4K35A

The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
719
structure length
719
Chain Sequence
b'DDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEAPLLTYAYAHHLTSIDDSNVKRTDMTLQSATKGPMTALVGNEWTLRETELSPVEWLPLQAAPNPTTINEIMTEINKDIASNYTQETAKEDNYFSGKGLQKFAMLALILNKSDQTQLRNPELAQIALDKLKAAFLPYLQNEQADPFRYDTLYKGIVAKAGLPTSMGGTDDLSAEFGHSYYSDHHYHQGYFVVTAAIIHHLDPTWNADRLKAWTEALIRDVNNANDGDEYFAAFRNWDWFAGHSWAGGIKPDGALDGRDQESVPESVNFYWGAKLWGLATGNTPLTKLASLQLAVTKRTTYEYFWMLDGNKNRPENIVRNKVIGIYFEQKTDYTTYFGRFLEYIHGIQQLPMTPELMEYIRTPEFVSQEWDEKLGAIAPTVQSPWAGVLYLNYAIINPAEAYPALRKVQMDDGQTRSYSLYLTATRPHFFRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords glycoside hydrolase family 81 endo-beta-1,3-glucanase
publication title The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase
pubmed doi rcsb
source organism Rhizomucor miehei
molecule tags Hydrolase
total genus 246
structure length 719
sequence length 719
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain
A PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1170 Mainly Alpha Orthogonal Bundle Helix Hairpins glycoside hydrolase family 81 endo-[beta] glucanase 4k35A03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4k35A04
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 4k35A02
1HTYA 5DJTB 3BUPA 1TQVA 3FXEA 2F1AA 1R33A 4WWIA 2KS1B 3LVTA 1ZXGA 3D4ZA 1LT1A 3CZSA 3D4YA 2LR2A 1LP1B 3BVVA 2F18A 2F7OA 2KI7B 3DDFA 3EJSA 1TQSA 2FYVA 2M0BA 4K35A 1H0TB 2R44A 2Q1KA 4KJMA 2M5AA 1BDDA 1O7DD 3EJRA 1JMBA 3MZWB 2B88A 4GOEA 4NPEA 1TQWA 2WYIA 4EYYQ 1NVOA 2OW7A 4NPFX 4IOIH 4ASWA 1HXKA 1TQUA 5DJUB 4HB1A 5CBOA 3FXDA 3BUDA 5C39A 1OVVA 2I8DA 2WYHA 4K3AA 3MHVA 1JM0A 3BUQA 4ZNCA 4GOFA 2P58A 4BXLA 3CV5A 2WMMA 2B87A 4GODA 1PS3A 2JWDA 5KBPA 2HR3A 1EDJA 3DDGA 2QVAA 5CBNA 1H0TA 2F7PA 1U7MA 4ZMDA 3BUBA 1FC2C 1QWNA 2KZIA 4MN4C 3EJTA 2KIKA 3RGUA 2SPZA 2UWJE 3DX0A 4HJGH 1EDLA 1MFTA 3EJUA 4ASVA 3ZDMA 2ZAEB 3D52A 1QWUA 4HKZH 1ZW0A 2RKLA 1EC5A 1LP1A 1U7JA 2LXBA 2QRXA 1S3JA 1SS1A 1OVUA 3QWOC 3CZNA 1X0TA 2F7QA 1EDIA 2F1BA 3DX3A 3D51A 3D50A 1R34A 3BVTA 3BVWA 4CPGA 3EJPA 1Y47A 3BLBA 5K5GB 2M5AB 2B87B 3BVUA 2B89A 3S1KA 2OW6A 3DX2A 3PH0A 1Q2NA 1HWWA 3BUIA 5EFWB 1QX1A 1DEEG 1EDKA 2KUBA 2LXCB 2K3RA 3DX4A 1TQTA 1OVRA 1BDCA 3BVXA 3DX1A 4NPDA 3EJQA 2ALWA 2OTKE 4JBZA 2F7RA 2KZJA
chains in the Genus database with same CATH superfamily
3B8NA 3OTFA 1TUEB 3ABMC 5IDJA 2WT7B 3T0AA 3OD4A 1LTIC 4Z2WA 4CZZA 3K5NA 1LP1B 2F93B 2Y48A 3T0UA 4QMAA 1HWYA 4PDVA 3G6BA 3JAWA 2PFXA 3MPHA 2R44A 4J9YB 3T2PA 4DR6O 3L71E 3CYOA 1JTHB 3LUTB 3JASA 4RQEA 4DR3O 2Z5IA 3HKEA 1QU7A 3Q4HA 4I4TB 1VQKP 3Q1NA 1PV3A 3IF4A 4NPFX 1X59A 3F5TA 1QVFU 2L5GB 4B3TO 1LTJA 2LO1A 1V7XA 3SJCC 3BVHA 3L72E 2KG7B 4LF7O 1YTFD 2ZNIA 4C7NA 3VDAA 4XDLA 3MD0A 2BCCJ 1BQZA 2W6AA 4DZOA 2IH1C 1NBMG 3Q1MA 3GVMA 3V5BA 5GTIH 5JJEB 5LHIA 4FMTA 4BXLA 4ZKPA 2X03A 1JR9A 3L9DA 1Q6UA 2HR3A 5KAIZ 2WSEH 3N4XA 3DDGA 3L75D 1FXKA 1NVPD 2IBZE 2F7PA 3CMAP 2AEMA 2E74D 3FX0A 2E43A 2QKCA 3AG3B 3BFRA 1VP7A 3B4SA 4I9WA 1J5EB 1N7SD 3BCCE 2QA4P 1M90Q 1RQVA 5B1NA 3USSA 3RW0A 2WZSA 1NTKG 1OJHA 1ROPA 5EBWC 3BS6A 4JYCA 2AXTH 1BT8A 4HZ3A 3T4DA 3OUFA 5FNVB 1EZVD 1RE4C 1WMPA 3E80A 3W7SA 1ZW0A 4I5SA 1PGOA 2JWAA 2ZFCA 1EC5A 4JTDB 5EYPA 2NR5A 2E5LO 1L0NG 2IZ1A 1AR5A 5E79E 1DP0A 1XHZA 1ORQC 3HKBA 2XUMA 3LW5H 4IT5A 3CX5I 1OCRC 2AZ0A 1BS3A 4BZGA 2G8YA 3ETEA 3DX3A 1NJIW 2WZ7A 3BVTA 4B3SB 1Y47A 1WMOA 4UXNA 3M06A 1LTAC 2FYUK 3B09A 1L2PA 4LNUA 1Z5VA 2B87B 2ZXWC 2CQTA 3J7AU 1TUBA 4G2KA 1WLEA 1Y76B 2GSMB 2OGUA 1KP2A 1AA0A 1AILA 1OVRA 5KMGB 1UPGA 1I94B 2QWPB 3IC9A 4PA3A 1AVKA 4LLHA 4W80A 3LNNA 1LOHA 1GN4A 3ASNB 4WY4A 4OPHA 1PZQA 2YIDA 1FS0G 1VQLV 2UUCB 1LT1A 4GKKO 2UU9O 2WITA 3LSSA 2MK3A 4R6ZA 3SYCA 4CC6A 2UXNA 3E2EA 3SGIA 1SQQK 3MTUE 4JQ0D 1SQXD 3X42A 1DK1A 4K35A 1IFDA 4X65O 3HB3B 1QNMA 3X41A 4DXWA 1W3YA 1IURA 4JF7A 3L71J 1F1SA 1L0LK 1RWAA 2BEZF 3CCMV 4DV4O 1K73Q 1IU7A 4U3FD 4AI8A 1VQPV 3E22B 1V54C 2IDBA 4DR6B 4NR1A 2P1JA 3HI7A 1IFNA 4OVNF 2ZXEB 1IBKO 2W6BA 1HXKA 5L3GA 4DR3B 3DC6A 5JJNB 1FDMA 2LW1A 3G4SP 3L72J 3G6EP 4Z1MH 1X79B 2E76C 4KP4A 5AW2B 1LTBC 2EACA 2VRSA 3HKDA 4B3TB 3AMOB 3E8GA 5H6QA 1JM0A 1T3UA 3H1IE 1VARA 4LF7B 2ZE7A 4YJ2A 2H94A 2BOBC 2HTBA 4FNRA 3K08A 1KILB 2QJYB 1PD3A 3T2MA 1N7SA 2KP8A 2JDIH 1RJOA 3AE7C 5AW4B 3EXAA 3OE7G 2POHA 3UT5B 1FJKA 4ICGA 1GD2E 5LP6A 4DR2O 5HFLA 4QE7A 3J7HA 1IXMA 2C11A 1HM3A 2QEXV 3WFVA 3H1JG 2ZAEB 1SQQE 1CZQA 2A79B 5CA0A 3HIGA 3HIIA 1GM9A 2RKLA 3S4DA 2V1DA 2AHZA 4OPAA 5KHJA 1YQ4C 1J95A 2BTQA 2HYNA 3HTKA 1K1WA 1R3IC 4IL6H 2JS3A 1D7MA 3Q5PA 3RL0B 1OJMA 4GX5A 1GU4A 2JKEA 3B5NB 1UJWB 3ZHUA 1N7QA 1H8HG 1KB9I 3BVWA 1VF6C 2CTRA 2E5LB 1J2JB 3IAYA 2WVXB 3FGAD 3VYIA 1SP4A 4YPCA 2MJZA 2M5AB 1NS7A 1S5LE 3D6YA 4Y28J 1S1CX 3H1KG 3C3TA 2AHYA 1CW5A 1US6A 1Y74A 3H1HD 3CB2A 3QO8A 4ZI7B 5CN0A 1AR1B 4I7ZB 1RH5B 1SQFA 1TQTA 4X64O 3RK3E 3H32B 4X1KA 2G3AA 1F4MA 2Q9LA 4LF9O 4UV9A 5B1AB 1S9KD 2ZE6A 2QWNB 5L3DA 4LFCO 3ECQA 1L0NK 2W0FC 1GM8A 2J59M 2EULA 3VQXA 3A3YB 3AG1B 4KUMA 5KJ7C 3SYQA 3DYMA 3CRMA 5APWA 3NTNA 3OW2U 2IYPA 2DMXA 1JVMA 3FYEB 5BY1A 3BVVA 2ADPA 2QWOB 1YF2A 4Q20A 4JPZB 4PA6A 1IVVA 2WPQA 4LF8O 1X9VA 3IMHA 3ABLB 2KYVA 4R4LA 1FOSF 1YEWA 1W6GA 4GKKB 2WLLB 2UU9B 1BMFG 3GWOA 2WLJA 4I0XB 3OA7A 5KUKA 1OIPA 2YDEA 5JJJB 1JMBA 2UXBO 4QGPA 3KHUA 1RWGA 2XU6A 2QE7G 3D6ZA 1YIJV 1LUWA 1UFIA 4YJ3A 3ZMSA 4K8XA 1SQVG 2BEQD 3E1IA 4X65B 3QFYA 5B1BC 4FZ1A 2KB1A 2RN9A 3JSNA 1YJWV 2WSEJ 2NRGA 1Q6IA 1NS1A 3F5HA 1RWFA 2CG0A 5LYJB 3SYAA 1KQFB 1OCOC 1VQ4V 1MA1A 3ACTA 1Z56A 4DV4B 2P10A 1Z5WA 2E76D 3JAMN 1JY2P 4QE9A 1OVVA 1XOUA 1PKXA 3BHPA 2RMZA 2H8PD 2YSUB 1AROP 3JD4A 1IBKB 3BLCA 3WA3A 2ZIMA 1NH4A 4P2ZA 4I9QA 2Z0AA 4E2LA 2ZYAA 3M0DC 4GIFA 3GWKC 3ZRWB 4EIJA 3ASNC 4WFAV 4JI4O 2Q7HA 4IYIA 5KBPA 2I1JA 1HMWA 1NTKE 4NB5A 3GG2A 1FFXA 3CC2V 4ZKIA 1MUUA 3I55V 5ITZB 3LIEA 2P4VA 5B3SB 3LW5J 5CHXA 3MAQA 1VQNP 2NPSB 2YFNA 1WPBA 5B5EZ 1OV9A 1L0NE 1H2SB 1RE4A 3AE8C 2KSEA 3AECC 3CD6V 1AFOA 1LVNA 3QO5A 4TQFA 2CK3H 2ZD9A 3KDPB 3TXSA 2W6JH 3R4YA 3OW2O 3IAOA 2WDAA 4WVZA 1YJ9P 2PGGA 3AG2B 1IQYA 5LOVA 3JAKA 3OEHG 1YQ2A 3OJAB 2XN2A 3OGIB 2WVRA 4EI2A 1QALA 4DR2B 1GK6A 4U3JA 4BW5A 2YC0A 1SQBK 2IFNA 3GW6A 3CXHE 2VWJA 1KTMA 2ZE8A 2GUZA 3T97A 5LXTA 3TGUD 3CCEP 1XEQA 2JGDB 1NU1D 1QVGU 1WPXA 3CC4P 1DIPA 4LH6A 1KBHA 1P7BA 5A2QN 1LWUC 2P67A 3L74G 4WFEA 3A0HE 1EDKA 1FS0E 5KLIB 4DV3O 1HJ0A 4C46A 3EFGA 1GRJA 4ZIBA 1OACA 1HW7A 4PV1B 4WFHA 2ETNA 2OOVC 4M3LA 3HPLC 4I2LC 1TAEA 3VDCA 1S2EA 1L7JA 2RDCA 1R5SA 4X20B 1VQ5V 1HGVA 1L4AB 4X64B 1NWQA 3JCZA 3LVTA 4LF9B 3V2QA 1VIBA 3I3EA 3K5LA 1GZLA 4EB6B 4BWNA 1T8ZA 5JH7B 4LFCB 3L73G 2XT9A 1GM7A 2Y0IA 1HVVA 3CCQP 2OTJP 3ABKB 2EIMB 1F4HA 3DDFA 3S4AA 3ICXA 4LWSB 2R5BA 5CCHC 2A9HA 1RF0A 2Q1KA 1WMNA 3RL0C 1PU4A 4GX0A 1O7DD 4DOJA 2XNDG 1R3LC 4WF9V 3MZWB 4PDMA 3PGBA 1NTMH 2HKOA 5IY5B 2EAEA 3X40A 4FM1A 2A06H 2N1TC 4QIWF 3N2KA 5CB4A 1G1IA 2O1JA 3ETDA 3SYOA 1I0HA 5KA6A 1SFCB 3JATA 1KYOH 4Z1VA 2UXBB 4HB1A 2BSKB 2UUAB 3BUDA 1ZR2A 1QVGO 5J2UA 4FK5C 2OTLP 5AW5B 2BCCD 4BIOA 2WT7A 1W5CE 3DGEA 4F4LA 5IJ9B 1N9EA 3FAVB 1JQ0A 4EFBA 2FXOA 5B1AC 5LHGA 2Q5UA 3PHLA 5APUA 2H3OA 3CXCU 1OW7A 2JWDA 1W7CA 1ZUQA 4DYLA 2EINB 1EZJA 3A7OA 2NZ2A 1S72P 1HGZA 2QVAA 3H1JE 3O65A 2WPSA 2YXQB 2IZ0A 3FWNA 1OMIA 1JTHA 3KKYA 3RK3B 3DXRA 4JI4B 1SQVK 3LOYA 2IU3A 1ZRTE 4JGSA 4I4TA 4X8AA 2R9RB 1M93A 2LW7A 3ABLC 2VS0A 3UM7A 4X1YB 1N7OA 4NXNO 3B40A 2Q3EA 1YITP 4DK1A 1ZTEA 3D52A 4DR5O 3F7VC 4HKZH 2CIRA 1BE3H 1M57D 4XDKA 3RYFB 2AEJA 1VF6A 1IO4A 1SF9A 3PTZA 1OCZB 3H1KE 2Q0OC 1HM2A 5E79Z 1X0TA 2Q6AA 2KSJA 5BR8O 2M8RA 3AE2C 4IIJA 5APSA 1ZL8B 2X6CA 3TDKA 2JKPA 3JCUH 2BCCH 2JS5A 5KLVG 1VQMP 3OUSA 1BCCG 5DM6V 1SQPG 5APQA 5AW8B 1K9MQ 3CX5E 1VQ6P 4WFBV 3BUIA 3WUUA 4EDFA 5EBLC 3RL0g 3T1CA 4A5UB 5AVTB 3JALB 1YJNP 4LF4O 4R4MA 