTWNADRLKAWTEALIRDVNNANDGDEYFAAFRNWDWFAGHSWAGGIKPDGALDGRDQESVPESVNFYWGAKLWGLATGNTPLTKLASLQLAVTKRTTYEYFWMLDGNKNRPENIVRNKVIGIYFEQKTDYTTYFGRFLEYIHGIQQLPMTPELMEYIRTPEFVSQEWDEKLGAIAPTVQSPWAGVLYLNYAIINPAEAYPALRKVQMDDGQTRSYSLYLTATRPHFFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
pubmed doi rcsb
source organism Rhizomucor miehei
molecule tags Hydrolase
molecule keywords glycoside hydrolase family 81 endo-beta-1,3-glucanase
total genus 246
structure length 719
sequence length 719
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain
A PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1170 Mainly Alpha Orthogonal Bundle Helix Hairpins glycoside hydrolase family 81 endo-[beta] glucanase 4k35A03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4k35A04
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 4k35A02
2LXBA 2F1BA 3RGUA 3BLBA 1H0TA 4GOEA 4EYYQ 2LR2A 1TQWA 2LXCB 5K5GB 3BUDA 1BDDA 4MN4C 1QWNA 3DX2A 1TQVA 3BVXA 2OTKE 2F7QA 2UWJE 2KIKA 2ZAEB 2Q1KA 4K3AA 1R33A 3CV5A 1X0TA 5CBNA 3BVVA 5C39A 1H0TB 2M5AB 1OVUA 2P58A 3LVTA 2KI7B 1LT1A 2KZJA 2WYHA 3D52A 1LP1A 5DJTB 2JWDA 4ZNCA 2I8DA 2M5AA 3FXDA 1TQUA 2B88A 4IOIH 1MFTA 2KS1B 3EJUA 1Q2NA 3BVWA 5CBOA 1ZXGA 3DX4A 4ASVA 1OVRA 4GOFA 3DDFA 1U7MA 3ZDMA 3DX0A 1EDKA 1SS1A 2R44A 1LP1B 3EJQA 1ZW0A 2ALWA 3DDGA 2M0BA 2F18A 3PH0A 3BUQA 1QX1A 2F7RA 2B87A 5DJUB 2FYVA 1EC5A 4BXLA 3BVUA 1BDCA 1O7DD 1EDJA 3DX1A 3QWOC 2KUBA 1DEEG 5KBPA 2SPZA 4ZMDA 1TQSA 2HR3A 1EDIA 1R34A 1Y47A 1OVVA 3MZWB 4KJMA 2F1AA 3BUPA 1TQTA 4NPFX 3CZNA 3EJRA 4JBZA 2OW7A 3EJSA 2WYIA 2K3RA 4HB1A 3EJTA 3DX3A 4WWIA 1U7JA 4K35A 1QWUA 1JMBA 2KZIA 3EJPA 2QRXA 4HKZH 3BVTA 1FC2C 2RKLA 2QVAA 3D4ZA 1HWWA 3BUBA 4ASWA 1HTYA 4NPEA 1PS3A 2F7OA 5EFWB 2B87B 3BUIA 4NPDA 2B89A 4GODA 2OW6A 4HJGH 1NVOA 3FXEA 1EDLA 1S3JA 2WMMA 3D50A 3D4YA 3CZSA 4CPGA 1HXKA 3D51A 3MHVA 2F7PA 1JM0A 3S1KA
chains in the Genus database with same CATH superfamily
2BSKB 2UXXA 1JYVA 3SWFA 2EINB 1NTZH 1QNMA 1WA8A 3SSUA 1PM9A 1H0TA 4FPPA 2IYOA 1YGAA 2FUQA 4XDLA 5K5GB 4UB6H 3ABUA 4WFGA 2UU9B 1HVVA 4J7KA 3CCMP 1FXKB 3IJ4A 3K5NA 1VQ5V 4LFBB 4FNSA 2WLJA 3BCCH 1SQPG 1SP4A 1JZ3A 5KAFZ 2LKMA 3SGIA 4I50A 2EACA 3B4SA 3IFMA 3FB7C 1VQ4V 5KTBA 1KB9I 4I1LA 4X9QA 4JYYA 4UB6E 2HFED 1ZSPA 4PA3A 1VEWA 3BHPA 1WPBA 4YJ3B 2B5UA 1YTFB 1Z56A 1L4AD 4PHZA 3HTKA 4J80A 1PV3A 4MS2A 2QG4A 2EABA 3MI6A 3DX0A 3RYHB 1K05A 1OW7A 2DQ0A 1URQD 2JEEA 1SQPJ 1M56D 2EIMC 3G3ZA 3C3TA 4NEIA 1TGOA 3L73J 1VPCA 1NHLA 2P4VA 3L73H 5LHHA 4I7ZB 3H9VA 4PI2A 2O1JA 3CXHF 3VQYA 4Z2WA 2OIEA 1EC5A 3JD3A 1V55C 3K9AA 3H1JD 4C7NA 1EDJA 2E42A 4MW3A 5FPOA 1LT9C 3C1LA 3V6IA 1RF1B 3WU2E 5KMGA 1NS8A 4FZ0A 4IHJA 4D6TD 3CX5E 3L74H 4KXRA 3ZHUA 3T2MA 4J7JA 3H1JJ 4Y99B 3CZNA 3IAQA 3G67A 2EIKB 2GSMB 5CCGD 2Z3YA 1NSXA 4BZGA 4JI3O 1N33O 4K35A 2DWDC 5J2TA 3BCCJ 2WZ7A 2LW1A 4D6TJ 4DUZO 1QR8A 3DYOA 5TISH 1NT2B 3OGCC 1EKMA 2HEPA 2G3AA 1O9HA 2YIAA 1NAYA 2JEUA 2WDAA 2M8RA 4PA4A 4WB4A 2A45G 2OTLP 2H7HA 1GRJA 3WB1A 4XA4A 1F4HA 2F4VO 3NREA 1H2SB 3RK3B 1FXVA 5KHGA 2QIWA 1EDLA 2W0XA 4BTXA 1V55B 3DTUB 3MHHC 4FFBA 1J0NA 3L70J 1RP3B 1VQLV 2ITAA 2AHZA 1SQQK 1JUNA 3GG2A 4I7ZC 1BSNA 2XZRA 1M9NA 5CMZA 1HJBA 1N34B 3A7OA 3JD1A 3EQ2A 4O4LA 1IFNA 1P84H 3K5TA 4JTDB 4J11A 1BCCH 2F4VB 3P8CE 1AVOA 4OPAA 4MMIA 2H88C 1GN4A 1Y76B 2V1DA 3A0HH 3SYPA 1PGPA 4DK0A 2YSUB 3A0RA 3OW2O 3MUZ1 1N36O 3U10A 2QJPC 1TQVA 2ZKOA 2E74D 1H2MA 2QE7G 2KKWA 1L0LH 4FIPC 4XDJA 2OYHC 2Y73A 4RUEA 3OR7C 2IJHA 4F4LA 4B3SB 1HM2A 3AG2C 5JVDA 2AGAA 3WFAA 4DUVA 4ZHQA 3WUTA 4MVSA 2LP7A 4LBEC 1H0TB 4WBNA 3S3XA 5J2UB 3WB2A 2O01N 2FB5A 4BTWA 2WQYC 1NTMK 1H88A 2E75C 2O01J 3USSA 2A06D 5E1AC 1NAFA 3S4BA 3CWBG 1GU5A 3C3SA 1EZVD 3QH9A 4IGGA 2ZFCA 3BVOA 4DV5B 1Q6IA 4MVRA 3RL0B 1RPOA 3BRVB 5K1XA 2RDYA 2FYUD 2IYPA 1Y8AA 1GZLA 5KX5B 5AG2A 3P3PA 3T1HB 3LNNA 3UIAA 1F4AA 3L70E 5FNVB 1OJPA 3RK3D 2ZL8A 2YO2A 3OR6C 4EFBA 2YIDA 3QG5A 2FYUH 1AVLA 3ZRVA 3O8ZA 1HH0A 2A06G 4W7YA 2J5UA 5KAIE 1IFJA 1EZVH 1KMIZ 1MMUA 1SQGA 3FAVB 3LIDA 3ZRXA 2F23A 5L3EA 3PLNA 3KZIZ 1EDIA 1R34A 3ECQA 1NJIW 3CCQV 1BGYH 1WB7A 3F5HA 2W0FC 1ZTEA 1UIXA 3L72D 1LTJA 2ZXXA 4H37A 3JC22 1SQBJ 1KFNA 5GTIH 4FNTA 1K1WA 3OEHG 1OFCX 2K3RA 2WYIA 3EJTA 3VD7A 1XUQA 2E43A 1F23A 2LO1A 5IDJA 2FXPA 3F89A 1NI8A 2HP8A 1IC2A 3HD7C 1DP0A 2E5YA 3ETQA 4HNAB 3A0OA 1X79B 3EFFK 3IC9A 1MABG 1VQ6V 4X88A 3OAAG 3SX1A 4LNUA 4UV8A 4LGDE 3BRCA 1IVWA 3K03A 1SQVH 1OJHA 1L0LE 4R8CA 5C93A 4NPDA 1P84D 2YIUB 2UU9O 4PDRA 1S3JA 1VQMP 3WIQA 4HH2A 2Z5IA 2Q9IA 4A7PA 2L91A 3RL0D 3D4YA 2ITDC 2P90A 4DCKA 1IFDA 3ABMB 1QL1A 2RJZA 4LLHA 1M56C 1YHQV 3S1KA 1RE4A 1RF0A 2C0XA 1QGKB 4IYHA 5LA6A 4LF6O 1U57A 4H0LD 1OCZB 2WVXB 3PJSK 1YITV 4JAAA 2XN2A 2WPSA 3GW6A 2ODMA 2ZM6O 1JY3P 1OV9A 3AEEC 1DYUA 4JZ2A 4EV5A 5JJNB 5H6RA 3L71D 3VYIA 1HN1A 2NR5A 1LNQA 3AK1A 4DO2A 1Q86Q 1AROP 3OMAB 1UIIA 1Y76A 1G8MA 3LSSA 4D6TH 1FDOA 1Q3EA 3MDSA 1URQA 1X9VA 3BASA 3B5NB 4DW0A 4PJ0E 4IFDK 2IJIA 5CA0B 2I8DA 1UFIA 2JJLA 5B5EZ 4IIJA 4IOIH 4YXDC 1XDCA 3LUTB 3RYFB 3G71P 1M93A 3P3NA 2X0LA 3ETEA 1ZR4A 2QM4A 1FE6A 1GH6A 4O4JA 4EI2A 3Q5SA 3E8BA 4GX2A 4U3FH 3CB2A 2E5LB 1DD3A 1GN2A 5LL6Y 3MHSC 2QJKB 4LF9B 2PYLA 3MWXA 3PHLA 1N36B 4FM0A 3VD3A 1USEA 4HZ3A 1IVVA 4YY3B 5D5QA 3CLQA 1QEXA 4DR6B 2B87A 1L0NG 4EB6B 2W6JH 1NTZD 2NLJC 1PNMA 1Y6XA 3ACTA 2C9LY 2BOBC 3CJHB 1PPJD 4WFFA 1KV4A 1NTZK 2E2VA 2XT9A 2XAFA 2IU0A 1JJOA 1ZLZA 3GF3A 1GMJA 1NU1K 2ADPA 2OIGA 1JQ0A 5CA0A 3CPWU 2BTQB 1YCIA 4PDVA 1JJ2U 5L3DA 3P8MC 3K5LA 5AVUB 1FOSE 1GL2C 1SQBG 3ETDA 3T2OA 4DRXB 2EIJB 5EC1C 2NNUA 3CWBJ 1G2CA 2AEJA 3QG0A 1HWWA 1ZR2A 3H1IH 3CD6P 1XBLA 2Q68A 2LGWA 4PA6A 1TUBB 3G6EV 2L5GB 3L75H 3KXDA 2PRRA 1VF5B 2QA4P 2B9ZA 4DR2B 2B87B 4FNVA 1J5EB 1RE3A 2O57A 2B89A 4DR7B 5LP6C 2PZSA 1NVOA 3B71A 2ZYGA 2OYHB 2XHNA 2DWEC 1KQSU 2ZNJA 1FBMA 2CFDA 4O2BB 4WFAV 4B3TB 2R3SA 1VL2A 2ZCEA 5KLVG 1M90Q 1HGVA 2PAJA 3LW5H 2ZE8A 3FX0A 3CCRP 2BASA 3NJVA 3E83A 2F7PA 2Y0IA 2OTJP 4C7UA 1UI7A 1ZP0C 3A3YB 3HUSA 3OS7A 2DE0X 2ZT9D 1RHZB 1SQBD 4U3FJ 1NS4A 4J41A 1JVMA 1X1HA 5E79Z 1SC5B 5JMDA 1GO3F 4DV2O 3MUDC 5EC2C 4H44B 1X1IA 2EILB 1A2VA 2J59M 1N7OA 1VP7A 3X42A 4X1KA 4JAVA 2A45I 1RE3C 5KLIC 2KI7B 5CHXA 4IYIA 1K33A 2UXNA 3OFNG 4LCUC 5JH7B 2ZQMA 1PP9G 3L75J 1O9GA 3CC7V 2XAGA 3VP9A 1FZCC 4AQYO 4Y28J 3SFDC 2CFLA 4KT0J 1MNGA 3E86A 5LOVB 3O6QA 1BL8A 4TUYB 4UXNA 2OYQA 5A2QN 2GV9A 3K58A 3CC7P 2WO0A 5L3GA 1JYWA 1URQB 2YC0A 1IJDB 2M0BA 4KP4A 4DR1O 4JYAB 4LR3A 1RW9A 1W6GA 5IYBO 1SQPH 1V7XA 1RM1B 2I1JA 3BVUA 4X8AA 4X66O 4X1KB 5AW8B 2KSEA 3MV11 3H1HD 5CCHD 2BT3A 2KUBA 2CGOA 3T1HO 1OJMA 2CAZC 4MTXA 4WVZA 3Q2YA 3WA3A 3J7AU 3H1IG 1NTKK 4KJMA 3AE5C 4X64O 3BUPA 3JSVC 4IL6X 4TT3H 2WW0A 1S5LX 3AMOB 1JCCA 1KP2A 2HPCB 1KKDA 2W6IG 4JBZA 4O4LB 1N7SD 4W80A 2K1EA 5AW3B 1BHAA 3RBXA 3V4QA 1H38A 3KZIH 3RVYA 4U3FG 3DYMA 3CJHA 2H8PD 4WCEV 2MKVA 4UCVA 1G1JA 2YIBA 3BVTA 3SJCC 1D6YA 2QVAA 3L71J 2EIKC 3L70D 4UVAA 1HTYA 1AVMA 4IFMA 1N9EA 1VDFA 1HNZB 5KUKA 4ZOLA 2WWWA 5J9PC 5CN0A 1HMUA 2XDJA 1NSVA 3HKBB 3ZHSA 1XEQA 3A0HE 1XREA 4QGPA 3BLCA 1FAFA 1VQ8V 3ZN0A 4TQFA 2YKPA 3MPHA 1BCCE 2VRSA 4I0XA 3N2GA 3D6ZA 4CPGA 1SQPD 3RK3E 3SYQA 3RGBA 5JCOC 3S4AA 2Y0PA 1JM0A 3X3XA 3BAAA 2OQEA 4U7NA 4W7ZA 4EKWA 2LXBA 4X89A 1XQ8A 3KPEA 1QL2A 3BLBA 3W7TA 4YPCA 2GTAA 3U1CA 1A02J 2GM4A 4DV4B 4B3MB 2AEFA 1IXBA 4BIZA 5JQGA 4TTGA 4BZEA 3SJQC 5EYPB 4WY4B 3MTUE 4YXWH 3Q4HA 3E1RA 2E2UA 2UXDB 2XN1A 2ZAEB 1SQBE 2F1MA 3CV5A 1F4NA 2PFXA 2PYJA 3H1KE 2WLHA 1HJ0A 1IQXA 1YQ3C 1AB3A 2QSIA 1N0JA 1Q86W 2N1TD 1XHXA 4I9WA 1GL2D 5IYZA 2P4KA 4R7CA 4JI0O 1XMOO 3FYIB 4CS3A 3ZS8C 5JMFA 1N34O 2BCCD 3RT3C 2Y9YA 3RK2B 3BGAA 3ITKA 3T0UA 1X4TA 1PP9J 2IBZE 1LTJB 3L75G 1RSOA 2IM9A 1L0LJ 3CC2V 3D71A 1ZXGA 5BR8B 4I50B 1YBKA 5L3CA 2WSCH 1S76D 1N32B 3L37A 2QTSA 3H1KH 4AYCA 3DDFA 2QJYB 3VP8A 