4K3HA

Immunoglobulin lambda variable domain l5(l89s) fluorogen activationg protein in complex with malachite green
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
QAVVTQEPSVTVSPGGTVILTCGSSTGAVTSGHYANWFQQKPGQAPRALIFETDKKYSWTPGRFSGSLLGAKAALTISDAQPEDEAEYYCSLSDVDGYLFGGGTQLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/inhibitor
molecule keywords Immunoglobulin lambda variable domain L5(L89S)
publication title Malachite Green Mediates Homodimerization of Antibody VL Domains to Form a Fluorescent Ternary Complex with Singular Symmetric Interfaces.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k3hA00
4EI5B 3VXQA 1G9MC 4W70A 1NBZB 3HG1B 4MDJB 5GRUH 1GHFL 1H3UA 1P4IH 5HYQA 4OBSA 4OGYH 2IAND 4JPVH 1C5DA 3K46A 2VIRA 1A3RL 1RURH 5I1AB 3TYFA 3MUY1 2UZXB 4HIJA 3VCLB 5DK2B 5HI4C 1KUMA 3KDMA 5DQJA 2P5EE 3I02A 3QHZL 1WC7B 2VABB 1X4ZA 3TNMB 2NY5C 5HGGS 5DO2C 4HKZA 3NZ8B 4XI5D 5D7KD 3V5HA 4YHLL 2ATPB 2YPKB 4GUPA 1HNGA 1CXKA 1LNUA 1OPGH 2YK1H 2ZOLB 5LAXB 2HFEA 4G6AD 3UTTB 1MSPA 1YMHA 5ETUA 4NCDA 3B5GA 3L3KB 4LCUA 2VLJE 4FABL 1JV5A 3KLSA 3KPRD 3FT3A 4O2CB 3T2NL 1S9KC 3MPCA 2W1NA 5DFTA 2WWMD 3QEHB 3MRQB 2I9LA 1CD8A 2VDQH 2G9HB 2DQGH 1KB5A 1S7WB 3VXRA 1JWUA 1KPVA 2G5BB 4JRXA 5D1XB 5DSCA 3QDGD 1P2CB 5FV1L 4MJ6B 4BZ1L 5DHYA 1TQCB 3FOLB 4YFLF 3TH3T 4K94C 4PJFB 2HG5A 4PYHA 5JOFB 5A3ID 1FVCA 5AG9A 4GG6B 4FFYH 1LO3H 4OZGB 1DN0B 5I1HL 1RUML 4U6HA 1IQDB 2B8OT 4JZNA 4LSSL 3KPSA 2CR3A 1MFDL 5GS1C 3VXME 3QDJD 1VFAB 4RWYH 2WNGA 4XBEL 2AV1B 4G9DB 3RX5A 5LGJB 1QPXA 4K3JH 4K9EC 2HWZL 3WHE1 1LE5A 5EO0A 3CH8A 4XP5L 3BPNB 4Y5XA 1PG7L 1H5BB 1G6RA 4PGZA 3DMMC 3RIFF 4OAWB 1NC2D 1ES0A 4O5LH 5E2WL 1RK1B 2NMSA 3ILPA 4DEPB 4PJ5D 5DMIL 1I7TA 3ARRA 3T0EB 1F00I 3PJSA 2C1PB 3EJJX 4BQBA 1PEWA 5FHAL 2PXYB 4NKIL 5EUOF 5EUOA 5IVOA 3WMSA 4R2GB 3VMPA 4PB9H 4JM2D 4I3RH 5DA0B 4M3KB 3BUTA 4OZ4B 1N64L 4JM4L 3SKOB 3VFWB 1AKJA 4TOYH 1R3LA 4ALAL 4XAWL 5DD5L 3TPUB 2FL5A 4MCZA 2FH6A 2EC9U 5EBMB 1BP3B 2DIJA 5EFIB 3RVTC 1NFIB 3TJHD 4HFUL 2Q86A 3MLTB 4EBQH 3QCTH 2AK1H 4G7YL 3GDBA 2YA0A 4G8IB 4Z76A 5EU6D 1TVHB 2FNBA 5CSGA 4ZFGL 4KQ4L 1J1XL 4OUUB 2J6EH 5F21B 2DJUA 1MFCL 3IT8D 3OF6D 4X6EB 3KPPB 2AXGB 5F88A 3RWHA 3ULUE 1RJYA 5D7IF 2I5YH 5D7IA 5CEXA 1QZ1A 2Z31B 5DJ2B 5ALCL 3S5LG 1N4XL 1DLHA 1X5KA 5GJTH 5KSAD 3ILQD 1A3QA 2ADIA 3CVHH 4Q58C 2OTUB 1HWHB 1EEYA 5MEPB 4F7EB 4ETQB 5FF6A 1XR8B 4LHUG 1HINL 1F4WH 4AIOA 2F54E 2IH1A 3G9VA 3FQTA 2BJML 4C4KT 4PJXB 2IGFH 2Y06H 3QIUB 1L0YA 1PEZA 5DR5L 5FUCC 4LHUB 3MC0A 2Y5TA 3H2WA 5D1QB 2RJMA 2QQNL 2WSKA 3FKUS 3LEXB 2FR4A 2GSIA 1Q1JL 1ZLSH 3MNVB 2ZSWA 2VYRE 4YDJB 4H0HB 1A7QL 5FUCE 4O02L 3TYGH 1OP3K 2H3NB 3OAZK 1KBGL 2L7JA 2OI9B 5CSZB 5IF0A 4J3UA 1MCNA 3I6LE 1DQQB 4QRPA 1RUAL 5GGVH 1GGUA 3L3GB 3ULVH 1OW0A 4Z7VF 4Z7VA 2VLME 3IS1X 1NMAL 3CSGA 1GCFA 4X7DC 2JJSA 4I77H 4TTDC 1F4HA 1IM3B 2VXUH 1BX2A 1UACL 4WEUD 4RIRA 1RZJL 4M6OH 5DD3L 4IJ3B 2Q7YB 3X11A 3DTXB 4PY7B 4D9QE 3QCVH 2KBGA 5FM4A 5HVHB 3S34H 1OAZL 4GKNA 4UU9B 2WWKO 1I8LA 3BHBA 4J7RA 1EGJH 1OAYH 1WEJH 4MQTB 5ILTH 2P43B 2AK4E 4E41B 5FCUH 3UTPD 3VWKC 3O6LH 2E7LC 5IBUG 3P9LA 5C9JA 3F12A 4DCQA 2Z91A 3SKMA 4K7PH 1J1OL 2P5EA 3MNZB 5IQ9B 1RUPL 3DROA 5HHXH 3VWJA 3QUXD 5IBUB 3RWJA 2J12B 2XV6B 3QFJD 4LPWA 2Y7QA 2R23A 2X4NB 4PV8B 1OP5K 1MI5E 4I18C 3V79C 3DJ9A 4NQEE 3VH8G 2COQA 3DIFA 4LLUB 4Z77B 4PP1D 4L8CA 4NBZB 3F58L 3HI6H 5IV2A 2H6PA 3VH8B 2DF3A 3RWDB 5MHSE 1AJ7L 2VXSL 