2QKAA 1VQ7V 2WA4A 4Y99B 3OR6C 5JCOC 2PAJA 3VSMA 5KJ7A 3J81N 1NS8A 1ZX3A 1PPJG 5EZYB 4PD4D 1AV4A 4BTYA 1TGOA 1JUNA 3BRTB 1EFRG 1J1EB 3WU2H 1T2KC 1XBLA 2NPSC 5FNVA 4DV3B 1HNZO 3H1LG 2A0LA 5LBQA 5H2FE 4FLVA 4UB8H 4K8ZA 4MVUA 1CP9A 1GH6A 1AQ5A 1MZ9A 1Y67A 2LR2A 2R72A 4FJCC 1QHTA 2RQ6A 1DF5A 1SQVE 3VN0A 2F18A 2WW0A 1JB0J 1CI6B 5CCHD 2OWOA 1Q6HA 3X2QB 1DH3A 1VEWA 3RL0D 4H13C 3UCSC 1LF6A 3I5CA 2HVJC 3L71D 2C2AA 2QR4A 1AI4A 1Y76A 3STZC 5GTIZ 2N1TD 4MTGA 3ZJZA 4LFBO 1PGQA 3A24A 1Y66A 2WLNA 2XNDH 3WUTA 1Q90D 5KMGA 2OARA 2Y0EA 4FLTA 1N0JA 1KKDA 5DJUB 2CTWA 3M0DA 2FKWB 4BRYA 3L72D 3SJAC 1PL4A 2FUTA 3JARB 2O57A 4ZKUA 3CCVP 4WY4C 4PV1C 2Y69B 3TETA 1Q8IA 1JY3P 3ZS8C 1GW4A 3EFFK 1XDCA 3L36A 2DW3A 2WMMA 2AXTZ 2M3EA 2EIJB 4TUYB 4JYYA 3BATA 2VQEO 5A1AA 2GUVA 1RY3A 1L4AC 2O1KA 1FDOA 3Q5SA 5B66E 2EIKB 1BGYG 1FZEA 1WP8A 1M56B 1NS0A 1NTZG 1FZCC 3AEAC 3K59A 1ZOYC 4CH3A 5KTBA 1JNMA 2ZCEA 3M9HA 3SPHA 3E22A 3EJUA 2CG1A 2JEUA 1E79H 4DK0A 3PN1A 5LGTA 3L71H 5IY5C 1K1XA 4HAMA 4MVRA 2QWQB 3QH9A 2HP8A 4NXNB 3CCRV 3L74E 3N2GB 4O2AB 5LMUO 1HWTC 4DR5B 2PNCA 1JEKA 2C0XA 4MVOA 3DSQA 2F1BA 2FYUG 1YI2V 1QQCA 2CPSA 4TLFA 1NGMB 1R34A 3I3BA 2Q5ZA 5KKZB 1FZAA 3BLBA 1FAFA 3VQWA 1X8YA 5K5GB 4O4JA 4OGQC 4XFJA 2PZSA 2OOVA 1BZKA 1FZBA 1B06A 2N05A 5GTHE 2C9NY 4HBNA 5BR8B 1USEA 2P2UA 4C7RA 2Y9ZA 2YIUB 1XI1A 1QX1A 2FTKA 1KB9E 3ABTA 3UT5A 2LXCB 2VQFO 4BW9A 1UG9A 3P32A 3L73E 2ZR2A 3EJQA 2Q9IA 1T2KD 1RQUA 2NPSD 2L91A 2IBZH 4LF4B 2HG5C 3RK3C 2AXCA 4FNUA 1HTYA 3JSLA 4MTFA 1NTMJ 4AHCA 2HHHO 1YGAA 1PNMA 1SETA 3BGAA 5AW7B 3JYCA 4QNHB 3ZMUA 3WG7C 5CCHA 1VF5C 3BCCH 4L75A 4WBNB 1YDXA 4DUZO 1VL2A 4ZHQB 1HBWA 2Z4EA 3S9OA 2B1IA 2F7OA 2MKVA 4NYKA 4UCRA 4NEIA 2KI7B 5KLVK 1MOFA 2FYVA 1NHLA 1OCZC 1SQPK 4H13D 1KC8W 3O6QB 2HFEC 2M5AA 1THZA 2LJ2A 2WOHA 4DV2O 1OWAA 1LF9A 2IJJA 3NXSA 5CBGA 2YKPA 3G3ZA 1SRYA 1I08A 3CJHA 1CPYA 1VPCA 4N78E 2WYIA 4ZI7A 1XNRO 2A7WA 1JMKC 2W6IG 1KN7A 3BRCA 4ASWA 4J11A 3WB1A 2WLIB 4L8JA 2XOKG 3CXHF 2P5OA 1NR1A 4DCKA 3L75G 4F6EA 3R66A 3MV01 1IX9A 4Y99C 4LFBB 4O4IA 1DYUA 1J1DC 4WY4D 3U11A 3BA8A 4FVMA 4BIZA 1JOVA 1R3KC 5LL6Y 1NSVA 1JO5A 4NTWA 2KXPB 1H38A 4RJTA 3X3ZA 5H6RA 1BE3J 1L4AD 1WB8A 2DQ0A 3GF3A 2WQYC 1HJBA 2WLLA 1YQ3C 3RRSA 4IL6Z 4NXMO 3BEHA 1M9NA 3SX1A 1G8MA 3RYHB 1HTLC 3A2FA 2VQEB 1MNGA 1VDFA 1W5ZA 1BGYH 3X2QC 1N36O 3JD0A 3KG2A 1D5NA 1RF1C 4YXWG 2LKMA 3CCMP 5KLVE 3L70H 3OR7C 1BCCE 2GDSA 3TJTA 4JAAA 1SQPE 1VQPP 4JAUA 1KECA 4I1LA 4DRXB 1S3JA 1IXBA 3CCLV 1U97A 1IFMA 2HTAA 1W59A 3C9IA 3M91A 3AEGC 2QWRB 1N7NA 2F4VO 1IK7A 4PJ0E 4TTGA 1OJPA 3FB7C 2KNCB 3RN4A 4NTYA 1B04A 2EZPA 4OGQD 5JCOA 2O01H 2ZR3A 4FNTA 2AZ2A 2Y69C 4DV0O 5LMUB 3H1LE 1TA8A 5ITZA 1XMQO 1NTZK 2A45H 2V7QG 3H1IH 4TT3G 3WMM0 2NPSA 3CCJV 2EIJC 1JMMA 5APYA 1QAKA 1US1A 1G2CB 1Q82Q 1H2LA 1LTGC 1R6NA 1GU5A 1XL4A 1SQXG 2EIKC 3R2PA 2WW3A 3RK3D 2HG5D 3SJBC 4LR3A 1NH2D 1MSDA 4N3YB 1SLQA 3OGCC 2VQFB 4PDLA 3A8TA 4FIPC 1F51A 1F7YA 1VF5D 4WWIA 2JKAA 3AG4C 2ZIOA 4E4EA 1OXZA 3TF5A 1QVFO 2QEXP 4UCTA 1YSCA 4U3FG 2ZDIC 3KZIE 4W7YA 3HE4A 2HHHB 4J80A 4CS2A 5KAFE 1SQQH 1TQSA 3WIQA 3SPJA 1AV1A 1PP9G 2HFED 3PP5A 2WSSG 4DUZB 3A0OA 1GL2B 1XHXA 4HYTB 5AVYB 2CFLA 3E8HA 3RSYA 3X3YA 1QLNA 4IHJB 1L0LH 2IJHA 4RKUJ 5KKZC 1LXKA 3E35A 1NQTA 4DV2B 2Y4TA 1QL2A 3ZHSA 5CBOA 1S5LH 1A02J 2XHBA 3K57A 3ACSA 3WIRA 5KX5B 1XNRB 4X20A 4TOIA 1BGYE 3S3WA 3HR0A 2Q3IA 1L4AA 2FKXA 2OYIB 1UIXA 1I5XA 2AW9A 1NTZE 5J9PC 2P58A 2ZQMA 1PNKA 4P30A 2AGAA 3OB8A 4EB6A 3ETQA 4BTXA 5KHKA 4UVAA 1Q81W 1FZCA 3L70E 5BXZA 2DN9A 1VQOV 2P06A 4JAVA 5KUMA 3DCDA 4D6TG 4LWSA 4OK2A 4OK4A 3VMAA 1WNSA 3F5WC 1F23A 3OFNG 4FFBB 1RF0C 1FC2C 1QWNA 1QLEB 2M7WA 4JI7O 3FKSG 4MTOA 2CWTA 2UWJE 3VQVA 3GLMA 2WW1A 1SIIA 2CWUA 1S76D 3ABVC 1Q5OA 4WBAA 1N8RW 4NXMB 3M9QA 2FYUE 3VD5A 1NR7A 1V55B 3IR9A 4HNAB 4W7ZA 4XA4A 3KPEA 1KYOF 2LQTA 3LDEA 1HH0A 1SQBG 4W4KA 3APQA 2XAGA 1IDSA 2OQQA 1N36B 1HNWO 5APXA 1YIJP 1DEBA 1BHBA 1KQLA 1V7WA 4WB4A 3U1AA 4NVPA 1JCDA 1YJWP 3H1HG 5IJ9A 1C82A 3FAVA 2F7QA 1JCCA 3CPWU 4RQFA 1VQ4P 3D50A 4TV9B 2D2CB 2BASA 4AYCA 1QBZA 1H8EG 4ZOLB 2FFDB 3EJPA 2IM9A 3AFJA 1K3EA 1JYVA 2WPRA 1QAFA 1XUQA 4NTXA 3L4FA 3W7WA 2N9YB 1DX7A 3OMIB 1AP6A 3H25A 1RFYA 3BCCJ 3M99B 1OW6A 2R9AA 5K1PA 3AEBC 4X9QA 2F4VB 5EFWB 4JPRA 1P84I 1XQ8A 4XDJA 5APTA 1NKGA 2DOSA 5KHIA 1CXZB 4X66O 4EKWA 3E89A 3S3XA 4DV0B 3CC2P 1NTKH 1XMQB 4NPDA 1W6CA 3I55P 3SFDC 3K25A 5E1QA 3WUVA 2C10A 4KFDA 2RH0A 4JBZA 1S0VA 3JD3A 3EHBB 1IBMO 1L0LE 1RKYA 4JI3O 3CD6P 3RYFA 5M1BA 1L0NH 1YYCA 1R33A 1XMOB 2OYQA 4UFZA 1H2NA 3D4ZA 1BHAA 5JMDA 2X6BA 3KN4A 4D7SA 1XTCC 3HE5B 1H88A 3U10A 2E75B 2Y4UA 3R65A 3EJSA 1ZL8A 3NR7A 3B77A 2YS8A 2IJKA 2ZNJA 3D3IA 4MVZA 1J0MA 3L75E 4PI2A 2JEXA 3CXHH 1ZWIC 1KD1W 1PP9H 4ASUG 3G71V 4CBCA 5BZBA 1SQXK 4GZRB 3AG3C 4CS4A 2UXDO 3DYOA 1EN4A 1PNLA 4UCSA 3CPWO 2ZXQA 2QSAA 1RP3B 4RAIA 2K1EA 1OX3A 5C39A 1V7VA 4BZEA 2I8DA 4LF5O 4K3AA 3OM3B 3K04A 3A0HH 1VQ8P 1OJOA 3HD7B 1FZFA 2DYSB 1BGYJ 3ZHRA 4ZNCA 3U59A 1FKAO 1R1BA 2GTSA 1K97A 3W7TA 2YO2A 3VMYA 4YIOA 1KB9F 1VQ5P 5FL7G 1BQ0A 3L70J 5CCGC 2UUAO 2Y74A 2KLUA 2OIEA 2XN0A 1U7MA 1IZ3A 4F6RB 4QJFB 4ZMDA 1RF1A 3I56P 4MW8A 1JX9A 4PD4I 4JV5O 3RK2B 1GK9A 4D6TH 2PP6A 4WCEV 1MFZA 2OYHB 2W90A 3ML0A 3AEEC 1VMGA 1KFMA 3VOPA 1GL2C 2ZVOB 3JCUZ 2O01J 1EDLA 2WVZA 3RGBA 2R3CA 2WPVB 3TGUG 3VD7A 2GBOA 2FYUJ 2KS1A 1NU1G 5JVDA 4JI7B 3H1IJ 1NJIQ 4GYCB 1SS3A 4XE5B 2D73A 3WB0A 1YHQV 3CS5A 2KLVA 3AE4C 2WO0A 1X1IA 3TXQA 4RO2A 2YXHA 2ARHA 1AVMA 4DV6O 2CFDA 3D51A 1LNQA 1F4AA 1HNWB 3WU2Z 2VRZA 2JP3A 2YI8A 3U0ZA 3A0BE 1NS2A 2OYIC 4FNQA 2GA1A 3JD2A 2CDYA 4UB8Z 1KZUB 1IVUA 3MWXA 2XTAA 2HLOA 1FXKB 1A02F 1L7KA 1AJPA 4D7TA 1FJPA 4P9OA 1SQQJ 3WB2A 4O2BB 1W0JG 2Q68A 1GN3A 3H1JH 1IC2A 2ITCC 2ZDIA 1QLEC 4X62B 3E86A 1PP9E 3Q2YA 4LGDE 3CWBG 5FLXN 4X66B 1L0LJ 1NTMD 1GK4A 1AJYA 1KQSU 2A06D 1AP5A 5EYPB 2PGDA 3N2GA 1V55C 4O2AA 1Q81Q 1IBMB 1KYOD 1EN5A 3HKBB 3APOA 4JI3B 3MV11 2ZJSE 3AK1A 1MMUA 2M0BA 1IJDB 1H0TB 3S4CA 2XAJA 3D70A 1KILC 2QJYC 5KAIE 1MZEA 1JYXA 3H1KH 1F4NA 4MT8A 2FFDC 1NVOA 2OIGA 3CEIA 3G67A 1TUBB 1FYJA 1N8RQ 4H44B 4WFGA 5KJ7D 5BMVB 1BSNA 1T3JA 1TQUA 1VQ9V 5LA6A 4N23A 2V4HA 1YBKA 3CX5H 2AEFA 4D6TE 2JRIA 1VQ7P 3MHVA 1FU1A 2WWWA 2UXDB 1M1KW 3EWKA 3T08A 4WBNA 4ZHQA 3CSXA 3Q5RA 3C90A 4LF5B 3B5NC 2CH7B 3IGAC 1AJNA 5EIBC 1KUQA 5CCGD 2H43A 1EDJA 1JZ2A 1BE3D 3CZJA 5TISH 4KL1A 2WPDG 5H2FH 1SQBE 2QSIA 1NSRA 1ZV8A 2KZIA 1N86A 1M1JB 2QE7H 3ZHQA 2N9BA 1SQVH 4JI8O 1NSSA 3O9OA 3NBBA 1FDIA 3H1HE 3TNUB 4L87A 5LHHA 2YIBA 1GL2D 4I7ZC 1YTFB 1HP8A 1LJ2A 1P49A 2WLIA 2Q0AA 4JV5B 1RWCA 4JF3A 4KFFA 3UO2A 3K0DA 1S9KE 3P8CD 1LP1A 1UI8A 4YXDC 2O01N 4DUYO 2WTYA 3AG1C 3QWOC 2B5UA 3NJVA 3AE3C 1NTKJ 1K92A 2PF4E 1X1JA 3CHXA 1IVSA 1K04A 1LTTC 1NAFA 2Q69A 3IC7A 4DV1O 1TVKB 2EILB 1VQNV 2IU0A 3K58A 5IJ0B 2DYSC 1L0NJ 3GMAA 3P7KA 2OW6A 2J5UA 4DV7O 1N7SB 4DW1A 1H2MA 4DV6B 2ZYGA 1Y4MA 1AQTA 3MIWA 4FLYA 5L3EA 2KUBA 3CLQA 2KG7A 2IW5A 1NTMK 4JASA 3V2RA 2QJPB 1AB3A 2IPPA 4TV8B 1PX3A 4B7KA 4LCUC 2QIWA 1NU1K 2E2TA 3CCUP 5C8YB 4JI6O 2IFMA 5B66H 1W2BU 3RK2C 1Q86W 1QX8A 2ITDC 3C3SA 2DW4A 1PX4A 2OYHC 4DUVA 1PP9J 4FZ0A 2QM8A 5CA0B 1LXMA 3BASA 1N33O 1XILA 4DRXA 5A9GA 1WJZA 4B3RO 3CZSA 1IK9A 3CWBH 5CA1B 4O9BA 2CIQA 3AEIA 3CC4V 1KORA 4FNVA 3FB8C 1NKNA 2F43G 1X1HA 4JZ2A 1SVFA 2WAMA 1KILD 3SPGA 2JK5C 5IYCO 4B08A 3CCRP 4AQYB 1NKDA 1NO4A 1PL0A 2JJ2G 3QTCA 4L73A 3H6PA 3L74H 4J9ZB 1P84H 1GDTA 2QJKB 5B3SC 1YI2P 1G2CA 1T6AA 4FPPA 5TISE 3OS7A 4QPKA 5AW9B 3FFQA 4KXRA 4GCZA 2XZRA 2D3OW 3ABMB 3FXDA 5GTHH 4L76A 3AG2C 3TYYA 3BY6A 4D6TJ 3RBXA 1KB9H 4B3MO 3DECA 5CCGA 3V2PA 2OCCB 2OYOA 2OTJV 3F7YC 4GOFA 2F1MA 2E3CA 1ZSPA 1NYHA 1OFCX 3L73H 3B5ND 3LDDA 4DJGA 2B87A 5EIBD 2EX3A 2NLJC 3W68A 5EC1C 1R6TA 1GTWA 3SXXA 3ZMTA 3TGUE 2F23A 4UCOA 1EZVI 1NU1E 1GL2A 1W2BO 4EV5A 3BUBA 4NKGB 1SQBJ 2YMKA 1Z45A 3I5DA 4PDRA 4IHJA 4QPJA 2XDJA 4FNSA 2NN4A 