4LP8A 2Y0DA 4CS4A 3AE1C 1SQBH 2NN4A 1F9GA 1V7VA 1NOHA 4OVNF 1TU5A 1BCCJ 4R50A 2K1AA 4YHHB 1GM7A 1JOVA 4LNUB 2R3CA 2V4DA 4ZI7A 2A9HA 3AG3C 1QX1A 1SQBK 2EZPA 1WMNA 1L4AA 1PIXA 2WAMA 1DIPA 1EGUA 2OARA 1DEEG 3HTKB 2Z4EA 2PNCA 1W2BO 3ZX6A 2F1AA 1L0NH 3NFQA 3K04A 1XL4A 1Q6HA 1TQTA 1K73W 3FFQA 1VQOV 2ZXWB 4UV9A 1OZHA 1EM1A 4J7ZA 5LMUB 3L75D 1AVKA 5APTA 3TGUJ 3A8TA 1L0NK 3SYOA 3DX3A 1F7YA 3H1KJ 1M1KQ 1BSHA 4JF7A 1S4XA 2WLIB 1VQPP 2XTAA 1SQQE 2HODB 4JI6O 2CK3H 5KMGB 3E22B 3I3EA 5AVVB 3H01A 4NTYA 3OMIB 4CH4A 1YI2P 1US1A 2R9RB 3ASOC 3G6BA 1PP9E 1PS3A 3H32B 2UXBO 3ZJZA 2X7RB 2C0WA 3JCUE 3N2KB 2YXLA 3LDDA 3N27A 1H2LA 2R9AA 2FY8A 2Q1FA 2R72A 4LF4B 1K04A 3O65A 1PPJH 2CTPA 2EJ7A 1CB8A 3X2QB 4JI1B 4CC5A 4DV2B 3AE8C 4ZKIA 1LF6A 1SESA 5IJ0A 1S0VA 4UB8Z 2YO3A 4H44D 1FYJA 3RFRA 2N9BA 1K1YA 1N2DC 1YSCA 3QDEA 1BGYE 4IIJB 4W4KA 1KZUB 3CX5H 3H25A 5FLXN 2KG7B 3CPWO 1GM8A 3BPZA 3SEPA 3II6A 1TVKB 1UI8A 3HE4A 2VQFO 3CRCA 1SQXE 2P2UA 2WW3A 2ZT9B 4U3FD 2FKXA 4LF4O 4PV1C 2N1TB 4MN4C 5CCHC 2FFDA 1BZKA 3K59A 3SYAA 1QVGU 4JI2B 1JY2O 3LIEA 4HYOA 3E2EA 2UXBB 2CUGA 2JS5A 2QWNB 5CA1A 1RF1A 3AFLA 4K3AA 2IX7C 3IGAC 3HE5B 2Q0AA 3RWRD 3I5CA 3SJBC 2O3JA 2F66C 1VQPV 1LUVA 2OGUA 3BRTB 3TGUE 5TISZ 1N7SC 1NTMJ 3ZEDA 4P30A 3CS5A 1LF9A 1MMZA 2ATKC 4L76A 1OW6A 1OHHG 1LJ2A 3OUFA 2A45H 1J1DB 3I55P 1RWHA 3L71H 3RW0A 1G4YB 2OOVC 2OCCB 1THZA 4FK5C 1QVFO 5CBOA 3UO2A 4AILC 1J1DC 3T2QA 4KFEA 2X6CA 1K9MQ 1JRQA 2Q7HA 3B8EB 2EAEA 4U3JA 5GTIE 1N73C 3SPJA 3AK3A 4FM1A 4I2LC 1COWG 1HP8A 3FB5C 3MUDA 2JGUA 2YMKA 1OIPA 5CBHA 1F51A 1FU1A 4MTFA 5B66Z 3BUQA 4YHHO 1VF5D 1X59A 2WPQA 1I5XA 2FYZA 3KN4A 2Y69C 2YEVA 4BXLA 1EQ7A 2XASA 1H8HG 3ASNB 3WU2Z 1JYNA 2A06E 1HDJA 2WW2A 2VQEB 1NVPB 3JAWA 1FKAO 4JAUA 1L8DA 1KN7A 4O2BA 4EDFA 1XMOB 3OEEG 1IBLO 3UM7A 3UCSC 3VQXA 2P7JA 1ZAUA 2FYUE 2ZDIA 3CMEP 1EZJA 3W7SA 1QLED 2OW7A 1P7GA 4FM2A 5BU5A 4G27B 1ZL8B 4PV1B 4DR4O 2ZVNB 2ZDIC 5LP6A 1BT8A 1N7LA 2XNXA 1NGMB 1KP3A 3FAVA 4N6JA 5AVSB 1D6ZA 2R32A 2E74C 1AJNA 4O2AB 1J1EB 5JVDB 3D4ZA 2CH7A 3AG4B 3VD5A 5ITZA 1WAZA 3X41A 2FMLA 4O4HB 2QE7H 1IVUA 3R66A 2CFGA 3L36A 3L72H 3VBBA 1IURA 5EFWB 5KLVD 2W8ZA 4DR4B 3UQ8A 1S2EA 5AW0B 2WLLA 1BGYD 3OD4A 5BMVB 3RYCA 4O4IB 2HYNA 3ZHRA 2AZ2A 5GTHH 1T3JA 1SRYA 4BW5A 5KHJA 2FUTA 3TY1A 2DW4A 2Q6AA 3M9HA 2DJVA 5LGNA 1BE3H 4J10A 5B1OA 5B1BC 3SPHA 2C9NY 1XHZA 1ROPA 2ZXQA 3H1LH 4BRYA 3G4SP 3HKCA 4LF8O 1WMPA 2AHYA 3B8NA 4DYLA 4KHXA 2IU3A 4TOIA 1WMKA 2RMZA 1NTZJ 3VMAA 2NPSB 2FXMA 2XAJA 4JI4B 3JATA 1ZRTD 5DEDA 4FLTA 5B5EH 5JCOA 3CP1A 5ITZB 1B06A 1AR5A 2D2CC 1AFOA 1KU9A 1N7SA 1W2ZA 1YI2V 3DXRA 2A06H 5IJ9A 1OJOA 1YEWA 3IFXA 2JKAA 4YXWG 3NXSA 3RYCB 4FNQA 4DV4O 4B3MO 3GLMA 1EXIA 3B8MA 2KSJA 1OCCC 3GVMA 2PGDA 3RL0g 2Q9LA 4F6EA 1N7QA 1KYOF 5LMNB 3T09A 1FS0E 3AG3B 2RDCA 4LF7B 3V2NA 1LP1A 1IVXA 2WZSA 3E7KA 4I4TB 1IX9A 5CA1B 1BQ0A 2QJKC 2HKOA 2HPCA 1MFTA 5LHGA 2KS1B 4BRYB 4BIOA 1RH5B 1Z2GA 5B66E 1L0LD 1JX9A 1OVRA 4UFZA 3P32A 1LTAC 4U7JA 3E1F1 4N78E 2QJYC 1SERA 4OXSA 3B5NC 4NVPA 3VQVA 1IDSA 4DR1B 1FFXB 4E4EA 1FD9A 1HNZO 3ZN1A 1NR7A 2H89C 5KA6A 2WITA 2GA1A 1BCCD 1CZQA 3B5NA 1ZW0A 2ALWA 3SYCA 3DDGA 2F43G 1LWUA 3OM3B 3S4CA 5IWAB 2CTRA 3DXRB 3FB6C 3FYEB 1XOUA 4LC1A 4PELA 4LFCB 3RYHA 3RYFA 5BZBA 2W0QA 1M7LA 3IAOA 3P7KA 5KKZB 2D2CB 4U3JB 3K57A 4JF3A 3JAKA 4JI5O 1DH3A 2DYRB 3UO3A 2P5OA 3MV01 4X1YA 3ZRWA 2FYUG 4I6MC 4XE5B 3V4WA 1JR9A 5LXTA 2IW5A 1KC8Q 2WVXA 1YJWP 4PV1D 1R1BA 1H8AA 4JYBA 2JRIA 3W7XA 1Z45A 4I9QA 4Z1MG 1QBZA 4IHJB 5JJEB 2IJKA 1NU1H 1SQPE 1QWUA 1UG9A 4FNRA 4FLXA 4UVCA 2WTYA 1FFXA 3JAWB 2QRXA 4L8JA 2Y74A 3VDBA 1CXZB 1A32A 3HKDB 4PDLA 1OX3A 3K08A 2W27A 4DXWA 1KILB 2V7QJ 1K5QA 5EIBC 2VWJA 5LMNO 2HG5C 2ZE5A 3T4DA 5GONB 1FZBA 1L4AC 1S9KE 1U97A 3PP5A 2WT7A 2WVRA 4ABMA 4WF9V 4JPZB 1VQOP 4YJ2B 1SQXG 4PDMA 2AZ0A 2WMMA 5EK0A 2CQTA 2BE3A 1Q81W 2XOKG 4O2AA 2WOFA 2W90A 1VARA 2UUBB 1Q81Q 1AILA 2BOCC 2WA4A 4GT1A 5K1PA 3H1JH 1OJNA 1GM9A 4O4JB 2E76D 4D6TE 1GK9A 3L73D 4PA9A 3MHVA 1VMGA 3A24A 1PPJG 1VQ7P 4B7EA 2C10A 5TJHA 2WSSH 3AG1B 2Q7EA 1VQKP 1LTGC 1W59A 5IY5C 1K4CC 3I55V 2E5TA 4LH6A 2FBWC 4G2KA 2V7QG 1R3JC 4FLUA 3ACSA 4HAMA 3C8VA 2EJRA 1JEKA 2JVDA 1KILA 4TV8A 1J5EO 3CCUP 3VSMA 2AW9A 2KYVA 4OGQD 3CCVP 1JFFA 1W0JG 3SR2C 3U11A 3D3QA 3FX7A 1RQVA 5L8RJ 1CP9A 4TV9B 2KB7P 4UB8H 2ZD9A 1W2EA 3CCSV 1SF9A 5IYDO 2Q73A 2NPSA 1MOFA 3LVTA 3BABA 2RQ6A 1VQ4P 3I5DA 4L87A 3A2AA 1PPJE 5KAFH 1FAVA 2JWDA 5AW2B 4WBNB 4AHCA 1NTKH 2XAQA 2E22A 1PL4A 2B88A 2EIMB 3U0ZA 3OTOO 4LF8B 2OQEC 2B1IA 4KL1A 5EBLC 2HTBA 5BVZA 1IXMA 1DGSA 4PD4H 3L9DA 2QM7A 4JZGA 3L74G 3PRJA 1PL0A 3V5BA 4TV8B 4F6RB 2OYHA 1JA8A 1BGYJ 3CE2A 1SQQD 4HBNA 1N8RQ 5KX5A 2WSEH 4RJTA 2OYIC 5EZYA 4Q20A 4QPKA 1W5ZA 3LNMB 4H0LB 4DK1A 1PX4A 2F7RA 2IBZI 3THOA 4NXMO 2W6AA 1XTCC 5KBPA 1ZN5A 1LURA 3B40A 3G80A 3APOA 5AW7B 3OUSA 3TGUD 5DN6G 1M57D 2N1TC 1HN0A 1Y47A 1AI6A 4ZKPA 1KQSO 2QEXV 1SFCD 1Z5VA 2FYUK 4X66B 5J2TB 1US6A 3L35A 2WLMA 2N74A 3CYOA 1LWUB 3F5WC 1AR4A 3MUY1 4JYAO 1HF9A 1XNQO 2ZT9C 3OAKA 4HB1A 3SWYA 1NH4A 4KUMA 2I1KA 5L3FA 1EZVE 1L7JA 3HI7A 3JARB 4LFAO 3D6YA 3S4DA 2QEXP 4FLVA 2RKLA 2N1TA 4J42A 3AEBC 5APYA 3WUUA 1XMQB 4ASUG 4ASWA 2FFDB 1ORQC 4PI0A 1DLBA 1MZ9A 2QJPB 2QKCA 1PV0A 2BRWA 3ABKB 1FZFA 3EVKA 4RESB 4NTWA 2E5LO 1KECA 2GUZA 3ABKC 3ABTA 1BE3J 1LT9B 4ZKUA 2CFWA 1JO5A 3FGAD 3TK1A 2ZR3A 3MD0A 1EN4A 3ZBHA 1KFMA 4LF6B 3I3DA 3CZSA 1DF5A 1NSMA 1G1IA 2HJDA 1NH2D 5AVYB 4J5TA 2QWOB 4AQRD 2E24A 1TUEB 1AI4A 3L72E 4GUNA 2F1BA 3CXHH 1SPUA 3STZC 3H1HE 4FLWA 1PD3A 4GLXA 1Q82W 2X6AA 2LR2A 1Q7YW 1GDTA 1MSDA 2NPSD 4EFEA 3CRAA 1Q7YQ 3CEIA 1W5CE 3PTZA 2VRZA 3JALA 4LF5B 2UWJE 1PU4A 3RBZA 2Y69B 5AVXB 1K9MW 4GKGA 3SXXA 2H43A 2JGDB 1LUWA 1W0KG 2OYIB 3KCXA 1AV1A 3V2PA 3GWKC 3HKEA 4X20B 1NU1G 3T1CA 5JQGB 3L70G 1K7DA 1SA0A 5EYPA 1QVGO 2Y4UA 2KZJA 1VQNV 2WSFH 2YNYA 5DJTB 5CJ4A 3QFYA 3RYIB 4JV5O 2M5AA 1SIIA 2QSAA 1SQXK 4G28B 3F7YC 2IBZD 5E79H 1PX3A 1AVYA 4GIFA 2FYNC 3MIWA 2H8PC 3JASA 3RK2C 3STLC 5IWAO 1NH2B 3CC4P 1Q8IA 1QAFA 3SPGA 1OZ0A 3OTFA 1LTJC 4DV0B 5E1QA 3B09A 2PY5A 3EJQA 1WA8B 4UCRA 1IBKB 4FJCC 2WPRA 3ZIAG 3QO8A 3TXSA 2C11A 4DV3O 1WP7A 2Q67A 1BDCA 1IVSA 2XSGA 3T0DA 2SPZA 3H1HJ 3AG2B 4DOJA 3BA8A 2LGQA 4EB6A 1D5NA 1EN5A 4J9ZB 4RQFA 1OVVA 3M0DC 1AV4A 4DR2O 5BR8O 3RYIA 4OH8B 2EINC 3KG2A 3AEIA 2WLNA 2UUCO 5GTHZ 4WY4A 4DR7O 2CWTA 4I55A 1S5LE 3ML0A 1MMXA 3WG7B 4DV6B 1JMBA 1OCZC 3EJPA 2ARHA 4YIOA 5KLVJ 1NTMD 3P30A 1FC2C 1PFIA 3CC4V 4WFEA 2LW7A 3AE3C 1RQUA 4DR3B 1SQXH 2Q0OC 3K0GA 5AW4B 5FL7G 1NSSA 1GK4A 2L6LA 1GAXA 2WOHA 1XNRB 2CPBA 2KLVA 3IF4A 1OCRB 3BUIA 2QTOA 2MJZA 4N21A 3CCQP 4YIPA 1VF5C 1T2KC 2OW6A 1GN6A 3HR0A 3J80N 4PJ0H 1MA1A 1P7BA 4UB6Z 2PUSA 4EIJA 3CCMV 3K5MA 3CX5D 3AE7C 1YHQP 3JSLA 1IZ3A 4QJFB 2YMYA 1S77D 1CI6B 4B08A 2CE4A 1AP6A 1OMIA 1L7KA 3HD7B 3J7HA 3APQA 3CCEP 1H8EG 2DQ3A 2K9YA 3VSNA 4BAYA 2QKSA 2EZOA 2MK3A 5IE9A 5APQA 3PGBA 3CC2P 1SIHA 1YJNV 2P10A 1BCCG 3X3YA 1HW7A 2OTKE 4UCOA 3K06A 1AQ5A 2YX9A 4K8XA 2Q1KA 2W6JG 2YIBD 2R70A 3G9RA 3VMXA 4OGQB 5CBNA 4DV1O 2P1JA 2EX3A 2W83C 2ZR2A 1TXKA 3BVVA 1NSRA 1U96A 2D3OW 3VTPC 4JASA 1L0NE 1K1XA 1WMOA 2GHYA 3BEHA 4M3LA 4C7RA 5APWA 3CZJA 1OCCB 3HIGA 5APVA 1BGYG 2UUCB 2GTSA 2OT5A 3A0BZ 2GDSA 4U3FE 2OCCC 4LWSB 3DX4A 2OYIA 1SKVA 2KXPB 1S9KD 2OTJV 1FZCB 4X1IB 4GOFA 3CMAV 4OK2A 1QR9A 4JGSA 1MG1A 3UT5B 4X65O 1YZBA 4BW9A 1U7MA 3ZDMA 4GYCB 3H1IE 3LOYA 1FJKA 4K0KO 5APUA 3SDLA 4OK4A 4O9BA 2F95B 1Y74B 2P7TC 1KBHA 3JCZA 5HFMA 3E35A 5CMUA 1MUUA 2G8YA 4DV3B 3TNUB 2JJ1G 3JCUH 3AEFC 1HTLC 5IJ0B 3K5OA 3T1YO 1VQNP 1KYOH 2AEMA 3QWOC 1HR0B 4JI8O 4XDKA 1NS1A 5AVQB 2ETNA 1NKNA 2KG7A 2IFMA 4H44C 3JYCA 3EWKA 4DZOA 5AVRB 1HNXO 3J81N 2UXCO 1V9PA 3IAYA 1MZFA 2NPSC 4NPFX 4D7SA 2HVKC 3AE4C 1N7RA 4GDOA 5J2UA 2E2TA 2A3QA 3LSQA 1QLEB 1QCEA 1TUBA 3FD9A 1KILC 1P84E 1TAEA 1KKCA 1SQXD 3TNUA 