4K3HA

Immunoglobulin lambda variable domain l5(l89s) fluorogen activationg protein in complex with malachite green
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
QAVVTQEPSVTVSPGGTVILTCGSSTGAVTSGHYANWFQQKPGQAPRALIFETDKKYSWTPGRFSGSLLGAKAALTISDAQPEDEAEYYCSLSDVDGYLFGGGTQLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin lambda variable domain L5(L89S)
publication title Malachite Green Mediates Homodimerization of Antibody VL Domains to Form a Fluorescent Ternary Complex with Singular Symmetric Interfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/inhibitor
total genus 24
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k3hA00
4TN9A 1A2YB 2EXWD 2Q86B 4ZUUA 2BHUA 2IALB 1VHPA 1U8JA 4M6MH 4LSRL 3UZVB 2IWGA 3HB3C 4HKJA 4LRNH 3TVMD 4O5LL 2VLJB 2N7BA 5AAWA 4NIKB 1ZK9A 4LCIH 1I9JL 2R69L 1E6JH 1AY1L 5HHOD 3QDJE 3SOBL 2YBRA 2PR4H 3TT3L 1T5WB 4UT6H 3CH8A 3ROLB 4RBPK 4AQ1B 5E8NB 1KUMA 5EU7E 1KELL 2AEPH 4PJ7E 4MSWB 2VIRA 1WCQA 4C83B 1U91B 1R3JB 3UTPE 4ZMAT 3PL6D 4UAOC 4DKEH 4LQFL 5CSBA 5L8LB 3BMVA 2H2PD 3GBNH 5DK3A 1A7RL 4KRMB 3O6KL 1F4AA 3TBWA 1QLFA 4YHNA 2J3SA 3Q5TA 4ZOEA 3ZTJH 1MCNA 3BZ4A 2VDQL 2W65A 4U1LA 5T1LB 4HKXB 1NJ9B 4HCRL 4UILL 5I8KH 1FCCA 5EN2A 4QHKJ 4UV4H 2XA3A 5C07A 5HVHC 3UDWA 4V1DB 3R8BB 3I6LE 3T3MF 5HD8C 3QA3A 4Y16A 3ULSB 1A21A 1ROWA 1KIQB 3HZMB 1TQCC 4U3XA 1AC6A 4I5BB 2EDDA 3ULUF 1YUHA 2OXHA 1A7QL 1CFSA 3VFOA 2CRMA 3FRPA 5EOTB 3GSOB 1R3IH 5HPMA 3T1FB 1DLFH 4XCNA 1L0YA 2YA0A 1FJ1A 1U8QA 3EAKA 5DJXA 1F02I 4M1CD 1EHNA 2H9GA 2BVOB 3SKUD 1ZAGA 3CXDL 5CGTA 1IC7L 5DFTA 4R0LC 3I84A 4NFCA 5CWSA 5B8CB 1SJEB 4YHLL 2B0SH 2DTML 2BOCB 4OSUL 1R24B 4CW1B 5TDOA 1OB1B 1QA9A 2A83A 3BJLA 1MCJA 3CPLB 5FIEA 4OLVH 2X4PA 3S37X 4JKKA 4G6ML 3CXHK 1HHIA 3CX2A 1QFWM 5C0BB 4AEFA 3DMMB 4XVTH 2ZJSH 3S35L 3H9HA 5CP7B 3CD4A 1L7IL 3UTTA 2FECL 1OPGL 2A6JB 4JFEA 3M17B 3BT2H 4M7JH 3KPQA 1QR4A 3SDAB 3C2SA 3S4SA 4TNWK 3BE1H 4JDVB 4FFVD 1Z3GL 1TVBB 3LAFA 1QSZA 3HZVB 1PW3A 3V9FA 3MUY1 4XC1L 4AEHL 2EYRB 5C7XH 1FFNA 1NMAH 2EC8A 2NZ9D 1XGQA 1NKRA 4MXQD 4XP1H 4IIQC 4OFYD 3F5WB 4H20L 4N0UE 5B39A 4JDTH 3PQYD 1YEFL 1QFWI 1ZHNB 1CBVL 1S7UB 2Q6WA 1OSZB 4JRYD 4DVBB 2CKBH 2W9EH 4KVNH 4KKLD 1XF2A 1QKZH 4U1SA 4X9HA 5IWLA 2HLAB 4JFPA 5F6IC 2FEEI 4PJGB 2NY0B 3C09C 2VUOA 4JANB 3QIBD 3JXAA 2ZCLL 5EIQA 2W91A 4X6DE 5B22A 4F15B 1CD1A 4KC3B 1QD0A 4X6CE 3B8SA 4E5XA 5HI3D 1KPUA 4NQCB 4KKCD 1FO0A 1AGDB 1MLCB 1HWHB 4FMFA 4C4KO 2Z8RA 1MCQA 2GSGB 3HC4H 5TQ0L 4R4NC 2EKSB 5EZIH 5C0DA 3RUGA 3OWEA 1P4BH 2APXA 1FFOA 2AV7B 5F7MC 4UI2A 1M05B 4ISVA 5FHAL 4Z7QE 3MJ7A 1MVUB 3T0DA 4IHOB 1ITBB 5KVDL 1XF5A 1JWMB 3GHBL 4D9RD 3SKNA 3ESUF 5IG7B 2NR6C 3MV8D 4JFDB 4Y1AD 4GXUN 5MEPB 1F6AA 4EOWH 1ZHKB 1U0QA 3JBG7 2VAAA 4Y2DC 4ELMA 2JIXA 3ZT6A 4JG1H 3BKMH 5ICXA 3I9GH 3HRZA 1MCWW 3ARWA 3KPRB 3PWVB 1ZT7A 1H8SA 5GS1C 3MLRL 4RFOL 2R0KH 1JVKA 5BO1L 4FS0A 1RULL 3UPRB 4JJHA 1FAKT 1S7TB 4PS4H 2HVKA 5J1AB 5JW4M 2ZUYA 2FJHB 1JNNL 1NAMA 2O5ZH 3OKKB 2GFBB 5E5UB 3HNTH 2J88H 4WFFE 1IEHA 4JN1H 3CVHH 1YEDA 4M62L 3UC0L 4PP1D 1XCQB 5T5NG 1CGXA 5I8CA 3BO8B 4XPBL 2X70B 1JPTL 5DA0B 3GSVB 5L8KB 2BDNH 4XPFL 5IB5B 1F2XK 5F9JB 1RU9H 1DVFD 3G5YB 3J7HA 3L5JA 3T0ED 5IP4A 4KZEH 1U2HA 2OTUB 1YMMA 4K3DH 1TCRA 2B1AL 3PV6B 4ERSL 5H94A 5FOBB 3HG1A 1I3RB 4RA3A 2NPLX 5DK0A 5FYLD 3BZEB 3VXUD 1Q0YH 3SGDH 4FQXD 3VXTB 4YH6A 1C5BH 5KS9B 4PJ9D 4OF5A 4LLYA 5INCB 5B3JF 1A7NL 4IIQA 1G7IB 4N0FB 2VR9A 4LPXA 3JWNC 4OLZL 4ZD3H 1UC6A 2NMSA 3KDMB 5EA0L 1A5FH 3K1KC 4YBLB 1C12A 3TJHD 1A7PH 2Z31B 1CDUA 4OB5L 4Q9CA 3ZE2F 2YPVL 3O3BA 1F45A 2FATL 1MREH 1EVTC 1T1ZB 2O61B 1B2WL 3MLSH 3MRDB 3T0XA 1YMHB 1A6AB 3SKJL 3VMPA 4W68A 4GW5A 1X7QB 1IGML 5I1KL 2ED7A 5IOPA 1JPGB 1XGYH 5BVJB 5ACLA 4WRLA 2OXGA 1KTDA 3LEYL 4G3YL 5E7BA 4NRYB 4JPWH 4OI9A 4C57C 3VW3H 3UYOD 1BREA 1VFBA 2IQAA 5I75C 2AV1A 1KLFA 3O6FA 2VLRB 1OTTC 3ARBD 3H9SE 4KPHL 3FRUB 1PSKL 3LN4B 3VGEA 4PJCF 3LQAH 1P84J 4YFDB 1DEDA 2Y4SA 4MYWB 1IRAY 1OVZA 3N0PB 1CQKA 3N85L 1I7TA 4DZBA 1CLZL 4GKNB 4FXKB 4PJDB 3MNZA 2JTDA 4I3SL 4QRSB 5E2VL 3EGSB 3GMLA 4LLUA 5DQJA 4Y2DA 5B8CC 5BV7L 4KKBD 4N8CH 1BX2B 2XWJA 5HHQA 5K9QG 1E28B 1LO4H 2YKLH 2AGJH 1RZGA 1FVDB 1UWEH 3BQUC 2E6PA 1SM3H 1Q1JL 5GS1A 3I3BA 2A1WH 3DMMC 3NTCH 2HRPL 1SJHB 2R2EB 1Q38A 1ED3A 3LZFH 4XAWL 1CN4A 1P2CA 3RY6A 5EU4A 3TJEH 4P5TD 1UEMA 3QXTA 1NMCC 5T3XE 3H6JA 2YN5A 4PJBB 3V5HA 1U8KA 3O11B 2HRLA 2SEBB 2C1PA 4P46D 3RNQA 1S9XB 3HE7D 1MFAL 3HFML 1FFRA 2PETA 2AJVH 4LCCC 4D0BB 1KGCD 1NGXA 4A2LA 5IB3B 1IAIH 1RZFH 2Q86A 1VKXB 4IOFD 4RGMB 3QUKA 1YY8A 2IALA 4KHXH 4MNQA 4WGVB 3WDHA 2V2WB 2YUZA 1DQML 2N1KA 1RUPL 2VLJE 5DZNA 2YRZA 5E8OA 3HCVB 1BF8A 3CSPA 4OV6F 1KJVA 1UJ3B 4N1EA 1T5WA 3UCRA 1Q0XH 5DD0L 3U9UB 4MD5B 5HYJD 2E6QA 5I1IL 3M1BA 2YD5A 3K74B 3MODL 2NY0C 5GRVK 3SDCD 4C83A 3UROR 4PR5B 5J3HD 1II4E 3VH8A 1CE1L 2DD8H 4F15C 5FM5O 4PLNC 4HJJL 1SMAA 2OMBA 4RMUA 4QO1A 4WHTB 4OCSH 2Q3AA 5TFSL 4DQOH 3MCLH 4OIBA 1F4HA 2P8PB 3ARFD 3G6JF 2CIKA 5J1TC 4S1RL 5H37G 3IFNH 4JPKH 4Y4KB 2DF3A 4V1DE 4ZOAA 5SV3A 3X12B 3L95B 1FZJA 4WV1B 1P4IH 2WP3O 3LN5B 1IZJA 1B88A 3QNZB 4O2FB 5ANMB 1UT9A 