1OW8A 4DR7O 5KLIC 2CAZC 2WLMA 1FD9A 2P22C 4PI0A 2XAFA 3CMEP 1D6ZA 1ZMEC 1IBLB 1LGHB 1U96A 4OX9O 5LGNA 4JI8B 2QTSA 5J2TB 1AVLA 4MVQA 4RESB 3RYIB 1RSOB 1P4RA 3RVYA 2OYIA 1JOCA 1LT9B 4DUWA 2PI5A 2ZT9B 1KQGB 2ZYDA 1T5EA 3H1JJ 2K9JB 3NMDA 2FUQA 2HJDA 1ENVA 3SFEC 2IBZD 2K1AA 1SA0B 4DUYB 2Y0CA 3ABKC 2EIMC 2R3SA 3KQGA 3JSVC 3BVUA 4JI5O 1IFIA 2KOGA 2Q4PA 1AR4A 1I5YA 3ZMVA 3BCCD 3M9BA 1FJGO 2RNBA 3CWBE 2WLHA 3IAQA 4DV1B 4BWAA 1CEZA 3L37A 1WT6A 2Q8VA 4DV7B 3SWKA 3OMAB 2E2VA 3E83A 3AMOA 2X6AA 4HNAA 1QGKB 1SFCC 1P84E 1WP7A 3LSQA 1D2DA 3H1KJ 4J5TA 3OMNB 1OCRB 1M1KQ 4KFMA 1NT2B 3JAKB 4LF6O 1R5LA 1W0KG 1ZXGA 1KILA 3D4YA 4I50B 4JI6B 1M4UA 4GX1A 1JZ3A 1OHHG 3T1YO 2BTOA 3QF7A 1K5QA 4TV9A 3QNEA 2PUSA 1S5LZ 4ZOLA 2K88A 2FFDA 3WVFA 1N33B 1URQB 5KLVH 2GUZB 2YKOA 3K3WA 4B3RB 4KJMA 1BCCH 1H54A 1SQPH 2EINC 5LXTB 3EJRA 2ZVNB 3CCLP 1MKMA 4J10A 4CH6A 2Q7EA 3ZRSA 1N34O 3NFQA 4NPEA 1QL1A 3Q3DA 5IWAO 2CQSA 2YXRB 3BABA 4KT0J 4PJ0H 2FYNB 3AK2A 1N7LA 1PPJH 2ZE5A 1JOYA 1HN0A 3MHHC 1K73W 1O9GA 2ZQ0A 1NKZB 2OCHA 3H1LH 4J7KA 4AQ0A 3B5NA 2DQ3A 2EJRA 3N9HA 1SPUA 1GMGA 2JIZG 1SQVJ 3KYQA 4HYOA 3VSNA 3VD4A 3RT3C 4KHXA 1BGYD 2WVXA 1K4DC 4BAYA 2X0LA 3ZIAG 2ZM6O 1MMZA 1RE3C 4FM2A 4JTCB 1R73A 4EOTA 3PLNA 1AJQA 4B3MB 2YXLA 2YIAA 2KK7A 3ZCCA 1ZLZA 3FWLA 3L70D 2DE0X 5AVQB 1I7FA 3T2OA 2PYJA 4G28B 2A3QA 4MN4C 3H32A 4FLWA 5K1XA 1DD4A 5AW6B 4UCUA 3RYCB 1OZHA 3KZIH 5JQGB 1WA8B 1LURA 5KAFH 4IL6X 1NS4A 4X89A 4PV1D 2E76B 3THOA 1Q86Q 4GDOA 4PD4E 3N2KB 2OQEA 2QJKC 2FYUD 2LP7A 1J1EC 1FBMA 5B1OA 4DR7B 3H1ID 3IFMA 1U7JA 2QRXA 3CCSV 3HD7A 5IYDO 3CRQA 3T0BA 1EZVG 3GB7C 1VQLP 3K5BA 1XTGB 1NAYA 2EZOA 2Q67A 4OX9B 4CPGA 4I0XA 3KCXA 1JFFB 4I55B 2OCCC 1GAXA 1KP3A 5AVWB 3S1KA 3A0BZ 4F6RA 3QO7A 4X88A 1NTZH 2W27A 3S4BA 3TY1A 2G38A 3P3PA 3CC7V 3CWBJ 1TU5A 2R9IA 3OTOO 5LYJA 1VQOP 2OYHA 4MMHA 3DXRB 1G1JA 4JI5B 3SJQC 1SQQD 3K79A 1MG1A 3K5MA 3TK1A 1G1XB 1FJGB 1SFCD 2OTKE 1FPOA 3C1LA 3IN6A 4Z1MG 3J80N 3L74J 5IYZB 1QCEA 3BUPA 5AVXB 2FYZA 2Y73A 3FXEA 2OT5A 3ZRWA 1L0LD 4BZHA 1OZ0A 2IX7C 1PPJE 2K37A 2X7RB 2HEPA 1MV8A 5FPOA 4YTPC 1QR9A 3ETGA 2GUSA 3NJXA 2FYUH 3AK3A 3H9VA 2JDIG 4LF6B 1DLBA 4YY3B 3RVZA 4OJZA 5H9CA 4IIJB 1Y6XA 3A0HZ 3BA9A 2B9ZA 1LT9C 3T1YB 3K9AA 2ZT9C 1XMOO 3FD9A 2YNYA 4GLXA 5CBFA 2CFWA 3L73J 1M56C 1RHZB 2ZXXA 1USDA 1HUCA 1QEXA 2EABA 2XHNA 3HKCB 4CH4A 2CISA 3RWRD 3MUDA 2ADQB 3LSUA 4O2BA 2Y9YA 3KXDA 1GTOA 2H7HA 2BOCC 4CH5A 3K9SA 1N34B 3E1F1 3AEDC 2QTOA 2E42A 5IWAB 3ZX6A 1U57A 3VMZA 2E22A 3ZHTA 1HMUA 3VTPC 4L74A 5GW7A 3V6IA 4YIPA 1JY2O 2JGDA 1FFTB 2KKWA 3QVNA 1XNQO 2ODMA 4B7EA 5LMNO 1NI8A 2HODB 1JZ4A 3ASOB 4GKJO 3CP1A 3L35A 2KQXA 2CTQA 2N04A 1H0TA 3AE5C 1LUVA 3A5TA 2ZM6B 3E7JA 4UB6H 4P9PA 2XAQA 5B1BB 4EEQA 2E5TA 2F95B 2KIKA 1HR0O 2YIUC 1S4XA 1OCOB 1URQC 2YKQA 1TXKA 3QG5A 4FLUA 4U7OA 4GKGA 5BMVA 1EXJA 1N0NA 5CJ0A 3CRAA 2CUGA 4IGGA 3IJ4A 3L75H 1COWG 3G71P 3CX5F 5JH7A 1KYOI 2R70A 4YHHO 1KU9A 4ABMA 2FYNC 3AE1C 4BRYB 3B71A 3KCYA 3CZNA 2YMYA 1D6YA 4UUJC 1NTKD 1MMXA 1VQKV 3MDSA 2CH7A 3DC5A 3EVKA 4FM0A 4AQRD 2QJ1A 3AE6C 1JZ8A 1EZVH 2RMKB 4O4HB 1RM1B 2P4KA 2B89A 1B6QA 3GHGB 3RFRA 1L0ND 1Q2NA 3PH0A 4R8CA 2UXCO 1Q43A 2ILMA 3W7UA 1EQ7A 4PA4A 1M1JA 1URFA 1SFCA 1KFNA 2W0QA 1MMYA 2Y0PA 3VOUA 2V4DA 3T0DA 5GTIE 2EADA 2BSKA 4TWKA 2WSCH 5HFMA 3TNUA 4G27B 3DX1A 3E8BA 5D5QA 5KLVJ 1M57B 2UXXA 4GX2A 1BCCJ 3HUSB 1SQPJ 2HPCB 3CE2A 1ZN5A 3V4WA 1EGUA 4YXWH 1SC5B 3OTOB 3MUZ1 3QG0A 5BU5A 3CXHD 3ZEDA 1JCHA 1IVXA 1PP9D 1YTZI 3OAAG 2P7JA 3CMAV 3E7KA 3AFLA 1K33A 3CI9A 4DT0A 1KC8Q 3D36C 4DW0A 5C93A 2PRRA 5AVUB 1X4TA 4X1IB 4RWUA 1XREA 3K06A 2H8PC 2KSDA 2QA4V 3H1LJ 2AXTE 1TVKA 2DWDC 1LWUB 4X62O 1QR8A 5IJ0A 5GONB 1YHQP 1BSMA 3N7NA 3TCUA 2ZT9D 2FXMA 1PV0A 1N73B 2B88A 3K03A 4O4JB 4JI1O 2CGOA 4X1YA 2V7QH 4TT3H 2BRPA 4O4LB 1M56D 2CK3G 1AVOA 5APVA 1TQWA 2Z3YA 2W6JG 1Q3EA 4JI2O 3TSIA 5JWPA 1N7PA 3T09A 1R6KA 3A0RA 5TJHA 1XL6A 1NZ6A 1SQXH 4TV8A 2K9YA 5TISZ 1W2EA 3A0BH 3BRVB 4DO2A 4N21A 5H2FZ 5C8YA 4UB6E 3S4RA 2P7TC 4H33A 1RE3A 2E5YA 2WA3A 1GW3A 4IFDK 1H89A 4D6TD 1JA8A 2YEVB 4IFFA 4U3FH 1MSWD 1FXHA 5CA1A 1PS3A 1JYNA 1SERA 2N74A 1EKMA 1G4YB 4JI0O 3JALA 1AI7A 3N27A 2WSSH 3RBZA 3P3NA 2XV5A 5IYBO 2LFRA 1XNQB 5EBMC 2N1TB 5LMNB 3UIAA 5EZYA 1SQBD 4GKJB 1P84F 3FYIB 2GHYA 1URQD 2Y0DA 3CL3D 1H2KA 2YUAA 1YVWA 1EZVE 3CJHB 2JKVA 5CJ4A 2GV9A 1WMKA 5KAIH 2CWVA 1ULVA 1NTKK 2ATKC 2M3BA 1KMIZ 2Z5HA 3VBBA 1HR0B 3SWFA 4LH7A 1NTZJ 2E2UA 1SIHA 2WGQA 2JO1A 1GKFA 1PL5A 1P7GA 1OVUA 2CTPA 2MW2B 4RUEA 1CI6A 4MSWC 4O4IB 1VQ9P 2YXYA 3GF7A 3H1JD 3JC22 5AVSB 3JAWB 5L3FA 5B66Z 4YHHB 2CGNA 2PY5A 4JZGA 5F2VO 2JEEA 1O9HA 3JASB 5EK0A 3AG7A 1ZRTD 3G4SV 2YO3A 3E1RA 1KV4A 3G6EV 3HKEB 1NTMG 4EV2A 1N7RA 3Q4HB 3I3DA 2A06G 3ASOC 2JJ1G 3WA2X 3SDLA 2RDYA 1K9MW 1LTJB 3BVXA 4W4LA 2H89C 2YIBD 5KHHA 2UXCB 3JARA 1A32A 1E1RG 4C7NB 1GO3F 5AG2A 1RWHA 2KZJA 1SQBH 1JY2N 3BVOA 1GMJA 2Q6QA 2YI9A 2XAHA 3H1KD 4OH8B 5DJTB 5J2TA 3AEFC 3D8CA 4TUYA 3RYIA 1RSOA 1SQXE 1ZP0C 3H1HH 5KHGA 1LT9A 1D5AA 2RCVA 4PHZA 2K9JA 3VP8A 4KHPO 5GTHZ 4TSFG 3CX5D 1SA0A 2WSFH 1J0NA 3CRRA 1A2VA 1SQGA 1N4CA 4K0KO 1DF4A 1NSXA 3ZMZA 4U3FE 2LGWA 4GOEA 4PD4F 4IL6E 2DYRB 3K5OA 2ZINA 2LFSA 1LR1A 3OT7A 1IFPA 4LBEC 1K5SA 2DWEC 3ZBHA 2EBOA 1RM1C 3GHGC 1Q7YW 2PTMA 1X22A 4JYBA 2WCOA 4JI1B 3B8MA 1BE3G 1NSUA 4JI2B 4H0LB 4AQYO 1K34A 1FAVA 4AILC 1EM1A 2FL4A 3ZRVA 2IBZI 3BUQA 1SQVD 1M5IA 4A7PA 1M57C 2M6YA 4I50A 3HUSC 5AW1B 1R8EA 2R5DA 4GODA 3JD1A 1M7LA 4TQDA 4H13B 3D71A 4CS3A 2BCCG 3L75J 4LNUB 1JY3O 4RUFA 2D2CC 3HE4B 1URQA 3LDCA 1PGPA 3M0AA 1JPXA 2H88C 4OWFA 1NSMA 1YZBA 3HRNA 3SWYA 3EJTA 1CSBA 2FMLA 1RW9A 3LIDA 2SPZA 3MHSC 3DX0A 3NBJA 2QG4A 4JI0B 3NREA 3H01A 1PIXA 1WN7A 1GN2A 3ZDMA 1L8DA 5IT9N 1VQ8V 1WRGA 1N73C 4BZFA 4J42A 4WY4B 1PGJA 1HNXO 2LXBA 4RO0A 2NNUA 3BPZA 2WSCJ 3K5TA 3O6QA 1K1YA 3E8FA 4UV8A 4Q6GA 4BTWA 4PELA 3I56V 1UIIA 1N32O 3VP9A 1IBLO 2E75C 3T1HO 1KQSO 1FZCB 4FLZA 2PI4A 1BSHA 1YCIA 5E1AC 3FB5C 4UVCA 1I8QA 1Z2GA 3CWBD 3RYCA 1OJNA 3DX4A 5JQGA 1WA8A 5IE9A 1BDCA 3KIIA 3W7XA 3VDBA 3STLC 4CC5A 1M8OB 3TGUH 3D36A 4LF8B 2ALWA 4JTAB 1H8AA 2F7RA 3EQ2A 1NU1H 4I6MC 4EFEA 2V7QJ 2OQEC 3L74D 5H5NA 3HKDB 1WB7A 1P84D 2F1AA 3CRCA 1D6UA 1MABG 3SR2C 2JVDA 4YJ2B 1NVPB 2P90A 4PJ0Z 2E74B 1SZXA 3HD7C 3QDEA 1SQXJ 2LGQA 4OGQB 3OEEG 1HDJA 1KD1Q 1OCCB 2FXPA 1K8AW 2I1KA 1JFFA 1EN6A 3RYHA 3VQYA 4BR6A 3M7MX 4I55A 1YJ9V 3QFZA 1K4CC 1KB9D 2W83C 3FB6C 4UVBA 2DJVA 3SPIA 4KHPB 2HJFC 5LP6B 4U3FJ 2OW7A 4IOIH 1QLED 3L73D 2A45I 2Q73A 4K0KB 1G6UA 4FNPA 1NH2B 1E79G 2KB7P 4HH2A 4MVSA 3UKMA 3L71G 4IFMA 3CCEV 3WG7B 2BTQB 3HTKB 1VF5B 2E24A 5JMFA 2WYHA 5AVRB 5IYZA 2QM7A 1LTJC 3P8MC 3VD3A 3KZIZ 2KNCA 1JRQA 2HLDG 1NOHA 5KAFZ 5L8RJ 2IYOA 3CV5A 1ZLLA 5DECA 3L72G 2ITAA 4PA9A 4WFFA 1YTZT 4LFAO 2D2CD 4MMIA 2RJZA 5CBNA 1SZTA 4RNLA 2P6JA 4KFEA 5FPRA 1K7DA 1V9PA 4R7CA 1RPRA 4N78D 3ABUA 1Y74B 2BE3A 4U7JA 2IH3C 2QM4A 3RGUA 5EC2C 1FXKC 1SO0A 3PJSK 4X1KB 1S5JA 1JYWA 3HKCA 4R50A 4HJGH 3MI6A 2QKSA 4PA7A 4DR4O 1MFTA 2CFGA 4ASVA 1IVWA 2IBZG 3MUDC 2JR8A 3W67A 2ZKOA 1J1DB 1JZ6A 5LGUA 4FFKA 3CCQV 1W2ZA 3G9RA 2DYRC 1DGSA 1MMMA 2QDOA 4C7UA 3ALAA 2C0WA 3BCCG 1HN1A 3P30A 2CE4A 1IFJA 4DR1O 1NTME 5B5EH 2W8ZA 5CBHA 1AVYA 1SNZA 1S5HC 1EDIA 2A06E 4DV5O 3UO3A 4LC1A 4BIUA 2B1GA 1HNXB 3ITKA 2HODA 4JYAO 4H0LC 1KYOE 2E75D 3WFAA 2XN1A 1JJOA 5BU8B 3DX2A 1DD3A 1HWWA 1JZ7A 3H1HJ 3II6A 2YFOA 3IAPA 4MVMA 2UUBO 3FX7A 1HF9A 3G80A 4YJ3B 1YXBA 1EBOA 2OTLV 2BRWA 1RF1B 2WW2A 5D5PA 5L3BA 1N32B 3MP7B 1M90W 3T1HB 1MZFA 4J7JA 1Q7YQ 5KX5A 2WSFJ 4H44C 5KLVD 5AVVB 4MTXA 1BCCD 1SQPD 2BT3A 2YX9A 1Q82W 3VD9A 1S72V 1TQVA 3C8VA 4MW3A 2KS1B 5JVDB 1RPOA 2XASA 3ZRXA 3HD7D 1JY3N 4LP8A 1E5WA 3X3XA 1N2DC 1PPJD 4UFCA 4AUWA 3VMXA 4ZBMA 4MS2A 3SYPA 4PD4H 4FFBA 1FFXB 1MN0A 3H1LD 2ZL8A 2Q1FA 1JJ2U 1K05A 2L6LA 1BE3E 1YITV 3CCSP 2JJLA 4O4HA 1BDDA 1FE6A 3GHGA 2B9BA 4KTRA 2FY8A 2JGUA 2L35A 1IZNB 4UCVA 5BVZA 