5J12B 5I1JH 4JN1L 4YDLB 4ZFFB 1AC6A 2C3HA 2ZCHL 2E8ZA 3CC5B 4PGJA 4OLWH 2XXCB 4TUJA 3ZDZE 2Q8AH 3BXNB 1B88A 4GMSL 4MJ5A 4RMRA 5IJKC 5J1TC 5DJ0B 1VKXB 4GRWH 4MSWA 4JDTL 1X4YA 5F3HB 5DTFA 1E4KA 2MCG1 3HFMH 3LN5B 2JB5L 4XPBH 1CXEA 1C5CL 5EN2B 1RK0A 2AEIT 4RGMC 5C0DA 2GTZA 2A1WL 3OKLB 1OTSD 1P5UA 4IDJL 4WJ5B 2VN4A 3HLAA 5C08B 2BFVH 3IDMB 1X6LA 5K9JH 3E8UL 3KS0J 5KVDL 5DMYA 1G7HB 3M8OL 5D5MB 1DANU 2XKNA 1KCUL 4NKOA 4UV7H 4ZYKB 1RZJC 2VLLA 1GH7A 3AU1A 4WW2C 3QO1A 1WVZA 5FUZL 1MWAB 3RI5K 1JYNA 4UMGA 1AQKL 1EO8H 2A83A 5IROA 4PRIB 5F7EL 5EU7C 5IG7B 4LGSB 3INUL 1MRDL 3RDTB 4K3DH 3GIVB 4WNQA 2HAZA 1FN4B 2XZQL 4FQLH 4GAYB 5LXGL 1A14H 1WFOA 3E6HB 1R0AH 1JNHA 2X1XR 3HE6C 3W2DH 3OR7B 1B0RB 3SE8H 1AIFB 2R29H 2DQFB 1ZLUH 4KROD 1F45A 5I30L 5C07A 1FO0B 3CNKA 1VGKA 5HYSA 3JZ7A 4JY6B 1FRGH 4MAYA 2IPUK 4HT1H 2FZ3B 3VMNA 1OLLA 3P0YH 3PABB 4RFOH 4LQFH 4RRPA 2F19L 2R1XB 1RU9L 4WUUE 1A1NB 5EC1A 2J4WL 3BP5B 5FYLD 4Z7UE 5JHDB 4J3WA 3G6AB 2IH3A 5DJAB 1NGWA 5B8CC 4LU5L 1J05B 4NC2B 3WXVH 1D7FA 4RZCB 1HI6A 4NQCB 1YEHL 4R4BB 1H0DB 3DYMA 2GTWA 1P7KA 1JNLH 4N90D 4NBXB 2GEEA 4HUWB 5GS2H 2KUTA 5LGHH 3PGCB 4LSPH 2LQRA 1T0NA 1CZ8L 4Z18A 5DD6B 1O7SA 4G6KH 4OGAC 4G3YH 4R90L 2HT4C 2HH0L 3UPRA 3RRQA 5BRZD 4CN4A 4DZBA 1NFDB 3B83A 4XPAL 1B4RA 1YNTA 2X10A 1PDKA 1FIGH 1NCBL 1S5IL 3GMOB 3NMEA 3LMJL 4GW5B 1E4WL 3D2UB 4GRMA 1FDLL 5FECA 1JHKL 1S7XB 3MLYH 5TF0A 3ARGA 4NSKA 2YN5A 4FQIL 3SOBH 4LOUC 3DYPA 4OD3H 4LF3B 5HYJD 3PP4L 4OZHF 3OX8A 4OZHA 1LO5B 3TIEA 3BW9B 1AXTL 3MFFA 1NGZA 3S3PA 2HN7A 4ODXA 4NUJA 1OGTB 4NQSB 2X7LA 1F58L 4K7FA 4RAUA 5ENWA 2AK4A 4EQ2A 3HE7A 3V5DB 5C0IA 4K55A 3MRDB 3BAEH 1EBAA 3VE0A 4UT7H 3CUPA 3O6FC 4NN6C 3TFKC 4ZAKD 3L5WB 2XNAA 1AGEB 1QFHA 1SY6H 5CKGA 1LDPH 3OAYH 4G9FB 4MXVF 2ATKB 3NVQA 1MFNA 1SVZA 3ARBA 3SKUD 4PGCB 2EDNA 3MXWL 1OQOA 3E6FA 1BREA 4S1RL 3PGDB 4R7DB 4WHCA 3MJ8B 1U91A 2VQUA 5JO5A 43C9A 5A16A 5LCVL 3DURA 1QEWA 1MLBB 2V5TA 2VLKD 4Q6IB 3TV3L 5DUPH 3IVKB 1XGTA 5GZOC 1NKRA 1F8TL 3REVA 1F02I 1MEXH 4W4NA 1JPSH 2VDRL 4FQXD 4L9LC 5SWSB 1R24A 2DQEH 4JAMA 1T7WA 3SN6N 2MMXA 3GM8A 4N9GB 4D0DA 4LVHB 3VA6A 3ZDZF 4WEMB 5C0GB 4NNXB 3JWOL 3GRWL 2OQJB 5EPMB 2A38A 3MJ7A 4M1DL 1HILA 5DRWA 5EBWB 2FO4B 5H94B 1F42A 1T1WA 4JDZA 3OAUL 4IBLT 5DRZA 2JB6B 3QUZA 3KWWB 4PV9A 3O4LE 1U8LB 4HAGA 4NQXA 3WFEH 3QG7H 4YWGH 3VXSA 3EYUH 2Z8SA 4YQXH 3T1WA 1EAPA 4WI9A 5F7FA 2RIKA 2WZPD 1ITCA 1FVEA 3L5XL 5IMLB 1A47A 2NY2D 4XXCC 3MBXL 2H8PB 3MO1B 1EEUA 4WCYH 3VG0L 2YRLA 3BP4B 2AS5M 5JXAL 3V6BR 3TBTB 1CLYH 5D70L 3CGTA 4DVBB 3ROOA 1KCVH 1VERA 3FONA 2IAMA 3H9YA 4QHMA 3C60B 4AMKL 1UCTA 4HWEL 4IHOA 3GSOA 1I75A 3ECBA 2QV2A 4PJBE 4PLKD 3MGTB 3RX7A 2AABH 3N85H 4F9PA 4TUKL 4Y4HC 2QR0B 4P0DA 4NQDB 4IRSD 4LKXA 1A6ZB 4U1KA 2BHUA 3RWFA 5AYUL 1RZ7L 3PWLB 4HQQH 3V4UH 5HDQH 4JFEB 4WUUA 1DSFL 2UWEB 5E9DA 4YHOH 2AGJH 5TPWH 2F5BH 4U1SB 3TA3D 1ZHNA 2B4CH 1YN7A 2QADD 2VISA 4KK8D 2FEEI 1ETZA 1MF2H 3ULVF 3CLFH 1A02N 1NGQL 4XVUD 1EHAA 1S7RB 1V8HA 2SEBA 4OF3A 5F96H 4YDKH 2HMIC 4KK9C 1BFSA 5HHOB 4X6FA 1XH3A 3JWOC 5MERB 4JFPA 3RIFK 2IPKB 1I85C 1I8KA 2Z9TA 5I9QC 5DJXA 2QQQA 3LKNA 4L1DA 4Y8DC 4F57H 2DM7A 4LNRA 3FO0L 4NWUL 5SWQA 1B6DA 1BZ9A 3FT2A 5JXEC 1TCRA 3UXFA 3LEVL 1EGJA 4PJ7F 4PJ7A 5F9DC 2KQMA 5D2NB 2YUXA 2IFGA 4UTAL 3D3VB 1D5MB 1KGCE 2J5LB 4FG6C 4HF5H 4U0RB 2X09A 3BPCB 2AAVA 4P5TC 3VFSA 2HJKB 2GYSA 4N0CC 5ADOH 2Y36H 2BNQE 2J2ZA 3ARFB 3V9FA 3I9GH 5JW5B 2GJ6A 3L3HB 3QIWA 