2X2YA 3O2WL 3KYNA 4I5BA 3RU8L 1ORSA 1QOKA 4JREB 4HS8H 1PGRB 1SQ2N 5EOTA 1T03H 3S3SA 3T1FA 2G60L 1JHKL 1PY9A 4LF3A 1MWAL 2YSSA 3VGHA 2J6EH 4MQTB 1NCDL 5BV7B 3GSQB 2BNQA 2BVOA 3L3DA 3DX6A 4U6VL 5FB8A 2DJSA 4LLQB 5J6HB 5SX5K 5AEAA 3O4LA 2QQLH 1EAJA 2VDMH 1EX0A 2BOCA 5KVFL 3DIFB 1R24A 4P4RB 4PJ8B 1FL6B 4E41A 3CPLA 1KEML 2VH5L 3BQUA 3ARZA 3GEWB 4XWOD 2VQUA 5ICZB 1MCEA 5C0BE 4BQ8A 15C8H 3DMMA 3GSNA 4O02L 4X4YB 4NT6B 4Z6AT 3TN0D 3VD9A 1KJ2H 1I3VA 2YPLB 5MHSE 1JUFB 3BKYH 5JIPA 3ISWA 1CQYA 1MQKH 1KEGH 2FD6H 5C9KA 4LCCA 5DZOA 1P6FA 4NQEB 5BQ7A 3VGBA 3KPTA 4ODWB 1DQJB 4ZUVB 1U8OB 2OL3L 4PD4J 4WJ5B 1LD9A 4HIJB 3LPGA 1XIWC 1P5UA 2AJXH 3PWLB 3L9RB 3MRIB 4YBLC 1K5NB 2VDRH 1F42A 1WCBA 2ID5A 2Z31C 4K7FB 2OX5A 2VZUA 3WFBL 2Z4QB 1AKJB 3OJDB 2C4FU 4RISH 4HUXA 1KTLA 5GGTA 4JRXA 3D39D 1KB5L 5EULV 3ARUA 4PRBA 2O26U 4JO4H 4YAQB 3MJ6A 1DEEA 1EGJL 3BIKB 1UCBH 4IS6A 4LDEB 1TTFA 2GSGA 3C5SA 4K3GA 1WTGT 2FEDD 1A8JH 5IB4A 5JPNA 3IDJB 5BS0E 5MERB 3GMOB 2AV7A 3DVGB 5T3ZD 5JO5A 4OM0L 5E94B 5E1HB 1ZVSB 4N5EC 4KI5E 4CVWA 3MC0A 2YD9A 2KQMA 5FKPB 4JFDA 5IT2L 1JNJA 5MEPA 2QKIB 2OZ4A 4LU5L 4IRJD 4RIRB 5HDBF 2WV3A 1K4DB 2ZSWB 4FQLH 3LS5L 4LLMA 3EBAA 1L6ZA 2YMXL 2HH0H 3V7AE 3B9DA 3WS6A 3NA9H 5EIIB 5EZOH 2PTTB 4MB3A 4FQIH 2W0KA 4GKZA 3TFKC 4YC2B 5EORH 1YEIH 2EIZB 5K59F 4R2GB 3PGFL 2HT3C 2JELH 4Y4HC 4J12A 5JXAL 3GMRB 1KIPA 5SX4I 3TIDB 5EZLB 1N5YL 4O4YH 2P24B 5T1KA 3MRKB 4PJHA 2PCPA 2GFBA 3MQIA 3HC3H 5DJYB 4IRZH 1UM6H 4NO5B 5EZJA 1GL4B 5BVPL 1A1OB 2C5DC 5JUEH 1G9MC 1FSKB 4L8SB 3VXRD 3GSVA 5I66A 4C55A 5IB5A 3QPQC 4KTDL 3QEGL 2OTUA 4LARL 4POYA 4IRSB 3O0RL 3V4PL 4ZUTB 5FOBA 4XMKH 4H0IA 3QZWB 5IVZB 1GXEA 5D1XD 1UJ3C 1WZLA 1KCKA 1TNNA 3RAJL 1BF2A 3JV6B 1PKQA 1BQLL 5KSBB 2E9IA 2IAMB 5TH2B 1XIWA 1AFVL 4PRPE 5JQ6H 3SGEH 3H3KA 3DROB 1QSFD 5MI0B 1RIUH 3MRHB 4DWHA 2Z31A 3GM0A 2Q7NA 3H0TB 3UEZA 4X99A 1GAFH 4AYFA 5IMOA 1YC7A 4NPYA 4EUPG 5E6ZA 4URTB 3MRDA 3U30C 4DOHB 3D85D 2XYCA 4KZDL 3IU4L 1CU4H 6FABL 1YMHA 2ESVE 5TF1H 1LO3L 4BZ2H 1CDHA 1QBAA 4F2MA 4U0RC 4OQTH 1D9KB 4NCC2 2ADJB 5KOMC 1JFQH 5HSFA 4LVNB 4Y4KC 2R0ZH 1YPZB 4WTZG 3QEQE 1A6ZA 4XPTH 3CU7A 3PGDA 3WHXA 4GO6B 1XF1A 2CDEB 4I8DA 1H3VA 1J86A 3U7AA 1NBYA 4KI1A 3TBVA 2Z93B 2VLRE 4NKIL 3OZ9L 4XCCH 1CXKA 3I2CH 4PLJD 1GGCL 1XGPB 3L5WA 4YIQB 4JM2B 4P3DA 4HH9B 1V7MH 1FRGL 3FFCB 3QWRD 1T4KB 2HFTA 2QQNH 4MAUL 4YDJB 5IEKB 4OZHF 5C70A 3VA6A 1FDLL 3QIUA 1QLRB 4ODVL 2UWEE 1BX2A 4K8RC 1T1XA 5CJQL 4HS6B 4R26H 2K7PA 3S9DB 3VFPA 1MEXL 3UBXG 2IANE 1UQSA 4XI5D 3F65A 4OKDA 3HNVH 4ODSL 5AYUL 2X40A 1GC1L 1BM3H 1WBZA 4XVSL 4L29A 1YEKL 2QSQA 4KJWC 2R2EA 1IGTB 4TUOB 3S96A 4Y4HA 4WW1B 4PGEB 2FHCA 3GJFK 4KKNA 4PJBE 3C2AH 3FT2A 4ZAKB 4X98A 4ALAL 3MLZL 1FIGL 4Z9KB 4WUKH 1PKOA 4WVRA 2BRRL 3CX5K 3WXWL 3BYYA 4G6KH 1YN6B 2JJSC 4FQQB 1IL1B 4PGBA 4XAKE 3DVNA 3QNYB 1F4XH 4EDXB 4PRHA 25C8L 3CMGA 1BQSA 3QQ3A 3SGKC 3UAJC 4YNYA 1YEJL 4LCWA 2V2XA 4UQ2A 4GG6F 5H2BB 4L5FL 3U9UA 1T2QH 5GJTH 3B5HA 1KYOK 3LSOB 5CHNB 3FCTB 3KXFB 4HH8A 4PJEF 3VXSD 4HBCH 2OJZH 3RWHB 3MX0A 2MHAA 3BPLB 1AIFA 3FQXA 4P3CH 5BOZG 2P8MB 3P0GB 5LGHL 3E2HB 4UDUA 1BBJB 1NCCH 3U0PA 3O2DA 2ADIB 4MMZC 4H26B 1GIGH 4HZAA 4Y4KA 3LN5A 1MJUH 1BLNA 1T7VA 4O2FA 5DHVH 5ANMA 3BGFB 4Y5XC 2R0LH 5FYLH 1K2DA 3LV3B 1DDHA 1RZ7L 3KG5A 1T7WA 3HE6C 3ECBA 4LNRA 3SGJC 3MBXH 4HXBH 2APBA 5T1DH 4I3GA 1QFWH 4BQ6A 4JRWA 1UFUA 5AZ2L 1TJHH 2VLME 1JGLL 3MA7A 5E2WH 5DJ6A 5MEOA 5ILTL 1Q9KA 4AM0B 4HWEL 5E08H 1KENH 4DFHA 5BMFH 2ZUXA 1WIOA 4BFIA 3HI5H 4R2GC 4PY7B 4U1IB 5BOPA 3B3IA 5BRZE 2NXYB 5DTFB 2Q87A 4G9FE 1EA9C 1PQZB 1S7SB 1T7YA 1G0YR 1PEWA 1UKQA 4GJTB 1N59B 1EBPA 1P7QB 4ZPVB 5GSRB 4NO0D 2GITA 3QXAB 4FXLA 1NGQH 4NHUB 3QDJD 3RTQB 2NLJB 1JWSA 4X4YA 3ROOA 4L8SC 1NFDA 2XTJD 2DQJL 2DMKA 4ZFGH 4F9PC 3LKQA 1B4RA 4M1GH 1JRHL 1XZ0A 2DQCL 2R4SL 4U1GB 1YEGL 3UTPD 5JHDD 4P59H 3ESVF 3O41B 3P4LA 1CFBA 4NQEE 5F3HB 1EMTH 2DQHL 3ZKNC 3H3BC 5I76A 3VFNA 3PWUB 4O51B 5HI5D 3X11B 4CMMA 2D7PA 2VZOA 5KAQG 4HIJA 3T65B 3S3JA 5SWZB 7FABL 3DX8B 4XP5H 3BGAA 3SGKA 3L9RA 3MLWH 4JO2H 5FAAA 3DV6B 4CVZB 4DN4L 1AKJA 2KKQA 4JY4A 3HPJA 5DVNA 4NKDA 5DD3L 4YX2L 3DPBA 5BJTB 4CN4A 1QSEA 1R3LB 3QEHB 4ODTH 3PXJA 1XGUB 3BIKA 3BN9D 5D71H 1QNZL 2UVFA 5B3NA 4Y5YA 1DFBH 2IBBA 3OB0K 1A1NA 2RCSL 3VI3E 3DVGA 3PWJB 5BW7C 2VZVA 5DEGA 1DQLH 2EH8H 1WT5C 3QDMB 3OJ2C 3G5VA 4HF5L 1JTPA 5D2LF 5JW3H 3KYKL 2DBJA 1OTSD 4Y5XA 5CZXC 5CBEA 3Q6FB 2QKIA 3GO1L 1IGFL 3WIHH 5F88B 3HE6A 4RMSA 1K4DA 4Y19A 2DLFH 1HIML 2AXHA 2EDYA 5T1MA 2NQCA 2X4TB 3N9GL 5FEBA 2DM7A 4X5WA 1MLBB 4R8WH 3S5LB 5EIIA 4JKLA 5C6TH 3JWOC 1Q72L 1AR2A 4WU5A 5DEFA 1CDBA 2ICWI 2F54A 1JK8A 2PUQT 2XACC 4ZAKC 5DJYA 1EFXA 5EB9A 3BP6A 3G5XB 1T22B 5JW4Q 3MYJB 1WZ1L 4LSVH 5FDYA 3GSRB 2H6PA 4L8SA 2XPGA 2VN4A 2XQYK 3IJYB 1S5HB 4NSKB 1XR9B 5EBLB 4F9PA 4HMCA 1BZ7B 2XQYG 1S5IH 4Z78B 4FRWA 4LLAA 3B5GA 1MFBH 3OKOB 3FZUC 1O7SA 3CLFH 4LCIL 1E6JL 1MIEL 5C9JA 4R97C 4BKLA 4GMSL 3TH4T 1G9NL 2AEPL 4OCMC 5J1SC 4I2XA 2Y6SD 1IKFL 4NC1C 3VFTB 1WBXB 3S4SG 5F3BA 1I4FB 4Y4FB 3VG0H 5I17B 3NCYP 2NX5B 5ESQA 5CZKA 1IVLA 1WLHA 2NTFB 1KC5H 4XNUL 5C09E 1NANH 2P46B 3BPLC 2UYLA 3DUUB 