3OBAA 3SEPA 1S5LX 3ZN1A 1ZR4A 4EYYQ 3RK2D 1SESA 2Z5UA 3CCUV 5KA5A 1M1JC 1JZ5A 1DTOA 4IYHA 1E1QG 1WAZA 1LTSC 1EXIA 1Y9BA 3UQ8A 1GN6A 1VF7A 2HVKC 5LOVB 4YY3O 2R32A 2WVYA 4KTPA 3HUSA 5CMUA 3JCUE 1H2GA 2BCCE 2HPCA 2Q7CA 2XKMA 3L70G 2IJIA 3AG4B 4U3JB 3F89A 3CC7P 4UB6Z 3T4ZA 4XBFA 1L1FA 1VQMV 2FBWC 2YICA 5AVZB 1IQXA 3ZN0A 3P8CE 1VQ6V 2RN0A 2ZXWB 1FXVA 3DTUB 5CA3A 1TU3F 2GM4A 4H37A 1YJNV 2XSGA 2Q7GA 1AI5A 4X1IA 3T97B 3T2QA 1J5EO 3O8ZA 4J7ZA 1B3QA 2VWKA 3SPCA 3MGNA 2WLKA 3WU2E 1LWUA 4B86A 5B5EE 3A2AA 2A45G 2EILC 3L72H 5GONA 2E74C 3V2NA 3H1IG 1SKVA 4UB8E 3SSUA 1N73A 5DEDA 3AE9C 5CMZA 3IFXA 1N7SC 1FOSE 4O4LA 4LFAB 3K0GA 1Y8AA 1OCCC 3M8AA 2K9PA 1AI6A 3CXHI 3CCJP 1KKCA 2QJPC 1UI7A 3U1CA 2O3JA 1QWUA 2FB5A 5LP6C 4B3SO 3ZHVA 3LNMB 1F9GA 4U7NA 5LA6B 1NTZD 2J58A 3MUY1 5DN6G 2GTAA 4DR4B 3HE5A 2YEVA 1SS1A 3OAKA 2CPBA 4OXSA 1BL8A 1PM9A 3B2EE 2CFKA 1R3JC 4DUXA 3B8EB 5AW0B 2F66C 3TGUJ 4H0LD 1SQQG 1NU1J 1K8AQ 1V54B 5L3CA 2QGNA 4FLXA 2WOFA 1ZAUA 4DR1B 1HNZB 1I94O 2C9LY 1KILE 3D3QA 1NSZA 4GUNA 1PFIA 2EJ7A 1S77D 4DV5B 3PRJA 2N1TA 4GT1A 1DEEG 3DYPA 3BAAA 1L0LG 4JYAB 1FZGA 2K3RA 5AW3B 3CMEV 5CB4B 1KSIA 3CCVV 2BRVX 5E79H 1CB8A 4J41A 2PYLA 1W4NA 3JATB 2UUCO 4N6JA 3V4QA 4H44D 2XNXA 2D1WA 2UUBB 2W0XA 5J2UB
chains in the Genus database with same CATH topology
1HTYA 5DJTB 3BUPA 1TQVA 3FXEA 2F1AA 1R33A 4WWIA 2KS1B 3LVTA 1ZXGA 3D4ZA 1LT1A 3CZSA 3D4YA 2LR2A 1LP1B 3BVVA 2F18A 2F7OA 2KI7B 3DDFA 3EJSA 1TQSA 2FYVA 2M0BA 4K35A 1H0TB 2R44A 2Q1KA 4KJMA 2M5AA 1BDDA 1O7DD 3EJRA 1JMBA 3MZWB 2B88A 4GOEA 4NPEA 1TQWA 2WYIA 4EYYQ 1NVOA 2OW7A 4NPFX 4IOIH 4ASWA 1HXKA 1TQUA 5DJUB 4HB1A 5CBOA 3FXDA 3BUDA 5C39A 1OVVA 2I8DA 2WYHA 4K3AA 3MHVA 1JM0A 3BUQA 4ZNCA 4GOFA 2P58A 4BXLA 3CV5A 2WMMA 2B87A 4GODA 1PS3A 2JWDA 5KBPA 2HR3A 1EDJA 3DDGA 2QVAA 5CBNA 1H0TA 2F7PA 1U7MA 4ZMDA 3BUBA 1FC2C 1QWNA 2KZIA 4MN4C 3EJTA 2KIKA 3RGUA 2SPZA 2UWJE 3DX0A 4HJGH 1EDLA 1MFTA 3EJUA 4ASVA 3ZDMA 2ZAEB 3D52A 1QWUA 4HKZH 1ZW0A 2RKLA 1EC5A 1LP1A 1U7JA 2LXBA 2QRXA 1S3JA 1SS1A 1OVUA 3QWOC 3CZNA 1X0TA 2F7QA 1EDIA 2F1BA 3DX3A 3D51A 3D50A 1R34A 3BVTA 3BVWA 4CPGA 3EJPA 1Y47A 3BLBA 5K5GB 2M5AB 2B87B 3BVUA 2B89A 3S1KA 2OW6A 3DX2A 3PH0A 1Q2NA 1HWWA 3BUIA 5EFWB 1QX1A 1DEEG 1EDKA 2KUBA 2LXCB 2K3RA 3DX4A 1TQTA 1OVRA 1BDCA 3BVXA 3DX1A 4NPDA 3EJQA 2ALWA 2OTKE 4JBZA 2F7RA 2KZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTY A;  5DJT B;  3BUP A;  1TQV A;  3FXE A;  2F1A A;  1R33 A;  4WWI A;  2KS1 B;  3LVT A;  1ZXG A;  3D4Z A;  1LT1 A;  3CZS A;  3D4Y A;  2LR2 A;  1LP1 B;  3BVV A;  2F18 A;  2F7O A;  2KI7 B;  3DDF A;  3EJS A;  1TQS A;  2FYV A;  2M0B A;  4K35 A;  1H0T B;  2R44 A;  2Q1K A;  4KJM A;  2M5A A;  1BDD A;  1O7D D;  3EJR A;  1JMB A;  3MZW B;  2B88 A;  4GOE A;  4NPE A;  1TQW A;  2WYI A;  4EYY Q;  1NVO A;  2OW7 A;  4NPF X;  4IOI H;  4ASW A;  1HXK A;  1TQU A;  5DJU B;  4HB1 A;  5CBO A;  3FXD A;  3BUD A;  5C39 A;  1OVV A;  2I8D A;  2WYH A;  4K3A A;  3MHV A;  1JM0 A;  3BUQ A;  4ZNC A;  4GOF A;  2P58 A;  4BXL A;  3CV5 A;  2WMM A;  2B87 A;  4GOD A;  1PS3 A;  2JWD A;  5KBP A;  2HR3 A;  1EDJ A;  3DDG A;  2QVA A;  5CBN A;  1H0T A;  2F7P A;  1U7M A;  4ZMD A;  3BUB A;  1FC2 C;  1QWN A;  2KZI A;  4MN4 C;  3EJT A;  2KIK A;  3RGU A;  2SPZ A;  2UWJ E;  3DX0 A;  4HJG H;  1EDL A;  1MFT A;  3EJU A;  4ASV A;  3ZDM A;  2ZAE B;  3D52 A;  1QWU A;  4HKZ H;  1ZW0 A;  2RKL A;  1EC5 A;  1LP1 A;  1U7J A;  2LXB A;  2QRX A;  1S3J A;  1SS1 A;  1OVU A;  3QWO C;  3CZN A;  1X0T A;  2F7Q A;  1EDI A;  2F1B A;  3DX3 A;  3D51 A;  3D50 A;  1R34 A;  3BVT A;  3BVW A;  4CPG A;  3EJP A;  1Y47 A;  3BLB A;  5K5G B;  2M5A B;  2B87 B;  3BVU A;  2B89 A;  3S1K A;  2OW6 A;  3DX2 A;  3PH0 A;  1Q2N A;  1HWW A;  3BUI A;  5EFW B;  1QX1 A;  1DEE G;  1EDK A;  2KUB A;  2LXC B;  2K3R A;  3DX4 A;  1TQT A;  1OVR A;  1BDC A;  3BVX A;  3DX1 A;  4NPD A;  3EJQ A;  2ALW A;  2OTK E;  4JBZ A;  2F7R A;  2KZJ A; 
#chains in the Genus database with same CATH topology
 3B8N A;  3OTF A;  1TUE B;  3ABM C;  5IDJ A;  2WT7 B;  3T0A A;  3OD4 A;  1LTI C;  4Z2W A;  4CZZ A;  3K5N A;  1LP1 B;  2F93 B;  2Y48 A;  3T0U A;  4QMA A;  1HWY A;  4PDV A;  3G6B A;  3JAW A;  2PFX A;  3MPH A;  2R44 A;  4J9Y B;  3T2P A;  4DR6 O;  3L71 E;  3CYO A;  1JTH B;  3LUT B;  3JAS A;  4RQE A;  4DR3 O;  2Z5I A;  3HKE A;  1QU7 A;  3Q4H A;  4I4T B;  1VQK P;  3Q1N A;  1PV3 A;  3IF4 A;  4NPF X;  1X59 A;  3F5T A;  1QVF U;  2L5G B;  4B3T O;  1LTJ A;  2LO1 A;  1V7X A;  3SJC C;  3BVH A;  3L72 E;  2KG7 B;  4LF7 O;  1YTF D;  2ZNI A;  4C7N A;  3VDA A;  4XDL A;  3MD0 A;  2BCC J;  1BQZ A;  2W6A A;  4DZO A;  2IH1 C;  1NBM G;  3Q1M A;  3GVM A;  3V5B A;  5GTI H;  5JJE B;  5LHI A;  4FMT A;  4BXL A;  4ZKP A;  2X03 A;  1JR9 A;  3L9D A;  1Q6U A;  2HR3 A;  5KAI Z;  2WSE H;  3N4X A;  3DDG A;  3L75 D;  1FXK A;  1NVP D;  2IBZ E;  2F7P A;  3CMA P;  2AEM A;  2E74 D;  3FX0 A;  2E43 A;  2QKC A;  3AG3 B;  3BFR A;  1VP7 A;  3B4S A;  4I9W A;  1J5E B;  1N7S D;  3BCC E;  2QA4 P;  1M90 Q;  1RQV A;  5B1N A;  3USS A;  3RW0 A;  2WZS A;  1NTK G;  1OJH A;  1ROP A;  5EBW C;  3BS6 A;  4JYC A;  2AXT H;  1BT8 A;  4HZ3 A;  3T4D A;  3OUF A;  5FNV B;  1EZV D;  1RE4 C;  1WMP A;  3E80 A;  3W7S A;  1ZW0 A;  4I5S A;  1PGO A;  2JWA A;  2ZFC A;  1EC5 A;  4JTD B;  5EYP A;  2NR5 A;  2E5L O;  1L0N G;  2IZ1 A;  1AR5 A;  5E79 E;  1DP0 A;  1XHZ A;  1ORQ C;  3HKB A;  2XUM A;  3LW5 H;  4IT5 A;  3CX5 I;  1OCR C;  2AZ0 A;  1BS3 A;  4BZG A;  2G8Y A;  3ETE A;  3DX3 A;  1NJI W;  2WZ7 A;  3BVT A;  4B3S B;  1Y47 A;  1WMO A;  4UXN A;  3M06 A;  1LTA C;  2FYU K;  3B09 A;  1L2P A;  4LNU A;  1Z5V A;  2B87 B;  2ZXW C;  2CQT A;  3J7A U;  1TUB A;  4G2K A;  1WLE A;  1Y76 B;  2GSM B;  2OGU A;  1KP2 A;  1AA0 A;  1AIL A;  1OVR A;  5KMG B;  1UPG A;  1I94 B;  2QWP B;  3IC9 A;  4PA3 A;  1AVK A;  4LLH A;  4W80 A;  3LNN A;  1LOH A;  1GN4 A;  3ASN B;  4WY4 A;  4OPH A;  1PZQ A;  2YID A;  1FS0 G;  1VQL V;  2UUC B;  1LT1 A;  4GKK O;  2UU9 O;  2WIT A;  3LSS A;  2MK3 A;  4R6Z A;  3SYC A;  4CC6 A;  2UXN A;  3E2E A;  3SGI A;  1SQQ K;  3MTU E;  4JQ0 D;  1SQX D;  3X42 A;  1DK1 A;  4K35 A;  1IFD A;  4X65 O;  3HB3 B;  1QNM A;  3X41 A;  4DXW A;  1W3Y A;  1IUR A;  4JF7 A;  3L71 J;  1F1S A;  1L0L K;  1RWA A;  2BEZ F;  3CCM V;  4DV4 O;  1K73 Q;  1IU7 A;  4U3F D;  4AI8 A;  1VQP V;  3E22 B;  1V54 C;  2IDB A;  4DR6 B;  4NR1 A;  2P1J A;  3HI7 A;  1IFN A;  4OVN F;  2ZXE B;  1IBK O;  2W6B A;  1HXK A;  5L3G A;  4DR3 B;  3DC6 A;  5JJN B;  1FDM A;  2LW1 A;  3G4S P;  3L72 J;  3G6E P;  4Z1M H;  1X79 B;  2E76 C;  4KP4 A;  5AW2 B;  1LTB C;  2EAC A;  2VRS A;  3HKD A;  4B3T B;  3AMO B;  3E8G A;  5H6Q A;  1JM0 A;  1T3U A;  3H1I E;  1VAR A;  4LF7 B;  2ZE7 A;  4YJ2 A;  2H94 A;  2BOB C;  2HTB A;  4FNR A;  3K08 A;  1KIL B;  2QJY B;  1PD3 A;  3T2M A;  1N7S A;  2KP8 A;  2JDI H;  1RJO A;  3AE7 C;  5AW4 B;  3EXA A;  3OE7 G;  2POH A;  3UT5 B;  1FJK A;  4ICG A;  1GD2 E;  5LP6 A;  4DR2 O;  5HFL A;  4QE7 A;  3J7H A;  1IXM A;  2C11 A;  1HM3 A;  2QEX V;  3WFV A;  3H1J G;  2ZAE B;  1SQQ E;  1CZQ A;  2A79 B;  5CA0 A;  3HIG A;  3HII A;  1GM9 A;  2RKL A;  3S4D A;  2V1D A;  2AHZ A;  4OPA A;  5KHJ A;  1YQ4 C;  1J95 A;  2BTQ A;  2HYN A;  3HTK A;  1K1W A;  1R3I C;  4IL6 H;  2JS3 A;  1D7M A;  3Q5P A;  3RL0 B;  1OJM A;  4GX5 A;  1GU4 A;  2JKE A;  3B5N B;  1UJW B;  3ZHU A;  1N7Q A;  1H8H G;  1KB9 I;  3BVW A;  1VF6 C;  2CTR A;  2E5L B;  1J2J B;  3IAY A;  2WVX B;  3FGA D;  3VYI A;  1SP4 A;  4YPC A;  2MJZ A;  2M5A B;  1NS7 A;  1S5L E;  3D6Y A;  4Y28 J;  1S1C X;  3H1K G;  3C3T A;  2AHY A;  1CW5 A;  1US6 A;  1Y74 A;  3H1H D;  3CB2 A;  3QO8 A;  4ZI7 B;  5CN0 A;  1AR1 B;  4I7Z B;  1RH5 B;  1SQF A;  1TQT A;  4X64 O;  3RK3 E;  3H32 B;  4X1K A;  2G3A A;  1F4M A;  2Q9L A;  4LF9 O;  4UV9 A;  5B1A B;  1S9K D;  2ZE6 A;  2QWN B;  5L3D A;  4LFC O;  3ECQ A;  1L0N K;  2W0F C;  1GM8 A;  2J59 M;  2EUL A;  3VQX A;  3A3Y B;  3AG1 B;  4KUM A;  5KJ7 C;  3SYQ A;  3DYM A;  3CRM A;  5APW A;  3NTN A;  3OW2 U;  2IYP A;  2DMX A;  1JVM A;  3FYE B;  5BY1 A;  3BVV A;  2ADP A;  2QWO B;  1YF2 A;  4Q20 A;  4JPZ B;  4PA6 A;  1IVV A;  2WPQ A;  4LF8 O;  1X9V A;  3IMH A;  3ABL B;  2KYV A;  4R4L A;  1FOS F;  1YEW A;  1W6G A;  4GKK B;  2WLL B;  2UU9 B;  1BMF G;  3GWO A;  2WLJ A;  4I0X B;  3OA7 A;  5KUK A;  1OIP A;  2YDE A;  5JJJ B;  1JMB A;  2UXB O;  4QGP A;  3KHU A;  1RWG A;  2XU6 A;  2QE7 G;  3D6Z A;  1YIJ V;  1LUW A;  1UFI A;  4YJ3 A;  3ZMS A;  4K8X A;  1SQV G;  2BEQ D;  3E1I A;  4X65 B;  3QFY A;  5B1B C;  4FZ1 A;  2KB1 A;  2RN9 A;  3JSN A;  1YJW V;  2WSE J;  2NRG A;  1Q6I A;  1NS1 A;  3F5H A;  1RWF A;  2CG0 A;  5LYJ B;  3SYA A;  1KQF B;  1OCO C;  1VQ4 V;  1MA1 A;  3ACT A;  1Z56 A;  4DV4 B;  2P10 A;  1Z5W A;  2E76 D;  3JAM N;  1JY2 P;  4QE9 A;  1OVV A;  1XOU A;  1PKX A;  3BHP A;  2RMZ A;  2H8P D;  2YSU B;  1ARO P;  3JD4 A;  1IBK B;  3BLC A;  3WA3 A;  2ZIM A;  1NH4 A;  4P2Z A;  4I9Q A;  2Z0A A;  4E2L A;  2ZYA A;  3M0D C;  4GIF A;  3GWK C;  3ZRW B;  4EIJ A;  3ASN C;  4WFA V;  4JI4 O;  2Q7H A;  4IYI A;  5KBP A;  2I1J A;  1HMW A;  1NTK E;  4NB5 A;  3GG2 A;  1FFX A;  3CC2 V;  4ZKI A;  1MUU A;  3I55 V;  5ITZ B;  3LIE A;  2P4V A;  5B3S B;  3LW5 J;  5CHX A;  3MAQ A;  1VQN P;  2NPS B;  2YFN A;  1WPB A;  5B5E Z;  1OV9 A;  1L0N E;  1H2S B;  1RE4 A;  3AE8 C;  2KSE A;  3AEC C;  3CD6 V;  1AFO A;  1LVN A;  3QO5 A;  4TQF A;  2CK3 H;  2ZD9 A;  3KDP B;  3TXS A;  2W6J H;  3R4Y A;  3OW2 O;  3IAO A;  2WDA A;  4WVZ A;  1YJ9 P;  2PGG A;  3AG2 B;  1IQY A;  5LOV A;  3JAK A;  3OEH G;  1YQ2 A;  3OJA B;  2XN2 A;  3OGI B;  2WVR A;  4EI2 A;  1QAL A;  4DR2 B;  1GK6 A;  4U3J A;  4BW5 A;  2YC0 A;  1SQB K;  2IFN A;  3GW6 A;  3CXH E;  2VWJ A;  1KTM A;  2ZE8 A;  2GUZ A;  3T97 A;  5LXT A;  3TGU D;  3CCE P;  1XEQ A;  2JGD B;  1NU1 D;  1QVG U;  1WPX A;  3CC4 P;  1DIP A;  4LH6 A;  1KBH A;  1P7B A;  5A2Q N;  1LWU C;  2P67 A;  3L74 G;  4WFE A;  3A0H E;  1EDK A;  1FS0 E;  5KLI B;  4DV3 O;  1HJ0 A;  4C46 A;  3EFG A;  1GRJ A;  4ZIB A;  1OAC A;  1HW7 A;  4PV1 B;  4WFH A;  2ETN A;  2OOV C;  4M3L A;  3HPL C;  4I2L C;  1TAE A;  3VDC A;  1S2E A;  1L7J A;  2RDC A;  1R5S A;  4X20 B;  1VQ5 V;  1HGV A;  1L4A B;  4X64 B;  1NWQ A;  3JCZ A;  3LVT A;  4LF9 B;  3V2Q A;  1VIB A;  3I3E A;  3K5L A;  1GZL A;  4EB6 B;  4BWN A;  1T8Z A;  5JH7 B;  4LFC B;  3L73 G;  2XT9 A;  1GM7 A;  2Y0I A;  1HVV A;  3CCQ P;  2OTJ P;  3ABK B;  2EIM B;  1F4H A;  3DDF A;  3S4A A;  3ICX A;  4LWS B;  2R5B A;  5CCH C;  2A9H A;  1RF0 A;  2Q1K A;  1WMN A;  3RL0 C;  1PU4 A;  4GX0 A;  1O7D D;  4DOJ A;  2XND G;  1R3L C;  4WF9 V;  3MZW B;  4PDM A;  3PGB A;  1NTM H;  2HKO A;  5IY5 B;  2EAE A;  3X40 A;  4FM1 A;  2A06 H;  2N1T C;  4QIW F;  3N2K A;  5CB4 A;  1G1I A;  2O1J A;  3ETD A;  3SYO A;  1I0H A;  5KA6 A;  1SFC B;  3JAT A;  1KYO H;  4Z1V A;  2UXB B;  4HB1 A;  2BSK B;  2UUA B;  3BUD A;  1ZR2 A;  1QVG O;  5J2U A;  4FK5 C;  2OTL P;  5AW5 B;  2BCC D;  4BIO A;  2WT7 A;  1W5C E;  3DGE A;  4F4L A;  5IJ9 B;  1N9E A;  3FAV B;  1JQ0 A;  4EFB A;  2FXO A;  5B1A C;  5LHG A;  2Q5U A;  3PHL A;  5APU A;  2H3O A;  3CXC U;  1OW7 A;  2JWD A;  1W7C A;  1ZUQ A;  4DYL A;  2EIN B;  1EZJ A;  3A7O A;  2NZ2 A;  1S72 P;  1HGZ A;  2QVA A;  3H1J E;  3O65 A;  2WPS A;  2YXQ B;  2IZ0 A;  3FWN A;  1OMI A;  1JTH A;  3KKY A;  3RK3 B;  3DXR A;  4JI4 B;  1SQV K;  3LOY A;  2IU3 A;  1ZRT E;  4JGS A;  4I4T A;  4X8A A;  2R9R B;  1M93 A;  2LW7 A;  3ABL C;  2VS0 A;  3UM7 A;  4X1Y B;  1N7O A;  4NXN O;  3B40 A;  2Q3E A;  1YIT P;  4DK1 A;  1ZTE A;  3D52 A;  4DR5 O;  3F7V C;  4HKZ H;  2CIR A;  1BE3 H;  1M57 D;  4XDK A;  3RYF B;  2AEJ A;  1VF6 A;  1IO4 A;  1SF9 A;  3PTZ A;  1OCZ B;  3H1K E;  2Q0O C;  1HM2 A;  5E79 Z;  1X0T A;  2Q6A A;  2KSJ A;  5BR8 O;  2M8R A;  3AE2 C;  4IIJ A;  5APS A;  1ZL8 B;  2X6C A;  3TDK A;  2JKP A;  3JCU H;  2BCC H;  2JS5 A;  5KLV G;  1VQM P;  3OUS A;  1BCC G;  5DM6 V;  1SQP G;  5APQ A;  5AW8 B;  1K9M Q;  3CX5 E;  1VQ6 P;  4WFB V;  3BUI A;  3WUU A;  4EDF A;  5EBL C;  3RL0 g;  3T1C A;  4A5U B;  5AVT B;  3JAL B;  1YJN P;  4LF4 O;  4R4M A;  2QKA A;  1VQ7 V;  2WA4 A;  4Y99 B;  3OR6 C;  5JCO C;  2PAJ A;  3VSM A;  5KJ7 A;  3J81 N;  1NS8 A;  1ZX3 A;  1PPJ G;  5EZY B;  4PD4 D;  1AV4 A;  4BTY A;  1TGO A;  1JUN A;  3BRT B;  1EFR G;  1J1E B;  3WU2 H;  1T2K C;  1XBL A;  2NPS C;  5FNV A;  4DV3 B;  1HNZ O;  3H1L G;  2A0L A;  5LBQ A;  5H2F E;  4FLV A;  4UB8 H;  4K8Z A;  4MVU A;  1CP9 A;  1GH6 A;  1AQ5 A;  1MZ9 A;  1Y67 A;  2LR2 A;  2R72 A;  4FJC C;  1QHT A;  2RQ6 A;  1DF5 A;  1SQV E;  3VN0 A;  2F18 A;  2WW0 A;  1JB0 J;  1CI6 B;  5CCH D;  2OWO A;  1Q6H A;  3X2Q B;  1DH3 A;  1VEW A;  3RL0 D;  4H13 C;  3UCS C;  1LF6 A;  3I5C A;  2HVJ C;  3L71 D;  2C2A A;  2QR4 A;  1AI4 A;  1Y76 A;  3STZ C;  5GTI Z;  2N1T D;  4MTG A;  3ZJZ A;  4LFB O;  1PGQ A;  3A24 A;  1Y66 A;  2WLN A;  2XND H;  3WUT A;  1Q90 D;  5KMG A;  2OAR A;  2Y0E A;  4FLT A;  1N0J A;  1KKD A;  5DJU B;  2CTW A;  3M0D A;  2FKW B;  4BRY A;  3L72 D;  3SJA C;  1PL4 A;  2FUT A;  3JAR B;  2O57 A;  4ZKU A;  3CCV P;  4WY4 C;  4PV1 C;  2Y69 B;  3TET A;  1Q8I A;  1JY3 P;  3ZS8 C;  1GW4 A;  3EFF K;  1XDC A;  3L36 A;  2DW3 A;  2WMM A;  2AXT Z;  2M3E A;  2EIJ B;  4TUY B;  4JYY A;  3BAT A;  2VQE O;  5A1A A;  2GUV A;  1RY3 A;  1L4A C;  2O1K A;  1FDO A;  3Q5S A;  5B66 E;  2EIK B;  1BGY G;  1FZE A;  1WP8 A;  1M56 B;  1NS0 A;  1NTZ G;  1FZC C;  3AEA C;  3K59 A;  1ZOY C;  4CH3 A;  5KTB A;  1JNM A;  2ZCE A;  3M9H A;  3SPH A;  3E22 A;  3EJU A;  2CG1 A;  2JEU A;  1E79 H;  4DK0 A;  3PN1 A;  5LGT A;  3L71 H;  5IY5 C;  1K1X A;  4HAM A;  4MVR A;  2QWQ B;  3QH9 A;  2HP8 A;  4NXN B;  3CCR V;  3L74 E;  3N2G B;  4O2A B;  5LMU O;  1HWT C;  4DR5 B;  2PNC A;  1JEK A;  2C0X A;  4MVO A;  3DSQ A;  2F1B A;  2FYU G;  1YI2 V;  1QQC A;  2CPS A;  4TLF A;  1NGM B;  1R34 A;  3I3B A;  2Q5Z A;  5KKZ B;  1FZA A;  3BLB A;  1FAF A;  3VQW A;  1X8Y A;  5K5G B;  4O4J A;  4OGQ C;  4XFJ A;  2PZS A;  2OOV A;  1BZK A;  1FZB A;  1B06 A;  2N05 A;  5GTH E;  2C9N Y;  4HBN A;  5BR8 B;  1USE A;  2P2U A;  4C7R A;  2Y9Z A;  2YIU B;  1XI1 A;  1QX1 A;  2FTK A;  1KB9 E;  3ABT A;  3UT5 A;  2LXC B;  2VQF O;  4BW9 A;  1UG9 A;  3P32 A;  3L73 E;  2ZR2 A;  3EJQ A;  2Q9I A;  1T2K D;  1RQU A;  2NPS D;  2L91 A;  2IBZ H;  4LF4 B;  2HG5 C;  3RK3 C;  2AXC A;  4FNU A;  1HTY A;  3JSL A;  4MTF A;  1NTM J;  4AHC A;  2HHH O;  1YGA A;  1PNM A;  1SET A;  3BGA A;  5AW7 B;  3JYC A;  4QNH B;  3ZMU A;  3WG7 C;  5CCH A;  1VF5 C;  3BCC H;  4L75 A;  4WBN B;  1YDX A;  4DUZ O;  1VL2 A;  4ZHQ B;  1HBW A;  2Z4E A;  3S9O A;  2B1I A;  2F7O A;  2MKV A;  4NYK A;  4UCR A;  4NEI A;  2KI7 B;  5KLV K;  1MOF A;  2FYV A;  1NHL A;  1OCZ C;  1SQP K;  4H13 D;  1KC8 W;  3O6Q B;  2HFE C;  2M5A A;  1THZ A;  2LJ2 A;  2WOH A;  4DV2 O;  1OWA A;  1LF9 A;  2IJJ A;  3NXS A;  5CBG A;  2YKP A;  3G3Z A;  1SRY A;  1I08 A;  3CJH A;  1CPY A;  1VPC A;  4N78 E;  2WYI A;  4ZI7 A;  1XNR O;  2A7W A;  1JMK C;  2W6I G;  1KN7 A;  3BRC A;  4ASW A;  4J11 A;  3WB1 A;  2WLI B;  4L8J A;  2XOK G;  3CXH F;  2P5O A;  1NR1 A;  4DCK A;  3L75 G;  4F6E A;  3R66 A;  3MV0 1;  1IX9 A;  4Y99 C;  4LFB B;  4O4I A;  1DYU A;  1J1D C;  4WY4 D;  3U11 A;  3BA8 A;  4FVM A;  4BIZ A;  1JOV A;  1R3K C;  5LL6 Y;  1NSV A;  1JO5 A;  4NTW A;  2KXP B;  1H38 A;  4RJT A;  3X3Z A;  5H6R A;  1BE3 J;  1L4A D;  1WB8 A;  2DQ0 A;  3GF3 A;  2WQY C;  1HJB A;  2WLL A;  1YQ3 C;  3RRS A;  4IL6 Z;  4NXM O;  3BEH A;  1M9N A;  3SX1 A;  1G8M A;  3RYH B;  1HTL C;  3A2F A;  2VQE B;  1MNG A;  1VDF A;  1W5Z A;  1BGY H;  3X2Q C;  1N36 O;  3JD0 A;  3KG2 A;  1D5N A;  1RF1 C;  