3KIIA 1KB9D 3IAPA 2XAHA 3AE2C 3M91A 3CHXA 1B6QA 2A0LA 5KHIA 2R5BA 2EILC 3PN1A 5FNVA 1ZL8A 1K73Q 1FJPA 2ZINA 4HJGH 3FXEA 1RWGA 1R3IC 3BY6A 1V54B 2WGQA 1KYOE 2BTOA 4PJ0Z 2YXRB 2KLUA 1RKYA 1YTFD 5EBWC 3NJXA 3CCSP 3B77A 2H94A 3D51A 2WVYA 3EXAA 1CEZA 1Y66A 3VOUA 2QGNA 4JQ0D 1W6CA 2K9JA 1YQ2A 1FPOA 1J95A 1IU7A 2JO1A 4MTGA 1S5LZ 2WLLB 3L71E 4MVUA 4OPHA 1NKZB 5CCGA 1VQLP 5B3SB 4TLFA 2K88A 3AE9C 3T0BA 1IFMA 1KUQA 3ZCCA 3I56V 2PI5A 3D8CA 1RY3A 1JOCA 3GHGA 4L75A 1NTMH 3KDPB 2YKOA 3IC7A 3CCVV 4W4LA 4UVBA 3CCUV 1NQTA 2X6BA 1PNKA 1MMYA 4MSWC 3BCCG 2YFNA 2ZYAA 4CC6A 1N32O 1KQFB 1RF1C 2LJ2A 2QJ1A 3L73E 4KFFA 2N9YB 3FKSG 2IH3C 1ZX3A 1N4CA 2P58A 3EHBB 3JATB 1LOHA 2JDIH 1VQ7V 4H13C 3FXDA 1URFA 1G2CB 2E76C 1RPRA 4Q6GA 5IJ9B 1BE3E 3FWNA 3MP7B 1R8EA 1JZ5A 4B3RO 1XL6A 4BIUA 3JSNA 1FFTB 3HRNA 3JARA 3SWKA 2BRPA 3H1HH 2AXTH 5AW6B 1MV8A 3GHGB 1EDKA 4DV6O 5BMVA 1LTSC 2DYSB 2R44A 1LP1B 3K5BA 4O4IA 1N33B 2F18A 1K34A 3PH0A 3GHGC 3TGUG 2N04A 1I8QA 2VQEO 1PGQA 1O7DD 1EZVG 2M6YA 4LF9O 1TU3F 4JTAB 1BHBA 3ZMSA 3I3BA 1ZRTE 1NBMG 4YY3O 4PD4E 3N7NA 4B3RB 3VMYA 3AFJA 3AG1C 1N0NA 1ZUQA 2IDBA 5E79E 3QVNA 2JIZG 3QNEA 2R9IA 2Y48A 3W68A 1SETA 5DM6V 1SQVK 1J0MA 1NTKE 2V7QH 3EJSA 1SQPK 1SVFA 2JKPA 4EV2A 1U7JA 3VN0A 3ASOB 4C46A 1E5WA 1R3LC 1S72P 1XTGB 1XNRO 5B1AB 2KZIA 2HTAA 2D2CD 1NS2A 2YUAA 4X1YB 3ZRWB 4ICGA 1NU1E 3CMEV 4RQEA 1PZQA 1BQZA 2WLIA 1TA8A 4ZIBA 4FFBB 4NPEA 1PP9D 1DX7A 2ZE7A 1SNZA 1RE4C 2ADQB 2KB1A 4FLZA 1VQ5P 4JI3B 3ZHQA 2FL4A 3HKEB 4WFHA 1VQ8P 3KQGA 1EZVI 1SFCB 4BZHA 3WMM0 3QF7A 2BEQD 1OCRC 4BR6A 2ZVOB 3CXHE 1VF6A 2GBOA 3M06A 2Q5UA 1GMGA 5BU8B 1SFCC 4UCUA 5F2VO 1D6UA 1WT6A 1M1JA 2WSCJ 1JZ8A 2JKEA 3BFRA 3Q4HB 4DV7B 2UUBO 4LF5O 2WT7B 4U7OA 4Y99C 1TQWA 1W7CA 3VQWA 2P22C 1YYCA 4P9OA 2Y9ZA 2N05A 2CIQA 1D5AA 1BDDA 1SQQH 4RO0A 5B1NA 1GD2E 3QFZA 4DV0O 3HE4B 1IBMB 1VF6C 1T3UA 1PGJA 4DW1A 2KIKA 1YJ9P 1PL5A 1S1CX 2CDYA 1LGHB 3BVHA 1R33A 4JI7O 2CK3G 4GZRB 1DK1A 4R6ZA 2ZM6B 3G6EP 3CCJP 5B1AC 5CBGA 3FWLA 2XU6A 1KQGB 1GU4A 2BCCG 1JY2P 2RNBA 3T97A 4KHPB 2B9BA 4JI1O 1OVUA 2KQXA 1JTHB 1M4UA 5CJ0A 4D6TG 4L74A 1KILD 3TGUH 1AI5A 2KSDA 3E8HA 4ZNCA 3CCLP 1DTOA 3M7MX 4KTPA 1M1JB 1JFFB 1OCOB 2M3BA 1LTBC 1ZOYC 1AJQA 5KAIH 3BVWA 1N86A 2UXCB 1Y9BA 3TDKA 5B3SC 1JY3N 1SZTA 4JI7B 1B3QA 2CTQA 4ZI7B 5KLIB 3CCLV 3AE6C 1P84I 3LSUA 3T1YB 2BSKA 2QDOA 1NKDA 2EBOA 5EIBD 1HNXB 1PGOA 4PD4D 3RRSA 3T0AA 1FJGO 1XNQB 1NTME 1K3EA 2XNDH 1NVPD 5DJUB 1VQMV 2OOVA 1E1RG 5GTHE 1NTKD 5HFLA 3O9OA 2PI4A 3T4ZA 5CBFA 4RKUJ 2XN0A 1FZGA 2Q69A 3LDCA 2WPVB 1BSMA 4B3TO 2DN9A 1JPXA 4F6RA 1QLNA 1GW3A 3OA7A 3AG4C 2ILMA 1BS3A 4X65B 1CI6A 5JH7A 2POHA 4H33A 4WWIA 4LF7O 4JI6B 4DR5O 5AVZB 5JWPA 3N9HA 1M90W 1JMMA 1BMFG 3AK2A 3X40A 5D5PA 1OXZA 5CCHA 3ABLC 5LOVA 3O6QB 4HYTB 2FFDC 3A2FA 3M99B 1DD4A 4TUYA 3K0DA 2D73A 1S5JA 2B1GA 2X03A 2YXQB 1I0HA 5IYZB 2ZYDA 3S3WA 4H13D 3KYQA 5DECA 3DECA 4GX1A 1NU1D 1QX8A 3EFGA 4IT5A 2M7WA 1H89A 3NBJA 3CRRA 3TJTA 4N23A 3CX5F 1MN0A 4WY4C 3VOPA 4I5SA 1WB8A 2Q8VA 4FFKA 3NBBA 2UXDO 1TVKA 1AI7A 3BS6A 2YXHA 4BWAA 4MVZA 3K3WA 3UKMA 5JJJB 1KTMA 1HM3A 3M0DA 4E2LA 2RN0A 1PNLA 3CWBE 1MZEA 3KHUA 5H2FH 1D2DA 2PF4E 3ETGA 2KOGA 5CCGC 2IFNA 3SFEC 3K9SA 2CFKA 2ZQ0A 1K92A 4BWNA 3AMOA 3UT5A 1R6NA 3RVZA 1ZV8A 3VMZA 2OYOA 2NZ2A 4OX9B 2WCOA 3BVXA 1WNSA 1SQVD 4MW8A 4IL6Z 1J1EC 4D7TA 2YXYA 3VD9A 4YJ3A 4MTOA 4FVMA 4DJGA 2DW3A 3CRQA 2LQTA 5KAIZ 3JD4A 2RCVA 5IT9N 1GTWA 1K8AW 1T2KD 1NS7A 5C39A 4NXNO 4R4MA 1R6KA 4X62B 1WPXA 4DUZB 1L0LG 4B7KA 4UB8E 3DC5A 2WYHA 1HMWA 4PD4I 1P84F 3V2QA 3Q1NA 1X8YA 2W6BA 1I94B 2WPDG 3HUSC 1Q2NA 2Z5UA 3ICXA 3E22A 2XV5A 2JGDA 1A02F 1NSUA 3WFVA 2ITCC 4DR5B 3D70A 2LFSA 5A9GA 5BXZA 2FYUJ 2G38A 3CL3D 4N78D 1K97A 1RWCA 5LGUA 4KTRA 1X1JA 2AXTZ 3N2KA 3SPIA 3GWOA 2P6JA 1ULVA 3K79A 1JZ4A 3JD0A 3JCUZ 4GKJB 1HUCA 4H13B 1F1SA 2FYVA 1JZ6A 1VQ9P 3GF7A 2IBZG 3L75E 4X64B 3ZMVA 3JASB 4ZMDA 3H1LD 4YTPC 5A1AA 1E79G 1R5LA 2K37A 4DR3O 2OTLV 1Q6UA 1H2KA 2AXCA 2WA3A 4QE9A 4K8ZA 5KHKA 2CTWA 3Q5PA 3KZIE 1NTZG 4Z1MH 3D36C 3EJRA 1PP9H 1IBLB 2QM8A 1GL2A 1VQ9V 3CXHI 4LFCO 3RSYA 2CISA 2PP6A 1AA0A 2CIRA 3KCYA 1P49A 1VQKV 3U59A 3ZHVA 2AXTE 1ZLLA 5AVWB 2KP8A 4O4HA 3WG7C 3WA2X 3QTCA 5KLVH 1M57B 1OACA 1M1KW 3LDEA 3HE5A 4LH7A 2RN9A 1MFZA 4MMHA 3RK3C 1E79H 2EIJC 2P06A 3L71G 1FDMA 4GKKB 2F7OA 1SA0B 2R5DA 1CSBA 3A0HZ 2VQFB 3OW2U 4JYCA 4AQYB 3B5ND 3A5TA 3R4YA 1X22A 3SJAC 4JI5B 1BE3D 4UCTA 3W67A 1FJGB 4P2ZA 3TYYA 1WJZA 2JWAA 5GTIZ 5GW7A 1NTMG 3HKCB 1Q5OA 1IBMO 4JV5B 1YJNP 3X2QC 3OGIB 1QU7A 3C90A 4FZ1A 3P8CD 1NKGA 2Q7CA 2ZXWC 3N2GB 1MMMA 1LXMA 3Q5RA 3RGUA 1KB9E 5LBQA 1R6TA 4AI8A 4GKKO 1SQFA 4GOEA 4JTCB 1JCDA 4CZZA 2LXCB 1URQC 4L73A 3S4RA 5KJ7C 3HD7D 4GCZA 3V2RA 5TISE 2Q7GA 1KYOI 2JP3A 1HBWA 2F7QA 4K0KB 4PD4F 4LFBO 1NTKJ 2Z5HA 2HODA 1JOYA 1IQYA 4HNAA 2WSFJ 1X0TA 4CS2A 4DV5O 3GB7C 4BTYA 1IFPA 1QQCA 3U1AA 2QWQB 3ZMTA 3L74J 1IZNB 2J58A 1AJPA 1JB0J 4P9PA 1NU1J 2JKVA 2HG5D 3D52A 5LYJA 1H2GA 3RL0C 2CWVA 1XMQO 3MGNA 4AUWA 1YXBA 1YITP 1TQUA 5EBMC 4JI8B 4DV7O 3L74D 3EJUA 1RF0C 2YDEA 4ASVA 5AW5B 4NB5A 5LHIA 4DV1B 1EBOA 1XILA 2E75B 3KKYA 3OBAA 1JZ7A 1YJ9V 2F93B 1WRGA 4JI4O 4QE7A 3L4FA 4H0LC 3R2PA 5CB4B 1SO0A 1L2PA 1CW5A 3N4XA 1EN6A 1FXKA 2QWPB 4NXMB 2IPPA 2IZ0A 4WY4D 3E7JA 1KD1W 5KUMA 4IL6E 1RM1C 1KD1Q 1JYXA 3W7WA 5CA3A 3JAKB 4GKJO 2OQQA 1DEBA 1C82A 3IMHA 1W3YA 5LXTB 1Z5WA 3IR9A 1FZCA 1GTOA 3ABMC 4X1IA 3DSQA 3MAQA 4DR6O 1W4NA 1GN3A 2EULA 4J9YB 1LXKA 1QVFU 1M1JC 3M9BA 1FZAA 4NKGB 4OGQC 2ZE6A 1SFCA 3MZWB 4CBCA 3HD7A 1G1XB 2GUSA 3QO7A 1YJWV 3CD6V 2YIUC 1LVNA 4NXNB 2ZXEB 5KAFE 4CH3A 2JDIG 1I94O 1KB9H 2FXOA 3E1IA 3DC6A 1USDA 3DGEA 4TSFG 5KA5A 4RO2A 3F7VC 1NR1A 1UJWB 1NSZA 2Q6QA 3OT7A 4UFCA 5CB4A 1QHTA 1AQTA 3H1KG 4HKZH 1J2JB 1NJIQ 3BUBA 3M9QA 1FDIA 2BCCJ 5H9CA 3DYPA 2E3CA 4YJ2A 4MVQA 1JCHA 3BCCD 1GL2B 1H2NA 2YI9A 5FPRA 2HLDG 5LA6B 3JD2A 4CH5A 4QNHB 3R65A 5KKZC 1HNWB 3T97B 1QALA 3L73G 2JK5C 1MKMA 2VS0A 1JTHA 3H32A 3WVFA 3QO5A 4CH6A 3H1LG 1W2BU 3BATA 3D50A 2CPSA 2E75D 3OTOB 1KYOD 2P67A 1YQ4C 1IFIA 1L0ND 2A79B 4GX5A 1RWAA 5APXA 2YFOA 3ASNC 1SQQJ 1T6AA 2MW2B 3OMNB 2E74B 1Y74A 4WBAA 1N7NA 2CGNA 5H5NA 4NYKA 1M57C 1I7FA 4RAIA 4JI2O 1GK6A 3TCUA 2BTQA 2O01H 1S5HC 1K4DC 1BE3G 1M8OB 1QWNA 4TV9A 1LWUC 3DX2A 3CI9A 3K25A 3T08A 1CPYA 1WP8A 4B86A 4ZBMA 2ZNIA 4DRXA 3H1JE 1SQVJ 2GUVA 2RMKB 2OWOA 1GW4A 1LTIC 1EXJA 5H6QA 1WN7A 1XI1A 2WW1A 3H1KD 3JALB 1JZ2A 1PKXA 1JY3O 3BCCE 2YICA 1RSOB 3G4SV 2UUAB 3Q3DA 1SQQG 2C2AA 2FKWB 1T5EA 4X20A 2BCCE 3NMDA 4DT0A 3E80A 1IK7A 5AVTB 4KFMA 3HKDA 1I08A 1Y4MA 1RWFA 4OWFA 5IY5B 3NR7A 1AJYA 4NR1A 3A0BE 3AECC 3CCEV 2FYNB 2LFRA 3ALAA 5EZYB 2Y0EA 1NO4A 4BZFA 3HUSB 5LYJB 2QA4V 2DYSC 4DUXA 3A0BH 1OW8A 3WB0A 1SLQA 3AEDC 1KILE 1RFYA 3LW5J 5LMUO 5L3BA 5LGTA 4EEQA 1HR0O 3AEGC 4ZHQB 3NTNA 3IN6A 1ENVA 1D7MA 2BCCH 2E76B 1DF4A 2CG1A 2K9JB 2HR3A 1L0LK 3H1LJ 4WFBV 5AW1B 2WSEJ 3DCDA 3WIRA 4GX0A 2YEVB 3SPCA 4DUYB 5B66H 2HHHB 3X3ZA 2Z0AA 4QMAA 1EFRG 1KC8W 1SS3A 3H6PA 5KJ7D 1KQLA 2HLOA 1VQ6P 1ZWIC 1SQVE 3GMAA 5AW9B 3VD4A 2YI8A 4UUJC 1WLEA 3CRMA 4OJZA 1T8ZA 3M0AA 4FNPA 2HFEC 3D36A 2ZJSE 4FMTA 2WSSG 3CWBH 3CCRV 5H2FE 3M8AA 3VDCA 4XBFA 3CXCU 4MT8A 2KK7A 4TT3G 3L72J 2KS1A 4DUYO 1YTZT 3D3IA 2HVJC 4MVMA 1V54C 3ABVC 4TQDA 1R5SA 5BY1A 1NS0A 5LP6B 1LT9A 2FTKA 1SQXJ 4RUFA 2A7WA 2UUAO 1OWAA 3G71V 4KFDA 3RK2D 3C9IA 3L72G 4UCSA 2DYRC 3F5TA 1R3KC 2JS3A 4GODA 2CWUA 3FB8C 4FLYA 2XNDG 3TF5A 1JY2N 3ABLB 4QIWF 4B3SO 1AR1B 4EOTA 3CX5I 1KORA 3CSXA 2CG0A 4XFJA 5KHHA 3HB3B 5KLVE 1NTKG 5B5EE 1FZEA 2ZIOA 1SZXA 2JJ2G 3JAMN 5APSA 4RNLA 2DMXA 3L70H 1L1FA 4KHPO 2WLKA 4EYYQ 4OX9O 2Y4TA 3I56P 3BUDA 4JPRA 3H1LE 2QWRB 3E8FA 2DOSA 3H1HG 2QR4A 2WVZA 2K9PA 2Q5ZA 1AP5A 1VIBA 2QKAA 2IBZH 3CMAP 1UPGA 1G6UA 1VF7A 1R73A 4A5UB 4LFAB 2PTMA 4AQ0A 2BEZF 2KNCB 1B04A 2IH1C 3S9OA 1N73A 3AG7A 1HNWO 1QLEC 4JI0B 2M3EA 2O1KA 1N7SB 1NZ6A 3CWBD 2M5AB 1Y67A 1LTTC 4FNUA 5M1BA 5GONA 1HWYA 1FOSF 2XUMA 4DUWA 1LT1A 1I5YA 1Q82Q 2EADA 1FXHA 2XHBA 1YIJV 1NTZE 4X62O 1HGZA 1OCOC 3AEAC 4N3YB 1QAKA 3B2EE 2Q4PA 4C7NB 1HWTC 3ZMUA 2HJFC 1KB9F 2BRVX 4IL6H 4I4TA 3W7UA 4MVOA 1IK9A 4LWSA 1FXKC 4R4LA 3E89A 2VWKA 2GUZB 1SS1A 3HIIA 1GKFA 2Q3IA 3CXHD 1Q90D 1N8RW 2Q3EA 4PA7A 3ZRSA 3VDAA 5H2FZ 1H54A 1E1QG 1FS0G 2KNCA 2Y0CA 2L35A 1YTZI 1N73B 2XKMA 3DX1A 1P4RA 1LR1A 1TQSA 3TXQA 2YKQA 3TSIA 2D1WA 3RN4A 3E8GA 4I55B 1K8AQ 2ZIMA 2V4HA 1JMKC 1YDXA 2JR8A 1M5IA 2RH0A 1ZMEC 4ZOLB 2PGGA 3H1IJ 4Z1VA 3Q1MA 1N7PA 3HKBA 3BA9A 5C8YA 1IO4A 2CH7B 1RJOA 3L74E 4IFFA 2IZ1A 1K5SA 1S72V 1NYHA 5IYCO 2YS8A 5B1BB 3WU2H 4I0XB 5KJ7A 2JEXA 3H1ID 3OB8A 4QPJA 1F4MA 3CCJV 2NRGA 1Q43A 3OE7G 4NTXA 3ZMZA 4RWUA 2OCHA 2CQSA 1JNMA 3HPLC 1S5LH 3T2PA 1IBKO 4TWKA 5KLVK 3OJAB 1MSWD 1M56B 1SQVG 2HHHO 2H3OA 1YVWA 1L4AB 3TETA 1YIJP 1HXKA 3H1JG 1L0NJ 3WUVA 2IJJA 1KSIA 3ZHTA 1V7WA 5C8YB 1NWQA 1YF2A