3I6GB 4DOHE 4WEBH 5ICYA 1QQDA 1ZGLB 5ALCH 5I8KL 2NY5C 4HIEB 5FECB 2EE6A 1O7VA 1YPZE 3TO2B 3K8KA 2YS4A 1J1PH 1KLGB 4FNLL 2Z92A 2PO6A 4YZFF 4LKXB 3QUMH 2ARJB 5GQBA 5DJAA 3AY4C 3PABB 2XRAH 4XVJL 1FGVH 3QWOB 5FUOH 3VDAA 1AXSA 1WT5A 2R56H 4XHJD 1XR8A 3S36X 4HPYH 3MV9A 4YIQA 4HH9A 1N64H 1EEZB 3P73A 4X9GA 6CGTA 5IEKA 1N8ZB 2B0SL 1MCFA 4LCUA 2XWBB 1IAOB 3UYRL 1MCIA 4LLVA 4K71B 3G6AB 4KUCD 4JQVC 2OM5A 3FTGA 3A6CH 3TESA 3IXAA 2I60L 1BIIA 4RRPG 3RFZC 4XVTL 2ZJSL 1JL8A 1OW0A 2M8XA 1OTUC 2E9JA 2PN5A 4NBYB 1ZE3C 4HC1H 2QR0B 3MLUL 4TUOA 3RTQC 5I16B 1IM3B 4F57L 2QQQA 4KAQH 4OZFH 3T04D 3MXVH 4B0MM 3WSQH 1RMFH 4P23C 1JI2A 3BE1L 1LEGB 4TPRL 1QO3B 5KG9A 2AK4E 5T3ZH 4U1GC 3KGRA 3RWEB 1P84K 5IVXE 1EJOH 3P0VL 5LXGL 5GISH 2DQTH 3UO1L 1DANT 1IL1A 5LVEA 4PJIA 1PG7W 3MOBH 4JDTL 2ORBL 4Z7WA 4K3EH 5AWNH 2XN9A 3FQUB 1H5BA 4U1KA 1JP5A 3C9NB 5GRJH 3F7YB 4XMPL 1MH5B 4NQXB 5HGHB 3PJSA 3D5OF 1U8LA 4WIQA 2WIIA 3TEUA 5FYJU 1M71B 2XZCH 4MZ3A 3RWFA 1IM9D 5HHXL 2LU4A 3NCYS 4N9GA 4NOBA 4KK6C 1A7BA 5DXWA 3SJVA 3JZ7A 4MJ2A 3HMXH 5FCUH 5EZIL 3ULUC 2P8MA 1MCPL 4I0PB 1P4BL 3EYFB 4MA8L 5IM7B 3TCLA 5GGTL 5CD3B 2BFVL 4PJCB 2VWEE 1T80A 3FQTA 4A6YH 4H8WC 2NNAB 4PB9H 2IQ9H 3W0WB 2OI9B 4UIKH 3T1WA 1RZKH 4GBXD 4OLXH 4LOUC 3LV3A 2VDOH 3WD5H 3FB5A 2H41A 2JCCF 4JG1L 4Z18A 3BKML 4LHUA 4MA3B 1D6VH 2AW2A 3MRFA 3I9GL 5D7JB 4XMLH 5DLML 4KMQA 2YUVA 4RAHA 2OMNA 1EHLL 5HVFB 4P2QA 2EICA 1TZHB 2R0KL 5I15H 4X4XB 4AM0A 4Z0XB 3EKCA 5DJ0A 4PS4L 4JQVA 3VGDA 1HYRC 3IXTB 4U1IA 2X89D 2ENSA 3PHQA 4JN1L 5GGQH 1PQZA 5HTSA 1W72A 4QXTA 3BAEH 3BPCA 5AUMB 1N59A 1I1YA 4OLYH 2F58H 4DZ8B 3QXAA 4PJXE 1RU9L 2FYYB 1MCOH 2CUMA 1FGNL 2ERJB 3NGBB 4OCWH 3S97C 5B38B 4MJIB 4K3DL 2IBGA 2VXTL 4P23A 2HLFC 2AXGA 1HH9A 4G8GD 1KJMB 1Y6KR 4W4NA 1G9EA 5JZ7D 3DETC 5I9QC 2DQGH 3WLWC 4DK3A 2G2RA 3UTTE 5F3HA 1Q0YL 5HYFA 1G7QB 1C5BL 5CLWA 2CKBB 1ES0A 3NFNA 3VFWA 2A73B 3MREA 4XHQA 3QG6A 2DDQH 3VMOA 5SWZE 3T65A 1NEZG 4Y4FC 4KKAD 1A7PL 2BCKA 2P43B 5E95B 4FFZL 3CIQA 3MLSL 5A16A 5LAXB 3OAUH 3FFDB 3TH3T 4FQ1H 5HGAB 1AHWC 2GI7A 3G6JB 3ZDYE 1AGFB 5JORA 1NUDA 4N0YL 4G42B 3IFPA 5F89A 4XNMA 5K9QI 4OUUA 4CMHC 3DRQA 5D1ZB 5SX4H 2WSKA 1N5AA 5E4EB 1A4KB 5GGVH 4MAYD 3NCCB 5TPWH 2IEPA 3RGVB 4E0RB 2FR4B 4FXGA 4AT6A 3BW9A 1J05A 3ZYJA 4PD4K 4X4MA 3RL1B 4P48A 3VI4E 5IW1B 2YOCA 4K2UL 4LSPL 3QDMA 4JAMA 1NL0H 1B0GB 1QZ1A 3OAYH 3P4MB 4DKFL 1FN4B 1IT9L 1KCSH 5DK2A 1IKNC 5D5MB 5L9DL 5F93C 2CLZA 4HS3B 4C4KT 1MHPH 3FN3A 4N8CL 1HXMB 3K2MC 1OL0A 4K71C 3GBLA 2JKXA 1LO4L 3QCTH 2AGJL 1P4LB 4YHKL 3ABZA 5KBNC 5MHSD 3SQBA 1SM3L 2R1YA 4QOKA 3QXVA 2A1WL 4M6OL 4ELME 3CVHB 3V4UH 4NQVA 3VXMB 3LZFL 2P8LA 3LD8C 5E6IB 3RWDB 3TT1H 4Z76B 1TJGH 3TJEL 4LCYB 3HAEA 1YEHL 3QO0A 4XP6L 4H25A 2DQUH 4LHJB 4QY8A 2P5WD 5GHWL 2AJVL 3MA9H 2X4UA 3TCXA 2RAMA 4MVBD 1IAIL 3F8UB 4JN2B 4MMXC 2EEDA 2ARWA 3GSRA 3KVQA 2QSCH 4MQXD 5MENA 1MHHB 1RJLB 4OJFH 1ZLVK 5J12B 3PIQA 4HFWB 3QI9D 5EBLA 1TFHA 3RVUD 4GRLB 3P9WB 4XPAL 3A6BL 3HLAB 3MV7B 2XNAB 2B1HL 2Z91A 1J18A 4L3EE 43C9B 2IFFH 2WBJB 3RWGB 3NOIA 1GH7A 1Q0XL 1LWRA 1TQBB 1G9ML 1YQVL 3BDYL 2VITB 4MD0B 1DBJH 1JWUA 2ZUQB 4NNXA 1G7JB 1I4FA 4ETQB 5BS0D 1F4WL 4CUCA 1MUJB 1R5IB 1Z9OA 4WCYH 4P4KD 1Y18B 1NH6A 2FBJH 2NX5A 4WFEE 5AYQA 5IMLB 4OCSL 2FHBA 3BPOB 3PWPB 2N4IA 3SDDA 5JMOC 2NTFA 5CCKH 3FQNB 3MCLL 4KI5D 3I6GA 1AHWA 4DEPB 1JN6A 5E2TH 3CGTA 5EO9B 1WF5A 2VKXA 4XBPB 3IFNL 2KDGA 3U36B 5CGYC 3DO7A 2COQA 2G75A 3CC5B 5FYJL 4J2XA 1W2KT 3P4NA 4YR6B 4X7TB 5IVNA 5ADPL 1KLGA 1Z5LA 1MHEB 1CK0H 4WO4D 1RHHB 4HS8L 4HK3N 2EC9U 1LNUB 4WI2A 3PABA 1M7DB 1AGBA 3U0TA 3NFSH 4HJGB 1I3UA 3MRNB 8FABB 4FQCL 5D7JC 1MPAL 4YXLL 4LNVA 1G0XA 3VWKD 3MLXL 2QQLL 3P9LA 4NZTH 2D0FA 4S1QH 2AEIT 4D3CH 1C16B 5C08B 3GGWA 3O3AB 1EAPB 1TVHA 2A74A 3K46A 2DMCA 3L5XL 4XH2A 1YA5A 1GVIA 1X5XA 4L4TE 2JB5H 3EDJA 1N0XL 1QRKA 2HFFB 5DMKB 3RWCB 1JF6A 3KPNA 2X9YA 4OGYH 3TO4B 1FVCA 4ENEC 1LK2B 2NYYD 4HUUB 4LMQI 4WDIA 5I74C 1OARH 4NDMA 1KJ2L 2AVGA 2ERJC 3NGBC 3BKYL 1CD9B 4K8RL 4LLDA 3C8DA 3D3VB 4PGDB 3V7AG 5JXED 1KEGL 1LEGA 2V5MA 4PRPD 5JIIA 3S37L 5IHBA 1U95B 3IDYB 3IRZA 2W0FB 1U36A 4OUOA 3OXSA 2R1WB 2IFGA 2HTKC 1KTRL 1U93A 1T1YB 1RURH 1NUNB 3BD3A 4NN7C 1NC4D 4FQHA 4C56B 4RQQB 4HUVA 2ESVD 4IJ3C 1D5BA 1QYGL 2AJXL 1RVFL 1MFEH 1MY5A 3FQUA 3QAZC 5JDSA 2AI0L 3WBDA 2QQKH 4NQXA 2DLEA 2VXSH 5E03A 3QEQD 4RISL 4GAJH 5SWQB 4JB9L 4NKMB 4FA8A 2PYEA 3MUGB 1B4JL 5H8DA 3OJVC 3TBTA 3UTSE 1OAXH 3E8UH 3LEVH 4YBQD 1UCBL 1CS6A 5D1ZC 2W60B 1T3FB 5E4EC 3JV4B 1PFCA 1F90H 3MGOA 2KBGA 1NGWA 4WY7H 2R4RL 1K8DB 3CDGA 4QHLB 3BEVB 2E7HA 4PJCA 1C1EH 3Q3GB 4KK8C 2OTPA 1A6VH 3W0WE 1NUGA 2DQFA 1N2RB 2IAND 3O8XD 4OZHB 5TQ2H 5J9PB 1RJYB 4KHTL 5J7CC 5IKCA 4UUJB 1H15A 2P45B 3KPOA 5CIPH 1FORH 4K7PY 1U8NA 3QXDA 1W0WA 5D7JA 1K3ZA 5GGUA 2X42A 4B41A 1S7XA 3DGGB 5EZOL 1YECH 5F9WB 4I4WB 5JLZA 1WWWX 1TZHA 1WFUA 1B90A 3PP4H 3EDFA 5D1QC 1YEIL 2WP3T 3OKEB 4UINL 3WUWB 4U6TA 1T7ZA 5JOPE 1YDPA 5IBUB 4U6XB 4O4YL 1BPVA 2ZCHH 2YD4A 4XCYB 1SYVB 4Z7OE 4MDIA 1UM6L 3UJIH 5AUMA 3FN0H 1B6UA 4XVUC 3SCMD 3MRJA 2JF1A 2UUDK 1OGAA 2P5EA 5ISZB 3TBSB 4YDVB 3IKCB 3MOQA 2XZQH 5KSAD 4OGAD 2P49B 