4YXW G;  2LKM A;  3CCM P;  5KLV E;  3L70 H;  3OR7 C;  1BCC E;  2GDS A;  3TJT A;  4JAA A;  1SQP E;  1VQP P;  4JAU A;  1KEC A;  4I1L A;  4DRX B;  1S3J A;  1IXB A;  3CCL V;  1U97 A;  1IFM A;  2HTA A;  1W59 A;  3C9I A;  3M91 A;  3AEG C;  2QWR B;  1N7N A;  2F4V O;  1IK7 A;  4PJ0 E;  4TTG A;  1OJP A;  3FB7 C;  2KNC B;  3RN4 A;  4NTY A;  1B04 A;  2EZP A;  4OGQ D;  5JCO A;  2O01 H;  2ZR3 A;  4FNT A;  2AZ2 A;  2Y69 C;  4DV0 O;  5LMU B;  3H1L E;  1TA8 A;  5ITZ A;  1XMQ O;  1NTZ K;  2A45 H;  2V7Q G;  3H1I H;  4TT3 G;  3WMM 0;  2NPS A;  3CCJ V;  2EIJ C;  1JMM A;  5APY A;  1QAK A;  1US1 A;  1G2C B;  1Q82 Q;  1H2L A;  1LTG C;  1R6N A;  1GU5 A;  1XL4 A;  1SQX G;  2EIK C;  3R2P A;  2WW3 A;  3RK3 D;  2HG5 D;  3SJB C;  4LR3 A;  1NH2 D;  1MSD A;  4N3Y B;  1SLQ A;  3OGC C;  2VQF B;  4PDL A;  3A8T A;  4FIP C;  1F51 A;  1F7Y A;  1VF5 D;  4WWI A;  2JKA A;  3AG4 C;  2ZIO A;  4E4E A;  1OXZ A;  3TF5 A;  1QVF O;  2QEX P;  4UCT A;  1YSC A;  4U3F G;  2ZDI C;  3KZI E;  4W7Y A;  3HE4 A;  2HHH B;  4J80 A;  4CS2 A;  5KAF E;  1SQQ H;  1TQS A;  3WIQ A;  3SPJ A;  1AV1 A;  1PP9 G;  2HFE D;  3PP5 A;  2WSS G;  4DUZ B;  3A0O A;  1GL2 B;  1XHX A;  4HYT B;  5AVY B;  2CFL A;  3E8H A;  3RSY A;  3X3Y A;  1QLN A;  4IHJ B;  1L0L H;  2IJH A;  4RKU J;  5KKZ C;  1LXK A;  3E35 A;  1NQT A;  4DV2 B;  2Y4T A;  1QL2 A;  3ZHS A;  5CBO A;  1S5L H;  1A02 J;  2XHB A;  3K57 A;  3ACS A;  3WIR A;  5KX5 B;  1XNR B;  4X20 A;  4TOI A;  1BGY E;  3S3W A;  3HR0 A;  2Q3I A;  1L4A A;  2FKX A;  2OYI B;  1UIX A;  1I5X A;  2AW9 A;  1NTZ E;  5J9P C;  2P58 A;  2ZQM A;  1PNK A;  4P30 A;  2AGA A;  3OB8 A;  4EB6 A;  3ETQ A;  4BTX A;  5KHK A;  4UVA A;  1Q81 W;  1FZC A;  3L70 E;  5BXZ A;  2DN9 A;  1VQO V;  2P06 A;  4JAV A;  5KUM A;  3DCD A;  4D6T G;  4LWS A;  4OK2 A;  4OK4 A;  3VMA A;  1WNS A;  3F5W C;  1F23 A;  3OFN G;  4FFB B;  1RF0 C;  1FC2 C;  1QWN A;  1QLE B;  2M7W A;  4JI7 O;  3FKS G;  4MTO A;  2CWT A;  2UWJ E;  3VQV A;  3GLM A;  2WW1 A;  1SII A;  2CWU A;  1S76 D;  3ABV C;  1Q5O A;  4WBA A;  1N8R W;  4NXM B;  3M9Q A;  2FYU E;  3VD5 A;  1NR7 A;  1V55 B;  3IR9 A;  4HNA B;  4W7Z A;  4XA4 A;  3KPE A;  1KYO F;  2LQT A;  3LDE A;  1HH0 A;  1SQB G;  4W4K A;  3APQ A;  2XAG A;  1IDS A;  2OQQ A;  1N36 B;  1HNW O;  5APX A;  1YIJ P;  1DEB A;  1BHB A;  1KQL A;  1V7W A;  4WB4 A;  3U1A A;  4NVP A;  1JCD A;  1YJW P;  3H1H G;  5IJ9 A;  1C82 A;  3FAV A;  2F7Q A;  1JCC A;  3CPW U;  4RQF A;  1VQ4 P;  3D50 A;  4TV9 B;  2D2C B;  2BAS A;  4AYC A;  1QBZ A;  1H8E G;  4ZOL B;  2FFD B;  3EJP A;  2IM9 A;  3AFJ A;  1K3E A;  1JYV A;  2WPR A;  1QAF A;  1XUQ A;  4NTX A;  3L4F A;  3W7W A;  2N9Y B;  1DX7 A;  3OMI B;  1AP6 A;  3H25 A;  1RFY A;  3BCC J;  3M99 B;  1OW6 A;  2R9A A;  5K1P A;  3AEB C;  4X9Q A;  2F4V B;  5EFW B;  4JPR A;  1P84 I;  1XQ8 A;  4XDJ A;  5APT A;  1NKG A;  2DOS A;  5KHI A;  1CXZ B;  4X66 O;  4EKW A;  3E89 A;  3S3X A;  4DV0 B;  3CC2 P;  1NTK H;  1XMQ B;  4NPD A;  1W6C A;  3I55 P;  3SFD C;  3K25 A;  5E1Q A;  3WUV A;  2C10 A;  4KFD A;  2RH0 A;  4JBZ A;  1S0V A;  3JD3 A;  3EHB B;  1IBM O;  1L0L E;  1RKY A;  4JI3 O;  3CD6 P;  3RYF A;  5M1B A;  1L0N H;  1YYC A;  1R33 A;  1XMO B;  2OYQ A;  4UFZ A;  1H2N A;  3D4Z A;  1BHA A;  5JMD A;  2X6B A;  3KN4 A;  4D7S A;  1XTC C;  3HE5 B;  1H88 A;  3U10 A;  2E75 B;  2Y4U A;  3R65 A;  3EJS A;  1ZL8 A;  3NR7 A;  3B77 A;  2YS8 A;  2IJK A;  2ZNJ A;  3D3I A;  4MVZ A;  1J0M A;  3L75 E;  4PI2 A;  2JEX A;  3CXH H;  1ZWI C;  1KD1 W;  1PP9 H;  4ASU G;  3G71 V;  4CBC A;  5BZB A;  1SQX K;  4GZR B;  3AG3 C;  4CS4 A;  2UXD O;  3DYO A;  1EN4 A;  1PNL A;  4UCS A;  3CPW O;  2ZXQ A;  2QSA A;  1RP3 B;  4RAI A;  2K1E A;  1OX3 A;  5C39 A;  1V7V A;  4BZE A;  2I8D A;  4LF5 O;  4K3A A;  3OM3 B;  3K04 A;  3A0H H;  1VQ8 P;  1OJO A;  3HD7 B;  1FZF A;  2DYS B;  1BGY J;  3ZHR A;  4ZNC A;  3U59 A;  1FKA O;  1R1B A;  2GTS A;  1K97 A;  3W7T A;  2YO2 A;  3VMY A;  4YIO A;  1KB9 F;  1VQ5 P;  5FL7 G;  1BQ0 A;  3L70 J;  5CCG C;  2UUA O;  2Y74 A;  2KLU A;  2OIE A;  2XN0 A;  1U7M A;  1IZ3 A;  4F6R B;  4QJF B;  4ZMD A;  1RF1 A;  3I56 P;  4MW8 A;  1JX9 A;  4PD4 I;  4JV5 O;  3RK2 B;  1GK9 A;  4D6T H;  2PP6 A;  4WCE V;  1MFZ A;  2OYH B;  2W90 A;  3ML0 A;  3AEE C;  1VMG A;  1KFM A;  3VOP A;  1GL2 C;  2ZVO B;  3JCU Z;  2O01 J;  1EDL A;  2WVZ A;  3RGB A;  2R3C A;  2WPV B;  3TGU G;  3VD7 A;  2GBO A;  2FYU J;  2KS1 A;  1NU1 G;  5JVD A;  4JI7 B;  3H1I J;  1NJI Q;  4GYC B;  1SS3 A;  4XE5 B;  2D73 A;  3WB0 A;  1YHQ V;  3CS5 A;  2KLV A;  3AE4 C;  2WO0 A;  1X1I A;  3TXQ A;  4RO2 A;  2YXH A;  2ARH A;  1AVM A;  4DV6 O;  2CFD A;  3D51 A;  1LNQ A;  1F4A A;  1HNW B;  3WU2 Z;  2VRZ A;  2JP3 A;  2YI8 A;  3U0Z A;  3A0B E;  1NS2 A;  2OYI C;  4FNQ A;  2GA1 A;  3JD2 A;  2CDY A;  4UB8 Z;  1KZU B;  1IVU A;  3MWX A;  2XTA A;  2HLO A;  1FXK B;  1A02 F;  1L7K A;  1AJP A;  4D7T A;  1FJP A;  4P9O A;  1SQQ J;  3WB2 A;  4O2B B;  1W0J G;  2Q68 A;  1GN3 A;  3H1J H;  1IC2 A;  2ITC C;  2ZDI A;  1QLE C;  4X62 B;  3E86 A;  1PP9 E;  3Q2Y A;  4LGD E;  3CWB G;  5FLX N;  4X66 B;  1L0L J;  1NTM D;  1GK4 A;  1AJY A;  1KQS U;  2A06 D;  1AP5 A;  5EYP B;  2PGD A;  3N2G A;  1V55 C;  4O2A A;  1Q81 Q;  1IBM B;  1KYO D;  1EN5 A;  3HKB B;  3APO A;  4JI3 B;  3MV1 1;  2ZJS E;  3AK1 A;  1MMU A;  2M0B A;  1IJD B;  1H0T B;  3S4C A;  2XAJ A;  3D70 A;  1KIL C;  2QJY C;  5KAI E;  1MZE A;  1JYX A;  3H1K H;  1F4N A;  4MT8 A;  2FFD C;  1NVO A;  2OIG A;  3CEI A;  3G67 A;  1TUB B;  1FYJ A;  1N8R Q;  4H44 B;  4WFG A;  5KJ7 D;  5BMV B;  1BSN A;  1T3J A;  1TQU A;  1VQ9 V;  5LA6 A;  4N23 A;  2V4H A;  1YBK A;  3CX5 H;  2AEF A;  4D6T E;  2JRI A;  1VQ7 P;  3MHV A;  1FU1 A;  2WWW A;  2UXD B;  1M1K W;  3EWK A;  3T08 A;  4WBN A;  4ZHQ A;  3CSX A;  3Q5R A;  3C90 A;  4LF5 B;  3B5N C;  2CH7 B;  3IGA C;  1AJN A;  5EIB C;  1KUQ A;  5CCG D;  2H43 A;  1EDJ A;  1JZ2 A;  1BE3 D;  3CZJ A;  5TIS H;  4KL1 A;  2WPD G;  5H2F H;  1SQB E;  2QSI A;  1NSR A;  1ZV8 A;  2KZI A;  1N86 A;  1M1J B;  2QE7 H;  3ZHQ A;  2N9B A;  1SQV H;  4JI8 O;  1NSS A;  3O9O A;  3NBB A;  1FDI A;  3H1H E;  3TNU B;  4L87 A;  5LHH A;  2YIB A;  1GL2 D;  4I7Z C;  1YTF B;  1HP8 A;  1LJ2 A;  1P49 A;  2WLI A;  2Q0A A;  4JV5 B;  1RWC A;  4JF3 A;  4KFF A;  3UO2 A;  3K0D A;  1S9K E;  3P8C D;  1LP1 A;  1UI8 A;  4YXD C;  2O01 N;  4DUY O;  2WTY A;  3AG1 C;  3QWO C;  2B5U A;  3NJV A;  3AE3 C;  1NTK J;  1K92 A;  2PF4 E;  1X1J A;  3CHX A;  1IVS A;  1K04 A;  1LTT C;  1NAF A;  2Q69 A;  3IC7 A;  4DV1 O;  1TVK B;  2EIL B;  1VQN V;  2IU0 A;  3K58 A;  5IJ0 B;  2DYS C;  1L0N J;  3GMA A;  3P7K A;  2OW6 A;  2J5U A;  4DV7 O;  1N7S B;  4DW1 A;  1H2M A;  4DV6 B;  2ZYG A;  1Y4M A;  1AQT A;  3MIW A;  4FLY A;  5L3E A;  2KUB A;  3CLQ A;  2KG7 A;  2IW5 A;  1NTM K;  4JAS A;  3V2R A;  2QJP B;  1AB3 A;  2IPP A;  4TV8 B;  1PX3 A;  4B7K A;  4LCU C;  2QIW A;  1NU1 K;  2E2T A;  3CCU P;  5C8Y B;  4JI6 O;  2IFM A;  5B66 H;  1W2B U;  3RK2 C;  1Q86 W;  1QX8 A;  2ITD C;  3C3S A;  2DW4 A;  1PX4 A;  2OYH C;  4DUV A;  1PP9 J;  4FZ0 A;  2QM8 A;  5CA0 B;  1LXM A;  3BAS A;  1N33 O;  1XIL A;  4DRX A;  5A9G A;  1WJZ A;  4B3R O;  3CZS A;  1IK9 A;  3CWB H;  5CA1 B;  4O9B A;  2CIQ A;  3AEI A;  3CC4 V;  1KOR A;  4FNV A;  3FB8 C;  1NKN A;  2F43 G;  1X1H A;  4JZ2 A;  1SVF A;  2WAM A;  1KIL D;  3SPG A;  2JK5 C;  5IYC O;  4B08 A;  3CCR P;  4AQY B;  1NKD A;  1NO4 A;  1PL0 A;  2JJ2 G;  3QTC A;  4L73 A;  3H6P A;  3L74 H;  4J9Z B;  1P84 H;  1GDT A;  2QJK B;  5B3S C;  1YI2 P;  1G2C A;  1T6A A;  4FPP A;  5TIS E;  3OS7 A;  4QPK A;  5AW9 B;  3FFQ A;  4KXR A;  4GCZ A;  2XZR A;  2D3O W;  3ABM B;  3FXD A;  5GTH H;  4L76 A;  3AG2 C;  3TYY A;  3BY6 A;  4D6T J;  3RBX A;  1KB9 H;  4B3M O;  3DEC A;  5CCG A;  3V2P A;  2OCC B;  2OYO A;  2OTJ V;  3F7Y C;  4GOF A;  2F1M