chains in the Genus database with same CATH topology
2LXBA 2F1BA 3RGUA 3BLBA 1H0TA 4GOEA 4EYYQ 2LR2A 1TQWA 2LXCB 5K5GB 3BUDA 1BDDA 4MN4C 1QWNA 3DX2A 1TQVA 3BVXA 2OTKE 2F7QA 2UWJE 2KIKA 2ZAEB 2Q1KA 4K3AA 1R33A 3CV5A 1X0TA 5CBNA 3BVVA 5C39A 1H0TB 2M5AB 1OVUA 2P58A 3LVTA 2KI7B 1LT1A 2KZJA 2WYHA 3D52A 1LP1A 5DJTB 2JWDA 4ZNCA 2I8DA 2M5AA 3FXDA 1TQUA 2B88A 4IOIH 1MFTA 2KS1B 3EJUA 1Q2NA 3BVWA 5CBOA 1ZXGA 3DX4A 4ASVA 1OVRA 4GOFA 3DDFA 1U7MA 3ZDMA 3DX0A 1EDKA 1SS1A 2R44A 1LP1B 3EJQA 1ZW0A 2ALWA 3DDGA 2M0BA 2F18A 3PH0A 3BUQA 1QX1A 2F7RA 2B87A 5DJUB 2FYVA 1EC5A 4BXLA 3BVUA 1BDCA 1O7DD 1EDJA 3DX1A 3QWOC 2KUBA 1DEEG 5KBPA 2SPZA 4ZMDA 1TQSA 2HR3A 1EDIA 1R34A 1Y47A 1OVVA 3MZWB 4KJMA 2F1AA 3BUPA 1TQTA 4NPFX 3CZNA 3EJRA 4JBZA 2OW7A 3EJSA 2WYIA 2K3RA 4HB1A 3EJTA 3DX3A 4WWIA 1U7JA 4K35A 1QWUA 1JMBA 2KZIA 3EJPA 2QRXA 4HKZH 3BVTA 1FC2C 2RKLA 2QVAA 3D4ZA 1HWWA 3BUBA 4ASWA 1HTYA 4NPEA 1PS3A 2F7OA 5EFWB 2B87B 3BUIA 4NPDA 2B89A 4GODA 2OW6A 4HJGH 1NVOA 3FXEA 1EDLA 1S3JA 2WMMA 3D50A 3D4YA 3CZSA 4CPGA 1HXKA 3D51A 3MHVA 2F7PA 1JM0A 3S1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXB A;  2F1B A;  3RGU A;  3BLB A;  1H0T A;  4GOE A;  4EYY Q;  2LR2 A;  1TQW A;  2LXC B;  5K5G B;  3BUD A;  1BDD A;  4MN4 C;  1QWN A;  3DX2 A;  1TQV A;  3BVX A;  2OTK E;  2F7Q A;  2UWJ E;  2KIK A;  2ZAE B;  2Q1K A;  4K3A A;  1R33 A;  3CV5 A;  1X0T A;  5CBN A;  3BVV A;  5C39 A;  1H0T B;  2M5A B;  1OVU A;  2P58 A;  3LVT A;  2KI7 B;  1LT1 A;  2KZJ A;  2WYH A;  3D52 A;  1LP1 A;  5DJT B;  2JWD A;  4ZNC A;  2I8D A;  2M5A A;  3FXD A;  1TQU A;  2B88 A;  4IOI H;  1MFT A;  2KS1 B;  3EJU A;  1Q2N A;  3BVW A;  5CBO A;  1ZXG A;  3DX4 A;  4ASV A;  1OVR A;  4GOF A;  3DDF A;  1U7M A;  3ZDM A;  3DX0 A;  1EDK A;  1SS1 A;  2R44 A;  1LP1 B;  3EJQ A;  1ZW0 A;  2ALW A;  3DDG A;  2M0B A;  2F18 A;  3PH0 A;  3BUQ A;  1QX1 A;  2F7R A;  2B87 A;  5DJU B;  2FYV A;  1EC5 A;  4BXL A;  3BVU A;  1BDC A;  1O7D D;  1EDJ A;  3DX1 A;  3QWO C;  2KUB A;  1DEE G;  5KBP A;  2SPZ A;  4ZMD A;  1TQS A;  2HR3 A;  1EDI A;  1R34 A;  1Y47 A;  1OVV A;  3MZW B;  4KJM A;  2F1A A;  3BUP A;  1TQT A;  4NPF X;  3CZN A;  3EJR A;  4JBZ A;  2OW7 A;  3EJS A;  2WYI A;  2K3R A;  4HB1 A;  3EJT A;  3DX3 A;  4WWI A;  1U7J A;  4K35 A;  1QWU A;  1JMB A;  2KZI A;  3EJP A;  2QRX A;  4HKZ H;  3BVT A;  1FC2 C;  2RKL A;  2QVA A;  3D4Z A;  1HWW A;  3BUB A;  4ASW A;  1HTY A;  4NPE A;  1PS3 A;  2F7O A;  5EFW B;  2B87 B;  3BUI A;  4NPD A;  2B89 A;  4GOD A;  2OW6 A;  4HJG H;  1NVO A;  3FXE A;  1EDL A;  1S3J A;  2WMM A;  3D50 A;  3D4Y A;  3CZS A;  4CPG A;  1HXK A;  3D51 A;  3MHV A;  2F7P A;  1JM0 A;  3S1K A; 
#chains in the Genus database with same CATH topology
 2BSK B;  2UXX A;  1JYV A;  3SWF A;  2EIN B;  1NTZ H;  1QNM A;  1WA8 A;  3SSU A;  1PM9 A;  1H0T A;  4FPP A;  2IYO A;  1YGA A;  2FUQ A;  4XDL A;  5K5G B;  4UB6 H;  3ABU A;  4WFG A;  2UU9 B;  1HVV A;  4J7K A;  3CCM P;  1FXK B;  3IJ4 A;  3K5N A;  1VQ5 V;  4LFB B;  4FNS A;  2WLJ A;  3BCC H;  1SQP G;  1SP4 A;  1JZ3 A;  5KAF Z;  2LKM A;  3SGI A;  4I50 A;  2EAC A;  3B4S A;  3IFM A;  3FB7 C;  1VQ4 V;  5KTB A;  1KB9 I;  4I1L A;  4X9Q A;  4JYY A;  4UB6 E;  2HFE D;  1ZSP A;  4PA3 A;  1VEW A;  3BHP A;  1WPB A;  4YJ3 B;  2B5U A;  1YTF B;  1Z56 A;  1L4A D;  4PHZ A;  3HTK A;  4J80 A;  1PV3 A;  4MS2 A;  2QG4 A;  2EAB A;  3MI6 A;  3DX0 A;  3RYH B;  1K05 A;  1OW7 A;  2DQ0 A;  1URQ D;  2JEE A;  1SQP J;  1M56 D;  2EIM C;  3G3Z A;  3C3T A;  4NEI A;  1TGO A;  3L73 J;  1VPC A;  1NHL A;  2P4V A;  3L73 H;  5LHH A;  4I7Z B;  3H9V A;  4PI2 A;  2O1J A;  3CXH F;  3VQY A;  4Z2W A;  2OIE A;  1EC5 A;  3JD3 A;  1V55 C;  3K9A A;  3H1J D;  4C7N A;  1EDJ A;  2E42 A;  4MW3 A;  5FPO A;  1LT9 C;  3C1L A;  3V6I A;  1RF1 B;  3WU2 E;  5KMG A;  1NS8 A;  4FZ0 A;  4IHJ A;  4D6T D;  3CX5 E;  3L74 H;  4KXR A;  3ZHU A;  3T2M A;  4J7J A;  3H1J J;  4Y99 B;  3CZN A;  3IAQ A;  3G67 A;  2EIK B;  2GSM B;  5CCG D;  2Z3Y A;  1NSX A;  4BZG A;  4JI3 O;  1N33 O;  4K35 A;  2DWD C;  5J2T A;  3BCC J;  2WZ7 A;  2LW1 A;  4D6T J;  4DUZ O;  1QR8 A;  3DYO A;  5TIS H;  1NT2 B;  3OGC C;  1EKM A;  2HEP A;  2G3A A;  1O9H A;  2YIA A;  1NAY A;  2JEU A;  2WDA A;  2M8R A;  4PA4 A;  4WB4 A;  2A45 G;  2OTL P;  2H7H A;  1GRJ A;  3WB1 A;  4XA4 A;  1F4H A;  2F4V O;  3NRE A;  1H2S B;  3RK3 B;  1FXV A;  5KHG A;  2QIW A;  1EDL A;  2W0X A;  4BTX A;  1V55 B;  3DTU B;  3MHH C;  4FFB A;  1J0N A;  3L70 J;  1RP3 B;  1VQL V;  2ITA A;  2AHZ A;  1SQQ K;  1JUN A;  3GG2 A;  4I7Z C;  1BSN A;  2XZR A;  1M9N A;  5CMZ A;  1HJB A;  1N34 B;  3A7O A;  3JD1 A;  3EQ2 A;  4O4L A;  1IFN A;  1P84 H;  3K5T A;  4JTD B;  4J11 A;  1BCC H;  2F4V B;  3P8C E;  1AVO A;  4OPA A;  4MMI A;  2H88 C;  1GN4 A;  1Y76 B;  2V1D A;  3A0H H;  3SYP A;  1PGP A;  4DK0 A;  2YSU B;  3A0R A;  3OW2 O;  3MUZ 1;  1N36 O;  3U10 A;  2QJP C;  1TQV A;  2ZKO A;  2E74 D;  1H2M A;  2QE7 G;  2KKW A;  1L0L H;  4FIP C;  4XDJ A;  2OYH C;  2Y73 A;  4RUE A;  3OR7 C;  2IJH A;  4F4L A;  4B3S B;  1HM2 A;  3AG2 C;  5JVD A;  2AGA A;  3WFA A;  4DUV A;  4ZHQ A;  3WUT A;  4MVS A;  2LP7 A;  4LBE C;  1H0T B;  4WBN A;  3S3X A;  5J2U B;  3WB2 A;  2O01 N;  2FB5 A;  4BTW A;  2WQY C;  1NTM K;  1H88 A;  2E75 C;  2O01 J;  3USS A;  2A06 D;  5E1A C;  1NAF A;  3S4B A;  3CWB G;  1GU5 A;  3C3S A;  1EZV D;  3QH9 A;  4IGG A;  2ZFC A;  3BVO A;  4DV5 B;  1Q6I A;  4MVR A;  3RL0 B;  1RPO A;  3BRV B;  5K1X A;  2RDY A;  2FYU D;  2IYP A;  1Y8A A;  1GZL A;  5KX5 B;  5AG2 A;  3P3P A;  3T1H B;  3LNN A;  3UIA A;  1F4A A;  3L70 E;  5FNV B;  1OJP A;  3RK3 D;  2ZL8 A;  2YO2 A;  3OR6 C;  4EFB A;  2YID A;  3QG5 A;  2FYU H;  1AVL A;  3ZRV A;  3O8Z A;  1HH0 A;  2A06 G;  4W7Y A;  2J5U A;  5KAI E;  1IFJ A;  1EZV H;  1KMI Z;  1MMU A;  1SQG A;  3FAV B;  3LID A;  3ZRX A;  2F23 A;  5L3E A;  3PLN A;  3KZI Z;  1EDI A;  1R34 A;  3ECQ A;  1NJI W;  3CCQ V;  1BGY H;  1WB7 A;  3F5H A;  2W0F C;  1ZTE A;  1UIX A;  3L72 D;  1LTJ A;  2ZXX A;  4H37 A;  3JC2 2;  1SQB J;  1KFN A;  5GTI H;  4FNT A;  1K1W A;  3OEH G;  1OFC X;  2K3R A;  2WYI A;  3EJT A;  3VD7 A;  1XUQ A;  2E43 A;  1F23 A;  2LO1 A;  5IDJ A;  2FXP A;  3F89 A;  1NI8 A;  2HP8 A;  1IC2 A;  3HD7 C;  1DP0 A;  2E5Y A;  3ETQ A;  4HNA B;  3A0O A;  1X79 B;  3EFF K;  3IC9 A;  1MAB G;  1VQ6 V;  4X88 A;  3OAA G;  3SX1 A;  4LNU A;  4UV8 A;  4LGD E;  3BRC A;  1IVW A;  3K03 A;  1SQV H;  1OJH A;  1L0L E;  4R8C A;  5C93 A;  4NPD A;  1P84 D;  2YIU B;  2UU9 O;  4PDR A;  1S3J A;  1VQM P;  3WIQ A;  4HH2 A;  2Z5I A;  2Q9I A;  4A7P A;  2L91 A;  3RL0 D;  3D4Y A;  2ITD C;  2P90 A;  4DCK A;  1IFD A;  3ABM B;  1QL1 A;  2RJZ A;  4LLH A;  1M56 C;  1YHQ V;  3S1K A;  1RE4 A;  1RF0 A;  2C0X A;  1QGK B;  4IYH A;  5LA6 A;  4LF6 O;  1U57 A;  4H0L D;  1OCZ B;  2WVX B;  3PJS K;  1YIT V;  4JAA A;  2XN2 A;  2WPS A;  3GW6 A;  2ODM A;  2ZM6 O;  1JY3 P;  1OV9 A;  3AEE C;  1DYU A;  4JZ2 A;  4EV5 A;  5JJN B;  5H6R A;  3L71 D;  3VYI A;  1HN1 A;  2NR5 A;  1LNQ A;  3AK1 A;  4DO2 A;  1Q86 Q;  1ARO P;  3OMA B;  1UII A;  1Y76 A;  1G8M A;  3LSS A;  4D6T H;  1FDO A;  1Q3E A;  3MDS A;  1URQ A;  1X9V A;  3BAS A;  3B5N B;  4DW0 A;  4PJ0 E;  4IFD K;  2IJI A;  5CA0 B;  2I8D A;  1UFI A;  2JJL A;  5B5E Z;  4IIJ A;  4IOI H;  4YXD C;  1XDC A;  3LUT B;  3RYF B;  3G71 P;  1M93 A;  3P3N A;  2X0L A;  3ETE A;  1ZR4 A;  2QM4 A;  1FE6 A;  1GH6 A;  4O4J A;  4EI2 A;  3Q5S A;  3E8B A;  4GX2 A;  4U3F H;  3CB2 A;  2E5L B;  1DD3 A;  1GN2 A;  5LL6 Y;  3MHS C;  2QJK B;  4LF9 B;  2PYL A;  3MWX A;  3PHL A;  1N36 B;  4FM0 A;  3VD3 A;  1USE A;  4HZ3 A;  1IVV A;  4YY3 B;  5D5Q A;  3CLQ A;  1QEX A;  4DR6 B;  2B87 A;  1L0N G;  4EB6 B;  2W6J H;  1NTZ D;  2NLJ C;  1PNM A;  1Y6X A;  3ACT A;  2C9L Y;  2BOB C;  3CJH B;  1PPJ D;  4WFF A;  1KV4 A;  1NTZ K;  2E2V A;  2XT9 A;  2XAF A;  2IU0 A;  1JJO A;  1ZLZ A;  3GF3 A;  1GMJ A;  1NU1 K;  2ADP A;  2OIG A;  1JQ0 A;  5CA0 A;  3CPW U;  2BTQ B;  1YCI A;  4PDV A;  1JJ2 U;  5L3D A;  3P8M C;  3K5L A;  5AVU B;  1FOS E;  1GL2 C;  1SQB G;  3ETD A;  3T2O A;  4DRX B;  2EIJ B;  5EC1 C;  2NNU A;  3CWB J;  1G2C A;  2AEJ A;  3QG0 A;  1HWW A;  1ZR2 A;  3H1I H;  3CD6 P;  1XBL A;  2Q68 A;  2LGW A;  4PA6 A;  1TUB B;  3G6E V;  2L5G B;  3L75 H;  3KXD A;  2PRR A;  1VF5 B;  2QA4 P;  2B9Z A;  4DR2 B;  2B87 B;  4FNV A;  1J5E B;  1RE3 A;  2O57 A;  2B89 A;  4DR7 B;  5LP6 C;  2PZS A;  1NVO A;  3B71 A;  2ZYG A;  2OYH B;  2XHN A;  2DWE C;  1KQS U;  2ZNJ A;  1FBM A;  2CFD A;  4O2B B;  4WFA V;  4B3T B;  2R3S A;  1VL2 A;  2ZCE A;  5KLV G;  1M90 Q;  1HGV A;  2PAJ A;  3LW5 H;  2ZE8 A;  3FX0 A;  3CCR P;  2BAS A;  3NJV A;  3E83 A;  2F7P A;  2Y0I A;  2OTJ P;  4C7U A;  1UI7 A;  1ZP0 C;  3A3Y B;  3HUS A;  3OS7 A;  2DE0 X;  2ZT9 D;  1RHZ B;  1SQB D;  4U3F J;  1NS4 A;  4J41 A;  1JVM A;  1X1H A;  5E79 Z;  1SC5 B;  5JMD A;  1GO3 F;  4DV2 O;  3MUD C;  5EC2 C;  4H44 B;  1X1I A;  2EIL B;  1A2V A;  2J59 M;  1N7O A;  1VP7 A;  3X42 A;  4X1K A;  4JAV A;  2A45 I;  1RE3 C;  5KLI C;  2KI7 B;  5CHX A;  4IYI A;  1K33 A;  2UXN A;  3OFN G;  4LCU C;  5JH7 B;  2ZQM A;  1PP9 G;  3L75 J;  1O9G A;  3CC7 V;  2XAG A;  3VP9 A;  1FZC C;  4AQY O;  4Y28 J;  3SFD C;  2CFL A;  4KT0 J;  1MNG A;  3E86 A;  5LOV B;  3O6Q A;  1BL8 A;  4TUY B;  4UXN A;  2OYQ A;  5A2Q N;  2GV9 A;  3K58 A;  3CC7 P;  2WO0 A;  5L3G A;  1JYW A;  1URQ B;  2YC0 A;  1IJD B;  2M0B A;  4KP4 A;  4DR1 O;  4JYA B;  4LR3 A;  1RW9 A;  1W6G A;  5IYB O;  1SQP H;  1V7X A;  1RM1 B;  2I1J A;  3BVU A;  4X8A A;  4X66 O;  4X1K B;  5AW8 B;  2KSE A;  3MV1 1;  3H1H D;  5CCH D;  2BT3 A;  2KUB A;  2CGO A;  3T1H O;  1OJM A;  2CAZ C;  4MTX A;  4WVZ A;  3Q2Y A;  3WA3 A;  3J7A U;  3H1I G;  1NTK K;  4KJM A;  3AE5 C;  4X64 O;  3BUP A;  3JSV C;  4IL6 X;  4TT3 H;  2WW0 A;  1S5L X;  3AMO B;  1JCC A;  1KP2 A;  2HPC B;  1KKD A;  2W6I G;  4JBZ A;  4O4L B;  1N7S D;  4W80 A;  2K1E A;  5AW3 B;  1BHA A;  3RBX A;  3V4Q A;  1H38 A;  3KZI H;  3RVY A;  4U3F G;  3DYM A;  3CJH A;  2H8P D;  4WCE V;  2MKV A;  4UCV A;  1G1J A;  2YIB A;  3BVT A;  3SJC C;  1D6Y A;  2QVA A;  3L71 J;  2EIK C;  3L70 D;  4UVA A;  1HTY A;  1AVM A;  4IFM A;  1N9E A;  1VDF A;  1HNZ B;  5KUK A;  4ZOL A;  2WWW A;  5J9P C;  5CN0 A;  1HMU A;  2XDJ A;  1NSV A;  3HKB B;  3ZHS A;  1XEQ A;  3A0H E;  1XRE A;  4QGP A;  3BLC A;  1FAF A;  1VQ8 V;  3ZN0 A;  4TQF A;  2YKP A;  3MPH A;  1BCC E;  2VRS A;  4I0X A;  3N2G A;  3D6Z A;  4CPG A;  1SQP D;  3RK3 E;  3SYQ A;  3RGB A;  5JCO C;  3S4A A;  2Y0P A;  1JM0 A;  3X3X A;  3BAA A;  2OQE A;  4U7N A;  4W7Z A;  4EKW A;  2LXB A;  4X89 A;  1XQ8 A;  3KPE A;  1QL2 A;  3BLB A;  3W7T A;  4YPC A;  2GTA A;  3U1C A;  1A02 J;  2GM4 A;  4DV4 B;  4B3M B;  2AEF A;  1IXB A;  4BIZ A;  5JQG A;  4TTG A;  4BZE A;  3SJQ C;  5EYP B;  4WY4 B;  3MTU E;  4YXW H;  3Q4H A;  3E1R A;  2E2U A;  2UXD B;  2XN1 A;  2ZAE B;  1SQB E;  2F1M A;  3CV5 A;  1F4N A;  2PFX A;  2PYJ A;  3H1K E;  2WLH A;  1HJ0 A;  1IQX A;  1YQ3 C;  1AB3 A;  2QSI A;  1N0J A;  1Q86 W;  2N1T D;  1XHX A;  4I9W A;  1GL2 D;  5IYZ A;  2P4K A;  4R7C A;  4JI0 O;  1XMO O;  3FYI B;  4CS3 A;  3ZS8 C;  5JMF A;  1N34 O;  2BCC D;  3RT3 C;  2Y9Y A;  3RK2 B;  3BGA A;  3ITK A;  3T0U A;  1X4T A;  1PP9 J;  2IBZ E;  1LTJ B;  3L75 G;  1RSO A;  2IM9 A;  1L0L J;  3CC2 V;  3D71 A;  1ZXG A;  5BR8 B;  4I50 B;  1YBK A;  5L3C A;  2WSC H;  1S76 D;  1N32 B;  3L37 A;  2QTS A;  3H1K H;  4AYC A;  3DDF A;  2QJY B;  3VP8 A;  4LP8 A;  2Y0D A;  4CS4 A;  3AE1 C;  1SQB H;  2NN4 A;  1F9G A;  1V7V A;  1NOH A;  4OVN F;  1TU5 A;  1BCC J;  4R50 A;  2K1A A;  4YHH B;  1GM7 A;  1JOV A;  4LNU B;  2R3C A;  2V4D A;  4ZI7 A;  2A9H A;  3AG3 C;  1QX1 A;  1SQB K;  2EZP A;  1WMN A;  1L4A A;  1PIX A;  2WAM A;  1DIP A;  1EGU A;  2OAR A;  1DEE G;  3HTK B;  2Z4E A;  2PNC A;  1W2B O;  3ZX6 A;  2F1A A;  1L0N H;  3NFQ A;  3K04 A;  1XL4 A;  1Q6H A;  1TQT A;  1K73 W;  3FFQ A;  1VQO V;  2ZXW B;  4UV9 A;  1OZH A;  1EM1 A;  4J7Z A;  5LMU B;  3L75 D;  1AVK A;  5APT A;  3TGU J;  3A8T A;  1L0N K;  3SYO A;  3DX3 A;  1F7Y A;  3H1K J;  1M1K Q;  1BSH A;  4JF7 A;  1S4X A;  2WLI B;  1VQP P;  2XTA A;  1SQQ E;  2HOD B;  4JI6 O;  2CK3 H;  5KMG B;  3E22 B;  3I3E A;  5AVV B;  3H01 A;  4NTY A;  3OMI B;  4CH4 A;  1YI2 P;  1US1 A;  2R9R B;  3ASO C;  3G6B A;  1PP9 E;  1PS3 A;  3H32 B;  2UXB O;  3ZJZ A;  2X7R B;  2C0W A;  3JCU E;  3N2K B;  2YXL A;  3LDD A;  3N27 A;  1H2L A;  2R9A A;  2FY8 A;  2Q1F A;  2R72 A;  4LF4 B;  1K04 A;  3O65 A;  1PPJ H;  2CTP A;  2EJ7 A;  1CB8 A;  3X2Q B;  4JI1 B;  4CC5 A;  4DV2 B;  3AE8 C;  4ZKI A;  1LF6 A;  1SES A;  5IJ0 A;  1S0V A;  4UB8 Z;  2YO3 A;  4H44 D;  1FYJ A;  3RFR A;  2N9B A;  1K1Y A;  1N2D C;  1YSC A;  3QDE A;  1BGY E;  4IIJ B;  4W4K A;  1KZU B;  3CX5 H;  3H25 A;  5FLX N;  2KG7 B;  3CPW O;  1GM8 A;  3BPZ A;  3SEP A;  3II6 A;  1TVK B;  1UI8 A;  3HE4 A;  2VQF O;  3CRC A;  1SQX E;  2P2U A;  2WW3 A;  2ZT9 B;  4U3F D;  2FKX A;  4LF4 O;  4PV1 C;  2N1T B;  4MN4 C;  5CCH C;  2FFD A;  1BZK A;  3K59 A;  3SYA A;  1QVG U;  4JI2 B;  1JY2 O;  3LIE A;  4HYO A;  3E2E A;  2UXB B;  2CUG A;  2JS5 A;  2QWN B;  5CA1 A;  1RF1 A;  3AFL A;  4K3A A;  2IX7 C;  3IGA C;  3HE5 B;  2Q0A A;  3RWR D;  3I5C A;  3SJB C;  2O3J A;  2F66 C;  1VQP V;  1LUV A;  2OGU A;  3BRT B;  3TGU E;  5TIS Z;  1N7S C;  1NTM J;  3ZED A;  4P30 A;  3CS5 A;  1LF9 A;  1MMZ A;  2ATK C;  4L76 A;  1OW6 A;  1OHH G;  1LJ2 A;  3OUF A;  2A45 H;  1J1D B;  3I55 P;  1RWH A;  3L71 H;  3RW0 A;  1G4Y B;  2OOV C;  2OCC B;  1THZ A;  4FK5 C;  1QVF O;  5CBO A;  3UO2 A;  4AIL C;  1J1D C;  3T2Q A;  4KFE A;  2X6C A;  1K9M Q;  1JRQ A;  2Q7H A;  3B8E B;  2EAE A;  4U3J A;  5GTI E;  1N73 C;  3SPJ A;  3AK3 A;  4FM1 A;  4I2L C;  1COW G;  1HP8 A;  3FB5 C;  3MUD A;  2JGU A;  2YMK A;  1OIP A;  5CBH A;  1F51 A;  1FU1 A;  4MTF A;  5B66 Z;  3BUQ A;  4YHH O;  1VF5 D;  1X59 A;  2WPQ A;  1I5X A;  2FYZ A;  3KN4 A;  2Y69 C;  2YEV A;  4BXL A;  1EQ7 A;  2XAS A;  1H8H G;  3ASN B;  3WU2 Z;  1JYN A;  2A06 E;  1HDJ A;  2WW2 A;  2VQE B;  1NVP B;  3JAW A;  1FKA O;  4JAU A;  1L8D A;  1KN7 A;  4O2B A;  4EDF A;  1XMO B;  3OEE G;  1IBL O;  3UM7 A;  3UCS C;  3VQX A;  2P7J A;  1ZAU A;  2FYU E;  2ZDI A;  3CME P;  1EZJ A;  3W7S A;  1QLE D;  2OW7 A;  1P7G A;  4FM2 A;  5BU5 A;  4G27 B;  1ZL8 B;  4PV1 B;  4DR4 O;  2ZVN B;  2ZDI C;  5LP6 A;  1BT8 A;  1N7L A;  2XNX A;  1NGM B;  1KP3 A;  3FAV A;  4N6J A;  5AVS B;  1D6Z A;  2R32 A;  2E74 C;  1AJN A;  4O2A B;  1J1E B;  5JVD B;  3D4Z A;  2CH7 A;  3AG4 B;  3VD5 A;  5ITZ A;  1WAZ A;  3X41 A;  2FML A;  