4XC3H 3S4SG 3VD7A 1DCLA 1MCCA 1MJJA 2X4UB 3A6OA 4P2QD 3TN0A 3GMQA 4PRHB 5CEZE 2CJUL 4I1NB 2ZG3A 3LQMA 4OCSH 3AS1A 4X80L 4EDXA 4L4TA 4MWFA 3IAQA 4KY1L 1C5BH 3S4SB 1EZVX 2XRAL 4ZD3L 2VLRE 2H26A 4CUCA 1SJEA 2ICWA 4Y5YA 1UH3A 4XMPL 1SJHB 1X9QA 1PG7W 4X4ME 1QLEL 5GHWL 1OARH 5DJCB 5INCA 5FB8A 2I9TA 5CCKH 3OKMA 1X5AA 3UYRL 3E2HC 1KN2L 1XF5B 5HVFB 3W0WD 1T3FA 1YN6A 4GRWF 1FL3B 4QOKB 5IB4A 2FIKA 5DS8B 5BV7B 3MRFA 5HGBA 3MA9L 5HBBA 2HKHL 4P57B 3WFDL 1BVLB 3OPZH 3QEUA 3ZO0A 3O11A 3TIDB 5J7CC 4ODWA 5E8EA 1UWGL 4HS3A 1MFBL 1RUQH 3MRKB 4AENA 2CMRH 5AWNL 4LPCA 3VXUA 4PJGB 1Y0LA 3I3BA 4FFVC 4XCEA 3ARDD 1CFQB 5B4MD 3I6KB 4KKLD 3WO4B 3M17B 4FZ8L 4OD1L 3RZCD 2FSEB 4HCRH 5CP7B 4XC1L 3P4LA 5JA9A 1I1AA 3HNTL 3J8F7 1I4FA 3W9EA 3SJVE 2CDEB 4WUKL 3IETA 2DQHL 3PDGA 1J7VR 5L8LB 3H9HA 3IKCB 5CJBA 3Q6FA 3I75B 3W39A 3TZVD 2DS4A 5MP6L 1YY9D 4XP9H 4ZUTB 5HPMA 4YH6A 3NIGE 3WIHL 3CPLB 4KMTH 4XI5C 3V0VA 3MCKB 1TZHB 3VFMB 1A0QL 4S1QL 1ZEAL 4GMTH 1CGWA 1FV1A 5DC9B 2E7CA 5DRNA 5E6IB 4XMLL 3GB7A 5D7KE 4CVZA 4DKFL 4OFKA 3A6BH 2GHWB 3MV8E 3DVFA 1T0MA 1WBYB 1OGAA 3QCUL 5KOVC 4NJ9L 3BH8B 3WSQH 3CFEB 1YA5A 4XNYL 3QAZB 4YGVA 1RD6A 1ZHKA 3S98A 3B6SB 2WWMC 3GO1H 3NCJH 5C0BA 3MMEB 5SX5K 1NMCB 4X98B 4U1LA 3DHJA 3NA9H 4HKXB 3KPRE 4PJBF 4PJBA 5I16A 1SJXA 1S7TA 4BFGA 5FGSA 4CRPA 4WDIB 5I1EH 1K3IA 4KMQA 1GOGA 5C0FA 2OZ4H 4YDIL 1KB5L 4XTRC 4CDHA 3CU1A 1ZGLM 3HZVB 3MRNB 1BBJA 5JTWA 4PJ9C 1S7UB 2XWTA 2B5IB 1Q9OA 4U1GC 3QDGE 1U95B 4L3EB 4P3CH 3OXSB 5DJYA 4RISL 3QRGH 1GAFL 2BERA 4K3GA 2NY3B 5DUMH 2A6KB 5KS9A 5KS9F 3GSWA 4QRRB 4PTTA 3BP6B 3OJMB 3UJIL 1KIRA 1ZA6A 2CKBA 1J8HD 2DI8A 2P8MA 3MUGB 3O9WD 5JUEL 3DBXB 5FXCH 1WZ1H 3JUYA 3LKPB 4J6RH 3X12B 5I66B 5K9KA 3D0VA 4K2UH 5CGTA 2DN7A 1CE6A 5JZ7C 1IMHC 4YEFA 2JTDA 5DHVB 5C6WH 4QRSB 5IFHL 4D94A 5I15H 2GSGB 2B0SL 4NC1C 2EIZA 1BFVL 5JW4Q 3U0PA 4PJ5E 2FBJL 3K80A 4R7NA 3T8XB 4DN4H 4GAGH 1KFAL 1V5JA 3OWEA 2F53E 3Q3GA 1ZKAA 4KFZC 4YAQB 1DQMH 2IWGA 3PWUA 1SY6A 3TJHC 1SYVA 1FJ1A 4LCCA 5IIEB 4LSVH 4HXAL 3SPVB 1RZKH 1IEAA 2APWA 4ZSOA 3CFKB 3RPIA 2YMXL 4IRZL 2NXYB 1YYLL 3K4ZA 5EU6E 3MZTA 3VFPA 2HJLB 4YK4C 3WFHA 3MODL 4N0FB 2X4TA 5KSAC 1XFPA 3O3BA 2X89D 4K7PX 4ODSL 3VGFA 3BIKB 3DXAB 3FB8B 4JVWA 2WINB 5CLTA 1I9IH 1QSEB 4GG8B 3DV6A 3MUZ1 1FNSH 1QSFD 3BRGC 3SGDI 3ARSA 2B7DT 2H1PL 1JYVA 4MB3A 2WIMA 1W72B 2DI7A 3C5ZD 3WCYA 2ERJB 2FH8A 4JFXB 5TE7L 3K4DA 5IKCA 4CN6A 3TBWB 4FP8H 4APQB 4JY5H 3RWCB 5IT2L 1G1CA 1KNOB 3EYVB 3RGVA 1D5XB 3KJ4B 3TT1H 5JNYA 1QO3B 3G6JB 3QA3B 4TRPL 4B5EA 4K23L 5LWYL 5GZND 1D3CA 3NBNA 4NHCH 4PR5A 1R3JB 3BWAB 1W0YT 2WK2A 3EO1A 4JJHA 3TBYB 3VGBA 2VDNL 5D7JA 3Q5YA 5E5UB 4JKWA 4R4FH 3LKSA 1S9XA 1XCQB 5F9JA 5HGHB 2AJXH 2CLRA 1WJ3A 3QJFB 1P7HL 1HXYB 4TPRH 4PJ8A 3L95A 1JZ5A 3KYKL 5HHMB 3MLZL 2YD6A 2X4OB 5FYKU 2IADB 4U6XA 5CHNA 2UUDH 3SJVA 4S11A 3LDBB 4NZRH 3VRLE 1GXEA 1UCBH 1AO7B 3NFSL 1ITBB 2YUWA 2ESVB 1GGBL 1ODAA 3HC4H 1JPFA 4XHJD 3FQRB 1WQVT 3TBSB 3UTPE 4S10A 5DEFB 3QUXC 5BCAA 1KN4L 5DT1H 3NIGF 4G8GB 2W0PA 1DBBL 2A0LD 2C4XA 4QKXB 1NC4B 4LDLB 3MRJB 3ZDXE 3U7YL 1UXWA 1XF4A 5D2LE 4PP1C 1PZ5A 4L3CA 5K33A 4ZTPH 5CJQH 4LAQL 1B2WL 4EVNB 4MDIB 1KLGA 3MV8A 3HC0B 5FDYA 3VJ6A 4QRQA 1T4KB 1QNZH 3UPAA 5FYLL 3O8XD 5T3XH 3PQYB 5EOCH 1DQJB 4O4YH 2PO6B 1QFOA 3ZT5A 3KPRA 1H3WM 4BJLA 5JMOC 4MLSA 4Z7OF 5JW4N 4I0CC 4HX1B 2H41A 4JPWL 4FFWD 5JDSB 2QSCH 3BUYB 4IOIA 5HGAB 5JW3L 1C8PA 1V7NH 5F7KC 4M8QA 1G0XA 1Z9SA 4PS4L 4I0PB 1JRHL 