4K3GA

Immunoglobulin lambda variable domain l5(l89s) fluorogen activating protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
109
structure length
109
Chain Sequence
b'AVVTQEPSVTVSPGGTVILTCGSSTGAVTSGHYANWFQQKPGQAPRALIFETDKKYSWTPGRFSGSLLGAKAALTISDAQPEDEAEYYCSLSDVDGYLFGGGTQLTVLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin lambda variable domain L5(L89S)
publication title Malachite Green Mediates Homodimerization of Antibody VL Domains to Form a Fluorescent Ternary Complex with Singular Symmetric Interfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k3gA00
5IB3B 3NPSC 3BIKB 3TV3H 1T2QL 3E6FB 1G9NL 4F7TA 3NZ8A 1BBJB 3DARA 1SYSB 2AJZB 3QUXA 4HWBH 3EFFA 3ES6A 5L8KB 4M93C 1YMHA 3ARVA 4LVHC 5JIIA 3W2DL 5L0QC 5ABDE 4CNIB 4EUPH 4PTTB 3BN9C 2AXFA 1EEYB 3C2AL 3CVHA 3UPRA 2MQCA 1T20B 4LASH 2XN9A 3S8WA 3TFKC 2ARJA 2FLBT 3BD5A 5JXAL 3FOLB 3CSYB 3F12A 3OKKB 3WN5C 3CC5A 1MFAH 3FT4B 4YK4B 3G6DL 1L9NA 5D5MB 3HE6C 2P24A 2OR9H 4CRPA 2YOCA 2VE6B 5AZEL 1RUML 1FQ9C 3IAQA 1O7SA 3RY5A 3A67L 5D93B 1JP5A 1K4CB 4OT1H 4NQSB 3VWJC 1UCBL 5TDOA 1X6NA 3MFGB 3OX8B 5DSCA 1P7QD 2ZJSH 4M6NH 4NRXA 4P23D 3UXFA 1YPZA 3WFDL 4U1KB 3SDCB 4HD9A 4OLYH 1AHWA 3TBWA 4ONGL 1QSFA 1A6AB 3C5ZA 4L9LA 3A6BL 2AQ1A 2P5WA 2CDFB 3FRUB 4NYLB 1OAXL 3VXQB 4PJGF 4XXCC 4OM1L 3TA3B 4NHUA 2YMXH 3H8NA 1BQSA 3MBEB 4FQLL 2DQEL 4OTXL 4DW2H 5I2IB 1KJVA 1DANU 4P57A 4WGWB 5ELIA 1TCMA 1KCVH 3BOVA 3BX7C 1ZHLB 4WW2F 2FR4A 4NP4L 3BP4B 4ODHH 4OLXL 2VDKL 2MFNA 2GAZB 4HUXA 4AEIH 3SJVB 4L5FH 2J8OA 4NKQB 4XCEA 5T3XE 3V6OA 5KVDH 4LPTA 3LEXA 1CICA 1E4WH 3O2WH 1IGFL 1CE1L 1D5BA 4BELD 4O5LL 4NT6B 3K1DA 4KZDH 4L1HA 3I3BA 2AGJL 2RJMA 3QUZB 4N8VA 2B1AL 2C1PB 1A1MA 4HC1H 3O4OB 4BH8B 1KT2A 2C3XA 3EOAA 1AD9B 4YHML 1R5IB 3ARGD 2LU4A 5GGTL 1S7TA 1N3NB 3UTSA 1A02N 1S5IL 2DOCA 3QHFL 1KCLA 1A7QH 5CFHA 3CSGA 3MXVH 3JSSA 1H15A 1UT9A 1YEHL 1JGDA 3VWKC 4P5TB 2NY6D 3CLEL 3LD8B 3GMNA 1PY9A 1T2XA 4ZD3L 3QIWD 4UOW1 1ODAA 3UCRA 4PJ5B 3OJMB 5FYJH 3HI6H 1ZHBB 4KK9C 2CMRH 1PBYA 4KVNH 2HJFB 3VFOA 2HLFC 3LQAC 4B7IA 3WDJA 4RFOL 5I1HL 1AD0A 1F3JA 4GAGH 1RJCA 1JCKA 4TUOA 4O9HL 4Z7NF 5GZND 3V7MA 3OBAA 3I50H 4MA7H 3MRFB 1IRAY 4YHZH 1HKLH 4YX2L 3ZE1F 3DRQA 4P2QB 2FO4B 3DO7B 1T1ZB 3I2CL 1RV6X 4PUBL 5CP3A 3RL2B 1KC5H 4K9EL 2Q7NA 1ZK9A 3A6CL 3MLRL 1TZGL 2NY3D 2AJXL 3Q5YA 4X9BA 1DEEB 1EUTA 4Y16B 1NGXA 4TN9A 5F89A 3RBSA 3V5HB 5DA4A 1A7RL 2DQDL 5JW3H 3TO2B 1XGRA 1IAOB 5D9SA 4GT7A 4KDWA 1G7JB 1S9WB 2G75A 3PJSB 2Q8BL 3D39E 5KJRH 5DD1H 4PJDE 4N0CD 1YNTA 5E6IC 3EYSH 1NMAH 1NFDF 4XNYL 3FQNB 5FUZL 1KLGA 5GSVA 1NGPL 4OGZA 4C4KO 1CFSA 4M48L 4KVCL 4QY8B 4U31A 5DHXB 4ZMAT 1I1RA 1UVQA 2D7NA 5LCVL 1KPRB 5I8KL 4Y5XC 4HXBL 3VA2C 5AAMA 5IKCB 1ES0A 4K7PL 1CZ8L 4WRLA 2YPKA 1YC7A 3NCJL 3L5JA 1ZA6A 3ARFB 4FMKA 3KLHD 4KXZI 3D48R 3TPKA 1FFOB 1N5YL 4W81A 3Q48A 1IAIM 1S3KL 1IM9A 5KSAA 4G8GE 4WHYH 4H8WH 1EVUA 5CZXD 3S34H 2OTUB 2JJSC 2QLVB 1B6DA 1W0WA 4RGOL 4V2BA 2Q20A 3FAWA 1WC7B 3OAUH 4PJ7B 4TVSa 3QI9A 2WK2A 4PJXF 1G6VK 3H7BB 5FM5M 3SEPA 5JPNA 4AQOA 1MEXH 4PJFB 4X4XA 4LQFL 3WL9A 2EYRA 3TLRA 1MFCH 4CW1A 4PJ8C 4JY5H 3SE9H 1OTTC 4WFGD 2V17H 4X4YB 5JZ7D 1T4KB 1WTGT 2X05A 4DK6A 1C5DB 4LSPH 5DVMA 4L8DA 3LS5L 4JAMB 32C2B 2VL5A 1U41A 1QLEH 2XG5A 1JYXA 5F1IA 3BPOC 4Z8FL 1MELA 3LV3A 1VFBB 2EDTA 5IT2H 4X5WB 4KRMB 2MNUA 4F7CA 3I9GH 1LEIB 1F11B 2BJMH 1TNNA 1OCWL 2IPUK 5E1HB 2X6MA 5DJ2A 2XOTA 5JIKA 4XHQA 2VXVH 3DUUA 1GOFA 1Z3GH 4XMLH 3LMJH 5C1MB 2X4RB 4HKXB 2XQYK 2XKNB 3JWNC 2HRPH 4ZXBA 3JTSB 2I24N 4G43B 2X10A 1A6VL 4QRUA 4NUJA 4ORGB 3PDOA 1IAKB 3BIKA 4N5ED 4XCYB 4D9RD 1JGVH 2RAMA 3ZHLA 1I8LA 4HAGA 4ZAKD 1SYSA 3QEHA 1SY6H 3OKNB 3EO9H 2A6IB 1RURH 4AEFA 4LLVA 5FKPB 3V7AG 4Q2ZA 4XP1H 1KV3A 4LIQL 1LEGB 4XZUB 4C4KT 5DZLA 3RA7L 3GDBA 4FXGA 4JM2A 1T66D 4JR9H 1U8LB 4PTTA 4ZFZA 4YC2C 3ETBF 4X9IA 5GS2D 3GHEL 1ZVSA 3RWHA 4JFFB 4HLJA 5ICZB 2JJVA 5MHSE 5D1XB 1MAKA 35C8H 3FMGH 4WENB 5D5MA 3ZZ1A 2MPAL 5KSBF 4LKCB 1K4CA 4P2RB 1WBXA 1YN6A 1N26A 1B6UA 2FJGB 2PXYB 3EFDH 2E6JA 4GMSH 3VXTA 5I1AA 1D5MB 3VXRE 4NQEE 3LZFL 1AO7A 1V7NL 2AEPH 5I1CL 2M26A 3B2VL 4QHMA 3MBXL 4EJ1C 2CDFA 5F7EL 1R0AL 4F3FB 5EIVA 3TA3A 5EOCH 1I7ZA 3KPSA 5L2KD 1E28A 3MBEA 5CJXC 1M71B 1ADQL 1NCAH 2FX9L 5DC9B 3RZCA 2Y06H 3P11L 3V4PL 3BP4A 4P2OC 3D3VB 2W0FA 3ARQA 2GAZA 2JJTA 3SJVA 4G9DB 4Z7UF 1HDMA 1L4IA 1BQHA 5JW4Q 1N8ZB 1BM3H 2W1NA 5GGRY 1ZGLP 3EJYC 3T0VA 1J0ZA 3GO1L 3PP4L 5DWUL 1O0VA 2HN7A 3BN9D 1QR4A 4APQD 5T3ZD 3WD5H 4QOKB 3TFKD 1N4XL 3QWRD 3QUMH 3STZB 1L7IH 1AD9A 4L8SA 1AXSB 3PWVA 1R5IA 2BSSB 3U36B 3HE6D 2BNRD 3MNVB 4U3XA 1C5BH 5HGHB 5E08H 3ARTA 3VWJD 4P5TA 4P2QE 1DBJH 4OCWL 1EGJH 3E6HB 3CXDL 4PJ5A 4Z95L 1L7TL 2XYCA 1ZHBA 1WCBB 3KXFD 1GZPB 2IFFL 5D7LA 1I7TA 4Y0GA 3GIVA 4KTDL 2ZCHL 1H8OA 2DQUH 4Q9QL 3MV7D 1HINL 4IRSA 4WFEE 3ECBB 4ODVH 3BE1L 3S6CA 2R4SL 1FP5A 3INUH 1MFNA 3U82B 1SEQL 5GJSL 4YHOL 2A6KB 3DVGB 4P2QA 1LO2H 4DGYH 3FZUC 4U1NA 1EH9A 3ULVL 5FYJU 4FQXA 2CO6B 4JQVC 3N1MC 3OKLA 1FGVH 2YKLH 4MWFB 2G5BA 4GSDL 4DKDC 1CVRA 3QPXL 4Y16A 5T1DL 4Y8AA 3U7AA 4IRJB 4F33B 1DQJB 1EMTH 3TO2A 1QFHA 4CL7A 2DYPD 3U7WH 4XX1E 