4GRLC 1BFSA 5CGMA 4OCXL 1KJMA 3SBWA 4GG8A 4NQDE 4DAGH 3QUYD 3UTZB 2WBJC 5AG9A 5F1NB 4LP5A 3RVTC 1QRNB 3ZKMC 1OP5H 3O6LH 3JTTB 3ZYOA 2BC4B 2XFXB 2ICEB 2N7AA 1KXTB 1LEIB 5JQ6L 3PNWA 4X6FA 4PJEB 3P0YH 3F7VA 4QHMB 1RIUL 5EWIL 1N26A 4NNPL 3KLHC 2Q20A 4HX1B 1GAFL 4R9HA 4NGHH 3WJJC 3BPOC 3QRGH 4KROD 1D5ZA 1CU4L 3FFDA 5TF1L 4BZ2L 3VWJC 1S8DA 3GSXB 5GSVB 4DEPC 1CL7L 5DC0A 2X09A 1T83C 1CFTB 1KCRH 1JFQL 4MCZB 3EOAB 5FGBC 5FUZL 3V5DA 4PGJA 1H0DB 1MI5A 1QPXA 4DTGH 2R0ZL 2IPTL 4RBPH 3E3QC 5FK9B 2QEJA 3C5ZD 4POUB 3UBXI 5DYOA 2MQ3A 2AEQL 3LQAC 3KYMA 4JJ5B 3GUTB 4PJ7F 2Y5TB 3GBMH 3TVMB 3Q6GH 4CADB 4XCCL 4PRIE 3VD4A 3RL1A 2VDKH 5LG1A 5HHOB 2E7LC 1ORQA 4GW4A 4NBXB 1V7ML 1FN4A 5BRZD 5GJSH 4G9FD 1J7VR 4GW1B 4QHNB 5D5ME 4OM1H 1UB5B 4F7PB 3P77A 2X4QB 2V2TB 3PL6B 3O3DA 3MZTA 5I1JH 1G7PB 3OF6D 2HT4C 1H8OA 4G6JL 2XG4A 3BGMA 3WV0A 1WQVT 1D5MB 5CD5D 3QJHB 4AG4H 2NW3B 1WV7T 1BM3L 4F9LC 2XQBH 3WNNA 4QRUA 5D1QA 3VXME 3CVHA 3FONB 4WI4A 2JB6B 1VGEH 3QPXH 4JKWA 4XC3H 1LE5B 1MJ7H 3C2AL 1G6RH 2BNUA 3T77B 2MNUA 2EDOA 2JJWA 1BJ1H 2GAZB 4ZS6C 3TWCL 2CDFA 3STLB 4WUKL 1IEAB 1DBBH 3IDYC 3TIEB 4G6KL 3A6OA 3TZVC 4UTBL 3MNVA 1XF4B 3IDXH 4R4BA 2GUOB 4X7DC 4PJHE 4I77H 1FNAA 3JWOL 2VERN 2DWEB 4KRNA 1F4XL 4HFWA 4ZFZB 1ZEAH 5FV2A 3W39A 4K94L 3VFMB 3U9PH 5L8JB 5F1SA 1X5JA 3NACL 1DLHB 1U3HC 43C9A 2NY7H 3REVB 3BSZH 1CGYA 2Y07H 1T89C 3QQ4A 1T2QL 5GJTL 4P5KB 4Q6YA 5ID0A 3IYLW 3PXHA 1SJVA 3PHOB 4DGIH 3DARA 1DQQB 4BSWB 2EYSB 3MJ9A 3HR5B 5BXFA 2E5EA 4HBCL 1R5IA 2VC2H 2C1OA 3KYOB 4I3RL 1PG7H 5GS3A 2FIKA 5C92A 3WJJA 1AE6H 2P44B 3PWPA 4G6FD 4L9LB 3BRGC 5JMRA 4TOYH 1RD6A 3VWJA 3O6ML 4JFQA 1T83A 3T4AA 4Y8AA 4QEGA 1OAKL 3VD3A 5HHNB 4WU7B 3CC5A 3DX7A 2CXGA 1RIHH 5D2LB 3WS3A 1PEZA 3VXOB 4PPTA 2R8SL 5F7HA 2X9XA 5IHUH 1RHHA 3ARGC 3PQYB 1LNUA 5CJXC 5JW4R 4JRYB 1M7DA 2OP4L 4X6DF 1NCAH 4CL7A 4X6CF 2J7LA 3L5IA 4HXBL 2E7LA 3LCYA 4NZRH 2FX7H 3V4VH 1QFWL 3MRNA 5IK3A 8FABA 2ATPA 1HHGB 3QUZA 3QIBB 2CLRB 4LEXL 5E08L 1KENL 1CXIA 5BMFL 4JEGB 4U1MB 3MZGB 4MNHB 2FEEL 5F8QC 1EAPA 3T8XB 3RWJA 4Z7QF 4KK9C 5JQHC 3KPLA 4JFXB 5ETUB 2Y25A 2VDLL 1UKTA 1R0AH 3MJGX 2HKFH 5DMKA 5DD6A 3RWCA 4F9LA 1MF2H 2F9BT 4IEFB 5K9JH 1T0MB 3GJEA 5JIKA 3QDGE 4M1GL 3D3VA 1RHFA 1DBMH 4P59L 1I1AD 3MV8B 1U95A 4Y1AB 1BVLB 2W0FA 5FM8A 3TZVA 1W72L 4AIOA 4U4BA 2C4XA 3IJSB 1QEWA 1RJZA 4NN5B 3QEUB 1W0YT 3E6FB 3FB8A 5C09D 1T1YA 5M7QA 4C56A 5IJVB 3HS0A 4XP5L 4LLWA 2BHZA 1U3HA 4M5ZH 1JGVL 3MLWL 2QLVB 5ITFA 2VJXA 4AL8H 4TQEL 1CFVL 4IDLA 1IILE 3IDUA 4KJYB 2IBZY 4DGVL 4KUCF 4PREB 4HLZG 2DWDA 3F7QA 4E42B 3TP4A 1A22B 1MAJA 1WAAA 5AD0B 3RL2B 4TVSa 2EIEA 2ITCA 4I0CC 3BKJL 5EUKA 3DSNA 3QZWG 4OGXL 4O5LH 2BXZA 3FQRB 5C0CA 2EXWC 1I9JH 2R69H 3X13A 1AY1H 1DFBL 4ODUB 4F7CA 3TT3H 1DVFB 4G7YH 5FYJE 3T0EB 5EO0B 2ZCKH 4HIXL 2AK1L 1RZ8A 1KELH 2FGZA 5DHVB 3TVMC 1QVOB 3VXQA 3LRSB 3OR6B 3VXUB 4J6RL 5SV4A 4LQFH 3FAXA 2DIBA 4B50A 5KVGL 4DUVA 1QTYT 3IF1B 4FQXB 4X8JB 1A02N 4PJ9B 2G9HB 3CFKB 4PTTB 1A7RH 3O6KH 1N2RA 5J13B 1HQ4A 2J6EA 1WIUA 2ATKA 4PJFF 3ARGA 2YD6A 3VFRA 5CJXA 2VE6B 3ARED 1U58B 1S7RB 2VDQH 3PL6C 2VISA 3HC0B 2QHRH 2VLKA 3O3EB 1VERA 4PP2B 2H2PC 3VE0A 4GT7A 1DBKL 3LKSA 4R8WL 2PW1B 3BP7A 4U6HB 4I4WA 2AK4D 5C6TL 5DHXB 1ZVHA 4HWZB 2A6DB 4OZGB 2EE3A 1I7ZA 2I07B 2BSSA 3OKEA 1HKFA 4IMLB 5K9KA 4YPGA 4ZO7A 2BNRA 1NBZA 3MBEC 4LKCB 4EVNA 4ZYKA 4ZNEA 4QHUB 5EFIB 1X44A 4LSVL 5E7FA 1BGXL 4JHWL 3AS1A 3ARBB 4HSQA 4NZJA 5JNYA 5ISZE 5D93C 4YHLH 4OIIL 1YN7A 4OSUH 5HBBA 1FE8L 2OS7A 1U3YA 3HUJE 1MFBL 5E5RB 1T21B 1HQRB 3S8WA 2DM3A 4AH2B 2C3WA 4G6MH 1GGIH 5EUOB 3MRGA 4WFHE 1RPQA 4GG6A 1QRNE 5I0DA 4K3HA 4QKXB 2XA8L 3S35H 4Z7NE 2BC4A 4X8XA 4DCQB 4I48A 1P1ZB 3VG0L 4ZTPL 3GZKA 1OPGH 1NLBL 4WUUE 5E2UL 4JVPA 4GAFB 3NZ8B 3ZMRA 1XCTB 4GRWE 3NCMA 4UV7H 5D7LA 5IR1B 2H3NB 5HYQA 4P5TB 4XC1H 4AEHH 4XRCA 1NCBH 5GSVA 3SE4C 5C07D 4DN3H 4P46B 4GQ9H 4OI8A 3HE7B 4BQCA 4Y16D 4Y0GA 2GHWB 4YHYB 3L7EA 4R96B 3EFDL 5E1AB 1QSEE 3JSSA 1FL3A 2NZ9C 4JJ5A 2HG5B 3B9KC 1FGVL 2Y5TA 5E8DH 5FUOL 2JCCB 4KRPD 2ZCLH 2L4OA 2R56L 4F7MA 1KN4H 4HPYL 5HHOE 3RDTD 4HDIA 1CFQB 2PYFB 3CFDB 5HYJB 5D96B 3ILPA 3I6KA 5EOCH 5HHPB 1BP3B 3SDCB 4F7PA 3PL6A 3ME0A 1MRCL 3MLTA 5HI3C 3WFDH 1X5KA 2PXYA 3AU1B 5FHAH 4KKCC 3DWTA 5F72S 4PV8B 3ZHDA 5DT1L 3LEXB 3V52H 4QRRA 4HWNA 2XY1A 4EZMA 3FO9A 1FFQA 1F6FB 5KVDH 1BVKB 5TDPB 1BZ9B 2MMXA 2NW3A 3ARFB 5I2IB 2EDNA 1QHOA 4YQXH 3UTTD 3B2UC 1NPUA 1HHJA 4JFED 1D7FA 3MXVL 2I9LA 3WSQL 1RMFL 3MMEB 3X3GH 1R3HA 3MBEA 5SX5H 3Q5YA 2R1XB 3L3KB 3PWNA 5D2NA 2Q8BL 4MNGE 3TIEA 5GISL 2F54E 2GUOA 4RFOH 1R5VB 5DJCA 5C0IB 2NTSP 1E4WH 5FA3B 1A1MA 5JOEA 3VJ6B 1O0VA 4K3EL 3IDNA 3F6IA 4OGZA 4FQ2L 1JNNH 1NGZB 4ZPTB 4GRMB 4K3JL 3UC0H 4XPBH 1B0WA 4XPGL 2XZCL 1WC7A 1LMKA 5CSZB 1JPTH 4XPFH 4NP4H 3PUCA 3ZDZE 2DS4A 4TUJB 2BVQB 1DQQA 3V6BR 4BSWA 1D6EB 2WLZA 2PKDA 3NZHL 2B1AH 2P48B 4C59B 4DUWA 1XAUA 1WZKA 3QHZL 4M93C 1JV5A 4U49A 3LMJH 3L3HB 3BH8A 4I2XE 3HMXL 1EH9A 4HZLA 5FCUL 4QRTB 1CICA 3OKDA 1SBSL 1IGJB 3TN0B 2VB5A 1A7NH 5DSCA 3QUMB 4JZJC 4WW2B 5HXMA 4PB9L 4WU7A 5EA0H 1CE6B 1Y6MR 4XZUA 3VD5A 1M1SA 4TUKH 4OB5H 4UIKL 2YPVH 2FATH 1A4JB 1RZKL 