4O4H B;  2QE7 H;  1IVU A;  3R66 A;  2CFG A;  3L36 A;  3L72 H;  3VBB A;  1IUR A;  5EFW B;  5KLV D;  2W8Z A;  4DR4 B;  3UQ8 A;  1S2E A;  5AW0 B;  2WLL A;  1BGY D;  3OD4 A;  5BMV B;  3RYC A;  4O4I B;  2HYN A;  3ZHR A;  2AZ2 A;  5GTH H;  1T3J A;  1SRY A;  4BW5 A;  5KHJ A;  2FUT A;  3TY1 A;  2DW4 A;  2Q6A A;  3M9H A;  2DJV A;  5LGN A;  1BE3 H;  4J10 A;  5B1O A;  5B1B C;  3SPH A;  2C9N Y;  1XHZ A;  1ROP A;  2ZXQ A;  3H1L H;  4BRY A;  3G4S P;  3HKC A;  4LF8 O;  1WMP A;  2AHY A;  3B8N A;  4DYL A;  4KHX A;  2IU3 A;  4TOI A;  1WMK A;  2RMZ A;  1NTZ J;  3VMA A;  2NPS B;  2FXM A;  2XAJ A;  4JI4 B;  3JAT A;  1ZRT D;  5DED A;  4FLT A;  5B5E H;  5JCO A;  3CP1 A;  5ITZ B;  1B06 A;  1AR5 A;  2D2C C;  1AFO A;  1KU9 A;  1N7S A;  1W2Z A;  1YI2 V;  3DXR A;  2A06 H;  5IJ9 A;  1OJO A;  1YEW A;  3IFX A;  2JKA A;  4YXW G;  3NXS A;  3RYC B;  4FNQ A;  4DV4 O;  4B3M O;  3GLM A;  1EXI A;  3B8M A;  2KSJ A;  1OCC C;  3GVM A;  2PGD A;  3RL0 g;  2Q9L A;  4F6E A;  1N7Q A;  1KYO F;  5LMN B;  3T09 A;  1FS0 E;  3AG3 B;  2RDC A;  4LF7 B;  3V2N A;  1LP1 A;  1IVX A;  2WZS A;  3E7K A;  4I4T B;  1IX9 A;  5CA1 B;  1BQ0 A;  2QJK C;  2HKO A;  2HPC A;  1MFT A;  5LHG A;  2KS1 B;  4BRY B;  4BIO A;  1RH5 B;  1Z2G A;  5B66 E;  1L0L D;  1JX9 A;  1OVR A;  4UFZ A;  3P32 A;  1LTA C;  4U7J A;  3E1F 1;  4N78 E;  2QJY C;  1SER A;  4OXS A;  3B5N C;  4NVP A;  3VQV A;  1IDS A;  4DR1 B;  1FFX B;  4E4E A;  1FD9 A;  1HNZ O;  3ZN1 A;  1NR7 A;  2H89 C;  5KA6 A;  2WIT A;  2GA1 A;  1BCC D;  1CZQ A;  3B5N A;  1ZW0 A;  2ALW A;  3SYC A;  3DDG A;  2F43 G;  1LWU A;  3OM3 B;  3S4C A;  5IWA B;  2CTR A;  3DXR B;  3FB6 C;  3FYE B;  1XOU A;  4LC1 A;  4PEL A;  4LFC B;  3RYH A;  3RYF A;  5BZB A;  2W0Q A;  1M7L A;  3IAO A;  3P7K A;  5KKZ B;  2D2C B;  4U3J B;  3K57 A;  4JF3 A;  3JAK A;  4JI5 O;  1DH3 A;  2DYR B;  3UO3 A;  2P5O A;  3MV0 1;  4X1Y A;  3ZRW A;  2FYU G;  4I6M C;  4XE5 B;  3V4W A;  1JR9 A;  5LXT A;  2IW5 A;  1KC8 Q;  2WVX A;  1YJW P;  4PV1 D;  1R1B A;  1H8A A;  4JYB A;  2JRI A;  3W7X A;  1Z45 A;  4I9Q A;  4Z1M G;  1QBZ A;  4IHJ B;  5JJE B;  2IJK A;  1NU1 H;  1SQP E;  1QWU A;  1UG9 A;  4FNR A;  4FLX A;  4UVC A;  2WTY A;  1FFX A;  3JAW B;  2QRX A;  4L8J A;  2Y74 A;  3VDB A;  1CXZ B;  1A32 A;  3HKD B;  4PDL A;  1OX3 A;  3K08 A;  2W27 A;  4DXW A;  1KIL B;  2V7Q J;  1K5Q A;  5EIB C;  2VWJ A;  5LMN O;  2HG5 C;  2ZE5 A;  3T4D A;  5GON B;  1FZB A;  1L4A C;  1S9K E;  1U97 A;  3PP5 A;  2WT7 A;  2WVR A;  4ABM A;  4WF9 V;  4JPZ B;  1VQO P;  4YJ2 B;  1SQX G;  4PDM A;  2AZ0 A;  2WMM A;  5EK0 A;  2CQT A;  2BE3 A;  1Q81 W;  2XOK G;  4O2A A;  2WOF A;  2W90 A;  1VAR A;  2UUB B;  1Q81 Q;  1AIL A;  2BOC C;  2WA4 A;  4GT1 A;  5K1P A;  3H1J H;  1OJN A;  1GM9 A;  4O4J B;  2E76 D;  4D6T E;  1GK9 A;  3L73 D;  4PA9 A;  3MHV A;  1VMG A;  3A24 A;  1PPJ G;  1VQ7 P;  4B7E A;  2C10 A;  5TJH A;  2WSS H;  3AG1 B;  2Q7E A;  1VQK P;  1LTG C;  1W59 A;  5IY5 C;  1K4C C;  3I55 V;  2E5T A;  4LH6 A;  2FBW C;  4G2K A;  2V7Q G;  1R3J C;  4FLU A;  3ACS A;  4HAM A;  3C8V A;  2EJR A;  1JEK A;  2JVD A;  1KIL A;  4TV8 A;  1J5E O;  3CCU P;  3VSM A;  2AW9 A;  2KYV A;  4OGQ D;  3CCV P;  1JFF A;  1W0J G;  3SR2 C;  3U11 A;  3D3Q A;  3FX7 A;  1RQV A;  5L8R J;  1CP9 A;  4TV9 B;  2KB7 P;  4UB8 H;  2ZD9 A;  1W2E A;  3CCS V;  1SF9 A;  5IYD O;  2Q73 A;  2NPS A;  1MOF A;  3LVT A;  3BAB A;  2RQ6 A;  1VQ4 P;  3I5D A;  4L87 A;  3A2A A;  1PPJ E;  5KAF H;  1FAV A;  2JWD A;  5AW2 B;  4WBN B;  4AHC A;  1NTK H;  2XAQ A;  2E22 A;  1PL4 A;  2B88 A;  2EIM B;  3U0Z A;  3OTO O;  4LF8 B;  2OQE C;  2B1I A;  4KL1 A;  5EBL C;  2HTB A;  5BVZ A;  1IXM A;  1DGS A;  4PD4 H;  3L9D A;  2QM7 A;  4JZG A;  3L74 G;  3PRJ A;  1PL0 A;  3V5B A;  4TV8 B;  4F6R B;  2OYH A;  1JA8 A;  1BGY J;  3CE2 A;  1SQQ D;  4HBN A;  1N8R Q;  5KX5 A;  2WSE H;  4RJT A;  2OYI C;  5EZY A;  4Q20 A;  4QPK A;  1W5Z A;  3LNM B;  4H0L B;  4DK1 A;  1PX4 A;  2F7R A;  2IBZ I;  3THO A;  4NXM O;  2W6A A;  1XTC C;  5KBP A;  1ZN5 A;  1LUR A;  3B40 A;  3G80 A;  3APO A;  5AW7 B;  3OUS A;  3TGU D;  5DN6 G;  1M57 D;  2N1T C;  1HN0 A;  1Y47 A;  1AI6 A;  4ZKP A;  1KQS O;  2QEX V;  1SFC D;  1Z5V A;  2FYU K;  4X66 B;  5J2T B;  1US6 A;  3L35 A;  2WLM A;  2N74 A;  3CYO A;  1LWU B;  3F5W C;  1AR4 A;  3MUY 1;  4JYA O;  1HF9 A;  1XNQ O;  2ZT9 C;  3OAK A;  4HB1 A;  3SWY A;  1NH4 A;  4KUM A;  2I1K A;  5L3F A;  1EZV E;  1L7J A;  3HI7 A;  3JAR B;  4LFA O;  3D6Y A;  3S4D A;  2QEX P;  4FLV A;  2RKL A;  2N1T A;  4J42 A;  3AEB C;  5APY A;  3WUU A;  1XMQ B;  4ASU G;  4ASW A;  2FFD B;  1ORQ C;  4PI0 A;  1DLB A;  1MZ9 A;  2QJP B;  2QKC A;  1PV0 A;  2BRW A;  3ABK B;  1FZF A;  3EVK A;  4RES B;  4NTW A;  2E5L O;  1KEC A;  2GUZ A;  3ABK C;  3ABT A;  1BE3 J;  1LT9 B;  4ZKU A;  2CFW A;  1JO5 A;  3FGA D;  3TK1 A;  2ZR3 A;  3MD0 A;  1EN4 A;  3ZBH A;  1KFM A;  4LF6 B;  3I3D A;  3CZS A;  1DF5 A;  1NSM A;  1G1I A;  2HJD A;  1NH2 D;  5AVY B;  4J5T A;  2QWO B;  4AQR D;  2E24 A;  1TUE B;  1AI4 A;  3L72 E;  4GUN A;  2F1B A;  3CXH H;  1SPU A;  3STZ C;  3H1H E;  4FLW A;  1PD3 A;  4GLX A;  1Q82 W;  2X6A A;  2LR2 A;  1Q7Y W;  1GDT A;  1MSD A;  2NPS D;  4EFE A;  3CRA A;  1Q7Y Q;  3CEI A;  1W5C E;  3PTZ A;  2VRZ A;  3JAL A;  4LF5 B;  2UWJ E;  1PU4 A;  3RBZ A;  2Y69 B;  5AVX B;  1K9M W;  4GKG A;  3SXX A;  2H43 A;  2JGD B;  1LUW A;  1W0K G;  2OYI B;  3KCX A;  1AV1 A;  3V2P A;  3GWK C;  3HKE A;  4X20 B;  1NU1 G;  3T1C A;  5JQG B;  3L70 G;  1K7D A;  1SA0 A;  5EYP A;  1QVG O;  2Y4U A;  2KZJ A;  1VQN V;  2WSF H;  2YNY A;  5DJT B;  5CJ4 A;  3QFY A;  3RYI B;  4JV5 O;  2M5A A;  1SII A;  2QSA A;  1SQX K;  4G28 B;  3F7Y C;  2IBZ D;  5E79 H;  1PX3 A;  1AVY A;  4GIF A;  2FYN C;  3MIW A;  2H8P C;  3JAS A;  3RK2 C;  3STL C;  5IWA O;  1NH2 B;  3CC4 P;  1Q8I A;  1QAF A;  3SPG A;  1OZ0 A;  3OTF A;  1LTJ C;  4DV0 B;  5E1Q A;  3B09 A;  2PY5 A;  3EJQ A;  1WA8 B;  4UCR A;  1IBK B;  4FJC C;  2WPR A;  3ZIA G;  3QO8 A;  3TXS A;  2C11 A;  4DV3 O;  1WP7 A;  2Q67 A;  1BDC A;  1IVS A;  2XSG A;  3T0D A;  2SPZ A;  3H1H J;  3AG2 B;  4DOJ A;  3BA8 A;  2LGQ A;  4EB6 A;  1D5N A;  1EN5 A;  4J9Z B;  4RQF A;  1OVV A;  3M0D C;  1AV4 A;  4DR2 O;  5BR8 O;  3RYI A;  4OH8 B;  2EIN C;  3KG2 A;  3AEI A;  2WLN A;  2UUC O;  5GTH Z;  4WY4 A;  4DR7 O;  2CWT A;  4I55 A;  1S5L E;  3ML0 A;  1MMX A;  3WG7 B;  4DV6 B;  1JMB A;  1OCZ C;  3EJP A;  2ARH A;  4YIO A;  5KLV J;  1NTM D;  3P30 A;  1FC2 C;  1PFI A;  3CC4 V;  4WFE A;  2LW7 A;  3AE3 C;  1RQU A;  4DR3 B;  1SQX H;  2Q0O C;  3K0G A;  5AW4 B;  5FL7 G;  1NSS A;  1GK4 A;  2L6L A;  1GAX A;  2WOH A;  1XNR B;  2CPB A;  2KLV A;  3IF4 A;  1OCR B;  3BUI A;  2QTO A;  2MJZ A;  4N21 A;  3CCQ P;  4YIP A;  1VF5 C;  1T2K C;  2OW6 A;  1GN6 A;  3HR0 A;  3J80 N;  4PJ0 H;  1MA1 A;  1P7B A;  4UB6 Z;  2PUS A;  4EIJ A;  3CCM V;  3K5M A;  3CX5 D;  3AE7 C;  1YHQ P;  3JSL A;  1IZ3 A;  4QJF B;  2YMY A;  1S77 D;  1CI6 B;  4B08 A;  2CE4 A;  1AP6 A;  1OMI A;  1L7K A;  3HD7 B;  3J7H A;  3APQ A;  3CCE P;  1H8E G;  2DQ3 A;  2K9Y A;  3VSN A;  4BAY A;  2QKS A;  2EZO A;  2MK3 A;  5IE9 A;  5APQ A;  3PGB A;  3CC2 P;  1SIH A;  1YJN V;  2P10 A;  1BCC G;  3X3Y A;  1HW7 A;  2OTK E;  4UCO A;  3K06 A;  1AQ5 A;  2YX9 A;  4K8X A;  2Q1K A;  2W6J G;  2YIB D;  2R70 A;  3G9R A;  3VMX A;  4OGQ B;  5CBN A;  4DV1 O;  2P1J A;  2EX3 A;  2W83 C;  2ZR2 A;  1TXK A;  3BVV A;  1NSR A;  1U96 A;  2D3O W;  3VTP C;  4JAS A;  1L0N E;  1K1X A;  1WMO A;  2GHY A;  3BEH A;  4M3L A;  4C7R A;  5APW A;  3CZJ A;  1OCC B;  3HIG A;  5APV A;  1BGY G;  2UUC B;  2GTS A;  2OT5 A;  3A0B Z;  2GDS A;  4U3F E;  2OCC C;  4LWS B;  3DX4 A;  2OYI A;  1SKV A;  2KXP B;  1S9K D;  2OTJ V;  1FZC B;  4X1I B;  4GOF A;  3CMA V;  4OK2 A;  1QR9 A;  