5BZDB 2P7TB 4S2SB 2BFVL 3PJSA 1CGVA 5C8JB 5CEZE 2OJZH 4MNHA 5E2TH 1NH6A 1YJDH 1WJ3A 3MLXH 5HYFA 2XG4A 3OR7A 5IJKC 4JFED 4OQTH 3VG9B 1WWBX 4EIGB 4U6VH 1CF8L 4UDUA 1V3LA 4AQ1B 4PJ7E 5HI3C 5C86A 1IC5L 1T2JA 3VWKD 2F8XC 1ZHKB 2XNAA 4PJFE 1P7KA 1BECA 2FIKB 1RZIA 3IXTA 4L4TB 3SGKA 5JLZA 4J3VA 1P6AB 3PUCA 1M7XA 2BY3A 5IR1B 1HN1A 4ONHB 4EVNA 1HXMB 2UZIH 4WW2A 3RBGA 4JZJB 2NLJB 5CEYB 4KK9D 3C6LD 1QFWH 4Z7VF 4UILL 2FYYB 3H0TA 4OUOA 1PW3A 4MQXC 4ZFGH 4Z7WA 1EA9C 3V8CA 4XP6H 3QSKB 4OJFL 3W0WB 3ARUA 3U46B 1C08B 4JO2H 4PJ7A 2JJWA 2DTSA 1D9KB 4Y2OA 4M43L 3IETB 5C0IA 3U4EB 3QIBC 5IGXH 2Y36H 5SWQB 2VQ1B 4FTVB 4HDIB 7FABH 5DLMH 1U8HB 2A77H 2YD7A 2E7CA 1MCOH 2EH7H 4HKJB 1VPOL 1UJ3B 1T4KA 1LO4H 2X41A 1UXSB 2VXQL 5FM8A 3O8XA 3DYOA 5T1KA 3MGAA 1L0QA 1CDJA 4IOSD 4PREA 4XT1C 3R8BB 2EO9A 4EN3A 4F37F 3UO1H 4PJ9A 3EUUA 5EC1A 4MGXA 1MAJA 3AB0B 2CLZB 4F37K 4P9HC 1G7LB 1Y6KR 4GRLB 5CGYD 2Z91B 1KJ2L 5F3HA 1NCUA 2HT4D 4OFPA 3TN0B 4HS8L 5ALBH 2FJFA 1B0RA 5F1SA 3GSRA 2GSIA 4NM4L 5HDOA 4EUPG 2Z8RA 2QEJA 1BFTA 2R2HA 5C09A 4QHUB 5CIPH 4RBPK 2P8PA 3C60B 2X4RA 4HKXA 3RU8L 4P5MB 3KLSA 5EU7C 4M1GL 5I9QB 2O61A 2GT9A 3JTSA 4NOBA 3TC9A 4JFFE 1OARH 4JM4L 3SDAB 1IAKA 4YUEH 3KR3L 5CSBA 4LF3B 3MGTB 2E27H 1I4FB 1KOAA 4P2RE 4R7DB 2A6IA 1YN7A 4OZGB 4P9HH 3UBXB 3KYKL 5FKPA 4GAJH 5HGBB 3WIIH 3PDGA 3BW9B 2GHWB 3TV3L 5A2IH 2I27N 1OLLA 4NKDA 1WZ1L 1U8LA 3ABZA 3QCVL 1EAPB 1BOYA 2J6EA 2ATKA 4MCZB 1DUZB 2HTLC 4K8RC 3MRQB 1A3RH 4PJ8D 3UJIL 1U95A 3I6LD 1OTTD 4J23A 5C0BB 3QZWB 3KLAB 3CFDB 3HRZB 1AR1C 25C8H 4LKCA 3PWLB 4F58H 5SWSE 2VSCA 4XCNA 5DJCB 3BH8B 4OV6F 1H3PH 2QSVA 4NRYA 4U1MB 4DKFH 2NY1D 4O58L 4NQCA 4WTZA 3V0WL 2BVPA 1VADA 4QRPB 1ZSDB 1B2WL 4O2CB 5HHVH 3D3VE 3JVGA 4HIJA 3V4UH 1D5MA 4PJEB 3VFGH 4ODWB 4BZ2L 3C8DA 1JYVA 4JDVB 4E0RA 4PJBB 5TE7H 1NAKH 2VNCA 2GJ6D 2D31B 3QDGD 1NCTA 4Y19B 5E6YA 3L1OL 2QKIA 2Y23A 4WHTB 4Y4FB 3H9ZA 4PJXA 1YNLL 5CCKL 2BXZA 2J5LC 4QOKE 1M71A 2WUBH 1UWGL 4JE4B 4KI5F 4CVXB 4I9WE 4DUXA 1NBQA 4W6XB 1JTOA 3WNKA 1TVDA 5J13C 2B0SL 5T3ZL 4XPGH 3G5XB 2YMXL 1KJMB 4ERSL 2Z0BA 5DQDH 3UYPA 3D69B 5ESQA 3BPCA 4G9DA 4U6HA 2FBJH 2R39A 1KIUA 3QIUB 3G6JA 1CFTA 3TJHC 1CCZA 5FOBA 5BS0B 4JVUA 3NFSL 1LDSA 2DLEA 1LVEA 2LQRA 1HXYB 1YEGH 5JXEA 1WEJH 4N0RA 2BVQA 4QOKA 1FCGA 3RWIB 5EO0A 1P4IH 4I3GA 3WFZA 4L5FL 2BOBA 2ITCB 3STZA 1INQB 5KVDL 4OLWL 4O2EA 2HFFA 1E4WL 4J4PC 1JV5A 4H20L 2R1WB 3LN5B 4OLUL 4LLQB 5CS7A 4KZDL 3VGBA 5HDBE 2MJWA 2JB5L 4TVPE 4GMTH 4HC1L 3GSVB 3LDBC 43C9A 3W9EA 1A5FL 4XP4L 4KKCC 5E2UH 3DMMB 1YY9D 4YHYC 4GLRI 1GGBL 2YN5A 2GITB 4PP2A 4HK0B 1Q1JH 4U1SB 1J8HA 1IBGH 2DKUA 4KV5E 3MOBH 5AD0A 5HVGB 4OSUH 1NUNB 4XNQB 5FYJL 4WU5A 3EO0B 3E1F1 5DMGD 1YUHA 3RGVC 3VXMB 3IDMA 1MHEB 3QHZH 3CFIC 1UB5A 4KTEH 5J11B 1A7OH 3VFSA 3RUGA 3L7FB 2VDQL 5FECB 2HVJA 4KK5C 3IAGC 4GAGL 1LHZA 3HE7C 4P2OD 3KPTA 3LEVL 4G80B 4MWFA 4U1IA 1D6VH 1J7VR 3R1GH 2DKSA 2G5RA 3I50L 4WY7H 4Z5RB 5JQ6H 4CVUA 4EDXA 4YHZL 5I71B 4UT6H 1J1XL 2AERT 4TULH 4OKDA 4Q6IB 2NY2C 1FPTL 1H3WM 3EJYD 4S2SA 5CJ8A 1IEAA 1KC5L 4G8IB 3VFUA 4X6CF 4L3CB 2R2CA 4UQ3B 3O0RL 4FQCH 4WHYG 4YIQA 3X14B 3VD7A 1JWSB 3GKWH 3QUXC 4CJ1A 1JYWA 4TRPL 1QBLL 3EYVA 4WUKH 1P84K 1A3QA 1XGYH 2Y6SC 1A4JB 5I1KH 1J1PL 2X4QA 1W0YT 4HUVA 1WZLA 5E8OA 2X1WL 5DD1L 3LQAL 5DGRA 3RNQB 1LNUB 3W39A 3EYSL 1NMAL 1EAJA 2FIKA 4HIXH 5C08B 4HWUA 4L4TA 3JV0A 2O5YL 3TGXA 3VFWB 4OI9A 5FGSA 4ONHA 4ODBD 4XX1G 5CEYA 3SOBL 3VE0A 3OXSB 2C3WA 2UUDK 2VZTA 5DJAB 4N0YH 5KAQG 2AV7A 1MFEH 3W0WA 2QHRH 2E7LA 2ORBH 1C08A 2Z4QB 3QUKB 5D7IA 4LU5L 4H0IA 5DJDA 3RWCB 4YJZL 1D9KA 5ANME 3SO3B 4NDMB 1N64L 5DTFA 4PV8B 2VQ1A 4QXTB 3C5ZC 1S9XA 4FTVA 4L9LC 3MUY1 2MSPA 5DEGA 1MJ8L 3RQ3A 1MH5A 3KPOB 3TBSB 1T0PB 4HKJA 4OBSA 3VXOA 3FRPA 3MA9H 1UXSA 4X8JA 3CVHH 3H3KA 3HMXA 3Q6GL 4K3JL 4O00A 5E7FA 2EE6A 3STLB 3OG6B 1NGYA 3MJ7A 4S0TD 2H1PH 3BRFA 5DUBB 3T2NL 5IHLB 3QA3B 2ENYA 5DVKA 2V17L 2L7JA 3SCMD 4QWWC 1VSCA 2Z91A 4LSPL 1DLHB 1JGLL 3QQ4A 4JN1H 5LAXB 2EEAA 1KN2H 3QJHA 2JCCF 2NTSP 2EDOA 4PRID 5KTEL 3LKPA 1TVHA 3TH2T 1JZ4A 4MXWH 4PRAB 5DURD 4NKIL 4OZGE 5J89A 3LKNB 1E27B 5EU4B 1KG0B 5HI3D 3T2QA 2P8LA 3WO4B 1YEEL 3DURB 1ZANL 3I9GL 2BJML 2ICCA 4ONOA 3MMEB 4I0KA 4EEEA 2GYSA 1GGTA 5KVEL 1XFPA 5C0BE 4Y88A 4KRPB 4JREC 1Z3GL 4XMLL 2YD3A 1MRCL 1KSRA 4G3YL 2HKFH 5TDNB 3EOTH 3ZHKA 2HRPL 4XP5H 5JTWA 1R3KA 1JL8A 1GOGA 2VITA 4XNMB 3QDJA 5K9JH 4QRPE 3ZDZF 1FNSH 2FX7L 4HIHA 4ENEC 2VDRH 3C08H 4MYWB 1W8NA 4MCZA 1UWXK 4DJMA 4PJBE 1FYTA 3QULA 1RURL 2DQFA 3ZDXF 3OMZA 2CR6A 4MHHG 5F7YC 1ZA3A 4WWKD 3HRZA 4KJPC 1HZHH 3ZE2E 2VJXA 3GK8L 1A0QL 5AUMA 3HG1A 2RIKA 4YXHH 3P9LA 5K9KB 1GSMA 4O2CA 4AIOA 1ND0B 2X5PA 4PJEA 1T1XA 2ZUWA 1FVDB 4LVNB 4JDVA 5D1QB 3T77A 1WISA 2O5ZH 3REVA 4OKVA 3BRDA 3PF2A 4Y19A 5BS0E 1X5LA 5T5NG 1ZT7B 1QFPA 2HG5A 2DRUA 4ODXB 4PGDB 3GMRA 4C83B 4O51B 4QXWA 1IZJA 3CLFH 3LSOB 3QRGH 1Q9LA 4CVXA 4YGAB 5KG9A 1EFXD 3O41A 4QNPF 4YHPA 4JKMA 2H32H 3RY4A 3D87B 4XAKE 4NWUH 4RGNC 3G5XA 1KJMA 3SDYH 1T1WB 4XPHH 3D69A 1MJUH 1XGQB 5TDPB 1DBML 4F2MA 2CGRL 5CP3H 3ZO0A 1YEIH 5I73C 3DHMA 5HVFB 1CS6A 3WSQL 4JO1L 2IQAB 3EJZC 3B9AA 1BZ7B 2BVYA 1INQA 