1U8IA 3PP3H 5J13C 1Z9LA 4OFYA 4OLXL 4OD3H 2CQVA 3B9KA 3WD5L 3PQYA 1NC2A 2JIXD 3U6RA 5E6YA 4JRYA 3SKJH 3JWDC 3TJHC 3GK8L 1D6VL 1IGMH 5I1KH 1X5YA 4XMLL 4ODXB 4BJLA 1YC8A 4Q6IB 2RQ8A 5I15L 3LEYH 4G3YH 4N5UA 1FNLA 1L0QA 2XTLA 3D39B 1G7MB 4TTDD 1TXKA 4S1DC 5C0JB 3KJ6L 1ZHLA 4PG2C 3RVVC 3S98A 2BHYA 4R3SA 4WHYH 1FYHB 3QQ9D 2F19H 4MS8D 5ETUA 5GGQL 5TE6L 1U92B 5DVLA 2AXFB 3BAEL 3VFSB 1OGTA 4OZFB 1ZA3B 1DE4B 1L9MA 3FO1B 4KI5F 1GPOL 2VL4A 4OLYL 3N85H 4PG9A 4L3ED 1CLZH 1HXYA 2CR3A 2DKSA 3ARBC 5C0GA 4OCWL 4I3SH 1ZTXH 2ZNXA 1LILA 1AGEB 2B4CL 3EYVA 4H1LH 4YDIH 5E9DA 4D9RE 3NPSB 2DQEL 4DGYL 2PNDA 2DQGL 2F53A 4P2YA 3S5LG 3MV8A 3TBYA 1EJ6A 1KT2A 1ZWIA 1TJIL 2VQTA 1Q1JH 4IRJB 5LKNA 4YHZH 4OLUL 2HRPH 3E6FA 4WI7A 1J0HA 4XAWH 4OAWA 1FV1B 1S9WB 3ZE0E 2CXKA 2VAJA 4X5LA 3N1FC 1MFAH 1OWWA 3OAUL 4S2SB 1MIMH 2XN9E 2X4SB 4P5TC 1JTOA 4E42A 4XBGA 3QJFB 5AD0A 3RL2A 3EJZC 1DQMH 4P46C 1FNHA 4BH7A 3HE7C 1X4YA 3C6SA 3GI8L 4HIIA 1RUPH 1OSPL 3MFFB 4LFHG 3BEWB 1RSFA 3VXRB 3QUXA 4YHYC 3P3YA 3RIFF 4A6YB 4AENA 3O6FD 3T0EE 3BXNA 3QULB 5DD0H 4CKVX 1IZKA 3K80A 5F1OB 3SJVE 4ONOA 4JZJA 4PYGA 3MODH 1A3RL 2K7QA 3DVIA 5MEQB 5DJ8A 3VXUE 1CE1H 1LO2H 1DN0B 1L6XA 2ADGA 5D1XB 3FO2B 4L4TD 3DRTA 5CEXA 3KJ4C 1TENA 4JQIH 4Y2DD 4DKDC 4O2CB 1MHPL 4X7CC 3SDCC 2Z8WC 5J3HC 4HIHB 4F80A 1QSFB 2IC2A 3HC0A 3I75A 4TULH 1BJMA 1DL7H 3FB6A 2YC1A 4UQ3B 2D03H 3EDDA 5D7SL 5D8JH 1J8HA 1F00I 3D85B 4PRNA 5DQ9A 1JPST 4EKXA 2PW1A 1C7SA 2GW5A 4U6HA 2Q76B 3V4UL 4X0KB 3NIGF 3RU8H 4OZGE 5ID1A 3ARFC 2A6DA 1TJGL 3TT1L 5HYEA 3DYOA 4N90D 1IAMA 5E0QA 4IMLA 1UA6L 2DQUL 2H26A 2G60H 4EQ3A 1MWAH 3MA9L 1NCDH 1KJ3H 1ERNA 3E6HB 5FUCE 2LABA 4MNQD 4PRDB 3V0WL 3M45A 4FQJH 2UWEF 5KVFH 3QNXB 5F71A 1J12A 1I75A 5T5FH 1KEMH 2ZUWA 4AH2A 5KTEL 3UTSD 5EUOE 3U46B 5FGCE 4CNIB 1CZ8H 3TYFA 2KUTA 4LSTH 5HPOA 3VMNA 4PJBF 4WCYL 1J1XH 1OCWL 2FBJL 3G5ZA 4R6UA 4M61B 4LGSB 1F3JB 3OGOE 5HVWA 4PJAA 4M6NH 4NC0B 3UZQA 5C0NC 5E2TL 1HKLL 4P5TA 4Y5VB 1UADC 2OL3H 2DLIA 1RZIB 5E8EA 5E8PB 4P46A 1UYWL 3WE6B 1QFUL 5D4QA 1Q9OB 5DUPH 1MELA 1U8HB 2DYPA 1KGCE 4F7EB 4Q0XH 4M9OA 3FQWB 2GJZA 4L4VA 2XG5A 1CK0L 2DBLL 3D9AL 3AXLB 4G9DB 3ZTJG 5FCSH 5J11B 5IW6A 1NCTA 1KB5H 2BNQD 4HV8B 4MQSB 2C7UA 5JOPD 2W92A 2PYFA 1VPOH 3BHBA 3CFDA 3O4LD 2A77H 4NZTL 5GIRA 3WUZA 4D3CL 4Q6IC 5K9OB 1ADQH 4X4ME 5HHPA 1EFQA 5I1LB 4JHAH 1S7WB 3VXSB 1HH6A 4ONHA 32C2B 1EBAA 2IG2H 4E41D 2JB5L 1T20B 3QDAA 4OM0H 5ABDE 3IDGB 4ZG1A 4M5YH 5TE7L 1A9EA 4KXZH 2FO4B 3DO3A 2CIIB 1PD6A 3HN3A 4NQDD 4YHPB 3AS2A 3VRJB 5IT2H 5HYSB 4M8QB 3U4BL 5HGDB 1A47A 4LU5H 4F3FB 3GSUB 2OR9L 1EEQA 2R1XA 3NPSC 2YMXH 5GZOC 4UDTA 5KANG 3GMNB 5C0EA 3NN8B 5KJRL 4JZOB 1HZHL 3NAAL 5JA8B 5C0IA 1E4KA 3TNMA 1TCMA 3GKWL 1A3LL 3PGFH 2X1OA 1INQB 2EEAA 3LQMA 1N5YH 2VABB 2QQKL 3VXPA 1AP2A 1S3KH 2HVJA 3U2SB 3JV5A 3U1SL 1KB9J 5DWUH 5B38G 4JRXD 5ECJE 1Z9MA 1IBGL 2HN7A 3DXAA 3WYRA 1N7MH 4Z0BH 1D6EA 3QEGH 3LEVL 4LARH 1VFAB 4PRID 3RPIB 4YXHH 3O0RH 2V7NB 3QISA 4NO0B 3L7FA 4ZODA 3V4PH 1QR1A 2XT1B 1CGUA 3MNWA 1SY6A 3GSWB 3QDJB 1U3ZA 2J2ZA 4KMTH 5C0AA 1IGJA 1I7UA 2XTJB 4M3JA 4PJ7B 1VESA 3RAJH 2I27N 2RJMA 4QRPA 4W81A 4P2OC 4M48L 2HJLB 5KZCD 3D0LB 5JHDB 1A6VL 1C08A 1UZ8A 2HT2D 4G6AD 4MJ5B 1UGNA 4HW6A 1I8MA 5DHYB 4YGVA 5D1XC 3RBGA 5TQ2L 3WEXA 1JHTA 1ACYL 3LKRA 4KZDH 3IU4H 3EYSL 4AIZB 5A2KH 3RX8A 4LVOC 5KSVB 2DI8A 1KNOA 3OB0H 4U3CA 5A2IH 1YECL 1F13A 5FA4A 1BFOA 1ZHBB 4LSDA 4XNZB 3D39E 1KOAA 2AP2A 3V5KA 1G7MA 1I85C 4D8PB 3VI3F 2D7MA 3N1MC 5C0JA 5T1KD 2D4DA 1HI6B 4LAQL 1SBBA 1GGCH 3N1GC 3R8QA 4HC1A 2BMKA 1T7XA 3C5JA 1U92A 2DM4A 4OD1H 2FSEB 3FN0L 2EDHA 3RWIB 5IBLD 1ZA3A 1DE4A 3P2TA 2VYRE 4GOSA 3G04B 1KIUA 1FRGH 4MAUH 5T3ZE 4UIMA 2ZG2A 1FDLH 3CLEL 4PLJC 2XZQL 1JF1B 2J8UB 4ODVH 1CG9A 5D7IB 5TGBA 3O9WC 5CJQH 3ZYIA 3RY4A 3DV4B 2ZZUT 3UTQB 2GJ6A 1MEXH 4MHHG 4DAGL 4QGTA 2A6KA 3BP4A 3KPPB 3KLSA 4ODSH 5AYUH 3O6LL 4X6EB 1YEKH 1XIWD 5DRWB 5IB1B 4IMKC 4QF1B 3D6GA 1FV1A 2MCPH 4RMWA 1FYTA 4YGAB 2FHFA 5DC4B 3MLZH 4L8BA 3R06B 2XKNA 4RZCA 3I3DA 3QRGL 2BRRH 4S2SA 2F5BL 2IPUK 4X5XB 2X4OB 3TYGL 4EUPA 2X4SA 2IPUG 4D0CB 4WENB 5KN5A 1FIEA 1GHFH 4Y5VC 1EV2E 2WBWB 3VGFA 5IFJA 4IOSD 1G7LA 2W59A 1C5DB 2O5XL 3MRPB 2QADC 3MFFA 4ZSOE 1W0VA 1NMBL 5FKAA 1UH3A 3VXRE 4WTZA 5IIEB 5D6DC 1JGEA 4ZDHB 4P9HC 1XF3B 3QULA 1WUNT 4L5FH 2Z0BA 3CSBA 1JYNA 3Q6GL 4P2OA 3CFEB 4OTXL 5KSBF 4NNYA 4X6DB 5J11C 4N5ED 4X6CB 2FZ3B 2YEZB 3ALWA 1JPFA 3OPZL 5C0RH 5D1XA 4OZIB 4JLRB 1FNGA 3STBA 2ZSVA 4G43A 4RAVA 1MNUH 2WWKO 3PV7A 3QIUD 5DI8B 4GQPH 4O2CA 3V6OE 4APQD 2AJYL 1QSFE 2ZPKH 4Q9BA 4NUJA 3C6LB 1WFOA 2RBLA 1YPZF 4OD2B 3SO5A 1AD0B 1G6VK 3QDGD 2MPAL 1FO0H 5IW3A 3RZCA 2CDGA 3TFKD 4ZUSB 2Q76A 4TYUA 4NJ9H 2HT3D 3QPXL 4Y4HD 1FZOB 3REWA 1S7VB 3MV01 2VSDA 1G6RL 2MQCA 4XB8A 1BOYA 4ONGH 4L8CB 4L1DA 3GJFA 4JM2F 3DURB 4NUGH 4X6BA 3F58L 5AZ2H 3E6HA 1JGLH 1FHGA 3FAWA 4I77L 5ILTH 5LGJA 2JE8A 4HQQH 2Q8AH 1I9RH 1ZS8A 3H2WA 1DZBA 1FNEA 4LASH 4PRHD 3O9WA 3U9PL 5ENWB 4ELKA 1YJDL 1FCGA 4J3UA 2Y7QB 5D9SB 4FQPA 4LCWD 4E9LA 2NY7L 3M8OL 3BSZL 1D3CA 1IAKB 4G80A 3B43A 4Z7VB 2VLLA 2BJML 1TZIB 2Y36L 4DGIL 4CNIA 2VXVH 5FYJD 3EYOA 43CAB 3MO1B 1HK6A 2DQJH 1A3QA 2VC2L 2UV3A 5IQ9A 3HPLA 4MX7A 5CAYB 4M61A 4OKVB 1YEGH 1F3JA 1AO7E 1MQ8A 1J0JA 4TOYL 5IVXF 1CDJA 3I02B 3RPKA 2EO1A 5DRXA 3CSYA 5ESVB 4G8IB 2V9RA 4Y5VA 1Q8MA 2XICA 5EU7C 4U1NB 3AB0C 3D69B 7FABH 3B9EA 1F4YL 5HGGS 2DJ4A 3FQWA 1RIHL 2ED9A 5ACZB 4S0TD 2WUCL 3S34L 5IHUL 1I8IA 2MSPA 4OFKA 5KOVC 1XGTB 5SWSA 4DN4H 4J3OC 4XBEH 3AXLA 1NCAL 4NC2B 3UPCA 4NZRL 5CJBA 3L5HA 3V4VL 4Z5RB 2KZWA 2NY6C 3ETBF 2JJTC 3KPSA 3QCUL 3VRIB 4YDLC 4NM8H 4XNZC 1AGCA 2C3VA 4K8RD 5D6CB 3VXSE 1YNTA 4P57A 1GRWA 3FOLA 1I7RB 4BH8B 2E7CA 1M7IB 1EO8H 4XXDA 1CGSH 5EDXA 1R0AL 3BN9C 1OHQA 1HSAB 2HKFL 1W8OA 1G6RB 2FO4A 1MF2L 4CJ1A 3KYKH 4YHPA 1EVUA 2D0GA 5HHME 5EG6C 1RZJL 4M8QA 3GO1H 3GI9H 4JZNA 1R3KA 4YHOH 2IADB 2EKJA 3VG9C 4LHQB 4EDWH 4WUUD 5BZDA 4LIQL 4GBXB 4YO0A 3THMH 3DNKA 4JZOA 2CO6B 4QCIA 3WUWG 3HI1A 1Q72H 5IBUG 1VB9A 2DL9A 1I1RA 1MSPA 3MROB 3PF2A 3X14B 4M5ZL 3OGCB 4B53A 4K7PH 4M3KB 4M02A 3MOAL 1AI1L 5EU3A 3TM6A 4AL8L 3B6SB 4ZOBA 1VEMA 3JTSA 3IDMA 3KS0H 4NO3B 1GGUA 2D4FA 4R4FH 1WZ1H 1WBYB 4PJXF 5LJYH 1QSED 2Z35A 3LKPA 1ND0B 2ZOKA 1MFNA 3MJ8B 3L3JA 1NDGB 1ZANH 2V7NA 4W6YB 4L3CB 1LEKA 1MIEH 2AAVA 3QDJA 4G7YL 4PLOB 2ZCKL 4GMSH 2L0DA 3WL9A 2XTJE 1G9NH 1UG9A 5C0FA 5L7XH 2BVYA 3BUYA 5JOFB 3GNML 4G8GB 1CLCA 4J3XA 1IKFH 5JHDE 3QCVH 4RNRB 2ZUSA 4LSQH 4GUPB 3CAFA 1U6AL 2ZP0T 5DJDA 1DUZB 5HYIA 3H7BA 1Y0LA 4XNUH 1RY7B 2Y6SC 5JHLL 3HE6D 2QHRL 1U42A 4AIZA 4Y19D 3ZDYF 3K8LA 4AMKH 4XNXL 4OCYL 2JK5B 4IOIA 3RX7A 1TDQA 5H35B 3UPAA 1Z0NA 2JJTA 4PJ5E 4R7DA 4FNLH 1G7HB 4P5MA 2F54D 1KPVB 5JPMB 1AQDA 4XVJH 1HI6A 4KUZL 3EO1A 4EI5B 3EJYD 3VI4F 1EFXD 5DGRA 1FFPA 2YPKA 5L6YL 4MAYB 3SDYH 1VA9A 4W6WB 5F1IB 3QFJE 1P7KB 3TV3H 3UYRH 1JF1A 2J8UE 4XHJC 5D7IE 5C8JA 2NXZC 4JFOB 4JPIB 4LPTA 3DV4A 2OBGA 4EXPX 3CFBB 1GGIL 4C54A 4HWBA 2I60H 3W9DA 4Z7UB 3LB6D 1VGKB 1OF2A 1E6OL 4ELMF 2HA1A 2F74A 3T3PE 4OV5B 2APTA 3MLUH 2CGRH 1ZVYA 4HUWB 5KSUB 1Q94B 4F57H 3OKLB 4KU1A 4NRZB 1PYWB 4TPRH 3V95A 3L6FB 3OHXB 4UV7L 2EZ0C 4U1HA 3EYUH 3RVWC 1AR1D 2Y9RT 3P0VH 4HUMB 5LXGH 2X4OA 4N8VB 3UO1H 1NCBL 1F11A 2VL5B 3GSNH 4DN3L 4GQ9L 2P5WB 4N0UA 2ORBH 5EPMB 4HXAL 5I73B 4KK5C 5I71C 1CT8B 4WI8A 1MHCB 1EDQA 5C2BL 3MRMB 5GRVL 2PO6D 3RKPA 5I18L 1PZ5A 4XMPH 4NRXB 1WAAE 2V5RA 1TZGL 1M6OA 4DKAA 3RNKB 4IBLT 5FO8B 2WANA 3QI9B 1WWAX 1FG2B 5EO1B 1M7XA 4UT7H 5E8DL 5I1HH 1IGCL 4X6DA 5CILH 1KN4L 2HTLC 5HHXH 4UOJA 4X6CA 3LKOB 3MV9D 1SVZA 3MV11 3AAZA 2ZOLB 4OZIE 4U3HA 5DO2C 1LHZA 1RUQL 2EDWA 5EOCL 1ACZA 5F7DB 5IHZB 1BECA 2B5IC 1MCPH 2ZUUA 5BS0B 4NKQB 4MA8H 3WFDL 4P4KB 3BH9B 5GGTH 2BFVH 3V52L 5EBWB 4EN3C 5DS8B 3BX7C 3KNBB 4CRPA 3KLAA 3SDXE 1TPXB 1JMZA 1OP3H 2VLKE 1KG0B 1UXSA 4YQXL 4RRPA 2OQJB 5J6GB 1LK3H 4OF0A 4AEIH 3X3GL 1EEYB 3QO1B 2VDNL 5EC2A 1E4XI 1TMCB 2X4NB 4WHCA 3WXVL 2F5AL 4WO4B 5DLMH 3IETA 3DURA 1UB6A 4R0LA 1EHLH 4GBXC 2FO1A 4ETYA 5CP3A 4JDZB 1FZMA 5FDWB 1E4WL 3DBXB 4NWTH 1LE9B 1UH4A 2OZ4H 4QT5B 2XN9D 3FZUD 2EE9A 2D9CA 3WO4B 3MRBA 4YFLF 1IC1A 3GMPB 3TPUA 3VWKB 2IPKA 3IT8D 4O2EB 1LQSR 1GGTA 2OJEA 2ILLA 3VXNB 2GYSA 2X4RB 3BP5B 4Z7VE 5DEZA 5GGSB 3PGCB 2EH7L 4NP4L 5DFVC 5DMYA 1JTTA 1FGNH 3U7YL 1MCRA 1MJ8L 2P7TB 4XNQB 3A67H 2VXTH 3OKMA 2ED8A 4MQ7B 3LMJL 4P2RA 3SJVD 1H8NA 3QH3A 3GIVA 1UH2A 2F15A 1A6TB 3ARPA 3OR7A 5DDHB 1Q9WB 4PRPB 4QTHA 1CGVA 5DD5H 3FOMA 4TUKL 2DOCA 3P11L 4J8RA 4FFZH 3WNMA 2PTUA 4PGCA 3O45B 3IU3B 1NC4B 4OD3L 4PJFA 2ESVB 2H32A 3MYZA 1J88A 4PV9B 4LHUD 3TNNA 1IQDA 4N0YH 1H3XA 4P2QD 3QEQB 1ETZB 5IEHB 2FL5A 2KL6A 2FWOB 3KLDA 1IM9A 3L1OL 4N8PA 3EO0B 4GKSA 4HHAA 3PDOB 1J0YA 1KV3A 3H9SA 4GXUM 2F19L 2XOTA 4EN3A 3F62A 2QJDA 4RAUA 5INDB 3W5MA 1HSAA 2KZ1B 4K2UH 4LSPH 3BPNB 3C8KB 4DKFH 5FF6A 4MAYC 1IT9H 2XWTA 4UOW1 2AJZA 1LGVA 5IB2B 3ARTA 4BSVB 5L9DH 5E2JA 5C3LD 4JY6B 2HFEB 5FFLA 1ZTXL 4NO2A 2UWEB 5F7LB 2ICES 4RMVA 5E5MA 1HOCB 1ZGLM 1LP9A 4YDIL 2DN7A 2CSPA 3VCLA 1LO5A 5D72H 2IADA 3GMMA 4YHKH 2IANB 3RIAK 1FPTL 3O8XB 2HJKA 4PBVC 5EU5A 3KHOA 3T4YB 4GBXA 4LDOB 4BELD 1JNHA 4YHZL 4M6OH 4LL9A 4NQSB 1ZT1A 5D2NE 3D18A 1J87A 5KW9L 1YEHH 2G5BA 3BWAB 4XP6H 1CFNB 3SDAC 4Z7OF 1NEZA 2X7LA 3MGTB 1EXUA 1JZ5A 4J3VA 5GHWH 4BYHA 4YHIB 5ALBL 1MIML 2HYMA 4MDJA 4Q9QL 1G1YA 1A2YA 1BD2E 5JIHA 5EU6E 5F9AC 2X89A 1WGOA 5GRWA 1TLKA 1X5AA 1UWXH 3MJ8A 1A9BB 4XTRD 4XPAH 3A6BH 2EDLA 2VLJA 2V7HB 2B1HH 3SCMB 4MVBC 3FO0H 2AEWA 3G9AB 4ZFOL 5DURD 3ROLA 5KSAB 5E8NA 1G9MH 3QI9C 1YQVH 4MSWA 3BDYH 3RVUC 4G8GE 2GTWB 1KF9B 1IC4L 1U91A 1R3JA 4LEOB 2BSTB 4OZ4B 1LO2L 1CXHA 3QUYB 4Y8DC 1F4WH 5F97E 2J4WL 4GUPA 2X44D 4QGYA 3UZEA 3EJJX 4JQIL 5FM4A 2UZYB 5T1LA 1KB9K 5CMAB 5EBMB 4HKXA 1NJ9A 4TULL 5F7KC 1DL7L 1BJ1J 1DTUA 4RA0C 3H42H 2D03L 1PX3A 4YFLI 4V1DA 5D8JL 5DRNB 3DYMA 4QOKD 4KROB 5FYJH 2DB8A 3IS0X 5IBTH 3ULSA 1YYML 2IGFL 4KI5C 5CUSL 1KIQA 3HZMA 5ADPH 1RK0B 2IH1B 1G7HA 3EZJB 1R5WB 1FZKB 3W81A 1CF8L 3BRFA 3GSOA 1AQKL 4PBXA 5JPMA 5F7EL 3C5ZB 4HEME 3I85A 3O2DH 3QQNA 4U1JB 3SPVB 1MFDL 1KJ3L 4FQCH 1HHKB 1MPAH 3ARVA 3CU1A 4WO4C 4H1LB 4YXLH 2A9MH 3CFJB 3MLXH 3BVNB 2HKHH 1UXWB 5D5MF 1EHXA 5B8CA 1SJEA 1V05A 2GK0B 1AXTH 2HLFD 4LIQE 2X1QA 4FQJL 4CW1A 2ZKHL 3OKYA 1OB1A 1ZT4B 4JFOA 3DETD 2VZTA 3L5XH 