2DKSA 3BD3A 1HH6A 1OTSC 1U8MA 1XIWB 4X6CF 1CGVA 2BOBA 4X6CA 5KW9H 4HWZA 2XN9B 1R5WA 4RNRA 2ZJSH 3T65A 2A9ML 1OW0C 4DAGH 5TDPB 4Y19D 1C1EH 5GSRA 1WICA 2F5AH 4JFYA 5IB2A 2DYPD 4GAJL 1EBPA 2E6QA 4KV5E 5SWZB 3P4OB 1KTKE 4KH2A 3DECA 1JGEB 5HTSA 5IFAL 4JFFD 2GJZA 4ERSH 3Q2CA 4Q9QH 1FORH 4KK6C 5GRXG 3WIFA 4OCRL 5BW7A 2ICWJ 5KVGH 4NGHL 3P9MA 1OD7A 3UJTH 5GGSA 3F5WB 4D2NA 4Y1AD 1QRND 4Y4KB 2X4RA 4UDUB 4KRPB 3OKEA 2V17H 1YECH 5DC0A 1FGNH 2Y07H 1N6QL 2FDBP 3O6ML 2F53A 4U33A 1N5YL 3VWJC 3IU4L 3T4YB 4XXDA 1HYSC 4FTVD 4L8SB 4M1GL 3LEYH 3R1GH 3IDXH 3REWA 3QQNA 3QXTA 3R06B 5EUKA 4M4PA 3EAKA 4QLRA 5DC4B 4DFIA 5ISZB 4ZUVB 4YHYB 4XX1G 5HJ3A 3D39D 4YBHA 1YEKL 4JY4A 1DEEB 1BBDL 3HS0A 3O0RH 5SV4A 1LEIB 4K8RH 5FA3A 3X14B 3G08A 4F15B 2FX8L 4XNXL 3FB6B 5D7LE 3VGAC 3MV9B 3U36B 4OIIL 4RQQA 5ALBL 2R4RH 5FYJU 2KPNA 2ZSVA 3O3AB 5FYLE 1WWWX 5F70A 4C83B 3VXNB 1KELH 3AM8C 4FQPA 1P4LB 4PJCB 5IHUH 4ODHH 4JO1H 43CAB 1CFTB 1E4KC 2B2XL 2VITB 4HCRA 1GIGL 4JN2A 3IDIA 3PP3K 5GRUL 1S9VA 1P4IL 1TJIH 3LB6D 4LCYA 4JPVL 4BKLB 4ZPTA 3GM0A 3SGDH 4UIKH 3TO4B 4MCYB 1A4KA 4X6DB 2QQLH 5INDA 4EN3B 3BQUD 3IDUA 1A7RL 1F5WA 5IROC 1KPRA 1R5VA 5C0CB 1QG3A 5TF1H 5F1IB 2YK1L 3GMLB 1Q94A 2YXFA 1IGCL 1JPTL 3IXTB 4MA3B 5IEKB 1MUJA 1OTUD 4F37K 2NW3B 3QUYD 3QXAA 2I26N 5FAAA 4JRWA 3Q5OA 4FN0A 5EZOL 3SDAA 4PJAB 2YBRA 1RHHB 3VFVA 1D9KD 2BMKA 3MR9A 3VI4E 1WFNA 1JGLH 2AJYH 3ZKXC 4MAYC 3HZMA 2GAZA 3VXQB 3T2PA 2OZ4A 1ORQA 1IC7L 2VDQL 4Y16A 1U6AH 4RBPH 1U58B 1KTLA 4HZLA 3IFPA 5FGBA 1P9MA 3RL2A 2L7UA 2VIRB 4OLEA 3TYFB 1P84K 4HIJB 1D5BB 3EO0A 4GQPH 4ZFOA 1N6UA 1MHCB 1S5HA 3KXFA 3KDMB 4QGTA 5DQJB 4A6YA 3I02B 4GRLD 4NQUA 3V2AR 2ZNXA 4ODTH 1NEUA 2CLVA 4M3JA 1BVKA 3FQXA 3ARED 4FFYL 2PYEA 4F7PA 4FQXC 3TWCH 3RVUC 5DQ9A 2DWEA 4JB9H 2IF7A 1LNUB 3PXHA 2HYMA 5D7SL 2P45B 3B2UD 3U0TB 1BF8A 2ZUWA 5IB1B 4M62L 1YMHB 1IC5L 3BD4A 4K3JL 4HHAA 4P2CG 5I18H 4P23A 5KSVA 3S37X 2CDGA 4LCUB 4AZ8A 1BQLH 3LQAL 2ZG2A 4YXKH 4O5LL 3WS3A 1AHWC 2VZ1A 4YPJA 4Y88A 5DURB 1ZLUK 3JV5A 2OP4H 3ZKND 4HD9A 2PW1B 1JWUB 1KPVB 2R1WB 4JRXB 2E9BA 3O3DA 2NY2C 2YSSA 1YEDB 4I3RL 2VDOH 1ED3A 3WEXA 2J8UE 2O5ZH 3KHOA 3BKCH 4WFGE 1CR9H 1W8OA 3NACL 1ERNA 4G8FB 1FVCB 3ARGC 5EIIB 4KV5F 2YZ1A 3L3OB 4HUVA 4EBQL 3QCTL 4H8WH 2AK1L 4U6HB 1JHLH 4JZNB 3KPSB 2FB4H 3GGWA 4GBXA 3ZSSA 2E9WA 3MGOA 1JK8A 5C3LD 2J6EL 4QCIA 4Z95L 1N5AA 1DR9A 3HE7C 5C09D 2R69H 3MOAH 4HK0B 1LE5B 1QACA 2JK5A 5EO0B 2LAAA 4KGJA 4Y5XB 2I5YL 5CBEA 4MAUH 1G6RB 3RVXD 3GSRA 5DZNA 3C6LB 3KPMB 1I9RH 4ZUUA 5GJTL 3U79A 1FG2B 3CVHL 2E7BA 3GMPB 4KRLB 1ES0B 4ZO8A 4HPYL 1F4WL 5MI0C 3PHOA 1X5XA 3ILPB 4P9HL 2A2QT 4ZO6A 4IRSC 5ADPL 1IQWH 2DM2A 3ARBC 3F7YB 1I7TB 3P73A 4OLUH 2P24A 3PJSB 5BOPA 3TO2A 1QR1B 2G75A 4OLXH 3VFNB 3D18A 1NLBH 3HPJB 3TVMD 1T7YA 4WVRA 4WO4A 5ITBL 2V7NB 3TA3C 2AEPH 1R3LB 5ICYA 4Y2OA 2FL5B 2RB8A 4MCZB 4DVRL 3TYGL 4J3XA 4ONGH 1UM5H 4LDEB 4NFDA 3D9AH 3FN3A 1H8NA 4OKVA 5D7LA 5HI5D 5DFWH 2Q86B 1KYOJ 1A6UL 1NH6A 5GGVL 4Z76B 1FYTD 3VDAA 3RKDD 4M48H 1HEZA 3LQAC 1HSAB 1Q72L 1IGYA 4X4ZA 3DX7A 2VXUL 3RWHB 3CVIH 4M6OL 5D7IB 5CEXB 3QCVL 1DLHB 1NCCH 4WTXA 2ADIB 1E0OB 1NJ9B 5J89A 3LKOA 3TCLA 3QUZC 4X9IA 1EEYB 1EGJL 4KHXH 5D8JH 1WEJL 5KZCD 1I9EA 4I2XE 5ILTL 2IH1B 3FQTB 3PHSA 5EZJB 5FCUL 2CGRH 1U9KA 3O6LL 1W2KT 1NCAH 4RCAA 2Y5TB 3OAYK 4M6ML 1DBKL 4K7PL 5C0ND 3TM6A 2BY2A 2FR4B 2GSIB 2VB5A 3BZ4A 1EJOH 1LEKA 4GO6B 4NO0A 4PJDB 1KJ2H 1EMTL 5IF0B 1YEFH 4CADA 1IAIM 2YD3A 