4K8RD 3T0AA 5IB4B 1WAAE 1RZGB 4UAOC 4MJ5A 4YDVB 1SEBB 4LLQA 1DQLH 1WT5C 2OL3B 4U2YA 1NLBH 3VXME 1MQ8A 3FQRA 3QI9C 4TUJB 3WD5L 2QSCH 1AR1D 5I75C 1FO0B 4IMKA 3G5VA 1MWAB 3QUML 1L7IL 3KAAA 3G9AB 2BNQB 1WUNT 1A6TB 2VWEE 3CVIL 4MQSB 2ZP0T 5K9QI 1G0XA 1C5BL 5ADOH 4GG8A 4X98A 4JPVH 4U1SA 1NBVH 3LS4L 3RVUC 5KVGL 1HH9A 1JUFA 2OM5A 4Y4KA 3ELAT 2BDNL 5E2WL 1RZKC 2XPGA 4XNQA 1CE6A 1KYOK 3BPLB 1KB5B 5BOPA 3V5DA 3GUTB 4CBPA 4RFNB 4U33A 2XKSA 4BQ8A 1XZ0B 3MV9D 4P5KB 3FB5B 5KZCD 2XZAH 5IFHH 2NX5D 4JPKH 3OKDA 1X5IA 3L7FA 5IROA 1QSZA 3DX9A 4IMLA 4XC3L 4J1UB 4G80A 1FIGH 3DYPA 2QQLH 1RIUH 5CJOH 3V0VA 3INUL 2V5MA 2HLAB 3L6FA 4FFZH 5LVEA 5KS9F 3PWPD 1IQDB 5CINH 4MA3B 3HPJB 5C08E 3TJHD 1KFAL 4ZXBC 3IDUA 4G8IA 1ONQB 5E8DH 4L3CA 1I8LC 1DEDA 4UOW0 4X6DB 3X14A 4ELMB 1AKJB 5H94A 4OZFB 2ED7A 1BZ9B 5HGGS 1EMTL 1RZKH 3RRQA 1FAIH 1DDHA 5E9DD 3OJVC 2IQ9L 4J4PD 2OJZL 4JRYE 1AXIB 5C0AB 3MLXL 4E5XB 3RNQA 4JM2C 1HHJA 2WW8A 3I75B 4YH6A 3S37H 3GBMH 2C3HA 3KPMA 3BXNB 3VFWA 1XT5A 2R1YB 3FFCD 5GHWL 2JIXB 5C07B 4MMXC 3O3AB 3QCUL 4Q0XH 1J0YA 2F9BT 4AYFA 3UYRH 3WXWH 1ZEAH 5EBWA 2D9CA 3QEUB 4LHUG 1HQRB 3RGVD 4RISL 1QFWL 2I07B 3ZT6A 5FM4A 4R90H 1B0GB 4G42B 1U8MA 4NDMA 3SDCC 3P4OA 5EZIH 4PV8A 5F44A 2XV6B 2YSSB 1UXWA 4XP6L 4KK5D 2NXZB 4O2FB 4B41A 3HE7D 4YAQB 4JANB 3TBSA 3TA3C 4Q6YA 4KQ4H 1H0DA 1XF2A 3LRSB 5KOMC 2R56L 3GSNB 5IQ9B 2HFGH 5IGXL 1PGRB 1QLFB 1NJ9B 5DUBA 3MBEC 1RJYA 5C6PB 2NY2D 2VABA 3CCHB 4WTXA 2A77L 1U36A 3V4VH 3F5WA 4TSBH 3QA3A 4G7VH 4PR5B 4X5XA 1MCBA 2XKUA 2Y07L 1D5IL 2DLTA 4RZCA 5AWNH 5JDSB 5LAXA 3Q5TA 2XZCL 4LSUH 3CDGA 2R4RH 1YECH 3QUXD 2A9MH 4H26B 1DLFL 5IFJB 5GIRB 1QOKA 2Y6SD 2ED8A 4NBXB 1HNFA 3RJQB 3LKNA 1QRNE 1E27A 5EU4A 3RNKB 2QTEA 3M1BB 1KG0A 2PO6B 4PRBB 3DURA 3MACL 2Y5TB 2VLLA 3RVWC 3KWWB 3X3FL 1II4E 4NKMA 2XN9D 2ADFL 3O4OC 1ITCA 3KPQA 4L8SC 2WBJB 2A6DB 4X7SH 3FN9A 4QRSA 4EQ2A 2VZUA 2NY5H 4P3CH 1E4XH 1R6VA 2P49B 5HXMA 1KJ3L 4OFIA 2F53B 1K2DA 1BIHA 4P5TC 1J1OH 2VLKB 4UUJA 4Y5YB 1UC6A 4JFOB 3LD8C 4JPIB 3VD9A 1OARL 4FQIL 4XNMA 1U8PB 1F3DH 2E27L 1MFBH 1QSFD 1MIML 3FO9B 4PLJD 2OK0H 3C5ZD 2R29H 4BH7A 2EDWA 2AXGA 1FZMB 2K3TA 3THML 2P5WD 4P9HL 4WNQA 5FK9A 4A2LA 4L29B 3WIIL 1U92A 4EI5A 4CU8A 3GMPB 3ZT7A 2M8XA 4XBEL 1P5VA 1U3ZA 2ADGA 5AZ2L 1EHAA 3B8YA 4D9LL 3I84A 4NOFA 3VCLB 4MJIA 3QZWG 3NH7H 2Q86B 2HAZA 5GQBA 1FN4A 3O9WB 3O6KH 4LSTL 2ADIB 3NFNA 2V2WB 2XA8L 4FQXC 4WEBL 2R0WH 2VLRB 1JGEB 4QWWD 1ND0A 5FYLE 2DD8H 2P5EB 1TJGL 1OGTB 4Y16C 5CJ5A 2AK4B 1A6ZB 1RULH 4WUUB 5D1QA 5IEKB 3WUWA 5ACZA 2R23A 1X5FA 1RZFH 3D0LB 4ODUB 1H3PL 3T08A 1ZT7A 2A38A 1M6OB 5HHVL 1HH6A 3BSZH 3G08A 1HHIB 2X70B 3T3ME 3VFGL 5A16B 1MHPH 2VIRB 3ARZA 3HUJB 1TNMA 4BFIB 1RHHA 3LSOA 5TE7L 1E6OL 1NAKL 2AJVH 4AL8H 4AK1A 1NC4B 2OZ4H 3UTSD 3O81A 4HH9A 1FNEB 1LGVA 4KDVA 4N90E 3U0PA 4D9QD 3MRHB 3DV6A 2H3NB 4K8RL 5BRZB 2WUBL 4DVRH 5B38G 3U0TB 3SGKC 2BNQE 2I9TB 2XA3A 3ARFC 1BEYL 2HT2C 2WIMA 5GISH 4X80L 4S1RL 4UV7L 1A14L 1AJ7H 2X4NB 5FYKE 3V5KA 1V5JA 3LEYH 2LV4A 1C16A 3LOWA 4XPTL 4FABL 5IVXB 4GW5B 3MREA 4YDVA 1SEBA 1I8IA 2OL3A 2QR0A 4M8QB 5SX4I 1YEGL 2L0DA 1JFQL 3FAXA 3P0YH 4KJPD 2A73A 1MCRA 4TUJA 4NNPL 2WWMC 1FO0A 4LCCB 4NZTL 3MLYH 4HG4J 2CH8A 4YXLH 3IXAB 1FNLA 5EU6B 3BUYB 1X5GA 4LLMB 5ISZB 3MQIA 4KUZH 3LKOA 5CHNA 1OW0A 5FF6A 3NIFE 3PHOA 4NC2B 3VW3H 3ULVF 4GMTL 1OT1A 4KMLB 2DI7A 4KKLC 2VLJA 4PJ9C 5E2UL 2EIZB 4NZRL 1FL5B 3QFJE 2FATH 4ELME 4X6DE 4EQ3A 5HHNB 4P5KA 4XHJC 4IDJH 4NNYB 3MOBL 1HIML 3QISA 3FO0H 3WS3B 4OSUL 3GSWB 2ZOLB 4NO2A 5TFSH 4WO4B 4KJWD 2GJZA 4OLZL 3QHZL 1NEZG 1QEWB 5C0AE 1NMBH 2IPTH 5A3ID 2WBWB 2HLAA 3PHSA 2R69L 3HPJA 1CT8B 4S1QH 2H6PA 4HX1B 5C9JA 3D39D 3D9AH 2VOTA 1D6VL 1I85C 5E5MA 5E8EB 5AYQA 1TMCB 2HWZH 1BJ8A 4IRZL 1SM3L 3MXWH 4YDLB 4XVJL 4UT6L 5D1ZB 1IVLA 4LVEA 2R0LH 1T04B 3G6AB 4XH2B 4C59B 1I3RA 1NGQH 3EDDA 3QI9D 2BOCB 4E5XA 3PP3H 2IAMA 3GKWL 2FD6H 1FZJA 4D0CA 3BXNA 4WUKL 4XCCH 5ECJE 2R1YA 3TJEH 1HILB 1XGYL 2C4FU 3EKCA 1RZJC 5E94B 4WDIA 3V0AC 3QAZB 5C07A 3O3AA 1T03H 3G9VA 4BSJA 2FL5B 1BFVH 5EZLA 3KPLB 5DEFB 3KDMB 5GGTA 5IQ7L 2D0HA 1QR1B 4M7LH 2PXYC 5F7DA 4JDZB 4LLYA 5D7JB 5I0ZA 3AS2A 5M7QA 1U8IB 3JVGC 2X9YA 4GG6B 1EBAA 1XEDA 3H42L 1FNFA 3ZTNL 4R7NB 1ZWIB 2V2TB 4K94C 4P4KB 4EOWH 4WU7B 3HI5H 4O2FA 2E3VA 2ORBL 4YAQA 4JANA 2Q8AH 4J3WA 3PHQB 3T0BA 4JFXB 3BPNB 4XAWH 3LRSA 3UDWA 1TCRB 4FQHA 2J6EH 5IQ9A 4ZFOL 1NJ9A 2PYEA 4HS6B 1RJLA 1Z9MA 2F54A 4KY1H 5EBGA 1W2KT 4ZXBD 3AS3A 4WI6A 1NCDL 4M62H 5J9PB 1KNOA 4PB9H 5IHZA 1E4KA 4G8FB 4JN2A 2VZ3A 3S37X 5FA3A 2YPVL 5FKAA 2F53E 4MB5A 2J2ZA 1LO3L 2EICA 5FGCE 3NPZB 3RVVC 3M1BA 2RR3A 2D7TL 4PRBA 4F57L 5LGJB 5JXEC 3EDFA 3QXAB 2Y5TA 3GIZL 4K94H 3UAJC 3KWWA 1KN2L 2UWEA 1CGXA 1MFDH 3QDMA 5F7MC 5ADPL 4HQQL 1T5XB 5GRZA 2WBJA 3TYFA 1KB9K 3RKDC 2DWEA 2GY7B 3B9DA 3FL7A 2VR4A 4JPWH 4M7JL 5IV2B 5KS9A 2VLKA 3BZ4B 3E2HC 3AC0A 5D2LF 3IDIB 3VI4F 1KCRH 3KYAA 4P46A 1B90A 1EX0A 1T7XA 1U8PA 4R9HA 3B6SA 4NHCH 5AYUH 3B9EA 4LFHD 3SDCD 2P5EE 3BDYH 3U2SB 4K3DH 3FO9A 4OGYL 3BT2H 3EIFA 2HKFL 3L3GB 3QNXB 5DYOB 4K23L 3EOTL 4Y5VB 4AM0B 3PQYA 1FZMA 4K71B 1YNKH 2IANA 4L29A 4HJ0C 3FOMB 3TA3D 