4JGS A;  1MG1 A;  3UT5 B;  4X65 O;  1YZB A;  4BW9 A;  1U7M A;  3ZDM A;  4GYC B;  3H1I E;  3LOY A;  1FJK A;  4K0K O;  5APU A;  3SDL A;  4OK4 A;  4O9B A;  2F95 B;  1Y74 B;  2P7T C;  1KBH A;  3JCZ A;  5HFM A;  3E35 A;  5CMU A;  1MUU A;  2G8Y A;  4DV3 B;  3TNU B;  2JJ1 G;  3JCU H;  3AEF C;  1HTL C;  5IJ0 B;  3K5O A;  3T1Y O;  1VQN P;  1KYO H;  2AEM A;  3QWO C;  1HR0 B;  4JI8 O;  4XDK A;  1NS1 A;  5AVQ B;  2ETN A;  1NKN A;  2KG7 A;  2IFM A;  4H44 C;  3JYC A;  3EWK A;  4DZO A;  5AVR B;  1HNX O;  3J81 N;  2UXC O;  1V9P A;  3IAY A;  1MZF A;  2NPS C;  4NPF X;  4D7S A;  2HVK C;  3AE4 C;  1N7R A;  4GDO A;  5J2U A;  2E2T A;  2A3Q A;  3LSQ A;  1QLE B;  1QCE A;  1TUB A;  3FD9 A;  1KIL C;  1P84 E;  1TAE A;  1KKC A;  1SQX D;  3TNU A;  3KII A;  1KB9 D;  3IAP A;  2XAH A;  3AE2 C;  3M91 A;  3CHX A;  1B6Q A;  2A0L A;  5KHI A;  2R5B A;  2EIL C;  3PN1 A;  5FNV A;  1ZL8 A;  1K73 Q;  1FJP A;  2ZIN A;  4HJG H;  3FXE A;  1RWG A;  1R3I C;  3BY6 A;  1V54 B;  2WGQ A;  1KYO E;  2BTO A;  4PJ0 Z;  2YXR B;  2KLU A;  1RKY A;  1YTF D;  5EBW C;  3NJX A;  3CCS P;  3B77 A;  2H94 A;  3D51 A;  2WVY A;  3EXA A;  1CEZ A;  1Y66 A;  3VOU A;  2QGN A;  4JQ0 D;  1W6C A;  2K9J A;  1YQ2 A;  1FPO A;  1J95 A;  1IU7 A;  2JO1 A;  4MTG A;  1S5L Z;  2WLL B;  3L71 E;  4MVU A;  4OPH A;  1NKZ B;  5CCG A;  1VQL P;  5B3S B;  4TLF A;  2K88 A;  3AE9 C;  3T0B A;  1IFM A;  1KUQ A;  3ZCC A;  3I56 V;  2PI5 A;  3D8C A;  1RY3 A;  1JOC A;  3GHG A;  4L75 A;  1NTM H;  3KDP B;  2YKO A;  3IC7 A;  3CCV V;  4W4L A;  4UVB A;  3CCU V;  1NQT A;  2X6B A;  1PNK A;  1MMY A;  4MSW C;  3BCC G;  2YFN A;  2ZYA A;  4CC6 A;  1N32 O;  1KQF B;  1RF1 C;  2LJ2 A;  2QJ1 A;  3L73 E;  4KFF A;  2N9Y B;  3FKS G;  2IH3 C;  1ZX3 A;  1N4C A;  2P58 A;  3EHB B;  3JAT B;  1LOH A;  2JDI H;  1VQ7 V;  4H13 C;  3FXD A;  1URF A;  1G2C B;  2E76 C;  1RPR A;  4Q6G A;  5IJ9 B;  1BE3 E;  3FWN A;  3MP7 B;  1R8E A;  1JZ5 A;  4B3R O;  1XL6 A;  4BIU A;  3JSN A;  1FFT B;  3HRN A;  3JAR A;  3SWK A;  2BRP A;  3H1H H;  2AXT H;  5AW6 B;  1MV8 A;  3GHG B;  1EDK A;  4DV6 O;  5BMV A;  1LTS C;  2DYS B;  2R44 A;  1LP1 B;  3K5B A;  4O4I A;  1N33 B;  2F18 A;  1K34 A;  3PH0 A;  3GHG C;  3TGU G;  2N04 A;  1I8Q A;  2VQE O;  1PGQ A;  1O7D D;  1EZV G;  2M6Y A;  4LF9 O;  1TU3 F;  4JTA B;  1BHB A;  3ZMS A;  3I3B A;  1ZRT E;  1NBM G;  4YY3 O;  4PD4 E;  3N7N A;  4B3R B;  3VMY A;  3AFJ A;  3AG1 C;  1N0N A;  1ZUQ A;  2IDB A;  5E79 E;  3QVN A;  2JIZ G;  3QNE A;  2R9I A;  2Y48 A;  3W68 A;  1SET A;  5DM6 V;  1SQV K;  1J0M A;  1NTK E;  2V7Q H;  3EJS A;  1SQP K;  1SVF A;  2JKP A;  4EV2 A;  1U7J A;  3VN0 A;  3ASO B;  4C46 A;  1E5W A;  1R3L C;  1S72 P;  1XTG B;  1XNR O;  5B1A B;  2KZI A;  2HTA A;  2D2C D;  1NS2 A;  2YUA A;  4X1Y B;  3ZRW B;  4ICG A;  1NU1 E;  3CME V;  4RQE A;  1PZQ A;  1BQZ A;  2WLI A;  1TA8 A;  4ZIB A;  4FFB B;  4NPE A;  1PP9 D;  1DX7 A;  2ZE7 A;  1SNZ A;  1RE4 C;  2ADQ B;  2KB1 A;  4FLZ A;  1VQ5 P;  4JI3 B;  3ZHQ A;  2FL4 A;  3HKE B;  4WFH A;  1VQ8 P;  3KQG A;  1EZV I;  1SFC B;  4BZH A;  3WMM 0;  3QF7 A;  2BEQ D;  1OCR C;  4BR6 A;  2ZVO B;  3CXH E;  1VF6 A;  2GBO A;  3M06 A;  2Q5U A;  1GMG A;  5BU8 B;  1SFC C;  4UCU A;  5F2V O;  1D6U A;  1WT6 A;  1M1J A;  2WSC J;  1JZ8 A;  2JKE A;  3BFR A;  3Q4H B;  4DV7 B;  2UUB O;  4LF5 O;  2WT7 B;  4U7O A;  4Y99 C;  1TQW A;  1W7C A;  3VQW A;  2P22 C;  1YYC A;  4P9O A;  2Y9Z A;  2N05 A;  2CIQ A;  1D5A A;  1BDD A;  1SQQ H;  4RO0 A;  5B1N A;  1GD2 E;  3QFZ A;  4DV0 O;  3HE4 B;  1IBM B;  1VF6 C;  1T3U A;  1PGJ A;  4DW1 A;  2KIK A;  1YJ9 P;  1PL5 A;  1S1C X;  2CDY A;  1LGH B;  3BVH A;  1R33 A;  4JI7 O;  2CK3 G;  4GZR B;  1DK1 A;  4R6Z A;  2ZM6 B;  3G6E P;  3CCJ P;  5B1A C;  5CBG A;  3FWL A;  2XU6 A;  1KQG B;  1GU4 A;  2BCC G;  1JY2 P;  2RNB A;  3T97 A;  4KHP B;  2B9B A;  4JI1 O;  1OVU A;  2KQX A;  1JTH B;  1M4U A;  5CJ0 A;  4D6T G;  4L74 A;  1KIL D;  3TGU H;  1AI5 A;  2KSD A;  3E8H A;  4ZNC A;  3CCL P;  1DTO A;  3M7M X;  4KTP A;  1M1J B;  1JFF B;  1OCO B;  2M3B A;  1LTB C;  1ZOY C;  1AJQ A;  5KAI H;  3BVW A;  1N86 A;  2UXC B;  1Y9B A;  3TDK A;  5B3S C;  1JY3 N;  1SZT A;  4JI7 B;  1B3Q A;  2CTQ A;  4ZI7 B;  5KLI B;  3CCL V;  3AE6 C;  1P84 I;  3LSU A;  3T1Y B;  2BSK A;  2QDO A;  1NKD A;  2EBO A;  5EIB D;  1HNX B;  1PGO A;  4PD4 D;  3RRS A;  3T0A A;  1FJG O;  1XNQ B;  1NTM E;  1K3E A;  2XND H;  1NVP D;  5DJU B;  1VQM V;  2OOV A;  1E1R G;  5GTH E;  1NTK D;  5HFL A;  3O9O A;  2PI4 A;  3T4Z A;  5CBF A;  4RKU J;  2XN0 A;  1FZG A;  2Q69 A;  3LDC A;  2WPV B;  1BSM A;  4B3T O;  2DN9 A;  1JPX A;  4F6R A;  1QLN A;  1GW3 A;  3OA7 A;  3AG4 C;  2ILM A;  1BS3 A;  4X65 B;  1CI6 A;  5JH7 A;  2POH A;  4H33 A;  4WWI A;  4LF7 O;  4JI6 B;  4DR5 O;  5AVZ B;  5JWP A;  3N9H A;  1M90 W;  1JMM A;  1BMF G;  3AK2 A;  3X40 A;  5D5P A;  1OXZ A;  5CCH A;  3ABL C;  5LOV A;  3O6Q B;  4HYT B;  2FFD C;  3A2F A;  3M99 B;  1DD4 A;  4TUY A;  3K0D A;  2D73 A;  1S5J A;  2B1G A;  2X03 A;  2YXQ B;  1I0H A;  5IYZ B;  2ZYD A;  3S3W A;  4H13 D;  3KYQ A;  5DEC A;  3DEC A;  4GX1 A;  1NU1 D;  1QX8 A;  3EFG A;  4IT5 A;  2M7W A;  1H89 A;  3NBJ A;  3CRR A;  3TJT A;  4N23 A;  3CX5 F;  1MN0 A;  4WY4 C;  3VOP A;  4I5S A;  1WB8 A;  2Q8V A;  4FFK A;  3NBB A;  2UXD O;  1TVK A;  1AI7 A;  3BS6 A;  2YXH A;  4BWA A;  4MVZ A;  3K3W A;  3UKM A;  5JJJ B;  1KTM A;  1HM3 A;  3M0D A;  4E2L A;  2RN0 A;  1PNL A;  3CWB E;  1MZE A;  3KHU A;  5H2F H;  1D2D A;  2PF4 E;  3ETG A;  2KOG A;  5CCG C;  2IFN A;  3SFE C;  3K9S A;  2CFK A;  2ZQ0 A;  1K92 A;  4BWN A;  3AMO A;  3UT5 A;  1R6N A;  3RVZ A;  1ZV8 A;  3VMZ A;  2OYO A;  2NZ2 A;  4OX9 B;  2WCO A;  3BVX A;  1WNS A;  1SQV D;  4MW8 A;  4IL6 Z;  1J1E C;  4D7T A;  2YXY A;  3VD9 A;  4YJ3 A;  4MTO A;  4FVM A;  4DJG A;  2DW3 A;  3CRQ A;  2LQT A;  5KAI Z;  3JD4 A;  2RCV A;  5IT9 N;  1GTW A;  1K8A W;  1T2K D;  1NS7 A;  5C39 A;  4NXN O;  4R4M A;  1R6K A;  4X62 B;  1WPX A;  4DUZ B;  1L0L G;  4B7K A;  4UB8 E;  3DC5 A;  2WYH A;  1HMW A;  4PD4 I;  1P84 F;  3V2Q A;  3Q1N A;  1X8Y A;  2W6B A;  1I94 B;  2WPD G;  3HUS C;  1Q2N A;  2Z5U A;  3ICX A;  3E22 A;  2XV5 A;  2JGD A;  1A02 F;  1NSU A;  3WFV A;  2ITC C;  4DR5 B;  3D70 A;  2LFS A;  5A9G A;  5BXZ A;  2FYU J;  2G38 A;  3CL3 D;  4N78 D;  1K97 A;  1RWC A;  5LGU A;  4KTR A;  1X1J A;  2AXT Z;  3N2K A;  3SPI A;  3GWO A;  2P6J A;  1ULV A;  3K79 A;  1JZ4 A;  3JD0 A;  3JCU Z;  4GKJ B;  1HUC A;  4H13 B;  1F1S A;  2FYV A;  1JZ6 A;  1VQ9 P;  3GF7 A;  2IBZ G;  3L75 E;  4X64 B;  3ZMV A;  3JAS B;  4ZMD A;  3H1L D;  4YTP C;  5A1A A;  1E79 G;  1R5L A;  2K37 A;  4DR3 O;  2OTL V;  1Q6U A;  1H2K A;  2AXC A;  2WA3 A;  4QE9 A;  4K8Z A;  5KHK A;  2CTW A;  3Q5P A;  3KZI E;  1NTZ G;  4Z1M H;  3D36 C;  3EJR A;  1PP9 H;  1IBL B;  2QM8 A;  1GL2 A;  1VQ9 V;  3CXH I;  4LFC O;  3RSY A;  2CIS A;  2PP6 A;  1AA0 A;  2CIR A;  3KCY A;  1P49 A;  1VQK V;  3U59 A;  3ZHV A;  2AXT E;  1ZLL A;  5AVW B;  2KP8 A;  4O4H A;  3WG7 C;  3WA2 X;  3QTC A;  5KLV H;  1M57 B;  1OAC A;  1M1K W;  3LDE A;  3HE5 A;  4LH7 A;  2RN9 A;  1MFZ A;  4MMH A;  3RK3 C;  1E79 H;  2EIJ C;  2P06 A;  3L71 G;  1FDM A;  4GKK B;  2F7O A;  1SA0 B;  2R5D A;  1CSB A;  3A0H Z;  2VQF B;  3OW2 U;  4JYC A;  4AQY B;  3B5N D;  3A5T A;  3R4Y A;  1X22 A;  3SJA C;  4JI5 B;  1BE3 D;  4UCT A;  3W67 A;  1FJG B;  4P2Z A;  3TYY A;  1WJZ A;  2JWA A;  5GTI Z;  5GW7 A;  1NTM G;  3HKC B;  1Q5O A;  1IBM O;  4JV5 B;  1YJN P;  3X2Q C;  3OGI B;  1QU7 A;  3C90 A;  4FZ1 A;  3P8C D;  1NKG A;  2Q7C A;  2ZXW C;  3N2G B;  1MMM A;  1LXM A;  3Q5R A;  3RGU A;  1KB9 E;  5LBQ A;  1R6T A;  4AI8 A;  4GKK O;  1SQF A;  4GOE A;  4JTC B;  1JCD A;  4CZZ A;  2LXC B;  1URQ C;  4L73 A;  3S4R A;  5KJ7 C;  3HD7 D;  4GCZ A;  3V2R