4UMGA 3WLWD 5BRZB 5T5FL 2B8OT 4G9FB 5CKAA 1N0XH 5CJ8A 1KPRB 2BVEA 4Z7UE 5C0BA 3FJTA 4TNVK 3WFHB 5CP7A 2OYPA 5DGQA 1X5FA 1CZ8L 4XCEB 1V5JA 2AABH 2OR8A 2YD3A 4LSTL 5D7KE 4FFYL 1J1XL 2A6JA 3M17A 4L8DB 4K8RH 3HZYB 5EC1B 3SDAA 4ACPA 3SDDD 3ZT5A 4F7TB 3K81A 4JDVA 3S37H 1TVBA 4M6NL 3HZVA 3S3PA 4ZS7L 4KQ4L 2D7TL 5I1AB 3D25B 2EYRA 4PJHF 3STZB 5JXEC 2P5WE 5DUPL 5C71A 3F5WA 4ZFOB 1JHLH 1QUNA 4I18B 4NN6B 1QYGH 5EPMA 1ZHNA 3FHQA 4Q0XL 1RVFH 5DMGD 1S7UA 1OSZA 4DVBA 4BFEA 1MHCA 1OD9A 2AI0H 3MRMA 4PIRF 4NRXA 5CEZL 2D7QA 1V3JA 4MD4B 3D0VB 1Y6NR 2H8PB 2HLAA 2EC9T 1S78D 3T0AA 4IDJH 1FNSL 4PJGA 4JB9H 1VACB 4NFDA 4JANA 2C3HA 4GRWH 1B4JH 4FG6C 1J11A 1KIRB 1A7OH 5E70A 5L88L 1N3NB 4NQCA 2EXYD 4HKBB 1AGDA 1VPOL 1MLCA 4HCRA 5CEYB 2A77L 3BYTA 1ADQL 5KANI 2EKSA 3ALPA 2QSVA 1X4XA 4JHAL 3B8YA 5BS0A 5A40E 2IG2L 3LPFA 1M05A 2R4RH 3BH9A 3PDDA 4YBQC 3GFUA 1MVUA 4G6FB 4M5YL 4IHOA 3R0NA 2AKRB 1JWMA 5IG7A 1FAIL 3V6ZB 1MWAB 2HJFB 1KG0A 4NQTA 4KTEL 4XP9L 1ZHKA 4KHTH 4JFFE 1J8HE 5FYKU 3RQ3A 5FO7B 2HFGL 3HHRB 2B39A 5DJ2B 1ZV5A 3PWVA 3K4DA 3KPRA 4X4ZA 1MCKA 2Y06H 4YEEA 4JDZA 3DBXA 1NLDL 4G8FB 4Z77B 3UPRA 4UINH 4YHMH 1S7TA 5J1AA 2FJHA 3OKKA 1S3KL 4H0GA 4OZFG 2OTWB 2ITDB 1XCQA 3BO8A 1BFVL 2X70A 5DWUL 3ULVL 2PYED 3BRDA 2AXJA 2LFGA 2DRUA 1JI1A 3LKNB 4RGMC 1IGYB 5F9JA 1N7ML 3C87A 3G5YA 4UNVA 1U8PB 4ZUWB 3IJHB 4Z0BL 3S7GA 3DUSB 3C08L 2P7TA 3PV6A 4YXHL 4FTVE 4MQ7A 4OCXH 2OL3B 4LAJH 1I3RA 1F3DH 2NY1D 3BZEA 4KMTL 3MRRB 3SCMC 3FMGH 1JYWA 1S9VB 2DQIL 5FO9B 3VXTA 5KS9A 4H5SB 4XPHL 1A6TA 1HDMB 5INCA 4OGAC 5DDHA 5JXEA 1G7IA 4N0FA 1JYVA 1I1AB 4Y89A 3UJJH 4PJAE 1GZQB 1PX4A 3KDMA 1QHPA 2YXFA 5EWIH 3QUYC 4JO3H 4NNPH 1KB5B 4K9EL 1WWCA 1S9YB 2M2DA 1T1ZA 2O61A 5C09B 1N6QH 3IU3A 4KVCL 4PTUB 3SKOB 1YNLH 2ESVA 3OXRB 1A6AA 5F70A 1CL7H 2EIBA 4L4VE 1X7QA 5FUZH 1JPGA 4UZGA 3G08B 4OIAA 2IPTH 2RIKA 5BVJA 4KROC 4WV1C 4MHHI 1OAYL 4NRYA 3FKUS 2AEQH 3KPMB 3H9YA 3V2AR 3PDOA 1ONQB 2Y1VA 1T5XB 4JREC 2VLRA 4LBEB 1DUYB 5I1DB 3FRUA 3LN4A 1NFIB 2APWA 1R6VA 3GMQB 4OD1L 3HA0A 5BV7C 3NIDE 1OGAD 2P5ED 3MR9B 3LIZL 4GKNA 4FXKA 4PJDA 4L1HA 4AQOA 1YQ2A 2YD1A 4NYLB 4QRSA 3EGSA 2UWEA 4CVXB 4YE4L 3SKMB 2CJUH 4G6JH 2R2BB 1E28A 4RWYL 1HILB 1ZSDB 4PJ8C 3P30H 1FVDA 1XGRB 3AREB 4HUKB 1RUML 1AO7D 2I5YL 3EYQC 2X5PA 1SJHA 1V7NH 2MCPL 4AK1A 1JZ4A 4PJBA 3O11A 2SEBA 5CD5C 3TWCH 5GPRA 3GHEL 1S9XA 5I8EB 2AK4B 2W07A 4HMDA 4YHIA 4D0BA 5IVXB 4HWBL 5GS0L 5IB3A 4UTBH 2P4AB 4NKOB 3MCKB 1VKXA 1GHFL 5IMMB 3JWOH 2YZ8A 1MI5D 1BOGB 2V2WA 5HHVL 3WJLC 1KCUL 4K94H 3HUJF 4NN6C 4G5ZL 3NACH 4ZUUB 5HJ3B 4LMQE 4JY5L 3HCVA 1I1CA 1U8JB 3DXAE 1UJ3A 2R29L 5ELIA 3HTLX 4Q9RH 4HT1H 1WZMA 4GH7B 4HKJB 5DZLA 4Z7NF 4MD5A 4OCLC 4CU7A 4KK8D 2GTWA 4JG0L 4RSVA 4PR5A 5L2KE 3A0OA 5C0AE 1C5CH 4ZO6A 4OZ4A 5C0RL 1KCVL 4RX4A 4I3RH 4RFNB 2VIRB 4WHTA 5FHBL 4QRPE 1MNUL 2GY7B 5KVEL 3O6MH 2KPNA 5CMAA 2P8PA 2ZPKL 5HHMD 1QLFB 4YHNB 1OAKH 3X12A 3L95A 2X1XR 3BZ4B 4U1LB 2W65B 4WV1A 1V3KA 3OAYK 5JR1H 1FO0L 1KBGL 5D70H 5D1QD 5EN2B 2D9QB 2HWZL 3QNZA 4NJ9L 5C07B 2R8SH 5IQ7H 2AJSH 3QA3B 4Y16B 2K9UA 5GZNC 3WFZA 2OP4H 3IAQA 2I9TB 4ONGL 1YUHB 2VRAA 3VFOB 1CFSB 1EEUA 4XVUD 5EH1A 3GSQA 4NUGL 4UOW0 2WUBH 4LLQA 5HPMB 5J6HA 2HMIC 4XCNB 3H7LA 1FJ1B 2APFA 4KDTC 4KRPB 4LEXH 5DJXB 4QTIL 4HQQL 2Q8AL 1I9RL 4YC2C 3DIFA 1I9IH 4LASL 8CGTA 3RDTB 4P4RA 1ZT4A 3EHBC 1F6LL 4PJ8A 1FL6A 3RVXC 2VDLH 4J1UB 5CWSB 5FYKL 1FNFA 4IM8A 5ICZA 5TDOB 3B4NA 5HYSG 1QA9B 2A83B 4PJXB 1FSKC 2X4PB 2VXVL 4NT6A 1K6QL 1HHIB 2YPLA 1JUFA 3HZYA 5DQDL 3LDBB 3H9HB 4IRSC 1NAML 3EZ8A 4RWHA 4NQEA 3UTTB 3VWJD 1W72H 2JJSA 2WZPD 4JFEB 4ODWA 1JZ7A 1DQJA 3KPQB 4FFWC 1MAML 4ZUVA 1U8OA 2AERT 4WJ5A 3TA3D 3WJLA 2Y5EA 3QFDB 2IAMC 4LSSL 1WVZA 1OAQH 4D9QD 4KQ3H 3PWLA 2VQ1B 4KWUA 3SEPA 1JGVH 1FFNB 3MRIA 5MI0C 1K5NA 1FVEB 4K7FA 5F6HJ 4KTYA 1XGQB 4TQEH 1CFVH 5B39B 3ZDXE 2Z4QA 4MLSA 2H8PA 3OJDA 4D0DB 3U79A 4XBEL 1JNLH 2Q6WB 4DGVH 2KH2B 3GRWA 4NBZB 1B6DA 4PJ5D 1VACA 3ZDZF 2I24N 1D9KC 4U1SB 1QLEL 1YYLL 3BKJH 4YAQA 1CDYA 4LVNC 4OF6A 4OGXH 2I25N 2W9DH 5CEYA 3ARRA 3QUZD 1NCWL 5C6WH 4NM8L 1CD1B 4E5XB 3TC9A 1KPUB 3IDJA 4XP4H 2HT4D 3E0GA 5MERA 1FO0B 4HIXH 3GMOA 2AK1H 3QFJD 1KCLA 2GSIB 3LH2L 1EO8L 1CGSL 5E94A 5C0DB 4J6RH 1T66D 2NY3D 3RUGB 1ZVSA 2J1KA 5KVGH 2AKRA 4UNTA 1FFOB 4JM2C 4ISVB 3U83A 1YNKH 3NIFE 5HVHB 3MJ7B 5FKPA 5I8OL 3GI9L 1T2JA 3W2DL 1XF5B 4RIRA 5FO7A 2ZSWA 3SGJA 4YHOL 1U9KA 1F6AB 4X9FA 3TZVD 4EDWL 4ZTOH 1RJCA 3EDKA 2VAAB 1DBKH 3THML 3UTOA 2J5LB 2FB4H 2WMPA 1NGPH 4ELMB 2JIXB 4KDTA 2PTTA 3AREC 2VDPH 5ICXB 4Q58C 4W70A 2EIZA 4G8FA 4Z77A 2YWZA 1U3HD 3GMRA 2A0LC 4K7PL 3TIDA 1ZT7B 1RUAL 5EZLA 3ZKSD 2P24A 4DVRL 3MRKA 4NO5A 1GOHA 4CDHA 2HVKB 4OF7A 2CRIA 4R4FL 1A1OA 1NEUA 1WK0A 1BGXH 4JHWH 3ILQD 5IFHL 1IGYA 1YEDB 1BAFH 4M7LL 3NCJL 3VGGA 3WKNA 1U8PA 3B2VH 3QYCA 4OIIH 4ORZC 4ZUWA 1FE8H 5I8CB 3DUSA 1ZANL 3HAEH 4IRSA 5C0CD 4LVHB 4ZUTA 2V5YA 4L3EB 4YLQT 3QZWA 2MKWA 4HJ0D 5DVOA 5IVZA 1CI5A 2EDKA 1YMMB 1TCRB 5L7XL 4YDKH 3WIIH 2XA8H 5H94B 4KRLB 3DHJA 3JV6A 5K93A 5KSBA 5DK0B 1ZLSL 2YD7A 2IAMA 5TH2A 3QCVL 4ZNCD 1OY3B 5CEZE 1MRFH 4ZTPH 3ZE0F 1NLBH 3DROA 4LSQL 5E2UH 1YZZA 1N0LA 3MRHA 