5IK3A 1FFNB 4CDGC 5K9JL 4IS6A 2IEPA 1YYMH 2BCKB 3MBED 3TZVA 5JHDA 3H9SB 2VDRL 3C08L 3B8SA 3HUJE 2XXCB 3W9DB 2DQGL 4C56E 1X5YA 2W9EL 2ADIA 5FGBA 2V2WA 5D8JL 3BZDA 1FG2B 1JGEA 2VLRA 5E8NA 4JFYB 2LTQC 2P5EA 3HAEA 4PJGE 5EUOF 5D72L 2AK4A 4IRJC 1A6ZA 3SJVD 4WUUA 5BRZE 4RA0C 3P4NA 5KSBB 1DL7H 4KJQC 4YXHL 5I30H 5IW3A 1UZ6F 2EZ0C 3ARDB 4WFFE 3SKOA 1M6OA 5IOPB 3VFNB 2PCPB 3MNWB 3QUZD 2FGWH 3S98A 3SKUD 4YO0A 1NC4A 5A2KH 3D18B 2YZ1A 2X1PA 1KTLA 3RGHA 3VG9C 4EXKA 1AGFB 1MCCA 4Y2DB 1G9MC 3IDNB 1NUGA 4FXKA 1U8JB 3QG6B 1GGUA 2CXKA 2LE9A 3GJFK 3QNZB 4WTWA 1OM3H 4DZ8A 3U0TA 3O2VH 4P5TD 5DK2B 1W72B 1ROWA 5JW5A 1I7UA 4X6EA 1CDUA 2I9TA 5DFVC 5ISZE 1AIFB 4PJ5D 5I66B 4NWUL 4U3HA 4HFUH 5HTSA 1AR2A 2EDDA 3PWJA 5TPWL 1MJUL 5JOFA 1P6FA 2X7LA 5IVXA 4RCAA 1A6WL 3B2UC 4L3AA 5I1LB 1OP3K 3S88H 4NIKB 1RUKL 2K7QA 5CD5C 5EU3A 3K7UA 3CFEA 1CWVA 1F58H 5IWLA 1D9KC 1GGYA 4L3EB 1JI2A 4P2QD 3IXAA 3CMOH 1Z9SA 2MOVA 4G8EB 5EU6A 2EDXA 3U7YH 1OGAB 3C5JB 3RFZC 4XBGA 5L8LB 1DQLL 5K93A 4Y16D 1P84J 1OTSC 1CLZL 3JZ7A 3WDHA 4RDQF 4R6UA 4M5ZH 4CN1A 1XR8B 2KBGA 1H8NA 5ITBH 1FL5A 2YD2A 3HI1B 5ADOL 1OAZH 5J3HC 5I1JH 4HKZB 4NNYA 1NAMH 4OV5B 4XVUC 3GSWA 4LCYA 3WIHL 1UYWL 1L9MA 4HMCA 2VZVA 3ALWA 3QHTC 4AH2B 1QEWA 2BHZA 1VFUA 3K3QA 2GW5A 3C60C 4KK8C 4I5BA 5IFAH 3AAZA 5DJ8A 5I9QC 2I60L 1KN4H 5I8CB 4ZUWB 1NFDE 3ARFD 3HMXH 5BQ7A 5CEZD 4XMKH 2HT2D 1FIGL 2QQLL 5F9OL 3D25B 5D96B 2F5BH 3HC3L 5IBLC 3MRRB 3WNMA 3IJHA 3NCEB 4OIIL 1M4KA 1Z0MA 5HYSB 5EOQL 2XWTA 4OZFG 5C70A 1HNGA 4NPYA 3VA6A 1KULA 4PRNB 2Q7YA 5E8DL 3G6AA 1DBBH 4KGLA 1I1YB 3GSUA 2H2PC 2WWMD 1KBGL 3ARGA 2O5XL 3LHPH 4GG6E 5LGHL 2VN4A 2A0LC 2XZQL 2QQKL 1M7DB 4X7DC 3RIAF 3OPZL 3RVXC 1HHKB 3RIAK 3ZYZA 4IHOB 4KPHH 2FL5A 3MA7B 3OQ3B 1XF1A 4KKLD 1S7QB 1QR1A 3RWEA 4HV8B 2E5EA 1PG7H 3ZKSD 1FE8L 1HSAA 5KBNC 4JDZA 1GIGH 1U8IA 1JVKA 3BUTA 4M00A 4HPYL 5EWIH 3TVMA 3OKOB 1IT9H 4R7NA 1X5ZA 1ZWIA 5E5RB 4P4KA 5ID0A 1Z9OA 5T5FH 2FHFA 3UYRL 3OGCB 1ZEAL 3VRJA 3S7GA 5BV7B 1D3CA 3CMGA 3PHQA 3KYNA 1K5NB 4TNWF 3IDJB 1TCRA 5EC2A 3WYRA 5CKGA 4TNWK 3SN6N 1IM3B 2P43B 4ESKA 5EIIB 2V7HA 4UIMB 5F1KC 5KSUA 1OOAA 4MZ2A 2YXMA 3ROLB 4QF1A 3IT8D 2VERN 2BVTA 2CKBB 1FFQA 4YQXH 4NO0B 4OB5H 4LRNH 5E00A 3VGFA 3IU4H 3PGFL 3QIUC 1KLUB 5DO2C 1S7VB 2YEZB 1CN4A 3SKJH 3UC0L 2W07A 4I2XE 4YDIH 3N1GC 5LGJA 3VRIB 1BQHG 1F97A 1N0LA 3QXAA 4OCRL 4LSUL 4TOYL 2NW2B 5I1IH 1P69B 2BY2A 5IB2B 2DQJL 1YECL 3B3IA 5ENWA 4RIRA 3GRWL 1RZ8B 3IF1B 3WXVH 4DZBB 4JFFD 2ZCKH 4R26H 5D1XD 5D70H 3HZMA 3L3JA 3ULUC 4JY6B 5CKAA 4XB8A 4RGMB 3QO1B 3EYQC 4P2RD 1PEWA 3RI5F 3H9SE 4KGJA 4CJ0A 5EZOL 1UKQA 3REWB 5IV2A 3RI5K 2M2DA 3IDIA 2PXYD 1RZ7H 1AC6A 1FC1A 2WP3O 3BP7B 3SDDB 4QYOA 1E4XL 3JWDH 5DD0L 1Z5LB 5DYOA 4U7KA 5HVHC 3PGDA 3BJ91 4Y5VA 5KSBE 2HVKB 3N85H 1XCQA 3UJTH 1DUYA 2AV1B 4NZUH 2J8UA 1MFBL 3UTPD 2EE3A 1WIUA 1KENL 2BCKA 1TZIB 4Z7OF 1MJ7L 2ITDB 4UU9B 3QQ3B 2X4UB 5J11C 2NZ9C 2LVEA 3ULUH 4I0PB 5IROC 3OKEB 1IEBB 3MUGB 4M6AA 4QXUL 4JLRB 5I17A 1I8MB 2GK0B 3WKNA 1KPVA 3ARWA 2IMNA 4HS3B 1J05B 1CGSH 4HPOH 3MYJB 5D7KE 2VDPL 4JHBA 5C0DA 1H8SA 3RVVD 3B43A 1R24B 2JELL 1IGYA 2R0WL 5FCSH 4JHAL 3QJFA 5D71L 3UAJD 2PCPA 3MNWA 4RX4A 3WE6B 1Q9WB 4QOKD 2EDQA 1RULL 1U8OB 1OAUL 2OYPA 4LCWB 2BX5A 1VGEL 2WBKA 1RZFL 3M8OL 4QXGH 3D18A 5I15L 2DJSA 3RKDD 4ODSH 4LCUB 1J86A 2R2EA 3GHBH 1KJ2A 1CTOA 1AGBB 1IC4H 3VD3A 2IH1B 5FDWA 1B88A 3QNZA 4L3EE 4R4BA 1QLRB 4JKPL 2AJVL 3TT3L 4JG1H 1OGAE 4RMQA 1AIFA 1JNHB 3OXRB 3U6RA 1J10A 5CEXA 5B3NA 5EIQA 4DGVL 4ZYKB 2PN5A 3NVQA 1EHLL 2G60L 4HJ0D 5DGQA 5I1LA 2FO1A 5JDJA 4UI2A 2CLVA 3FN0H 5F1OB 5GISL 3IYLW 2DTML 4TVPD 1AJ7L 3GMLB 4L3EA 3SO3C 2BY1A 4GKZB 3LEYL 3B9KB 1I7RA 4QHKI 1HYRC 2PR4H 4S1SH 4WEUD 2YD1A 1CLOH 4NN7B 4MA1B 1JPSH 2F5AL 5DS8B 2GCYB 2R8SH 1QA9B 3P0YL 2WP3T 4N68A 4IRJD 4XCFL 2OCFD 1G7PA 4W68A 1LE5A 1A47A 4XNUL 1BFOB 3OKYA 3X3GL 2EH8H 4A6YB 1XR8A 2HFTA 4NQDB 1EZVX 2AK1L 5D2LA 3WIFB 3OKMA 5E0QA 3VW3L 1T83A 1GC1L 5I18L 3EDEA 4HKZA 3FONA 4OV5A 4G5ZL 1JNLH 3AS1A 5CEZL 4RA3A 5E99H 5L2KA 4HHAB 1U2CA 2D7QA 3WO4C 5C7XH 4X9FA 1A2YA 1CG9B 3WFHB 4QTHB 4ZOCA 2OQJA 1AE6L 1Y0LB 1SJXA 4QO1A 1H3GA 3FHAA 5ID1B 2VXUL 4L4TD 4W4OC 5FV2A 5DFVD 1QFWM 1I9EA 4ZS6C 2I25N 5L7XL 2JJUA 2BC4A 1MVFA 3WCYA 2A6JB 5IEHB 1NANH 3D25A 3ALPA 4F15B 3MLUL 1A6UH 4G6JH 3GFUA 2D7PA 5HYSA 3B2UD 4APQA 3W0WD 5FCUH 3EBAA 1S7SB 1UM4H 2VLME 5CD5D 3QWRA 5BO1H 1D9KD 5ITFB 1KTDB 2EKSA 2ID5A 1R5WB 3QR2A 4OZHF 4UZGA 4X6CB 4LAQH 4CU6A 2BNRA 3D0VB 4Z7VE 4FTVD 2R0LL 4JHWL 3VDBA 1NKOA 1M7DA 4HH8A 3VWJA 3GEWB 3DX7B 4MNQB 4R2GB 4EI5C 1OTSD 4DTGH 3QDHA 3MA7A 5DEZA 3HFMH 4YZFF 3NCCB 4UNTA 4XTRC 3TJEL 2FWOA 3F6LA 1UWEH 1JK8B 3MLZL 4UTBH 3L3DA 4D8PA 4MSWA 5IMLB 4GRLD 3MRJB 1U3HB 5J3HD 3K1KC 4XXCA 2DL9A 3RKPA 3VGDA 3OKOA 1PEZA 1CTNA 3KS0H 1AP2A 3MV7A 3O6FA 4WTZG 5D1QC 3VXPA 3TN0D 5DD3H 4XVUD 1FVCA 4M7LL 3PXHA 2DWDB 4JFDB 4M7KH 3S35H 3SKNB 5JOPE 4OLVH 4JB9L 1K5NA 5SV3A 1T22B 2YK1H 3D2UB 1KCKA 2H8PA 2EDHA 3C60D 4KKNA 4KK8D 4XC1H 4M7ZC 1GPOH 5EIIA 1S9YA 3HI5L 4UIMA 2UZYB 1TTUA 2JTDA 3HNSH 3LIZL 4OD2B 5EO1B 4OCXH 3MRGB 4CVWA 4MAUH 4X7TA 2DYPA 5IBLD 1Q94B 4NO0A 4LLAA 