A;  2E3C A;  1ZSP A;  1NYH A;  1OFC X;  3L73 H;  3B5N D;  3LDD A;  4DJG A;  2B87 A;  5EIB D;  2EX3 A;  2NLJ C;  3W68 A;  5EC1 C;  1R6T A;  1GTW A;  3SXX A;  3ZMT A;  3TGU E;  2F23 A;  4UCO A;  1EZV I;  1NU1 E;  1GL2 A;  1W2B O;  4EV5 A;  3BUB A;  4NKG B;  1SQB J;  2YMK A;  1Z45 A;  3I5D A;  4PDR A;  4IHJ A;  4QPJ A;  2XDJ A;  4FNS A;  2NN4 A;  1OW8 A;  4DR7 O;  5KLI C;  2CAZ C;  2WLM A;  1FD9 A;  2P22 C;  4PI0 A;  2XAF A;  3CME P;  1D6Z A;  1ZME C;  1IBL B;  1LGH B;  1U96 A;  4OX9 O;  5LGN A;  4JI8 B;  2QTS A;  5J2T B;  1AVL A;  4MVQ A;  4RES B;  3RYI B;  1RSO B;  1P4R A;  3RVY A;  2OYI A;  1JOC A;  1LT9 B;  4DUW A;  2PI5 A;  2ZT9 B;  1KQG B;  2ZYD A;  1T5E A;  3H1J J;  2K9J B;  3NMD A;  2FUQ A;  2HJD A;  1ENV A;  3SFE C;  2IBZ D;  2K1A A;  1SA0 B;  4DUY B;  2Y0C A;  3ABK C;  2EIM C;  2R3S A;  3KQG A;  3JSV C;  3BVU A;  4JI5 O;  1IFI A;  2KOG A;  2Q4P A;  1AR4 A;  1I5Y A;  3ZMV A;  3BCC D;  3M9B A;  1FJG O;  2RNB A;  3CWB E;  2WLH A;  3IAQ A;  4DV1 B;  4BWA A;  1CEZ A;  3L37 A;  1WT6 A;  2Q8V A;  4DV7 B;  3SWK A;  3OMA B;  2E2V A;  3E83 A;  3AMO A;  2X6A A;  4HNA A;  1QGK B;  1SFC C;  1P84 E;  1WP7 A;  3LSQ A;  1D2D A;  3H1K J;  4J5T A;  3OMN B;  1OCR B;  1M1K Q;  4KFM A;  1NT2 B;  3JAK B;  4LF6 O;  1R5L A;  1W0K G;  1ZXG A;  1KIL A;  3D4Y A;  4I50 B;  4JI6 B;  1M4U A;  4GX1 A;  1JZ3 A;  1OHH G;  3T1Y O;  2BTO A;  3QF7 A;  1K5Q A;  4TV9 A;  3QNE A;  2PUS A;  1S5L Z;  4ZOL A;  2K88 A;  2FFD A;  3WVF A;  1N33 B;  1URQ B;  5KLV H;  2GUZ B;  2YKO A;  3K3W A;  4B3R B;  4KJM A;  1BCC H;  1H54 A;  1SQP H;  2EIN C;  5LXT B;  3EJR A;  2ZVN B;  3CCL P;  1MKM A;  4J10 A;  4CH6 A;  2Q7E A;  3ZRS A;  1N34 O;  3NFQ A;  4NPE A;  1QL1 A;  3Q3D A;  5IWA O;  2CQS A;  2YXR B;  3BAB A;  4KT0 J;  4PJ0 H;  2FYN B;  3AK2 A;  1N7L A;  1PPJ H;  2ZE5 A;  1JOY A;  1HN0 A;  3MHH C;  1K73 W;  1O9G A;  2ZQ0 A;  1NKZ B;  2OCH A;  3H1L H;  4J7K A;  4AQ0 A;  3B5N A;  2DQ3 A;  2EJR A;  3N9H A;  1SPU A;  1GMG A;  2JIZ G;  1SQV J;  3KYQ A;  4HYO A;  3VSN A;  3VD4 A;  3RT3 C;  4KHX A;  1BGY D;  2WVX A;  1K4D C;  4BAY A;  2X0L A;  3ZIA G;  2ZM6 O;  1MMZ A;  1RE3 C;  4FM2 A;  4JTC B;  1R73 A;  4EOT A;  3PLN A;  1AJQ A;  4B3M B;  2YXL A;  2YIA A;  2KK7 A;  3ZCC A;  1ZLZ A;  3FWL A;  3L70 D;  2DE0 X;  5AVQ B;  1I7F A;  3T2O A;  2PYJ A;  4G28 B;  2A3Q A;  4MN4 C;  3H32 A;  4FLW A;  5K1X A;  1DD4 A;  5AW6 B;  4UCU A;  3RYC B;  1OZH A;  3KZI H;  5JQG B;  1WA8 B;  1LUR A;  5KAF H;  4IL6 X;  1NS4 A;  4X89 A;  4PV1 D;  2E76 B;  3THO A;  1Q86 Q;  4GDO A;  4PD4 E;  3N2K B;  2OQE A;  2QJK C;  2FYU D;  2LP7 A;  1J1E C;  1FBM A;  5B1O A;  4DR7 B;  3H1I D;  3IFM A;  1U7J A;  2QRX A;  3CCS V;  3HD7 A;  5IYD O;  3CRQ A;  3T0B A;  1EZV G;  3GB7 C;  1VQL P;  3K5B A;  1XTG B;  1NAY A;  2EZO A;  2Q67 A;  4OX9 B;  4CPG A;  4I0X A;  3KCX A;  1JFF B;  4I55 B;  2OCC C;  1GAX A;  1KP3 A;  5AVW B;  3S1K A;  3A0B Z;  4F6R A;  3QO7 A;  4X88 A;  1NTZ H;  2W27 A;  3S4B A;  3TY1 A;  2G38 A;  3P3P A;  3CC7 V;  3CWB J;  1TU5 A;  2R9I A;  3OTO O;  5LYJ A;  1VQO P;  2OYH A;  4MMH A;  3DXR B;  1G1J A;  4JI5 B;  3SJQ C;  1SQQ D;  3K79 A;  1MG1 A;  3K5M A;  3TK1 A;  1G1X B;  1FJG B;  1SFC D;  2OTK E;  1FPO A;  3C1L A;  3IN6 A;  4Z1M G;  3J80 N;  3L74 J;  5IYZ B;  1QCE A;  3BUP A;  5AVX B;  2FYZ A;  2Y73 A;  3FXE A;  2OT5 A;  3ZRW A;  1L0L D;  4BZH A;  1OZ0 A;  2IX7 C;  1PPJ E;  2K37 A;  2X7R B;  2HEP A;  1MV8 A;  5FPO A;  4YTP C;  1QR9 A;  3ETG A;  2GUS A;  3NJX A;  2FYU H;  3AK3 A;  3H9V A;  2JDI G;  4LF6 B;  1DLB A;  4YY3 B;  3RVZ A;  4OJZ A;  5H9C A;  4IIJ B;  1Y6X A;  3A0H Z;  3BA9 A;  2B9Z A;  1LT9 C;  3T1Y B;  3K9A A;  2ZT9 C;  1XMO O;  3FD9 A;  2YNY A;  4GLX A;  5CBF A;  2CFW A;  3L73 J;  1M56 C;  1RHZ B;  2ZXX A;  1USD A;  1HUC A;  1QEX A;  2EAB A;  2XHN A;  3HKC B;  4CH4 A;  2CIS A;  3RWR D;  3MUD A;  2ADQ B;  3LSU A;  4O2B A;  2Y9Y A;  3KXD A;  1GTO A;  2H7H A;  2BOC C;  4CH5 A;  3K9S A;  1N34 B;  3E1F 1;  3AED C;  2QTO A;  2E42 A;  5IWA B;  3ZX6 A;  1U57 A;  3VMZ A;  2E22 A;  3ZHT A;  1HMU A;  3VTP C;  4L74 A;  5GW7 A;  3V6I A;  4YIP A;  1JY2 O;  2JGD A;  1FFT B;  2KKW A;  3QVN A;  1XNQ O;  2ODM A;  4B7E A;  5LMN O;  1NI8 A;  2HOD B;  1JZ4 A;  3ASO B;  4GKJ O;  3CP1 A;  3L35 A;  2KQX A;  2CTQ A;  2N04 A;  1H0T A;  3AE5 C;  1LUV A;  3A5T A;  2ZM6 B;  3E7J A;  4UB6 H;  4P9P A;  2XAQ A;  5B1B B;  4EEQ A;  2E5T A;  2F95 B;  2KIK A;  1HR0 O;  2YIU C;  1S4X A;  1OCO B;  1URQ C;  2YKQ A;  1TXK A;  3QG5 A;  4FLU A;  4U7O A;  4GKG A;  5BMV A;  1EXJ A;  1N0N A;  5CJ0 A;  3CRA A;  2CUG A;  4IGG A;  3IJ4 A;  3L75 H;  1COW G;  3G71 P;  3CX5 F;  5JH7 A;  1KYO I;  2R70 A;  4YHH O;  1KU9 A;  4ABM A;  2FYN C;  3AE1 C;  4BRY B;  3B71 A;  3KCY A;  3CZN A;  2YMY A;  1D6Y A;  4UUJ C;  1NTK D;  1MMX A;  1VQK V;  3MDS A;  2CH7 A;  3DC5 A;  3EVK A;  4FM0 A;  4AQR D;  2QJ1 A;  3AE6 C;  1JZ8 A;  1EZV H;  2RMK B;  4O4H B;  1RM1 B;  2P4K A;  2B89 A;  1B6Q A;  3GHG B;  3RFR A;  1L0N D;  1Q2N A;  3PH0 A;  4R8C A;  2UXC O;  1Q43 A;  2ILM A;  3W7U A;  1EQ7 A;  4PA4 A;  1M1J A;  1URF A;  1SFC A;  1KFN A;  2W0Q A;  1MMY A;  2Y0P A;  3VOU A;  2V4D A;  3T0D A;  5GTI E;  2EAD A;  2BSK A;  4TWK A;  2WSC H;  5HFM A;  3TNU A;  4G27 B;  3DX1 A;  3E8B A;  5D5Q A;  5KLV J;  1M57 B;  2UXX A;  4GX2 A;  1BCC J;  3HUS B;  1SQP J;  2HPC B;  3CE2 A;  1ZN5 A;  3V4W A;  1EGU A;  4YXW H;  1SC5 B;  3OTO B;  3MUZ 1;  3QG0 A;  5BU5 A;  3CXH D;  3ZED A;  1JCH A;  1IVX A;  1PP9 D;  1YTZ I;  3OAA G;  2P7J A;  3CMA V;  3E7K A;  3AFL A;  1K33 A;  3CI9 A;  4DT0 A;  1KC8 Q;  3D36 C;  4DW0 A;  5C93 A;  2PRR A;  5AVU B;  1X4T A;  4X1I B;  4RWU A;  1XRE A;  3K06 A;  2H8P C;  2KSD A;  2QA4 V;  3H1L J;  2AXT E;  1TVK A;  2DWD C;  1LWU B;  4X62 O;  1QR8 A;  5IJ0 A;  5GON B;  1YHQ P;  1BSM A;  3N7N A;  3TCU A;  2ZT9 D;  2FXM A;  1PV0 A;  1N73 B;  2B88 A;  3K03 A;  4O4J B;  4JI1 O;  2CGO A;  4X1Y A;  2V7Q H;  4TT3 H;  2BRP A;  4O4L B;  1M56 D;  2CK3 G;  1AVO A;  5APV A;  1TQW A;  2Z3Y A;  2W6J G;  1Q3E A;  4JI2 O;  3TSI A;  5JWP A;  1N7P A;  3T09 A;  1R6K A;  3A0R A;  5TJH A;  1XL6 A;  1NZ6 A;  1SQX H;  4TV8 A;  2K9Y A;  5TIS Z;  1W2E A;  3A0B H;  3BRV B;  4DO2 A;  4N21 A;  5H2F Z;  5C8Y A;  4UB6 E;  3S4R A;  2P7T C;  4H33 A;  1RE3 A;  2E5Y A;  2WA3 A;  1GW3 A;  4IFD K;  1H89 A;  4D6T D;  1JA8 A;  2YEV B;  4IFF A;  4U3F H;  1MSW D;  1FXH A;  5CA1 A;  1PS3 A;  1JYN A;  1SER A;  2N74 A;  1EKM A;  1G4Y B;  4JI0 O;  3JAL A;  1AI7 A;  3N27 A;  2WSS H;  3RBZ A;  3P3N A;  2XV5 A;  5IYB O;  2LFR A;  1XNQ B;  5EBM C;  2N1T B;  5LMN B;  3UIA A;  5EZY A;  1SQB D;  4GKJ B;  1P84 F;  3FYI B;  2GHY A;  1URQ D;  2Y0D A;  3CL3 D;  1H2K A;  2YUA A;  1YVW A;  1EZV E;  3CJH B;  2JKV A;  5CJ4 A;  2GV9 A;  1WMK A;  5KAI H;  2CWV A;  1ULV A;  1NTK K;  2ATK C;  2M3B A;  1KMI Z;  2Z5H A;  3VBB A;  1HR0 B;  3SWF A;  4LH7 A;  1NTZ J;  2E2U A;  1SIH A;  2WGQ A;  2JO1 A;  1GKF A;  1PL5 A;  1P7G A;  1OVU A;  2CTP A;  2MW2 B;  4RUE A;  1CI6 A;  4MSW C;  4O4I B;  1VQ9 P;  2YXY A;  3GF7 A;  3H1J D;  3JC2 2;  5AVS B;  3JAW B;  5L3F A;  5B66 Z;  4YHH B;  2CGN A;  2PY5 A;  4JZG A;  5F2V O;  2JEE A;  1O9H A;  3JAS B;  5EK0 A;  3AG7 A;  1ZRT D;  3G4S V;  2YO3 A;  3E1R A;  1KV4 A;  3G6E V;  3HKE B;  1NTM G;  4EV2 A;  1N7R A;  3Q4H B;  3I3D A;  2A06 G;  3ASO C;  2JJ1 G;  3WA2 X;  3SDL A;  2RDY A;  1K9M W;  1LTJ B;  3BVX A;  4W4L A;  2H89 C;  2YIB D;  5KHH A;  2UXC B;  3JAR A;  1A32 A;  1E1R G;  4C7N B;  1GO3 F;  5AG2 A;  1RWH A;  2KZJ A;  1SQB H;  1JY2 N;  3BVO A;  1GMJ A;  2Q6Q A;  2YI9 A;  2XAH A;  3H1K D;  4OH8 B;  5DJT B;  5J2T A;  3AEF C;  3D8C A;  4TUY A;  3RYI A;  1RSO A;  1SQX E;  1ZP0 C;  3H1H H;  5KHG A;  1LT9 A;  1D5A A;  2RCV A;  4PHZ A;  2K9J A;  3VP8 A;  4KHP O;  5GTH Z;  4TSF G;  3CX5 D;  1SA0 A;  2WSF H;  1J0N A;  3CRR A;  1A2V A;  1SQG A;  1N4C A;  4K0K O;  1DF4 A;  1NSX A;  3ZMZ A;  4U3F E;  2LGW A;  4GOE A;  4PD4 F;  4IL6 E;  2DYR B;  3K5O A;  2ZIN A;  2LFS A;  1LR1 A;  3OT7 A;  1IFP A;  4LBE C;  1K5S A;  2DWE C;  3ZBH A;  2EBO A;  1RM1 C;  3GHG C;  1Q7Y W;  2PTM A;  1X22 A;  4JYB A;  2WCO A;  4JI1 B;  3B8M A;  1BE3 G;  1NSU A;  4JI2 B;  4H0L B;  4AQY O;  1K34 A;  1FAV A;  4AIL C;  1EM1 A;  2FL4 A;  3ZRV A;  2IBZ I;  3BUQ A;  1SQV D;  1M5I A;  4A7P A;  1M57 C;  2M6Y A;  4I50 A;  3HUS C;  5AW1 B;  1R8E A;  2R5D A;  4GOD A;  3JD1 A;  1M7L A;  4TQD A;  4H13 B;  3D71 A;  4CS3 A;  2BCC G;  3L75 J;  4LNU B;  1JY3 O;  4RUF A;  2D2C C;  3HE4 B;  1URQ A;  3LDC A;  1PGP A;  3M0A A;  1JPX A;  2H88 C;  4OWF A;  1NSM A;  1YZB A;  3HRN A;  3SWY A;  3EJT A;  1CSB A;  2FML A;  1RW9 A;  3LID A;  2SPZ A;  3MHS C;  3DX0 A;  3NBJ A;  2QG4 A;  4JI0 B;  3NRE A;  3H01 A;  1PIX A;  1WN7 A;  1GN2 A;  3ZDM A;  1L8D A;  5IT9 N;  1VQ8 V;  1WRG A;  1N73 C;  4BZF A;  4J42 A;  4WY4 B;  1PGJ A;  1HNX O;  2LXB A;  4RO0 A;  2NNU A;  3BPZ A;  2WSC J;  3K5T A;  3O6Q A;  1K1Y A;  3E8F A;  4UV8 A;  4Q6G A;  4BTW A;  4PEL A;  3I56 V;  1UII A;  1N32 O;  3VP9 A;  1IBL O;  2E75 C;  3T1H O;  1KQS O;  1FZC B;  4FLZ A;  2PI4 A;  1BSH A;  1YCI A;  5E1A C;  3FB5 C;  4UVC A;  1I8Q A;  1Z2G A;  3CWB D;  3RYC A;  1OJN A;  3DX4 A;  5JQG A;  1WA8 A;  5IE9 A;  1BDC A;  3KII A;  3W7X A;  3VDB A;  3STL C;  4CC5 A;  1M8O B;  3TGU H;  3D36 A;  4LF8 B;  2ALW A;  4JTA B;  1H8A A;  2F7R A;  3EQ2 A;  1NU1 H;  4I6M C;  4EFE A;  2V7Q J;  2OQE C;  3L74 D;  5H5N A;  3HKD B;  1WB7 A;  1P84 D;  2F1A A;  3CRC A;  1D6U A;  1MAB G;  3SR2 C;  2JVD A;  4YJ2 B;  1NVP B;  2P90 A;  4PJ0 Z;  2E74 B;  1SZX A;  3HD7 C;  3QDE A;  1SQX J;  2LGQ A;  4OGQ B;  3OEE G;  1HDJ A;  1KD1 Q;  1OCC B;  2FXP A;  1K8A W;  2I1K A;  1JFF A;  1EN6 A;  3RYH A;  3VQY A;  4BR6 A;  3M7M X;  4I55 A;  1YJ9 V;  3QFZ A;  1K4C C;  1KB9 D;  2W83 C;  3FB6 C;  4UVB A;  2DJV A;  3SPI A;  4KHP B;  2HJF C;  5LP6 B;  4U3F J;  2OW7 A;  4IOI H;  1QLE D;  3L73 D;  2A45 I;  2Q73 A;  4K0K B;  1G6U A;  4FNP A;  1NH2 B;  1E79 G;  2KB7 P;  4HH2 A;  4MVS A;  3UKM A;  3L71 G;  4IFM A;  3CCE V;  3WG7 B;  2BTQ B;  3HTK B;  1VF5 B;  2E24 A;  5JMF A;  2WYH A;  5AVR B;  5IYZ A;  2QM7 A;  1LTJ C;  3P8M C;  3VD3 A;  3KZI Z;  2KNC A;  1JRQ A;  2HLD G;  1NOH A;  5KAF Z;  5L8R J;  2IYO A;  3CV5 A;  1ZLL A;  5DEC A;  3L72 G;  2ITA A;  4PA9 A;  4WFF A;  1YTZ T;  4LFA O;  2D2C D;  4MMI A;  2RJZ A;  5CBN A;  1SZT A;  4RNL A;  2P6J A;  4KFE A;  5FPR A;  1K7D A;  1V9P A;  4R7C A;  1RPR A;  4N78 D;  3ABU A;  1Y74 B;  2BE3 A;  4U7J A;  2IH3 C;  2QM4 A;  3RGU A;  5EC2 C;  1FXK C;  1SO0 A;  3PJS K;  4X1K B;  1S5J A;  1JYW A;  3HKC A;  4R50 A;  4HJG H;  3MI6 A;  2QKS A;  4PA7 A;  4DR4 O;  1MFT A;  2CFG A;  4ASV A;  1IVW A;  2IBZ G;  3MUD C;  2JR8 A;  3W67 A;  2ZKO A;  1J1D B;  1JZ6 A;  5LGU A;  4FFK A;  3CCQ V;  1W2Z A;  3G9R A;  2DYR C;  1DGS A;  1MMM A;  2QDO A;  4C7U A;  3ALA A;  2C0W A;  3BCC G;  1HN1 A;  3P30 A;  2CE4 A;  1IFJ A;  4DR1 O;  1NTM E;  5B5E H;  2W8Z A;  5CBH A;  1AVY A;  1SNZ A;  1S5H C;  1EDI A;  2A06 E;  4DV5 O;  3UO3 A;  4LC1 A;  4BIU A;  2B1G A;  1HNX B;  3ITK A;  2HOD A;  4JYA O;  4H0L C;  1KYO E;  2E75 D;  3WFA A;  2XN1 A;  1JJO A;  5BU8 B;  3DX2 A;  1DD3 A;  1HWW A;  1JZ7 A;  3H1H J;  3II6 A;  2YFO A;  3IAP A;  4MVM A;  2UUB O;  3FX7 A;  1HF9 A;  3G80 A;  4YJ3 B;  1YXB A;  1EBO A;  2OTL V;  2BRW A;  1RF1 B;  2WW2 A;  5D5P A;  5L3B A;  1N32 B;  3MP7 B;  1M90 W;  3T1H B;  1MZF A;  4J7J A;  1Q7Y Q;  5KX5 A;  2WSF J;  4H44 C;  5KLV D;  5AVV B;  4MTX A;  1BCC D;  1SQP D;  2BT3 A;  2YX9 A;  1Q82 W;  3VD9 A;  1S72 V;  1TQV A;  3C8V A;  4MW3 A;  2KS1 B;  5JVD B;  1RPO A;  2XAS A;  3ZRX A;  3HD7 D;  1JY3 N;  4LP8 A;  1E5W A;  3X3X A;  1N2D C;  1PPJ D;  4UFC A;  4AUW A;  3VMX A;  4ZBM A;  4MS2 A;  3SYP A;  4PD4 H;  4FFB A;  1FFX B;  1MN0 A;  3H1L D;  2ZL8 A;  2Q1F A;  1JJ2 U;  1K05 A;  2L6L A;  1BE3 E;  1YIT V;  3CCS P;  2JJL A;  4O4H A;  1BDD A;  1FE6 A;  3GHG A;  2B9B A;  4KTR A;  2FY8 A;  2JGU A;  2L35 A;  1IZN B;  4UCV A;  5BVZ A;  3OBA A;  3SEP A;  1S5L X;  3ZN1 A;  1ZR4 A;  4EYY Q;  3RK2 D;  1SES A;  2Z5U A;  3CCU V;  5KA5 A;  1M1J C;  1JZ5 A;  1DTO A;  4IYH A;  1E1Q G;  1WAZ A;  1LTS C;  1EXI A;  1Y9B A;  3UQ8 A;  1GN6 A;  1VF7 A;  2HVK C;  5LOV B;  4YY3 O;  2R32 A;  2WVY A;  4KTP A;  3HUS A;  5CMU A;  3JCU E;  1H2G A;  2BCC E;  2HPC A;  2Q7C A;  2XKM A;  3L70 G;  2IJI A;  3AG4 B;  4U3J B;  3F89 A;  3CC7 P;  4UB6 Z;  3T4Z A;  4XBF A;  1L1F A;  1VQM V;  2FBW C;  2YIC A;  5AVZ B;  1IQX A;  3ZN0 A;  3P8C E;  1VQ6 V;  2RN0 A;  2ZXW B;  1FXV A;  3DTU B;  5CA3 A;  1TU3 F;  2GM4 A;  4H37 A;  1YJN V;  2XSG A;  2Q7G A;  1AI5 A;  4X1I A;  3T97 B;  3T2Q A;  1J5E O;  3O8Z A;  4J7Z A;  1B3Q A;  2VWK A;  3SPC A;  3MGN A;  2WLK A;  3WU2 E;  1LWU A;  4B86 A;  5B5E E;  3A2A A;  2A45 G;  2EIL C;  3L72 H;  5GON A;  2E74 C;  3V2N A;  3H1I G;  1SKV A;  4UB8 E;  3SSU A;  1N73 A;  5DED A;  3AE9 C;  5CMZ A;  3IFX A;  1N7S C;  1FOS E;  4O4L A;  4LFA B;  3K0G A;  1Y8A A;  1OCC C;  3M8A A;  2K9P A;  1AI6 A;  3CXH I;  3CCJ P;  1KKC A;  2QJP C;  1UI7 A;  3U1C A;  2O3J A;  1QWU A;  2FB5 A;  5LP6 C;  4B3S O;  3ZHV A;  3LNM B;  1F9G A;  4U7N A;  5LA6 B;  1NTZ D;  2J58 A;  3MUY 1;  5DN6 G;  2GTA A;  4DR4 B;  3HE5 A;  2YEV A;  1SS1 A;  3OAK A;  2CPB A;  4OXS A;  1BL8 A;  1PM9 A;  3B2E E;  2CFK A;  1R3J C;  4DUX A;  3B8E B;  5AW0 B;  2F66 C;  3TGU J;  4H0L D;  1SQQ G;  1NU1 J;  1K8A Q;  1V54 B;  5L3C A;  2QGN A;  4FLX A;  2WOF A;  1ZAU A;  4DR1 B;  1HNZ B;  1I94 O;  2C9L Y;  1KIL E;  3D3Q A;  1NSZ A;  4GUN A;  1PFI A;  2EJ7 A;  1S77 D;  4DV5 B;  3PRJ A;  2N1T A;  4GT1 A;  1DEE G;  3DYP A;  3BAA A;  1L0L G;  4JYA B;  1FZG A;  2K3R A;  5AW3 B;  3CME V;  5CB4 B;  1KSI A;  3CCV V;  2BRV X;  5E79 H;  1CB8 A;  4J41 A;  2PYL A;  1W4N A;  3JAT B;  2UUC O;  4N6J A;  3V4Q A;  4H44 D;  2XNX A;  2D1W A;  2UUB B;  2W0X A;  5J2U B; 
#chains in the Genus database with same CATH homology
 1HTY A;  5DJT B;  3BUP A;  1TQV A;  3FXE A;  2F1A A;  1R33 A;  4WWI A;  2KS1 B;  3LVT A;  1ZXG A;  3D4Z A;  1LT1 A;  3CZS A;  3D4Y A;  2LR2 A;  1LP1 B;  3BVV A;  2F18 A;  2F7O A;  2KI7 B;  3DDF A;  3EJS A;  1TQS A;  2FYV A;  2M0B A;  4K35 A;  1H0T B;  2R44 A;  2Q1K A;  4KJM A;  2M5A A;  1BDD A;  1O7D D;  3EJR A;  1JMB A;  3MZW B;  2B88 A;  4GOE A;  4NPE A;  1TQW A;  2WYI A;  4EYY Q;  1NVO A;  2OW7 A;  4NPF X;  4IOI H;  4ASW A;  1HXK A;  1TQU A;  5DJU B;  4HB1 A;  5CBO A;  3FXD A;  3BUD A;  5C39 A;  1OVV A;  2I8D A;  2WYH A;  4K3A A;  3MHV A;  1JM0 A;  3BUQ A;  4ZNC A;  4GOF A;  2P58 A;  4BXL A;  3CV5 A;  2WMM A;  2B87 A;  4GOD A;  1PS3 A;  2JWD A;  5KBP A;  2HR3 A;  1EDJ A;  3DDG A;  2QVA A;  5CBN A;  1H0T A;  2F7P A;  1U7M A;  4ZMD A;  3BUB A;  1FC2 C;  1QWN A;  2KZI A;  4MN4 C;  3EJT A;  2KIK A;  3RGU A;  2SPZ A;  2UWJ E;  3DX0 A;  4HJG H;  1EDL A;  1MFT A;  3EJU A;  4ASV A;  3ZDM A;  2ZAE B;  3D52 A;  1QWU A;  4HKZ H;  1ZW0 A;  2RKL A;  1EC5 A;  1LP1 A;  1U7J A;  2LXB A;  2QRX A;  1S3J A;  1SS1 A;  1OVU A;  3QWO C;  3CZN A;  1X0T A;  2F7Q A;  1EDI A;  2F1B A;  3DX3 A;  3D51 A;  3D50 A;  1R34 A;  3BVT A;  3BVW A;  4CPG A;  3EJP A;  1Y47 A;  3BLB A;  5K5G B;  2M5A B;  2B87 B;  3BVU A;  2B89 A;  3S1K A;  2OW6 A;  3DX2 A;  3PH0 A;  1Q2N A;  1HWW A;  3BUI A;  5EFW B;  1QX1 A;  1DEE G;  1EDK A;  2KUB A;  2LXC B;  2K3R A;  3DX4 A;  1TQT A;  1OVR A;  1BDC A;  3BVX A;  3DX1 A;  4NPD A;  3EJQ A;  2ALW A;  2OTK E;  4JBZ A;  2F7R A;  2KZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...