3C6LD 4LLYB 4RFNC 4FHBD 2LU7A 3H0TA 2E8YA 3W11C 3ARGD 1IE5A 4HK0B 1C12B 2VLKD 1EGJA 3E2HC 3X17A 5CFHA 4AMKL 1D9KA 2ADJA 1RQ5A 4KY1L 5F96H 4FZ8L 2VXUL 4K23H 5SWSE 4OQ1A 3T2NL 1ITCA 1YPZA 2VWEC 3C09B 4MGXA 4ZO8A 1BIHA 3EFDH 4GW5B 5JW5B 2CDEA 5F9DC 5IOPB 4GLRI 3KPMA 3BGFC 2FJFB 2Z93A 2BNRD 1QFHA 5BW7A 4Y16C 1KTDB 1F58L 3IFLL 1XGPA 1NFIA 4KGLA 1KSRA 1VFBB 2IQAB 2FLBT 2AV1B 1WIPA 3RBSA 3QBTB 2WNGA 3O6FB 4JM2A 3SDYL 3FFCA 1T4KA 4YDJA 4FP8L 3TV3L 4PB0L 3RHWK 3C60D 5DUBB 2BERA 1QLRA 2XZZA 4PFEA 2W0PA 1MRCH 3G6DL 1I7TB 3RDTC 4HS6A 4DZBB 1QSVA 4WWID 1GC1C 4L4TB 4TVPD 2NXYC 5DT1H 5TE4L 1ZXQA 4A2MA 3CUPB 5ACMA 4PUBL 3GMLB 4LLUB 5DQJB 4Y2DB 4XX1E 2XWJB 4MZ2A 2CK0H 3AREA 4KJQD 2WLYA 3RIAF 5HHQB 1YY9D 4OZGF 4HD9A 1IGTA 2CGRL 5A2LH 4WW1A 4PGEA 2WWMC 1BVZA 3JUYA 3AROA 1GGBL 3ULVE 5GS1B 4ZAKA 1TETL 3FT4B 3LDBC 5D7LD 1ED3B 3EYUL 1P2CB 2Q8BH 2ARJQ 4TSBL 2FLRT 3SQOH 1YN6A 3V5HB 1U8KB 2F8VA 1OP5K 4FQQA 5LWYL 2C1PB 2LAGB 3GSNL 3RNQB 3QNYA 4LRIC 1NGXB 5GGVY 2R39A 4EDXA 4FQ2H 5HJ3A 5I1GH 3QUKB 1WISA 1YY8B 2G5RA 1INEL 4MNQB 4K3JH 3BDXA 5EUOF 5DJZB 5TF0A 5H2BA 2L7JA 1T6VN 2NY2D 4UT7L 4XPGH 5I1HL 3ZTNL 3MXWH 5E8OB 5CILL 3LSOA 5CHNA 4WI9A 2FX9H 3FCTA 3KXFA 4KMLB 2V17L 1KJVB 3RX5A 3VDBA 4D2NA 2PTVA 3UTSB 2QBWA 3NZHH 5IWLC 5IV2B 3QHZH 2YK1L 3M1BB 3RWHA 1VENA 1P5VA 2IF7A 4CU6A 3VH8B 1SBSH 1CLYL 2PXYD 4J23A 1BBJA 2ADIA 4H26A 3V7MA 4XB7A 3DOSA 4QRRD 2XZAL 1CGWA 4F37F 3NCEB 3EO9H 4M7KH 2CIKB 3BMWA 5C07E 4NZUL 1LK3L 3AY4A 4AEIL 1FZJB 4MA1B 3UX9B 3MBED 3DVFA 1ZLWH 2MWCA 3KYNB 2I9TA 1KTKE 3GK8H 1ORSB 5I75B 3EFFB 4Z8FH 1HINH 2J5LC 4LF3B 2YSSB 4NWTL 2EDQA 2OZ4L 2FBOJ 1LDPH 2BNQB 3L3DB 1KN2L 3DX6B 2BSED 1BD2D 3RDTA 5FB8B 5DMIH 1BBDL 3KJ6H 4PY7A 2H2SD 5EU6D 4ZXBD 3O4LB 5DTFA 5TE6H 1S7SA 5C6PB 1DCLA 4J1UA 2FCBA 4NOFA 2CRYA 2YD2A 4TSCL 1P7QA 2YA2A 4U0QB 4ZPVA 5GSRA 1GPOH 1GZPB 1RAMA 4NHUA 3QIWD 4TTDC 3QT2A 4PJXA 4E41B 3RTQA 2NLJA 3BQUB 3OBAA 5A3ID 3QQ9C 4MS8C 4TNVF 3A67L 2MQ0A 4YXKL 2A9NH 4BFBD 3GSNB 2B4CH 4Q97A 5JW4N 4DGYH 2DQEH 4NQDB 4H0HB 3IS1X 1CICD 2CD0A 4LVHC 3O41A 3DI2B 1NMCB 3OL2A 3ARDD 5J8OA 4JFEE 5DC9B 1TJIH 3D87B 4CVUA 3PWUA 4O51A 3X11A 4RGNE 4OLUH 4LRIA 4LCCB 4Q74A 4QYOB 3T0WA 5BQ7B 3QFDA 5SWZA 5DD5L 2R15A 3DX8A 4JM4L 4TSAH 3WDIA 2VQ1A 3CMOL 2LQRA 1FVEA 1MCWM 1LD9B 3O4OB 3DV6A 4CVZA 3B9KD 1NC2D 3LS4L 4WFGE 4D0DA 4WTXA 5BJTA 5LCVL 1WCBB 3BJ91 1NDMB 4QWWC 1Z6JT 1R3LA 3QEHA 3GI8H 4HUXB 1OSPH 1KTLB 4EI5D 1XGUA 4JRXB 4PRBB 4N0RA 4P9MH 4LP4A 3TLRA 1DEEB 4IS6B 4WNQB 4PRIB 3PWJA 2GSIA 1A3RH 4WW2F 3C5SB 5J06A 2EEBA 5IB4B 5JPNB 3RUGE 1AD9B 2EIDA 4EBQH 5F7WC 3O6FC 4WWKD 4X80L 3B2UD 5JO5B 2VTFA 5KZCB 3Q6FA 2AJUH 1WITA 3RGHA 5F88A 3UXFA 5E9DD 1UCTA 3DGCR 2F53D 5D7KD 5D72L 5D7SH 2X4TA 1MLBA 2EO9A 3S5LA 1EZVY 4LLMB 5FYKE 3BD4A 2V9QA 3N1PC 3RZWA 1UA6H 4CDGC 1O5DT 2VZ1A 2UZIH 2FH8A 4GKZB 3K2UL 1A6WL 3G5XA 1CR9H 1T22A 3RY6C 3MYJA 2BY2A 5CINL 1KIPB 3WKMH 4M43H 5T1KB 4PJHB 2PCPB 3IJYA 1S5HA 3MPCA 4NSKA 4WEUD 2DJUA 1XR9A 3V0WH 5EZJB 1BZ7A 4Z78A 5B4MC 2VZ3A 2WW8A 1G9NC 4FABL 3OKOA 3P40A 3FO0L 5I66B 3QUXD 4L3EA 1P9MC 1U41A 5KTEH 3ET9F 1CYGA 1YMME 3MACL 4P2RE 4J3SA 3HG1E 4HPOL 5L2JB 4LSUL 3VFTA 5A2FA 1WBXA 1HYSD 4HLJA 4Y4FA 3Q5OA 5I17A 3B5TA 1OCWH 5JDJA 4QXGL 4AIXA 5BZWB 1PKQB 2R9HC 3T2PA 3MLVL 1XIWB 2LVEA 4L3AA 4N8VG 4HK0A 4CN6A 3DUUA 3UJTL 1ZGLA 2AJ3B 1EHAA 1HKLH 4I0PC 3HMWL 1RI8A 3H42L 1JZ8A 5JA9A 4X99B 3QXUA 4HIEA 5FECA 5IMOB 4NPYB 1UYWH 1QFUH 1J8HD 2BXYA 4JFFD 4PJFE 3MJ9H 3MCG1 3TO2A 4UB0H 5DR5L 5IBTL 4F2MB 1J0KA 3OAZK 2OI9C 5JW5A 12E8L 1IFHH 4S1DD 4LKXA 2ARJA 3RVVD 2E27L 2DBLH 3D9AH 4JFHE 2FJFA 5FOJA 4MA1C 1A6ZB 4JFZL 3QWOA 3O2DL 3PGDB 3WHXB 3IGAB 5IESL 3Q1SL 1NBYB 3TBVB 2A9ML 1DP0A 4RGOH 1IKNA 2HKHL 1EEZA 3CVIL 5HVGB 4WEMB 1N8ZA 1AXTL 2XWBA 3L5WB 1IAOA 5DUBA 4P3DB 4WI5A 3G6AA 1SHMA 2YR3A 4L4TA 3S36H 3CUPA 3QIUB 1A14L 4QRQB 5TE7H 4FTVD 3WCYA 4MXVE 1T1XB 1LP9E 5F9OH 4APQB 3VFPB 2AABL 2QR0A 35C8H 1UQSB 5I16A 1IM3A 1NANI 3U4BH 4WGWB 3QDGB 2DI9A 1WBZB 3RI5K 4L29B 1IQWL 1QO3A 2OR9H 3FT4A 3RWEA 4W4OC 1F8TL 3S96B 4Y4HB 4N90E 3FT2B 5KJRH 1GSMA 4X98B 1HZHH 3NAAH 3DX9B 3EJZD 4GFTB 2FDBP 5ITBL 2DYPD 3O81A 1JHLL 3GKWH 1A3LH 2GK2A 4YWGL 4KGJA 4L4VD 1P9MA 1EO5A 4PGBB 3C9NA 5BCAA 3DVNB 3KR3H 3F7YA 4MNQE 5I1CH 1MH5A 3NABL 5HGHA 1N4XL 1V8HA 3MRQB 3AMLA 4POZD 3LHPH 5DJZA 3O4OC 3U1SH 1H3GA 4IDJL 4PRHB 1M71A 3F6LA 3QQ3B 1IBGH 1JZ6A 4YNYB 4JVUA 1A7OL 4LCWB 4LQ1A 1IC5H 2V2XB 4UQ2B 3UTSA 3RIFK 2FGWH 1INDH 2GTZB 4JPVL 1PJ9A 5IV2A 1SJXA 4I0PA 3EYFA 1OQXA 5IM7A 2K3TA 3GRWL 3RGVC 5CD3A 4M48H 1WSST 2MHAB 4S10A 3U30B 1AIFB 3FQXB 2Q3ZA 1OAZL 2NNAA 4U0RB 3W0WA 4UDUB 3U0PB 4QXUL 1J1OL 2DKMA 1ACYH 2O5YL 1WWBX 3EYSH 2HT2C 4G6AC 1BLNB 2DTSA 4MA3A 1MOEA 3KS0J 1J8KA 4XWGL 1K2DB 4ZFFB 3EFFA 3ALXA 1DDHB 2Y06L 4M1DH 3ECBB 4LNRB 4X4XA 2YUXA 4Z0XA 5E6IC 2UY7A 3NCFB 2BNQE 4YHML 1DBAL 4M4RA 5DFWH 3IXTA 5MEOB 3MA7B 3QHTC 4LAQH 5DJ6B 3WS6C 3O4LE 1Q9KB 1KJ2B 5JTWA 1CGTA 4BFIB 1K4CB 3CDYA 3B3IB 1GZPA 4DZ8A 3NVQA 2D31B 1QACA 4YUEH 4E41E 3DXAD 2FYYA 5B38A 4MJ6B 3CLEH 4MJIA 5J12C 2VKWA 3HUJB 3MLYL 2GITB 3INUH 5IBLC 2W1NA 5L2KD 4NQDA 4W4OA