2FHBA 1RZJL 1FL3B 3TT1H 5I76A 1L6ZA 1RUPL 3CSBA 4M62L 1EO5A 1K8IB 4GBXB 5CZKA 4LEOB 3CAFA 1F00I 1ZT4A 4LPUA 1WLHA 4M1DH 3IF1A 2A0LD 4PG2A 1MQKL 4DZBA 2JCCB 3E8UH 5K9OB 1E0OB 2IH3A 3DVIA 4CVZB 3RVXD 4ZTOL 2IPUG 2V9QA 4UOJA 2AKRA 1QSEE 3BN3B 4I18A 5IBTH 1JF1A 2ESVE 3C6LA 1BAFH 3O45B 1F4HA 1CDGA 4P3DB 4R4FL 5HHXH 2QSQA 4QRPD 2EDKA 3SDXF 4D0BA 4C57C 1OW0C 2QL1A 3H7LA 1PKOA 3EO1A 3QQNA 4JRXB 4PRHB 3MR9B 5GZOC 2FSEB 5B22A 1XIWB 2JLLA 3CFBB 2YRLA 1Q9OB 3DXAE 2VXSH 1BVKA 1AGEA 4Y19D 4NQVB 1KCRL 2VUOA 4HKBB 2WWKT 4LP4A 3BPLC 2IG2H 3L3HA 5DMJB 4Y4FD 4NHCL 5AYUL 4MNGB 1BLNB 2VUYA 4RFNC 2W91A 1VFAB 3MV8B 4PLNC 3O3DA 2W60B 4UU9A 1CL7I 1T2QH 3GMQB 2N56A 4OF3A 4LCWE 1G9NH 1CGUA 2YRZA 3WEXB 3KPRB 1JYNA 3OKEA 1IEBA 5ETUB 1G6RA 4J12A 2GK0A 5F72S 5DUML 1K3ZA 4MXQC 3W2DH 4HS3A 4KHXH 3QIUD 5DO2D 4AEHL 5BS0D 5DRXB 1HQ4B 2ADJA 2X42A 1JPGA 3WE6A 1Q9WA 2NY0C 3RX8A 1JWUB 4AIZB 4F7MB 5EBMB 4H1LB 3TYGH 4Y5XA 3QQ9C 2LFGA 4MHHI 5AZEH 1RUMH 1C7TA 5I30L 3F7QA 4LCUA 3RIFF 3TNMA 3U1SL 3DSFL 1UCBH 4K3HA 1AGBA 3UTOA 5C0FB 3V52L 4P49A 4JFQA 2IH1A 5CUSL 2KL6A 5DHVB 2AI0L 2IAMC 2FH6A 1T0NB 3WFDH 3MCLL 4ONGH 1JNHA 3DMMD 4KROB 4TVPL 3P0VL 5EOTA 3A6BH 1PFCA 3LPFA 4HFWA 4ZYKA 4DN4L 3O2VL 4HUMB 3GSXB 3K81A 1KIQB 2BMKA 2AS5M 3CU1A 4FQLH 4NQDE 2DQEH 4OTXH 4C55A 1K9TA 1NCCL 3DBXB 4JJ5B 3HB3D 3RTQB 3VXMD 2CDEB 4J7RA 4M61A 3GMLA 3HRPA 1A9BB 5DRWB 4BJLA 1F3RB 2V5RA 1F6AB 1CDYA 2VMFA 4NP4H 2NZ9D 4OLXH 3BJLA 2VDKH 3MUJA 5TQ2L 5FB8A 5KW9L 2P45B 4P4RB 5CP7B 2NXZC 4I77L 4MAYB 1RK1B 3W5NA 1NSNL 4WI9A 1AY1L 2GCYA 4U6YA 1TXKA 4LMQE 4QRTA 5BJTA 3UDWC 4HMDA 4RRPA 1IGFH 4YBLB 1CE1H 1A4KB 4O5LH 3Q3GA 3U7YL 3ARBA 1G9ML 2Z93A 4NQDA 3V2AR 2VC2H 3MX0A 1RAMA 2GJ6A 1E4KC 4R96B 3BO8B 4YHMH 2J7LA 5GGTH 4KXZH 3QHFH 2AJ3B 4M5ZL 5FUCE 4Z78A 4DN3L 1LP9B 1PSKL 5CBAB 1PLGL 5ITBL 3NIGE 5SX5H 3ZSTA 1YEHH 3WHXB 3SGDI 5C9KA 1M05B 3CLEH 4OZIF 4JZOB 4ZD3H 3T0EB 4QTHA 5I1JL 3VD4A 4U1JA 4KU1A 3GGWB 4X6CE 3S3JA 3PDDA 3U30B 1BD2B 1RIVL 1N59B 2FZ3B 2VDLL 3O3BA 3V95A 2CKNA 2DIAA 2WBJC 4N8PA 4RFOH 3L9RB 3OJ2C 1NL0L 5I1HH 4MDIA 4MNQE 2NXYB 3Q2CA 1QTYT 5A40E 4O9HH 3T8XB 3BKML 3HMXL 1MLBB 1J87A 5C0EB 1VEOA 3VXUB 4P46C 2Q6WB 3FB6A 1DBAH 5ITFA 4PJAF 3I2CH 3HZVA 1KELH 4PUBH 3RWGA 4K9EH 3MLRH 1ORSB 4OCLC 1TZGH 2CK0L 2AJXH 4LHQB 1A7RH 1EZVY 5HDQH 2DQDH 4IDLA 2EE9A 4JFDE 4Y1AB 2R0KH 5CSZB 5FOJA 3LPGA 3T1FB 4K2UL 2Q8BH 5GS1B 4Z0XB 4PJCA 2R2BB 4O4YL 5HDLA 5TE6L 5FGBC 1MSPA 1YYLL 3TBTA 1HHHB 1EIBA 4XNYH 5FUZH 1S9VB 4KQ3L 1DBKL 1NGPH 1U3HA 2IADA 3G04B 4GRWH 4KPHL 4IEFB 4KVCH 4M48H 3VRLE 3IFOB 1G0DA 1E4JA 2GTWB 2ZOKB 5LCVH 1YEDA 4HXBH 2DWDA 3AVEA 4K7PH 1CZ8H 4RAUB 3PG2A 5EWIL 3RVTC 4QLRA 1DN0B 3BP5B 1T6WA 4NQXA 1N5YH 2JCCE 4ZS6D 1QQDB 3MRGA 4I3SH 4KRPD 1GVIA 2WLYA 1JZ6A 3K8MA 4NZJA 5JNYA 1YMMA 2EYSB 4HGWB 3NFPB 4OCSH 3L5WA 4RGOH 5GJTL 1GGCH 2UY7A 3TBVB 5BVJB 4R0LB 5GGRB 2D0FA 1YA5A 3HAEH 4LQFH 3G5ZB 3UROR 4LRNL 4V1DE 3LH2H 4PRHE 5EZJA 4LSDA 2J88L 3IU4L 1FLTX 5K9OA 1U8QA 3SGJA 3LS5H 3ARSA 4GXUN 4X83A 1SYVA 1VFMA 1T3FB 4NN6B 5H2BA 4YDIL 1N2RB 1M7IB 4FQJL 1DVFB 4Z8FH 5I1IL 5IWLC 4MNGE 4P99A 1D5ZB 2WIIB 4MJ6B 4JFPB 3MV8E 3ZDZE 4PJHB 4ISVB 3C8KA 2JF1A 4X4MA 3FFDA 1SJHB 3GNML 4P3DA 1A21A 3KPRE 3MLVH 2YPLB 5BVPH 5TGBB 1DQQA 3W5MA 2BXYA 5EORH 1OCWH 5CJQL 5FHBL 1TQBB 4MLIA 4NO3A 3RPIA 4JRXA 4QT5B 5D1QD 3CFBA 4CGTA 2E9BA 2YUZA 4L4VB 3QYCA 1A6VH 4MNGA 3FT3B 4GS7B 5J8OA 1CD9B 2J3SA 4E41B 1Q9KB 5DJXB 2ATPA 3PL6B 3CU7A 1K8DA 1T89A 5E8PA 3KPRA 2BVOA 5C3TA 4HIEB 4CMMB 3IGAB 4YNYB 4WO4C 5FYLD 2OMNA 3O4LB 4DUWA 5IB5B 1GHFH 4BSVA 3SCMA 3RA7H 3BI9X 3UBXI 1WBZB 4U7MA 5DRXA 1N6UA 2VSDA 1HQ4A 1EEZA 4ZUVB 5IJVB 1RUQL 3QUYB 4PRIA 3GHEH 4QNPE 4ZNEA 5BZWB 3NTCL 1W0VB 2GKIA 4AIZA 4YDLC 3A6OA 3DGCR 2MPAH 5KN5B 3OV6A 4S1DC 1I1AB 1MCWM 3S5LB 4DGIH 3CFJA 2Q76A 3AREB 3N1FC 4KH2A 5CBEB 3KHOA 5GRYA 3ARGC 4QXGL 3DRTA 4D0DB 2BNQD 4YFDB 1ZS8A 3LZFH 1FV1A 1XH3B 5IMMA 1V7NH 5I1CH 4URTB 3B2VH 1QYGL 3MBXH 3QAZC 2NY6B 5F7EH 5IESH 1RUAL 1R0AH 5FYKD 5GZOD 3L3IA 4MCYB 1G7HB 4QRRB 3KPNB 1FVEB 2N4IA 1S9KC 5HHMB 1KIQA 1CVSC 4JG1L 1OSZB 2A83A 1ADQH 4ZUSB 4JJ5A 1UZ8A 1UKSA 2XWBB 3O3EA 3CDCA 2FX9H 3FQXA 1MCNA 5DRWA 4B7LA 3P11H 3V4PH 3TVMC 1PQZB 2V5YA 3TO4B 4P4KC 2B5IB 5CP7A 1RHFA 4WWKA 5GGUA 4MAYA 2E9WA 1J18A 3SQBA 2X1QA 4XMPL 4PJIB 3VJ6B 2LVCA 2Z92B 3BPNC 3T65A 4MXQD 8CGTA 4WHCA 1JN6A 5IG7B 4PJDF 1A4KA 3JV6A 1O5DT 1PY4A 3BD4A 1BD2E 2NY3B 2PR4L 4HUKB 5ESVB 1F5WA 2FHCA 5EUKB 1N4XH 1JPSL 2WMPA 2NR6C 4R96A 3BO8A 1CXEA 1KEGL 1AKJD 3NAAL 1ZLSH 2EH8L 1LP9A 5F8QC 1MRFH 3SY0A 5CBAA 2WUCH 4YFLI 1M05A 3UX9B 2EIDA 2V2XA 1CLYL 5C0AD 3VXUE 4LPCA 4X9GA 3EHBC 4WFHE 1JGUL 5DJ6B 5A2FA 1F8TH 3T0EA 1WCQA 4OBRA 3CXDH 1KIRB 3GGWA 4Z95H 1L7TH 1EO8H 3MLPA 4N1EA 5E99L 4AT6B 1F45A 3S4SB 4PG9B 2IFFH 2YRPA 5IVZB 5DJ0B 1IJ9A 5C07D 3L9RA 4BYHA 4KTDH 5C7XL 3TESA 4Y1AE 2FB4L 1KEMH 4Q9QH 2ICEB 3QWQB 3T8XA 2R4SH 3SPVB 1SEQH 5GJSH 4YHOH 4GXVL 1MLBA 5C0EA 2CIIB 1F6FB 1FFPB 1CFVL 1JHLL 4CMHB 1EHNA 2Q3AA 2CIKA 1ORSA 4GSDH 1X9QA 4Y5VC 4K71C 2NXZD 5T1DH 3VFMB 2DLGA 2W65B 2CLRA 3X17A 5BO1L 1XF5B 2GSGB 4WV1B 2YA1A 5CSZA 