4P2QE 5IQ7H 5E08H 1FL6B 2IAMC 2CIKA 4QRPB 4PGDA 2VDLL 2EIEA 4P46D 2EC8A 5IBLD 4JKLA 5ID1A 3FFCE 4XWOD 1PW3A 1E27B 4HUUA 5C0EB 3AMKA 4FQJH 5E03A 5C0AD 2D7PA 5I1JL 1BVZA 1BX2B 3EKCA 1NBYA 5J4MA 3MOQA 4P9HC 4RIRB 4N8VG 3X11B 1G7PA 3VI4F 4F9PC 4GKNB 2DOCA 4OLWL 4MXWH 4RMUA 1MCSA 5LQBL 2BZDA 3BHBB 3I2CH 3M45A 3WN5C 1T6WA 1T20B 4N8VB 4U4BA 3W0WE 4PREA 2AJZA 5I8CA 1QYGL 1FNGA 1K3ZA 1FFNA 1P7QA 3HFML 4MMZC 3F12B 5I8OH 1K5NB 2Z91B 2P5EB 4XPBL 4CW1B 1WGOA 2HVJB 1HHGB 4R4ND 1PKOA 3RWJB 2GCYA 3B9KD 3RL1A 3WLWD 5JORA 3ULVC 1PYWB 2J3SA 2C4FU 2BFVL 25C8L 3K7UA 4MQ7A 2D7NA 1RQ5A 4ZFZA 5ECJE 3DIFB 4XBGA 1MWAH 1UXSB 9CGTA 1DQLL 1V3KA 2YPLE 4KKLC 4UV7L 3TT3H 2WIIB 3EYQD 4L8CB 4CJ1A 3HZKB 1CFSA 3RTQA 5IV2B 1EO8L 2VN7A 4OI7A 3RZCC 2VLJB 2FD6H 4AH2A 4BSWA 1K6QH 4TUJB 4FQLL 3GFUA 4MJ5B 1F2XK 3TZVC 1BD2D 4HGMA 1YY9C 3SBWC 3W2DL 4E5XB 3VFGL 1EERB 4CVWA 4ZPVA 1FO0H 1WZLA 1UB5A 4FZEH 4P5KA 3SE8L 3EDEA 4MSWB 3WJLA 3QIWC 1ZXQA 4KVCH 2H32B 35C8H 4KZDH 3QNXA 4PG9A 1FRGL 1RK0B 1QFPA 5EORH 3JTTB 2GTZB 2OR8A 2MQ0A 4HT1L 3P77A 2MOVA 4G7VH 4RFOL 1VA9A 4LEOA 4IRJD 3HLAB 1T2JA 3RVWC 3VXMB 1T66C 3ZE1F 4Y5YC 1IL1A 3MREA 5HI3D 5HY9B 5J3HD 5KTEH 2XKNB 4NKOB 5IEHA 2VLLB 2EDOA 3AU1B 2PTUA 3QO1B 1CF8L 2DQDL 1Q0XH 2BVUA 1EFXD 2I07B 5EWIH 5L8JB 3WXVL 2ICCA 3E3QC 4P4KC 2VL4A 4D0BA 4Q9RL 3QHFH 5FFLA 1N0LA 4WNQB 1NBZA 2YD5A 4FQQA 5D6DC 1JNHB 5HYSG 5LGHL 2D7QA 4LSPL 3GMNA 3VCLA 2N56A 3BGFC 5DK2A 5GRWA 4G6KL 4RRPG 4G3YL 5HYSB 4LSTH 1CLZL 3SO3B 1T7XA 2VABA 3DYOA 2NW2B 3LKQB 1U3HA 3NZ8A 5FO9A 3BSZH 4B50A 1OAQH 4NO2B 5LAXA 4JANA 2UV3A 1VGEL 1ZGLA 3UTTA 3BO8B 3SE9H 2W9EL 2OL3H 4B0MM 3MV7E 3MLYL 4MZ2A 3K3QA 1JYXA 3NCMA 3L3KA 3SOBL 4GLRI 1RHFA 1NGWB 2UY6A 1ZHLA 4O2CA 3BX7C 1OL0A 3FN0L 4I2XA 2GTWB 1Z6JT 1ND0B 2F54B 1ORSA 1P7KB 2W91A 4C55A 2G9HA 1U2CA 2XQBH 3BAEL 3QDHA 3GUTB 2NY1B 2Y6SC 4UT7L 2VDKH 4PRPE 4M4RA 5EZIL 4L1HA 5D1XA 5IOPA 1M1SA 4OSUH 3C8HA 1T0NB 1P2CA 3WBDA 1SY6L 1JGUL 2E8YA 3MLVH 2BCKB 3DRQB 3FOLA 4PJFF 4PJFA 4ZOCA 1JUFA 3UPRB 5JOFA 1T7VA 4OZGA 4OZGF 4P2QA 1TZGL 3MJ9H 3GJFB 4PRBB 3ZHKA 3L7EB 2NTFA 3O2DL 3FFCA 1T89A 5DD1L 3HNVH 1FCGA 3U4AA 4GRMB 1JHTB 5LGJA 1GOFA 5DK0A 1MEXL 1U36A 4NSKB 1JPSL 2DQEL 1H5BA 2ZUYA 3CLEL 2W0LA 4TVPD 5DF0A 2NZ9D 4OAWA 3TIEB 3IDYB 3MFFB 1NGZB 4ODXB 4NUJB 4EI5D 4X7TB 3T3MF 1QSFE 4YXHH 4K7FB 2VH5H 4RAUB 1AXSA 2AK4B 5FHBH 3T0EA 2C1PA 2ZNWA 4KMLB 3LN4A 3VE0B 3CUPB 2PXYA 3FL7A 2XNAB 4OZ4A 3KAAA 4JO3L 4LCWD 1I9JH 5MEQA 3CDFA 3QG7L 4YWGL 4UBDC 1GVIA 4YQXL 3FB5A 3QBTB 5EFIA 3BGMB 3K2MC 1MI5B 4NRYB 1F4YH 2JJUA 4ODVL 2EKSA 4NQEB 1ACYH 4G8IA 1CE1H 2YPLA 5DWUH 4UT6H 1DTUA 1TVHA 3OB0K 2FWOA 3SDXE 1QEWB 4C4KO 1W0WA 3FHQA 5BVPH 2EDTA 4KXZI 1VFOA 5D93C 2MNUA 2X44D 2Z31A 4JZJA 4AYFA 2KQNA 4BZ2L 5AZ2H 4JFHE 4FFZL 4D0DB 2OTUA 5BZDA 1MJ8H 5MEPA 4F7EA 4ETQA 1XR8A 2EEBA 5JMRA 5E6ZA 4TQEL 2A0LC 3QIUA 3ZYZA 3MJ7B 5JR1H 1NAMB 1HILB 4LHUA 4LCCC 2AABL 3N85L 1T1WB 4JDZB 3TESA 2IBBA 2ILLA 5DRZB 4NNYA 1II4E 2FCBA 5GGRY 1CICB 3MNVA 4YDJA 1G7LB 3DRTA 4NQXB 4WGWB 1NEZA 2H3NA 4HS8L 5CSZA 5T1LD 4HQQL 1YQVL 4JHWL 5JPMB 2K7QA 1CDJA 1QBMH 1FVEB 4YHOL 2C3GA 2AGJL 5TPWL 3O8XC 2A6DB 3GBNH 3L3GA 2B4CL 2RAMA 4Y5VA 4J3TA 4MD0A 4LVOC 4FQ2H 3T0XA 2QSTA 4XNMA 4U1JB 1JPGA 3SDDA 4BFEA 5F96L 4YDKL 4FFWC 3RAJH 3ROOB 1UJ3B 3V95A 2FJFA 3DTXA 4PY7A 3SHSA 4QHMB 1NL0L 1RZFH 4NNPH 1I7ZA 3C09C 3LD8C 3Q6GH 4F57L 3S36H 1FG9C 4BQ6A 2XZAH 3QPXH 4M5YL 5BS0E 1FH5H 2H45A 