A;  5TIS E;  2Q7G A;  1KYO I;  2JP3 A;  1HBW A;  2F7Q A;  4K0K B;  4PD4 F;  4LFB O;  1NTK J;  2Z5H A;  2HOD A;  1JOY A;  1IQY A;  4HNA A;  2WSF J;  1X0T A;  4CS2 A;  4DV5 O;  3GB7 C;  4BTY A;  1IFP A;  1QQC A;  3U1A A;  2QWQ B;  3ZMT A;  3L74 J;  1IZN B;  2J58 A;  1AJP A;  1JB0 J;  4P9P A;  1NU1 J;  2JKV A;  2HG5 D;  3D52 A;  5LYJ A;  1H2G A;  3RL0 C;  2CWV A;  1XMQ O;  3MGN A;  4AUW A;  1YXB A;  1YIT P;  1TQU A;  5EBM C;  4JI8 B;  4DV7 O;  3L74 D;  3EJU A;  1RF0 C;  2YDE A;  4ASV A;  5AW5 B;  4NB5 A;  5LHI A;  4DV1 B;  1EBO A;  1XIL A;  2E75 B;  3KKY A;  3OBA A;  1JZ7 A;  1YJ9 V;  2F93 B;  1WRG A;  4JI4 O;  4QE7 A;  3L4F A;  4H0L C;  3R2P A;  5CB4 B;  1SO0 A;  1L2P A;  1CW5 A;  3N4X A;  1EN6 A;  1FXK A;  2QWP B;  4NXM B;  2IPP A;  2IZ0 A;  4WY4 D;  3E7J A;  1KD1 W;  5KUM A;  4IL6 E;  1RM1 C;  1KD1 Q;  1JYX A;  3W7W A;  5CA3 A;  3JAK B;  4GKJ O;  2OQQ A;  1DEB A;  1C82 A;  3IMH A;  1W3Y A;  5LXT B;  1Z5W A;  3IR9 A;  1FZC A;  1GTO A;  3ABM C;  4X1I A;  3DSQ A;  3MAQ A;  4DR6 O;  1W4N A;  1GN3 A;  2EUL A;  4J9Y B;  1LXK A;  1QVF U;  1M1J C;  3M9B A;  1FZA A;  4NKG B;  4OGQ C;  2ZE6 A;  1SFC A;  3MZW B;  4CBC A;  3HD7 A;  1G1X B;  2GUS A;  3QO7 A;  1YJW V;  3CD6 V;  2YIU C;  1LVN A;  4NXN B;  2ZXE B;  5KAF E;  4CH3 A;  2JDI G;  1I94 O;  1KB9 H;  2FXO A;  3E1I A;  3DC6 A;  1USD A;  3DGE A;  4TSF G;  5KA5 A;  4RO2 A;  3F7V C;  1NR1 A;  1UJW B;  1NSZ A;  2Q6Q A;  3OT7 A;  4UFC A;  5CB4 A;  1QHT A;  1AQT A;  3H1K G;  4HKZ H;  1J2J B;  1NJI Q;  3BUB A;  3M9Q A;  1FDI A;  2BCC J;  5H9C A;  3DYP A;  2E3C A;  4YJ2 A;  4MVQ A;  1JCH A;  3BCC D;  1GL2 B;  1H2N A;  2YI9 A;  5FPR A;  2HLD G;  5LA6 B;  3JD2 A;  4CH5 A;  4QNH B;  3R65 A;  5KKZ C;  1HNW B;  3T97 B;  1QAL A;  3L73 G;  2JK5 C;  1MKM A;  2VS0 A;  1JTH A;  3H32 A;  3WVF A;  3QO5 A;  4CH6 A;  3H1L G;  1W2B U;  3BAT A;  3D50 A;  2CPS A;  2E75 D;  3OTO B;  1KYO D;  2P67 A;  1YQ4 C;  1IFI A;  1L0N D;  2A79 B;  4GX5 A;  1RWA A;  5APX A;  2YFO A;  3ASN C;  1SQQ J;  1T6A A;  2MW2 B;  3OMN B;  2E74 B;  1Y74 A;  4WBA A;  1N7N A;  2CGN A;  5H5N A;  4NYK A;  1M57 C;  1I7F A;  4RAI A;  4JI2 O;  1GK6 A;  3TCU A;  2BTQ A;  2O01 H;  1S5H C;  1K4D C;  1BE3 G;  1M8O B;  1QWN A;  4TV9 A;  1LWU C;  3DX2 A;  3CI9 A;  3K25 A;  3T08 A;  1CPY A;  1WP8 A;  4B86 A;  4ZBM A;  2ZNI A;  4DRX A;  3H1J E;  1SQV J;  2GUV A;  2RMK B;  2OWO A;  1GW4 A;  1LTI C;  1EXJ A;  5H6Q A;  1WN7 A;  1XI1 A;  2WW1 A;  3H1K D;  3JAL B;  1JZ2 A;  1PKX A;  1JY3 O;  3BCC E;  2YIC A;  1RSO B;  3G4S V;  2UUA B;  3Q3D A;  1SQQ G;  2C2A A;  2FKW B;  1T5E A;  4X20 A;  2BCC E;  3NMD A;  4DT0 A;  3E80 A;  1IK7 A;  5AVT B;  4KFM A;  3HKD A;  1I08 A;  1Y4M A;  1RWF A;  4OWF A;  5IY5 B;  3NR7 A;  1AJY A;  4NR1 A;  3A0B E;  3AEC C;  3CCE V;  2FYN B;  2LFR A;  3ALA A;  5EZY B;  2Y0E A;  1NO4 A;  4BZF A;  3HUS B;  5LYJ B;  2QA4 V;  2DYS C;  4DUX A;  3A0B H;  1OW8 A;  3WB0 A;  1SLQ A;  3AED C;  1KIL E;  1RFY A;  3LW5 J;  5LMU O;  5L3B A;  5LGT A;  4EEQ A;  1HR0 O;  3AEG C;  4ZHQ B;  3NTN A;  3IN6 A;  1ENV A;  1D7M A;  2BCC H;  2E76 B;  1DF4 A;  2CG1 A;  2K9J B;  2HR3 A;  1L0L K;  3H1L J;  4WFB V;  5AW1 B;  2WSE J;  3DCD A;  3WIR A;  4GX0 A;  2YEV B;  3SPC A;  4DUY B;  5B66 H;  2HHH B;  3X3Z A;  2Z0A A;  4QMA A;  1EFR G;  1KC8 W;  1SS3 A;  3H6P A;  5KJ7 D;  1KQL A;  2HLO A;  1VQ6 P;  1ZWI C;  1SQV E;  3GMA A;  5AW9 B;  3VD4 A;  2YI8 A;  4UUJ C;  1WLE A;  3CRM A;  4OJZ A;  1T8Z A;  3M0A A;  4FNP A;  2HFE C;  3D36 A;  2ZJS E;  4FMT A;  2WSS G;  3CWB H;  3CCR V;  5H2F E;  3M8A A;  3VDC A;  4XBF A;  3CXC U;  4MT8 A;  2KK7 A;  4TT3 G;  3L72 J;  2KS1 A;  4DUY O;  1YTZ T;  3D3I A;  2HVJ C;  4MVM A;  1V54 C;  3ABV C;  4TQD A;  1R5S A;  5BY1 A;  1NS0 A;  5LP6 B;  1LT9 A;  2FTK A;  1SQX J;  4RUF A;  2A7W A;  2UUA O;  1OWA A;  3G71 V;  4KFD A;  3RK2 D;  3C9I A;  3L72 G;  4UCS A;  2DYR C;  3F5T A;  1R3K C;  2JS3 A;  4GOD A;  2CWU A;  3FB8 C;  4FLY A;  2XND G;  3TF5 A;  1JY2 N;  3ABL B;  4QIW F;  4B3S O;  1AR1 B;  4EOT A;  3CX5 I;  1KOR A;  3CSX A;  2CG0 A;  4XFJ A;  5KHH A;  3HB3 B;  5KLV E;  1NTK G;  5B5E E;  1FZE A;  2ZIO A;  1SZX A;  2JJ2 G;  3JAM N;  5APS A;  4RNL A;  2DMX A;  3L70 H;  1L1F A;  4KHP O;  2WLK A;  4EYY Q;  4OX9 O;  2Y4T A;  3I56 P;  3BUD A;  4JPR A;  3H1L E;  2QWR B;  3E8F A;  2DOS A;  3H1H G;  2QR4 A;  2WVZ A;  2K9P A;  2Q5Z A;  1AP5 A;  1VIB A;  2QKA A;  2IBZ H;  3CMA P;  1UPG A;  1G6U A;  1VF7 A;  1R73 A;  4A5U B;  4LFA B;  2PTM A;  4AQ0 A;  2BEZ F;  2KNC B;  1B04 A;  2IH1 C;  3S9O A;  1N73 A;  3AG7 A;  1HNW O;  1QLE C;  4JI0 B;  2M3E A;  2O1K A;  1N7S B;  1NZ6 A;  3CWB D;  2M5A B;  1Y67 A;  1LTT C;  4FNU A;  5M1B A;  5GON A;  1HWY A;  1FOS F;  2XUM A;  4DUW A;  1LT1 A;  1I5Y A;  1Q82 Q;  2EAD A;  1FXH A;  2XHB A;  1YIJ V;  1NTZ E;  4X62 O;  1HGZ A;  1OCO C;  3AEA C;  4N3Y B;  1QAK A;  3B2E E;  2Q4P A;  4C7N B;  1HWT C;  3ZMU A;  2HJF C;  1KB9 F;  2BRV X;  4IL6 H;  4I4T A;  3W7U A;  4MVO A;  1IK9 A;  4LWS A;  1FXK C;  4R4L A;  3E89 A;  2VWK A;  2GUZ B;  1SS1 A;  3HII A;  1GKF A;  2Q3I A;  3CXH D;  1Q90 D;  1N8R W;  2Q3E A;  4PA7 A;  3ZRS A;  3VDA A;  5H2F Z;  1H54 A;  1E1Q G;  1FS0 G;  2KNC A;  2Y0C A;  2L35 A;  1YTZ I;  1N73 B;  2XKM A;  3DX1 A;  1P4R A;  1LR1 A;  1TQS A;  3TXQ A;  2YKQ A;  3TSI A;  2D1W A;  3RN4 A;  3E8G A;  4I55 B;  1K8A Q;  2ZIM A;  2V4H A;  1JMK C;  1YDX A;  2JR8 A;  1M5I A;  2RH0 A;  1ZME C;  4ZOL B;  2PGG A;  3H1I J;  4Z1V A;  3Q1M A;  1N7P A;  3HKB A;  3BA9 A;  5C8Y A;  1IO4 A;  2CH7 B;  1RJO A;  3L74 E;  4IFF A;  2IZ1 A;  1K5S A;  1S72 V;  1NYH A;  5IYC O;  2YS8 A;  5B1B B;  3WU2 H;  4I0X B;  5KJ7 A;  2JEX A;  3H1I D;  3OB8 A;  4QPJ A;  1F4M A;  3CCJ V;  2NRG A;  1Q43 A;  3OE7 G;  4NTX A;  3ZMZ A;  4RWU A;  2OCH A;  2CQS A;  1JNM A;  3HPL C;  1S5L H;  3T2P A;  1IBK O;  4TWK A;  5KLV K;  3OJA B;  1MSW D;  1M56 B;  1SQV G;  2HHH O;  2H3O A;  1YVW A;  1L4A B;  3TET A;  1YIJ P;  1HXK A;  3H1J G;  1L0N J;  3WUV A;  2IJJ A;  1KSI A;  3ZHT A;  1V7W A;  5C8Y B;  1NWQ A;  1YF2 A; 
#chains in the Genus database with same CATH homology
 2LXB A;  2F1B A;  3RGU A;  3BLB A;  1H0T A;  4GOE A;  4EYY Q;  2LR2 A;  1TQW A;  2LXC B;  5K5G B;  3BUD A;  1BDD A;  4MN4 C;  1QWN A;  3DX2 A;  1TQV A;  3BVX A;  2OTK E;  2F7Q A;  2UWJ E;  2KIK A;  2ZAE B;  2Q1K A;  4K3A A;  1R33 A;  3CV5 A;  1X0T A;  5CBN A;  3BVV A;  5C39 A;  1H0T B;  2M5A B;  1OVU A;  2P58 A;  3LVT A;  2KI7 B;  1LT1 A;  2KZJ A;  2WYH A;  3D52 A;  1LP1 A;  5DJT B;  2JWD A;  4ZNC A;  2I8D A;  2M5A A;  3FXD A;  1TQU A;  2B88 A;  4IOI H;  1MFT A;  2KS1 B;  3EJU A;  1Q2N A;  3BVW A;  5CBO A;  1ZXG A;  3DX4 A;  4ASV A;  1OVR A;  4GOF A;  3DDF A;  1U7M A;  3ZDM A;  3DX0 A;  1EDK A;  1SS1 A;  2R44 A;  1LP1 B;  3EJQ A;  1ZW0 A;  2ALW A;  3DDG A;  2M0B A;  2F18 A;  3PH0 A;  3BUQ A;  1QX1 A;  2F7R A;  2B87 A;  5DJU B;  2FYV A;  1EC5 A;  4BXL A;  3BVU A;  1BDC A;  1O7D D;  1EDJ A;  3DX1 A;  3QWO C;  2KUB A;  1DEE G;  5KBP A;  2SPZ A;  4ZMD A;  1TQS A;  2HR3 A;  1EDI A;  1R34 A;  1Y47 A;  1OVV A;  3MZW B;  4KJM A;  2F1A A;  3BUP A;  1TQT A;  4NPF X;  3CZN A;  3EJR A;  4JBZ A;  2OW7 A;  3EJS A;  2WYI A;  2K3R A;  4HB1 A;  3EJT A;  3DX3 A;  4WWI A;  1U7J A;  4K35 A;  1QWU A;  1JMB A;  2KZI A;  3EJP A;  2QRX A;  4HKZ H;  3BVT A;  1FC2 C;  2RKL A;  2QVA A;  3D4Z A;  1HWW A;  3BUB A;  4ASW A;  1HTY A;  4NPE A;  1PS3 A;  2F7O A;  5EFW B;  2B87 B;  3BUI A;  4NPD A;  2B89 A;  4GOD A;  2OW6 A;  4HJG H;  1NVO A;  3FXE A;  1EDL A;  1S3J A;  2WMM A;  3D50 A;  3D4Y A;  3CZS A;  4CPG A;  1HXK A;  3D51 A;  3MHV A;  2F7P A;  1JM0 A;  3S1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...