2BFVH 4LAQL 5DK0B 5E95B 2WAHA 4R8WH 2F54D 1YEKH 5GS1A 5JZ7C 1DSFL 4Z0XA 2IPKB 4MMZC 2VXTH 4BKLA 1XGPB 2PUQT 4G9FE 5D2NB 3C87A 1S9VA 2L7UA 2DN7A 2VZ1A 3G04A 5FO8B 1G7QB 1PVHA 2I9LB 2DMCA 2XTJE 2Z31B 3ZKXC 1CF8H 3GSOA 4JM2F 1BOGB 4NFBA 5D6CA 1X44A 2FIRT 3QEGH 1A7PL 4CN6A 3MV9A 2RHEA 3N50A 4UTBL 3KGRA 4X7EC 3K2UL 2PO6D 3T04D 1PYWA 1WBYA 4Q9BA 3VFPB 5D5MF 4OFVA 5DJYA 4UILH 2J12B 2WBJD 1X4ZA 1EBPA 4XGZB 4Y4HB 2V5TA 1QQDA 3DX6A 4HUUB 4M7KL 3UMTA 4TTDC 3PWPA 4OLVL 3TBYB 3PE9A 2DQIL 3DYMA 4OJFH 4U2ZA 4RMVA 3L3OB 1NEUA 2F53D 3IVKB 1JWMB 1MI5B 4PJHE 2VLKD 3HNSL 3Q5OA 2YXFA 1WVZA 1MCIA 4M43H 4OCXL 4LIQE 4ZUTB 2BSRB 4ZAKB 2YPLE 3MODH 1UA6H 3PGCA 1URLA 1MAML 5ESAB 3OZ9L 5KSVB 4JHZA 1R3LA 1VPOH 2FJHB 2VXQH 4N0FA 1BBDL 2JE8A 2A74A 4ETQA 3IFNL 4L4VE 5BOZG 5KANI 3LKSB 4ZPVB 1DVFA 4GAYB 3ZE0F 4HIIB 1D5ZA 5EOCJ 4JFPA 3FB7B 4M1DL 3ZHDA 4XRCA 4E41E 3O9WD 2P48B 4K7PX 1QO3B 1TQCB 1SJHA 1KJ2H 2G2RB 4G8GB 3TH4T 2VLRD 2P5ED 1PX3A 1DP0A 3O4LE 2GQHA 1OLZA 2AK4D 1EK3A 2GFBB 1NLDL 4WUUD 3CFKA 4NM4H 3VGAC 5FUOL 5IBTL 4ZSOA 3VG0L 5FYLL 1VCAA 3EYOA 5L9DL 4OD3H 4UQ2B 4H0GA 5J1TC 4EUPB 1N5AB 4M1GH 4LPYA 3UZQA 4NNXA 3RVTD 3BHBA 4OLEA 4LNVA 1T83C 3CFCL 3KR3H 4E41A 4RAVB 5DJXA 1NC4D 1UFUA 3PL6A 5E2JA 2VXSL 3P77A 2LAGB 4LSRL 5GS2H 2GUOB 3IDXL 4OM0L 4YNYA 1MCJA 1VEMA 2Y4SA 1WK0A 2X9XA 4I48B 5F7FA 3EZJB 1MCQA 5IB5A 3BDXA 4U1LB 5BRZD 3MGOA 5B39B 1HEZA 3MRLB 3NA4A 2IGFH 1WZ1H 3B5HA 3BP6A 2OL3L 3QEQB 1AQDA 3QCVH 4XI5D 5JMOC 5IJVA 3QO0B 3C6SA 2R1XB 5DDHA 1FO0L 4ZFFB 5JMRA 3SGEI 2E9JA 4ZFOA 1MWAL 5DI8A 3UJIH 5D96C 4XNZB 1RQ5A 3KG5A 4JG0L 5BZWA 4GLRH 4KHXL 5L0QB 5EUOB 4QRRE 5IM7B 1JBJA 1R3JB 3HNTL 4GUPB 5HHME 2HTKC 4APQC 3T2PA 1KTRL 4D3CH 4OFKA 4H1LG 1BF8A 2IWGA 4YDJB 1XCTA 2ZSWA 3K8KA 1TETL 5CBEA 4PY8J 4TSCL 5HPMB 5DZOA 4O58H 3V0WH 3M17B 3TYGL 1B2WH 5JUEL 5EU6D 4D0DA 1GL4B 3N06B 5ISZD 4BZ2H 4QCIA 2YBRB 1UJTA 3FB8B 4ZPTA 3GMMB 4PFEA 4PJIE 3BRGC 5F97E 2OTPA 3MV01 4Z7QF 1KUMA 3L1OH 1G7HA 3QP3A 2HJKA 3KPNA 1FVEA 2BSTA 4UNUA 1S7RB 2VAAB 2XXMB 3JV4B 1YNLH 5CCKH 1UWGH 4MD4A 3IU3B 2OSLB 3WFBH 1MUJA 4X8XA 2B0SH 4ZDHB 1J9CT 2ZWLT 5T3ZH 1U2HA 1PQZA 3O6FC 1J8KA 4MD5A 1JZ8A 4HF5L 4ERSH 1YQVL 3ULVE 2W92A 3M45A 2YZ8A 3HPLA 3EYFB 2P47B 3K80A 4WO4D 4WCYL 5BV7C 4PJIA 3VJ6A 3HR5A 4UDTB 4ODTL 3A0OA 2DM4A 2EIEA 3NFSH 3CSPA 5FA4A 2OLDA 2AJYL 2OX5A 4HJGA 3VXRB 4NQEB 1J0KA 4GW4B 3X12A 3QBTB 4Z7WF 3GJFH 3BWAB 5J06A 5MENB 1JRHL 2F58L 4OLWH 1N7MH 2BNUB 3BZFA 4MXVF 4PJ7F 4H20H 4OLUH 1QACA 3VDCA 3FTGB 5EN2B 4YGVA 3QXDB 2CQVA 5KOVC 1S8DB 5F7WC 5MEOA 2ICWJ 2JB5H 3P73B 5ERWB 1D6EB 3QH3A 1CFNB 4KMQA 4S1DD 1P4BL 5GSRA 2VC2L 4F7PB 1HK6A 3TIEB 4JRWA 1A5FH 3PIQA 2KQMA 4XP4H 3UTZB 5DJ6A 3T3PF 2D9QB 4LLUB 3MCG1 5E70A 1OP3H 1GGBH 1VACA 4FQQB 4PG2C 2VRAA 4AT6A 4WEMB 3MJ9L 3EZ8A 3HLAA 2OJEA 2EKJA 3VWKB 5IB1B 3MRNA 4QGTA 5GRJL 2DJ4A 4RGMC 1CDIA 4XPFL 1GYAA 2JKXA 4I18C 4J6RH 1VENA 3C6LC 3FQUA 4NWTL 1I3GL 2NNAB 4KZEH 1U58B 5EBLB 3RWFB 5D2NE 4GH7B 3PP3K 5D7JD 1JTTA 1FFPA 2VDQH 5FXCH 4JGMA 3TVMD 3LEVH 5DHYA 5HVWA 4K7FB 4P4KD 1BJ1H 2W65A 4LEXH 1J1XH 5LQBL 1DBAL 4WV1A 5GRUL 1FPTH 2PW1A 4LLDB 3U0WL 2CK2A 3PV7A 1KELL 4YLQT 4KAQL 3S9DB 1IQWL 4HK3N 5HGAB 2R9HC 2AEIT 2H9GB 2IPKA 3E3QE 4I0PC 1XGPA 3O0RH 1G7MB 1I9IH 5HDQL 1ZLWK 1T0MB 1KCSL 2NR6D 3VXSB 2XT1B 1XGUB 5HPOA 4TRPH 3SKMB 3WHE0 3BISA 2R0KL 1QBLH 5FO8A 1G7QA 2ZG1A 3KYOB 3BGAA 1J1PH 4XBPB 4NGHH 1MI5E 3LQAH 2MHAB 5CGYC 4Z18A 1N0XH 2IBZY 4PP1D 1P1ZB 5J1AB 4H5SB 5E6IB 2HT4C 2KUTA 3RDTB 4HCRA 3DROB 3EHBD 2O5YH 3IJYA 1JRHI 5J12B 3IJSB 1SVCP 1WFNA 2BRRL 3C5SB 4KRLB 3SOBH 3BQUB 2IBBA 3BGMA 4HWZA 3F6IA 3L3OA 1MNUL 3D39A 4FG6C 2X2YA 1QFOA 4LU5H 4PJDA 4OGXL 3WIHA 1HSBB 4LL9A 1FJ1A 3MRPA 1G6RH 4YBQC 1N64H 5BXFB 1CD1B 4ZUTA 2BSRA 4I3SL 1CK0L 1SJEB 1V7ML 1MJ8H 4KC3B 4OCSL 1WT5A 1O7VA 1FHGA 3BAEL 3NN8A 4PLKC 2OI9C 1GGCL 1LO5B 3Q6GH 4K3JH 2BHYA 3AXLB 4YXKL 3MRDB 4HT1H 1LMKA 4L8BA 4M6OL 1BPVA 1RK0A 3T2NH 4N8CH 3LKSA 3P4MB 3VI4E 4MQ7B 3VFRB 4KUCD 3H9SD 3LH2L 3Q6FB 4LVOB 3EJJX 2PW2B 3B9KC 3DIFB 5I19L 3RWDB 1QO3A 5T33L 1JGLH 2LU7A 2G2RA 2VH5H 4G8GA 1FDLH 1S7XB 4QHNB 4NN7C 3G6JF 4BQCA 4MA1C 4AEEA 5KTEH 3QPQD 4NKIH 4FRWA 3BKCL 2NY1C 3P30H 1UEMA 1YEEH 3ARBC 4HWEL 1ZANH 3MLVL 3QEQE 3FO2B 3ARDD 5BVPL 1CYGA 1N5AA 4X6BB 5EORL 3K74B 4EUPA 3V6FA 3DLQR 3PABA 2QV2A 4RX4D 1T5WB 4X6FA 5FGRA 5KVEH 4RAVA 1CIUA 2XWJB 5EUOE 1XAUA 1MCEA 4JVWA 5HGDB 1MRCH 4G3YH 2ZUUA 4TTDD 4FZ8L 5T3ZE 4P2CG 4Y2DD 3LN4A 1UZ6E 4U1LA 5IB3A 3GBNL 4NCC1 3MRLA 4PGBB 4OF6A 3E6FA 4FFYL 2FX7H 4W70A 1BBJA 2AJZA 3QO0A 4CN4A 2OTWB 3QWOB 1GHFL 1QRKA 3LKRB 3KJ6L 5HDBF 1F4WH 2DM7A 4CNIA 5IHBA 5IM7A 4GUPA 1AI1H 4K7PY 1EEYA 1T20A 3RUGF 3GK8H 4YDJA 4IJ3B 3FOLA 1A0QH 3CSYA 1PJ9A 1JMXA 3NGBB 5DF0A 3OKKA 2Z8VC 3PWNB 4L3ED 3S5LG 3FT4A 5CWSB 1U8NB 1MPAL 2DF3A 2VE6A 4K07A 3V8OA 1OGAD 1Y6MR 4KV5F 4DGIL 4JJHA 4NQSA 5F6IB 3FB8A 4POUB 4Q58C 3OX8A 4L1DA 4R2GC 3GRWA 2W9LA 3HA0A 1ZGLM 5HJ3B 3VH8G 4GW1B 1YY9C 2X4TB 4ZNCD 4U1KA 3SDCA 2VAAA 1A6AA 5FYJE 1L0YA 1NUFA 2D4FA 5MENE 2OSLA 3JBG7 3CIQA 1Z2KA 2Y25A 5IESL 1FL6B 3G5YB 3FRUA 4NYLA 1U3HC 3VXQA 5BW7A 4ZDHA 3QUMB 