4HK3J 3HR5A 1IEHA 2X4QA 4F9LC 2YR3A 4R2GD 2EYTA 5IQ9A 3GEWB 1IKFL 1IT9H 1KXTB 4HBCL 3RWFB 2X4NA 2NY6C 4WUUB 2OR9L 1KJ2A 4XC3L 5F6IB 4Z77A 1L7TL 1T83A 3EJYD 4M9OA 5E2TH 3U6RA 3MV7A 3M07A 4OCSL 2VISB 4Z7UB 1Y6NR 3RWDA 3X3GL 1IC1A 4QHLA 4NM8H 1WBXA 4JFFE 2SEBB 4ZFFA 5DGRA 3AAZA 3MCG1 4R97C 4X6FB 4JFPB 5EOCJ 1AR1D 5DJXB 3DX8B 3LKNB 2GIYA 4WWKA 5CCKL 3V6ZA 4LNRB 1HIML 4Y1AE 1QRNE 3FT2B 4PRPA 1NDGA 4PD4K 1TCRB 4LLAA 3FTGB 2A9NH 5F3HA 3GSNL 5D1QD 5DRXB 2K1MA 3QEQE 4K3EL 4GLRH 5BV7H 5IFJA 1FZOB 5EN2A 3VFSB 5HVGB 3RA7L 5B21A 2FHBA 2C3XA 3KYAA 4WJ5A 2B4CC 2EDWA 3IDMA 3GJEB 4M7JH 4MNQE 4NOBA 3ZMRA 2NY4B 5C6TH 4FA8A 4CVXA 1MJJB 5D5MF 5D5MA 3TN0B 2MPAH 3GMQB 3QWRD 4OT1H 1CTOA 3MRRA 3H8NA 1RUQL 3QDAA 2R4SH 1MWAA 1KEML 4MWFB 5D1ZB 2O93L 5DFVD 4PLOB 3CZJA 3SGJA 2OK0H 3HI1A 3BPLB 1J0ZA 2H26B 1U3JA 4KJWC 1SJEB 2ICWB 2AQ2A 3EJZC 1F3DJ 5INCB 4UTBH 4I13B 2I9TB 1FN4A 4GAYA 2FEDC 4QTIH 4X9HA 1FFRA 3MLUH 3OKMB 3PIQB 3E6HA 4LARH 4UAOB 4E41D 3C8KA 1Z0MA 2GT9B 2Q1EA 3OR7A 4JZOA 4DKEH 1T3FB 2LU3A 1YDPB 4M7LH 4RGNE 1UM6L 1FO0A 5KANG 3JTSA 4JY6A 1Q0YL 3GSVA 1OOAA 1U42A 2IPTH 4LLVA 4U49A 4LLYA 3CFDA 3PABA 4F7MA 5CBAA 3Q5TA 4LHQB 3QEUB 5TE6H 2X6MA 4CL7A 1FAKT 5I8KH 3RHWK 1A1NA 1YEGL 2WLYA 2B1HH 4HS3B 4AENB 2J8HA 2VERN 3HPLB 4JVPA 3G6AA 1HZHH 2PKDA 1Y0LB 5LG1A 1MCPH 4RSVA 1M7DA 1V3MA 2CRMA 5I1CH 1D9KC 4OLVL 2XOTA 1HKFA 3GK8L 5LGKA 3NA9L 1P53A 4WFFD 2ARWA 4KJPD 1I1AB 4FQHB 5I1EL 2BOCB 2V2WB 3PGCA 5M94B 4CNIB 4KXZH 3BH9A 2UY7A 2AI0H 1A64A 4RX4D 3ZE2E 3I50H 3IETB 3FO1B 3O4LB 1FGVL 4YXLH 1U8IA 3Q6FB 3W39B 2DQCH 3AREC 1FSKC 2CH8A 5FO7A 5HPMB 4KUCF 5C08D 1NFDF 1NFDA 3PV7A 5HHVL 3QRGL 3KPQA 4WY7H 4F7TA 1J9CT 2OCFD 4AEHL 4E42B 5DUML 3VI3E 5DRNB 3ZDYE 3B2UC 3GB7B 2EH7H 4CVZB 5JQ6H 3UZQA 3G5XA 4NN7B 4W4OA 2OL3A 4PRID 4WI6A 5DHVH 3UC0L 5F9OH 2AW2A 1CLOL 3BW9A 1WZ1L 4J6RL 3RDTD 3GBLA 4YGVB 1INEH 4ZUSB 1J18A 1JI1A 5BS0A 1OSZB 1KC5H 4L8DB 3BFOA 1OLZA 4PJBB 5I73B 4PRDB 5I15L 2HRPL 1KTDB 3CJJA 1IGMH 3MRDA 1S7TB 5T1MA 1KULA 5JIKA 1NPUA 2EEDA 4XCFH 4BM7A 2YWZA 5C0FB 3L5WA 1XF2B 4DN4L 1A7NL 2EC9T 2JLLA 4J23A 5HDLA 1BBJB 1DQML 5CJOH 4PGCA 4D9LH 1FE8L 1Q9OB 1Z5LA 4QXGH 3BKYL 4R7DA 3B4NA 3MJ8A 4LRIC 1MLCA 5DJ6B 2V9RA 1RZKL 2DYPA 3ZKSD 1JCKA 5HI4D 2CK2A 2D7TH 3GSWB 4Q6IA 4PTTB 4ZXBA 3MLXH 3AFLA 4PJIE 1KIRB 5JHDD 4JFFA 5FA4A 5FM8A 1ZA6B 2CKBB 4YPGB 3NIFE 2P8MB 3RVXC 4LVNB 2XI9A 4NQCD 5T1KA 2I25N 4N9GA 3D0VB 2E27H 5C09E 1I9IL 1CE6B 3UYPA 2Y4SA 4HLJA 1FNSL 2DLFH 1ROWA 1VFBB 2K9UA 3S8WA 2R8SH 4DTGH 1W72H 4QTHB 1EEQA 1R3IH 1HSBA 3QEQA 5EBWA 2FO4A 1UH2A 5H94A 2YC1B 3JWNC 3TVMC 3U0PB 1IAMA 4UNVA 4X83A 4R7NB 5D96B 1S7SB 1VEOA 1BIIA 3S35X 1U8LA 2BHZA 3CZFB 4YC2B 3U7WH 2BNQB 3PWUB 4JY5L 4MNQA 1PKQE 1SYVB 3RIAF 3HRPA 2AXHA 5CILH 1QKZH 3KR3H 5F3BA 1NSNL 3PHQA 4JQVC 4ZSOB 3RKDC 4JR9H 3TT1L 1JVKA 3D2UD 3MO1A 5DA4A 3RPIB 4KK5D 4CMHB 3BP4A 5M95B 4NHCL 3GMMB 2VLRB 3LY6A 3VFPB 3VG9C 3U9PH 2BNRE 3QRFM 4N1EA 2H2PC 1OHQA 1ONQA 5I0ZA 4TPRL 1BM3L 3DV6B 3WE6B 3CXDH 4F7CA 4ONFH 4KKCD 4LLQA 3S3SA 3AVEA 3THML 4JO2H 4OCXH 5DYOB 4B41A 1OY3B 2VXVH 3WS6A 4GS7B 4L4VE 3J7HA 2ZUSA 4NZRL 4X7EC 4PJEE 1UCBL 3Q1SH 5DQDH 3EYFB 2EH8H 4LDOB 3X17A 4C59B 8CGTA 4NQDA 4X8JB 2PTTB 5DT1L 4G9FD 1RZKC 1X4XA 2VUOA 2KL6A 3MRCB 5GSVA 4R0LB 1U8JA 4JFEA 3VGDA 3LZFH 4M02A 5TQ0H 2UWEF 2UWEA 4GBXC 3RGVB 2WBJB 3V6OE 4M7ZB 5M7QA 1RJZB 4P46C 3MBEA 5IBLC 1DE4A 4U1SA 3SCMA 1LO0L 1VPOH 5JNYB 1EFQA 3U2SA 3U1SL 