4AY0A 1ZLVH 4PGCB 1AXTH 2MCPL 5DMGC 2Y7QB 2I5YL 2VZOA 2WV3A 5SWSB 5I2IA 1DBMH 5F3BB 2CGRH 4JFEE 1A9EB 1T6VN 1ZHLA 4JCLA 3UTTB 3WSQH 4JO1H 5HYIA 4PTUB 4ZG1A 3VXRA 4NQEA 3MRCB 4GW4A 4I8DA 1JHKH 2DBLL 5F88B 3DUHA 1JNNL 3BWAA 3UPAA 2VQUA 5EU5B 1K4DB 3MRKB 4AJ0A 2EE2A 1CU4H 5D7IF 1OSPL 3FTGA 4NT6A 2B20A 1S8DA 5SWZB 2HTKD 2YA2A 3L5IA 3QUZA 5I8OL 1CFNA 1K85A 2C1PA 5DR5L 4J8RB 4BH8A 1BIIB 4GBXC 2NY7H 4N0UB 3UTZA 4ZS7L 1N3NA 3MRMB 4FFVC 3CVIH 1ZLSL 1ACYL 3OR6B 4FQQA 3NCFB 1MRFL 1V8HA 4KWUA 3LS4H 4JCMA 3SGJC 5KVGH 2WUCL 4I4WB 2VZSA 3S96B 3S4SG 1FNHA 2BDNH 2CRIA 5E2WH 1F8TL 1U93B 2ZUYA 3L3KB 1I1FB 3DV4B 1PKQB 4PBVC 1EO8L 2DQTH 5MI0B 4HLZG 2B2XH 2HJFA 3X13B 2VLMD 5H37H 3DO3A 1RU9L 1LEKB 2ZPKH 3VXSE 2VN7A 1KEML 2QQQA 5F9JB 4XC3H 3O6FD 3C09B 4K7FA 2Y9RT 5IBUG 3MRFA 1HHGB 4GFTB 5DQJB 4X5LA 2FO4A 1C1EH 3BKYL 3DO7A 2C3GA 1KFAH 1T1ZA 1OP5H 3T1WA 4HGMA 3RL2A 1IAIL 3L95B 3DNKA 4HUWB 5HGAA 1EJOL 1DEEA 4IIQB 1T89C 1G7MA 3V5HA 4POZC 5FM5O 1IAOA 1T0MA 4PRDB 3P4LA 1XGUA 1NDGB 2ICWB 2IQ9H 4NO0D 3EYUL 1G7JA 1S9WA 5GS0C 4XBPA 2D3VA 4DKEL 3EDKA 4R8WL 1YEKL 2D03L 3SCMC 4UMGA 2UYLB 2VXTL 5J1AA 5IW6B 3D5OF 3FQNA 8FABB 5INDB 3DROA 5A43C 1FCCA 2DAVA 3HHRB 1GAFL 3M07A 4QY8A 5E6ZA 5GHWH 5HHOB 4EKXA 2X89A 3C5SA 4C58B 2X09A 1KPRA 4P9MH 3QCUH 5FO7B 3QEGL 4GQPH 3BQUA 5IKCA 1WWWX 2BVEA 1RIHH 3ARFA 5I1DB 4IBLT 2DS4A 3C8HA 3I6LE 4PJEF 1FFOA 4RISH 1BFSA 1CFQB 5BXFA 1CD1A 4PJBF 3SDDD 4LHUB 2HJLB 1TIUA 4RFEB 2XY2A 2OTUA 3TIDB 2Y5EA 4Y8DC 1CFBA 2R15A 1LILA 1WC7A 2RFXB 1NGWB 3H7BA 2R56H 4OCMC 3MRDA 1X7QB 3V6ZB 4PJFA 3QIBB 5HYJB 5BMFL 4OFDA 3MODL 1UA6L 5CIPB 3P4MA 1EJ6A 4MQ7A 3VFRA 3Q6FA 3QDGE 4X4YA 2R9HD 2Y07H 1D5IH 5J6HB 3DIFA 1LD9B 3RWDA 4UT9H 1C5DA 1BVLB 4I0PD 4BZYA 2XRAL 2XZCH 2VAJA 4JAMA 32C2A 4WWKC 3R06B 1S7XA 4MAYC 1DLFH 2V5SA 2QADB 1SY6A 1EXUB 1VFBA 1IAII 3KPPB 4FQ2L 5ANMB 1P7HL 3MACH 2BRQA 4R3SB 4X5WA 1DE4B 3MJ6A 3X3FH 1LEIA 1F11A 5ALCH 4X6BA 2ADFH 5LXGL 3C9NB 3O3UN 3F58L 3ULUF 1QFUH 1A1NB 5HBBA 4LCWD 2XWJA 5E4EB 1VGKB 2ZKHL 3ZL4H 3GM8A 5HGDA 2J4WL 5M95B 4OD3L 3VFVB 1KJ3H 1T21B 3RL1B 2UVEA 3ZLQC 2XKNA 3JTTB 4G43A 4OCYH 2N7AA 2FNBA 4RNRB 4CKVX 4H25B 3BFOA 4ORGA 3T0EC 1I85A 4FG6D 4XCYA 5SX4H 4FQIH 4NRZB 3U30C 2F74B 4YBQD 5B39G 1MCLA 4HMEA 1MIMH 3OKNA 3AS0A 4C54A 3THMH 4BFBD 2NXYC 4LQ1A 1R3IL 2WINB 5CSGA 4PLKD 1LEGA 4U0RB 4XZUA 3UJJH 2IGFL 4XBEH 3FT2B 5AZ2H 4D9LH 3OHXB 4ZOBA 3QXVA 4OF8A 2UVFA 4JFFA 5F7NC 4LSTH 5ICZA 2APWA 2XA8H 3PWNA 5D1XA 4WEBH 5CWSA 4F9PA 3B9KD 3EGSB 4BQBA 3WS6A 1U8NA 1TJGH 1BMGA 4P2RA 4D3CL 3IKCB 2K7PA 4PD4J 3VFTB 5F9AC 2FJGA 1DR9A 2NYYC 2PXYA 3DETC 5HJ3A 1FZKB 3P0GB 4GW1A 3UTTE 2X4TA 3D1MC 3ARBD 5GS1C 2JB6B 1UACL 5E2VL 5DXWA 1XF4B 4NQDD 4PGEB 1E6OH 1FL6A 1ZHNB 4F3FA 3RAJL 2RCSH 5F9DC 4UB0L 3HCVB 5SWZE 4I3RL 1L6XA 3PNWB 5C0CB 1MF2L 4K8RH 5SWSA 2P8MB 2BZDA 4LHJB 3WFBL 4N0UE 1RJZB 4X4ZA 1A9EA 2PTUA 3MLSL 3IDYB 1TPXC 5J13B 3BESR 3MYZA 1BEYH 3D3VA 5B38B 4HZLB 4E42B 1ORQB 4TSAL 3MRCA 4X80H 4S1RH 4UV7H 1A14H 4YHNB 5EU5A 4XPTH 1K4DA 4FABH 1N8ZA 1KACB 3MRKA 5DRZB 1OAKL 2Z35B 2V6HA 4UBDC 2B39A 4ZUUB 5SWZA 1PKQE 1JFQH 2YUWA 5I1EL 4NNPH 4NZTH 3V6BR 2H45A 4J8RA 4F7EB 2BERA 2APXA 4RDQG 1Q0XL 1N7ML 1AXSA 5E9DB 4ELKB 2BSSA 3U36A 3T0DA 3MRMA 3MNVA 4PRPB 4HJJL 1HKFA 5HGHA 3MLTB 3OG4B 4TUKL 4RQQB 4BM7A 2A2QT 4NJ9L 3S96A 3LDBB 4MNQD 4R2GD 4JKKA 4NSKB 1DVFC 3E6HA 4NZRH 2NTFB 4OZIB 1I1FA 3L3KA 1ZLUH 1VKXB 4GKNB 2NY4B 1WCBA 5BV7L 2OR7A 4OZHE 1GZPA 5B21A 1AFVH 1U91B 4GJTB 1TJIL 1HIMH 2EYTB 1Q0YH 3U9UB 1U3HD 2W0PA 4PS4L 1TQBC 1RPQA 5CILH 5TF1H 4OQTA 1TFHA 4OLZH 3BKJL 3ECBA 4J6RL 2YD9A 3RGVB 5CMAB 4OF7A 2EC8A 4KZEL 1HHGA 4YZFE 5DQJA 2A6KA 3DVGA 3E0GA 4JFDD 1GH7A 2R69H 2F8OA 1CGYA 2A9NH 3D2UD 4JQXC 1NEZB 3L95A 2R0ZL 4GS7C 3ULSB 4K3GA 1S7UB 4PJAB 5HHOE 2X4OB 1IFHL 3I3EA 3PL6C 4IRJA 4IRZH 1MCPL 4F33A 1SM3H 2EDFA 1DQJA 4LEXL 1MRDL 4XVJH 3AMLA 1FNGB 4PRDA 4QEGA 2QHLA 1DFBL 2ICWA 4B0MM 1YMMD 3HC4L 5BZDA 2P4AB 2P7TA 2AEQL 5C8JA 4G7YH 5C6TL 1I9IL 4F7TB 2Y72A 4NJAL 5IW6A 3NZ8B 4GBXD 8FABA 3MOAL 3ES6B 4FFVD 5EA0L 2RQ8A 4NGHL 1KXTB 1F3DJ 4JVPA 5FO7A 1ZAGA 1N0XL 2C9AA 1ZHKA 4Z9KB 5JW4N 5ILTH 2AXFB 2FDBP 3CVHB 5HYJE 5IQ7H 3CX2A 1WITA 5IR1A 2C7UB 4YPGB 1PDKA 5I1DA 1HXMA 1LE9B 4JZJA 2NLJA 3CC5B 3CDYA 6CGTA 3WFCL 5J57B 1MCKA 2FYYA 2ZUSA 2P24B 3H42H 3ZTNH 3JWOC 4LHUA 4RFEA 1B4JL 4LARH 5TDOB 1F4XL 4JRXD 3U46A 4Q9CA 5DSCB 4PRHD 2AJUH 4JRYB 3RWJB 4B50A 1NGWA 1J11A 4JFHE 4NRXB 2HT3C 1JI1A 1G6RL 3IETA 4NCDA 3U4EA 1YPZB 1X7QA 1AHWB 4PLJC 5SWQA 2OXHA 2AQ2A 4HDIA 1U8HA 4L9LB 3IFLL 3U4AA 4WI2A 3OAYH 4M9OA 1NCDH 3MV8D 1UJ3A 3LCYA 5J6HA 1LD9A 1BVLA 4NHUB 3TO4C 3KPRD 1Q72L 4POZD 2HFEB 4HT1L 2YPVH 1IKNA 4N8CL 5D7SL 1LO3H 1KJVB 2NMSA 5JR1L 4P57B 4EDWL 5HHPB 4YWGH 5GS0D 2E6QA 3U9PL 2CLZA 1G7LA 2D7TH 5ANMA 4MA8H 1HCFX 4GRLA 4F57H 3GIZH 1NQBA 4R3SA 2APBA 4WHDA 2VH5L 4HUXB 4DK3A 1E6JL 1FDLL 3TN0A 3HC0B 4XPBL 1A7NH 3CK0L 5ADPH 4HQQH 5K9QG 1EDQA 1A1NA 2YHGA 3LEXB 1CICB 2EC9T 3P30L 4G6FB 4QHUA 1R5VB 3C60A 4N8VB 4P5MA 4HGKC 4M7JH 4YPJA 5I6XB 1KT2B 1DQTA 2H41A 1UADC 3SDAA 4NRZA 4LF3A 3MGTA 2F74A 1I4FA 5F9WC 4OGYH 