5ERWA 4OKDA 3DX9A 1VESA 3RVTD 4BELD 4PR5B 1VEPA 5SWSD 1S7RA 2OS7A 4I5BB 5KVFH 1MJUH 1BZ7B 5D7JB 5MERA 5T3XL 3TLRA 5F9JB 1S9XB 3LKSB 3MRPB 4EXPX 2CLRB 4N1CA 5EOCL 4O4YL 4TNWF 4KKBC 2IBZY 4ONHB 4PJ8B 3L95B 1C16B 4OIBA 4YFLI 4RFNB 5C71A 1MCIA 1WV7T 5L88H 4GQ9H 5D2NA 3ZE2F 3SJVB 2VNCA 3D3VA 1L9MA 1MFAH 3AY4C 3DO3A 4WO4C 2LVEA 1JPFB 3CSPA 4ZG1A 4R4NC 4GXVH 3VD4A 3B9KC 3PE9A 5FV2A 3WLWC 5KW9L 1L0QA 1K85A 3CMOH 1Q9KB 2C7UA 3G04A 3L3HA 1DANT 3VI3F 3ZDYF 4UOW0 2NXZB 2X4UA 4DAGL 4KHTL 4Z78A 4L3CB 4P4RA 2F5AL 1X5FA 1KLGB 3MV8B 4XBPA 5AAWA 4QRQB 3LPFA 2O5XH 1AQDA 4UIMB 1KF9B 4Q9QL 4MYWB 4C58B 3MYJA 2W60B 5KVGL 3KPRB 2R2BA 4Y0GA 4P59H 3MYZA 4TTDD 1S7QB 1XF5A 3UJTL 4AT6B 1I3RB 1J1PH 4MJIE 1GZPA 4JCLA 3ZE0E 2EE6A 4OCYL 3BJLA 2V17L 1YECL 4XPHL 1FGNL 5AAMA 2Y07L 2XTJB 4QOKA 1BD2E 3NOIA 3PWNA 4ISVA 3T09A 2WP3T 1RIUH 3KJ6L 4GJTB 5E4EC 1D6EA 3OJVC 2XTLA 1HH6B 3LEYL 3IDXL 3QDGB 1U8MB 2XA8H 4LK4A 3LH2H 5B22A 2BOBB 4HWZB 1G9NL 1R5WB 4RNRB 3RP1A 2DQJL 2JCCE 4PLJD 3TP4A 3KS0H 3WDJA 4PBXA 1CFNA 3GI8H 4F58H 1T03L 4PJIF 4PJIA 4XP1H 5GSRB 3BEWA 2Z93A 1F6FB 4JFYB 1CXFA 3NIFF 4QEGA 4LSRH 2WBKA 4PJGA 4PJGF 2I24N 5HHQB 5HHOD 3GHEH 5I74B 1CFQA 2R4RL 5FYKD 2DAVA 2OYPA 2GJZB 4FXLA 1MCEA 2B1AH 2W0FB 3WIFB 4TVPL 1T5WB 1AE6L 3EDKA 3P9MB 1T2QL 4J4PA 2V5SA 1NC2B 2FSEA 5ESVA 4DUWA 1TJGH 4JO1L 3X13A 1JF1A 1KJ3H 4PJ5B 5LVEA 4Z8FH 2CDEA 4YHMH 2F53B 3PL6A 3IKCA 4XXDB 2FX9H 4ZO9A 4M1CC 3S97C 3ZZ1A 1PKQA 4JM2B 3ARFD 3CPLA 4U3CA 5EUKB 1TZHA 2DQUH 2J88L 2XA3A 1QSVA 5E6IA 4PRHD 1IFHL 1YEIH 4NO3A 3MROA 4JDVB 3S9DB 3HS0B 1X5YA 3RTQC 4EDWH 5FA3B 4XCYA 5EU6B 4H20L 4TNVK 3IU3A 3G08B 2GITA 2BNRA 5TF1L 1WBYA 3WYRA 1MAMH 4D3CH 4BH7A 4RQQB 1XR9B 3BH8A 3CFEA 2ZSVB 2L0DA 3WD5H 2DTSA 3T08A 2R2EA 5B3NA 4HKXA 1KENH 1WIOA 3G6DL 2CXGA 4KI5D 3WKMH 4L4VA 3EOAA 1HHJB 4HWNA 5L0QC 1TJHH 3P11H 4WV1C 5K9QI 4OCWH 1CDCA 3B5HA 1G9NC 2AJYL 2DWDA 4JN2B 1MREH 3IDIB 4U7MA 4G6MH 4NZTH 4AK1A 2EYSA 1U6AL 4F2MA 1AGBB 4NYLA 2MKLC 1S9VB 1PLGH 1U95A 3OXSA 4LCYB 2HKFH 3T77A 3V6OA 1G1YA 4K8RC 4J3VA 2DKMA 2XY2A 3MOBL 2A6KA 1A4KB 1UVQA 1XGQA 4QRRA 4ODTL 1CU4H 3BP6A 3VRIA 3QIBA 3BYTA 3O4OB 1R5VB 3TWCL 4YE4L 1NCNA 1TQBC 1QLFA 4KPHH 4JB9L 3FRPA 1Q94B 1BPVA 2NZ9C 1B90A 3DSFL 3DBXA 3LKPA 4Y4FA 4EI5C 1XZ0A 5DHVA 1VCAA 4QWWD 3QXAB 4H25A 3RY6A 2FBOJ 4LAJH 4M7KH 2AVGA 2VXTH 1A21A 4LLMB 3SDAB 3QI9A 5F1OB 3VFVB 3T8XA 1AY1H 5J1SC 1HH9A 2X40A 3KNBB 4NN5B 2GAZB 3F7VB 1NFKA 4JQXA 1Z3GH 1ORQB 3HCVB 3WKNA 4Y16B 2CLZA 4HC1A 4M03A 1A22B 5GRYA 3PWPE 1KTLB 4HZLB 3IFPB 5GISH 2NX5E 3KLDA 4TVSa 3RL2B 1R3HA 4KTEH 5D2LB 3T0VA 1MCLA 4LCWE 5IIEA 2VDOL 3MLRH 3SPVA 1MCRA 4ZFOB 5FYJD 2O5ZL 4A6YB 5F1SA 3CFKA 2ENYA 4E0RB 2CLVB 2EDJA 1BVKB 3E0GA 4OF5A 1BF2A 2APBA 2I27N 2HJLA 2JIXD 1YYMH 1JHLL 2DWEB 5E99L 1IM9A 3DXAA 3EFFB 3T0WA 3FB8A 4FXKA 1WT5A 1TZIA 3IJYA 4HHAB 4UDTA 4GH7B 4P23B 2R69L 5ACZB 1EEZB 2CDGB 1GOHA 4MJIA 6FABH 4MAUL 3ZE0F 2IALB 1A3LL 2V5YA 3QUKA 4HKJB 5LBSH 5D1XC 1N0XH 3D1MC 3V6FA 5EA0L 5AYQA 1FNLA 1W72A 2BVEA 3BPOB 1TQCC 4JFXA 5CIPH 1IQWL 1ZVHA 4XPGH 5A2FA 3GKWH 3N1GC 1E6OL 4APQA 3AS2A 4LPVA 1DJSA 4L3ED 5AUMB 5F71A 3RWCA 4OLXL 1LO4H 1FNFA 1KNOA 4DGIH 2UZIH 4Q9CA 3TFKD 2P7TB 3QNZA 3EW3B 4OFYD 4MA7L 3G6JF 3G6JA 2BC4A 3WNLA 4ONGL 3QA3A 1MQKL 1UM5L 3BPNC 4MJ4A 1R3JA 4HUVB 5E1AB 1RULH 1H5BC 2DQTH 3TBYA 1B4JH 5C7XL 3SDCA 3CIQA 1F4XH 1JK8B 1EFXA 4DEPC 3IFNH 1HXYA 3B2VH 3T0EC 1HHKB 5GS3A 2JK5B 3CVIL 2X4OA 