1QBBA 4YHKH 4KROD 1H15B 2AJSH 4R7DA 4K23H 3IKKA 1XR9B 4OZGA 3CXHK 3UBXA 1QRNB 2QBWA 3GMNB 2WINA 5HGBA 4IOFD 3BW9A 4HBCH 5GGVL 3FT2A 1EAPA 1ULVA 1DUZA 2DQGH 3VFOB 2W9EH 3MRQA 2B4CC 4A6YL 4HULB 1AD0B 5C0BA 5D8JH 5JOEA 4KHTH 3NA9H 3QZWA 4UT7L 4CMHC 3KLAA 1F4WL 4PBWD 4KTYA 3CFDA 2H32B 1AI1L 3KJ4B 5C0CE 5D72H 3IB4A 4MAYD 3PWLA 3IKCA 3VFTA 3DRQB 3K46A 2KPNA 4RMUA 5DJCA 3BH8A 4WV1C 2NX5E 4U1MA 1IKFL 4F80A 4QRPA 1ZSDA 3X11B 5HI4D 5EDXA 1AGDB 4ODWA 1NGXB 5F89B 4PJBA 5D2NC 4N9OB 4RAHA 2CJUL 1XGRB 5D9SB 2D31A 1NMCB 3HZKB 5E7BA 2G75B 4WHTA 3FQWB 2PF6A 4Y4FA 1RFDL 3TM6A 2B8OT 5F7UA 2OR8A 2HMIC 1F90H 1YNTB 4O02H 1MCFA 1KLGB 1RJZA 5E9DE 3T0ED 3HN3A 1CFSB 2ZZUT 1AXTL 4KJWC 5GXBB 2DMKA 2NPLX 4RGNB 2OP4L 4PRPE 2APFA 3FHQA 3E3QC 4U6XB 2XIDA 3GKZA 5A3IC 5TPWH 4YHNA 4Y4HC 5DVLA 5MEPB 1ES0B 3QIUA 4TTGA 2NXYD 3K8LA 5BS0A 1A6WH 2YPKB 2Z35A 4ZUUA 4OZIE 1RUKH 1HXYA 4P59L 3FFCE 5H37G 3U4BL 5SX5K 1L0XA 1JHKL 1TLKA 3RWIA 3O6ML 3GI9H 3KLDA 4F7EA 3RPKA 3VXUD 2ITCA 3ME0A 1IM9B 5KSAB 4WFHD 1CU4L 1F42A 2R1WA 3LN5A 1MCHA 1W0WB 4OGAC 4PRPA 3LRHA 3U48A 5FEBA 1CLZH 1A7BA 5JPNB 3GSVA 4UINL 3L7EB 1GRWA 2NY7L 4J3SA 4Y1AD 2NYYD 4OIAA 3WL9B 3DETD 3DMMA 2EYRB 4CW1B 3SE4C 2GITA 4HXAL 5JA9A 4PJAE 2CR3A 4HK0A 4JO4L 3VMOA 1TQCC 5FDYA 3S36L 3W11C 4Y89A 3UYOD 1U91A 4L8DB 1WAAA 2VL5B 2EYTA 4HEPG 5EULV 4YHLL 5C0JB 3WIHH 5F1IB 3EO0A 1UYWH 1WF5A 4LPVA 3OJDB 3VXMA 3LV3B 2DQTL 1MHEA 2FH8A 2B2XL 2UWEF 2VB5A 1VESA 2FEDC 4LMQI 4D94A 5CZVL 1QKZH 2ZPKL 4GO6B 4U0QB 5FECA 5I1GL 2I60H 3L5HA 1NEZA 3CZJA 4UTAH 3QFDB 4NN5C 3ULSA 3ESVF 1S7UA 5F9OH 3O2DA 4Z5RA 2X4OA 4LNRB 3HC3H 3DUUB 3R0MA 4OIIH 1N6QL 4GRWF 1C1EL 1INEL 1FNGA 1OQOA 4Q6IA 5EOQH 2XN9E 5CJBA 4X7CC 1NCBL 1QBML 4UBDD 3QFJB 4NUJB 1IAMA 1AH1A 3PDOB 4UQ3A 1KBGH 2O5XH 2ZG2A 5LGHH 1JWSA 3QEHB 5FO9B 2XZQH 2QQKH 1CI5A 2CRZA 4XNZC 1A4JA 1IGML 3OPZH 4LLVB 4Q2ZB 5GRVL 2D4DA 1LNUA 3NCBB 4JM2B 4FXGB 1YPZE 3NIDF 4RSVA 3BEWB 4ZFZB 5C08A 1QSFE 2V9RA 5DT1L 1DVFD 1P4LB 1ZVSB 3RWHB 2C7UA 1WFTA 4YPGA 5DK3A 2P5WE 3VI3E 1FE8H 4YFEA 4YK4C 3MZGB 1LE9A 4K55A 5EG6C 1EPFA 4P9ML 3OXSA 4HPYH 3P3YA 1LK3H 4DAGL 1LK2B 2YPLD 5DJAA 4HSQA 5D93C 4ZO7A 2AQ3A 1WBXB 1GGIH 1YN6B 1H3VA 1RIHL 3NBNA 4LAJH 3CD4A 2Z4QA 3RWJA 4JRYA 3QUKA 4HUNB 1J0IA 3RWCA 1OAYL 3VXTB 3HUJF 4L4VD 5I1AB 1RVFL 4QXTA 4Q9RH 1SBSL 1AO7B 5GS0L 3JUYA 4QHMB 5GPRA 1Q8MA 1Z9LA 3KPOA 3V6OE 5BW7C 4E41D 2V9TA 1BGXL 3PL6D 2WZPD 1I7ZB 3STLA 3KPSB 2VDOL 1FLRL 2HFEA 5DQ9B 4NO5B 1E28B 3P2TA 5DJZB 2P44B 3ZYIA 3PGFH 3O4LD 5HHPA 2DLFL 1WIOA 4XVTL 3T4YB 5C0RL 3RZCB 4UT9L 3UC0H 3UTSE 4TQEL 1H9VA 1NDMB 4OCRH 2W0FB 1DLHA 4TOYH 4Q97A 2DQJH 4D9QE 2W0LA 3GRWH 5IVXF 5JHLL 3HC0A 3QUYD 4PRAA 1HDMB 3DI2B 1BQHB 4M3KB 4DCQB 1A8JH 1R5VA 3QUZC 2HN7B 1I1AD 2UV3A 5ALCL 1F02I 5EZOH 3ARED 3MMEA 2DM3A 4W4OA 5D6DA 2MCG1 1QFUL 4L8SB 3PWVB 1OF2B 3AM8A 4TPRL 1T7VA 3GM0A 3C2SA 4RWYH 3ZL4L 1DQDL 2B1HL 5DD0H 5H8DA 5TDNA 1MHHB 1XR9A 5CGMA 3GI8L 5F7KC 4OCYL 5FGCB 1QRNA 3WNNA 4QRRD 5F71A 2HT3D 1S5HB 4NKOB 2FRGP 5HHMD 3DI3B 1KENH 4RMWA 4Y7MA 1MJ7H 3SO5A 5D7LB 4BSWB 1FBIL 1I7TB 4EIZC 4MD0B 1RMFL 3GIVB 3UJJL 1IMHC 1UEYA 4QXUH 1I1CA 3HNVL 3TO4D 2H32A 4IRSB 4WW1B 1UM5H 1NC2B 1QBAA 4UV4L 4LPXA 2VDPH 3DECA 4QTIL 4U1NB 4ZTPL 4CDHA 2JELH 4FQXB 4N1CA 5K9KA 1EERB 3OKLB 3T09A 2J1KA 4JHAH 3X11A 5C2BL 5D71H 4RGNE 2G5BB 3VMPA 1AGDA 1FVDA 4N5UA 1V05A 1OAUH 2Q1EA 3M8OH 1VGEH 1MHCB 1CXLA 5I15H 3HZKA 4H8WC 3FQWA 3ULVD 3B5GA 2YUVA 4ODXA 4MNHB 4PGDA 2C4XA 1GJIA 4NBYB 4C83A 4O51A 5TQ0L 4C56B 3OR7B 4JKPH 3NOIA 1X5KA 3TT3H 3RDTC 1MCWW 5J12C 2RCSL 3MTRA 4KK6C 1QPPA 2ARJQ 4PJGB 4UDUB 2EDLA 1T1WA 1UM6H 4U6XA 4DGVH 3BQUC 1XGQA 5TDPA 5MEPA 5T3XD 3DUSB 1EHLH 5IMOB 2XNAB 1P7KB 2G60H 1GC1C 3IXTB 1RZIB 5GGSY 2FECL 5JLZB 1SQ2N 5AG8A 2D0GA 2IQAA 1GZQB 2O26U 4EVNB 4GG6F 4WW2B 2DTMH 2AXHA 1BZ7A 3MNZB 1ZE3C 2OMBA 1U42A 4HAFA 3H0TB 3BMWA 2FLRT 5IB4A 1RZGA 5F8RC 4Z7WB 3ARPA 3R4DA 1H3TA 4J3UA 2F5AH 4OD1L 4WI3A 2BVUA 4XCFH 5L6YL 1MWAA 4XNUH 5C0IB 3X3GH 3L7EA 2BNQA 3EDJA 1A6TA 2AK1H 4LVOC 1AGCB 2YD6A 5K59F 2ZCLL 3O8XB 1YEFL 1LDPH 1GC1H 5I18H 5T1KB 4GXUM 4G5ZH 5CEZH 4PREB 4P3WA 4EN3B 5C0JA 4PJ9B 2Z31D 1KB5A 5EC1B 3OJDA 3GUTA 2HMID 2RB8A 1XZ0A 1AFVL 1AE6H 3FB5A 5F3HB 2VXUH 1OY3B 1Q0YL 1FRGH 4ZO6A 5HYQB 3QFDA 5CILL 4J1UA 2VKXA 2FJFB 5TF1L 1B0RB 5L7XH 4DVBB 3GSRB 2GSIB 4AMKL 2CXGA 4FQPA 4LNRA 3MLUH 2R2HB 5C09B 2GEEA 4Y4HD 2P8PB 3D85B 1ZTXL 3VMNA 3ZDYF 1IQDA 4MA3A 1KXVC 2A9NL 2O61B 2GT9B 4M6ML 1ONQA 1D7FA 3QFJA 1AQKL 1B4RA 1NUDA 1A22B 4HBQA 1MI5D 4ELMA 1NGZB 4X6DA 5D5ME 3LPWA 1AKJA 4OZFA 1BZ9A 1F6LL 2WSKA 4JHWH 4XVSH 5FO9A 1YN7B 2E9IA 2FECI 5LBSH 5EH1A 2YR3A 4OGAD 1EEQA 2J8UF 5C0AA 4G7YL 3NMEA 2ZUVA 2XICA 4KUCF 4NKDB 3I75A 3BEWA 4OUUB 1AO7E 4IJ3C 2ATKB 1P4LA 4JFZL 1NFDB 1J5OL 2ENSA 3NGBC 1GXEA 3MLZH 5D1XC 1YC8A 1U95B 4F9PC 2JIXA 4KDTC 3MROB 1QP1A 3WS6C 2DMBA 3W11D 3WDIA 3KPSE 3S97C 4LRIC 5ILTL 4G8GD 1LK2A 1CL7H 1KPUB 5F6IC 2VL4A 2LABA 4XCNB 1FC2D 3QEUA 5DMIL 1HQRA 1G7IB 4JKWA 3MJ9A 2HH0L 4NRYB 4JB9H 4NQCB 4F9LC 2W38A 2I07A 4V2CB 5F1NB 2BVPB 3K0WA 1VADB 1ZLWH 1B0GA 4G42A 3ZE0E 4AZ8A 2FEDD 3JV5A 4HI