5CBEB 4KDTA 2PXYC 3GSRB 4ZUUB 4Z7QE 4R2GC 3F7QA 3QH3A 4ZUWA 4MJ2A 2FATH 1I3UA 4KHXL 3U30B 5D8JL 3FQRA 2DKUA 3TBSA 3R0NA 5DEFA 5FK9B 4KROB 2XPGA 4G8GA 4LPUA 2CGRL 4OCLC 2YS4A 5DXWA 3TO2B 1D5ZA 3D18B 5JW4R 3U4EB 1NCDH 2WWKT 4WU5B 3EJYC 3BRDA 4H8WC 1ZWIB 4J3SA 1EJOL 1OB1A 3QISA 4EVNA 4MDIA 4OKVB 3HC0A 2VC2H 5D7LB 2Z31C 5E08L 2PW2B 5B39A 1H15B 3CH1B 5T3ZH 2QL1A 1QSED 1AR1C 5CUSH 3SE3C 5IW3A 2PYFA 4NUGH 1IGYB 3CDGB 1KV3A 3F65A 2ZUQB 3KLAA 3QIUC 1YMMD 2GUOA 4YDVB 3GHBL 5D1QC 3TJEH 4CKVX 3LKOB 4MXWL 2XACC 1PJ9A 4X7FC 4KVNH 7FABL 5F9WB 1T1YB 3I3EA 3RWIB 5I1KH 5IHZB 4HEPG 1ZLWH 1XIWA 2OI9C 5E1HB 5D71H 5I8OL 4PGEA 3SGEI 3NN8B 3L3JA 3U0WH 1WCQA 3BZ4B 5TDPA 2NY7L 4NO0B 1QFWI 5BO1H 3VFUA 3ESUF 2NNAB 2NY5H 5C70A 3MZGB 2XIDA 2ZCKL 3NA4A 4IJ3C 4YHNA 5SWZA 4PGDB 5HVHC 1MWAL 5DVNA 3QUMB 3WJJA 4FNLH 2OXGA 4OLZH 3DVIA 5D72L 3TT3L 2YD8A 1AH1A 3KPOB 4HUUB 5FKPB 1AD9B 5HHMD 4HZAA 5F89B 2FD6L 3ALPA 2G5RA 4Y7MA 1XGYL 4Y4KA 4HH8A 2G60H 1G7PB 1H3PH 1K6QL 4UDUA 1BMGA 3MRMA 3MV11 5IBTH 2V9TA 2ESVD 5DVKA 4KJQD 3T4YA 3B9VA 3PWPA 4ZAKB 4L8SA 3F7PC 4PREB 1UH4A 3ARQA 2AJZB 2NX5A 3R06A 4H5SB 2H32H 1FNGB 1NC4D 1MNUH 4FZEL 4MQXD 4Z7NE 1R3KA 5I19H 1A6AB 3WL9B 3HMXA 4KVCL 3O81A 2R0WH 3NPSB 4FG6D 3SE4A 4KZDL 1SHMA 3WNKA 4LSUH 4P5TD 1SEQH 1F11B 3DUUA 4K94H 4N0CD 4UI2A 1LEIA 3RL1B 4G7VL 5JORB 5I6XB 3X14A 2OJEB 5J12C 1NDMB 4YDLC 4MQ7B 3MV9A 5KBNC 4CMMA 1M4KA 1MJ7H 3PQYD 4N8CH 5KTEL 2FIRT 2N4IA 1EJ6A 4C83A 5A1AA 1CFSB 1FC2D 1FNHA 4KZEH 4KJPC 5FOJA 1Q0XL 1P4LA 2FX7H 3DVNB 4AH2B 4MNHB 2ZUXA 1UFUA 5EWIL 43CAA 3FZUC 2ITCB 1CFTA 2VITA 4Q9BA 1BJ8A 4HV8A 3ROLA 4I0PD 5CINL 3JV6B 5KG9A 1OD9A 3K81A 4ZPVB 2XN9D 4S1SL 1UB5B 4RFEA 4DWHA 1PY9A 4YR6B 1ZHBA 3Q48A 3BIBX 4OF8A 1OP9A 2J8UB 3TO4A 3QNXB 3WFZA 4X5WA 5C08E 2IJ0C 4EN3A 1WWAX 4JFOA 1QP1A 2FHCA 4LEOB 1OAQL 5C0CA 5ITFB 2ARJA 4S2SA 1IL1B 1N3NA 1OAXL 3MREB 3IXTA 4DQOL 3ALWA 1D5IL 5IEKA 3RDTC 3ULUH 5CZVL 1V7MH 2X70A 4FABH 5IEHB 3O2WL 4QF1A 1A1OB 3VD3A 1QFUH 4U3HA 3BIAX 1WIPA 4FFVD 5L9DL 1DVFA 4PJAF 4PJAA 4KRPD 1RHHA 2Q87A 4MD4A 4P2OA 1L7IH 4QY8B 1KLUA 5FIEA 1NMBL 1L6XA 4FQQB 4U6VH 1U58A 4I48A 4BZ1H 3ZKMD 1UWXH 3UEZA 5ISZD 3JVGC 3GMNB 5HXMA 1D5BA 3MLVL 4Q7DA 1MHCA 1NAKH 4QHNB 2ICWI 5I1HH 3OHXA 3R8BB 3HC3L 4MQSB 5F97E 3GJFH 1MFDH 4HBQA 1U3HB 2CXKA 5FO9B 3MJ9L 1HE7A 1IBGL 2QADB 2P4AB 4JANB 2NYYC 5DZLA 1FFOB 3U0TA 3ZKQD 2JJTC 4YX2H 1ZLVH 1ZGLB 4KC3B 3N50A 3HNVL 4XP5H 5IB1A 4WFHD 3NCCB 1JNNH 3MGAA 4XCNB 3N1MC 2FGWL 3P40A 2Z8RA 3LHPH 4OLYL 4QYOA 1DFBL 5E2WH 1ZHLB 3UTSE 1WF5A 5KANI 4D9RD 3KPLB 1HKLL 4I2XB 3H3KA 1ORSB 2VH5L 3MA7B 4K07A 4NKIH 4Z6AT 5IWLC 3BISA 2PW1A 5I1LA 5JIHA 4P9MH 2R1WA 4ALAH 5DD5H 5IOPB 1YEDA 4XTRD 1RUKH 5IP4A 4G7YH 1JUFB 4G8FA 4PJ9D 2X4PA 4PG2C 4KK5C 3KPNA 5EIIA 1F4YL 4W4OC 1JL8A 4P2QB 3L3OA 4AL8H 5KN5B 4KQ4H 3CCHA 1ACYL 3HZYA 2NTFB 4UT6L 3IFLL 4U1IB 3FFCB 4XVSL 1KG0B 5BVPL 3SGEH 1N4XH 3V4VL 4KKCC 1ZA3A 3FFDA 4HK0A 5DK0B 1QFWH 2P42B 4OM1H 4HGKC 2ZWLT 3C6LA 3KPMA 5JHLL 1FG2A 4LIQE 3TGXA 4UNTA 3GMPA 4DN3H 1MJ8L 5JZ7D 1NAMH 1V3JA 5DR5H 3W0WB 2F74B 1Q38A 1AXSB 3F7YA 5CIPA 1Q1JH 1QR1A 1NCWL 3LN4B 3VFNA 4NC0B 3HPJA 1IC4H 3ARZA 4C56E 4TULH 4X5XA 4OF0A 1KBGH 2VQTA 2V7NA 1XGUB 5EO1A 4Q6IC 4JO4H 5MEQB 1MY7A 3BN3B 1RUAH 3FB5B 4ENEC 2VWEC 2EKSB 5GIRB 8FABA 1FZJB 4Y2DA 2YPLB 3GBNL 2N7AA 4LVHC 1KB9J 3QQ9C 4G42A 2FWOB 1ZS8B 5H8DA 3OKKA 1W0WB 1HSAA 1RZJH 2PETA 4HH9A 3IRZA 3ARDB 3IXAB 3L9RA 4MMXC 1WCBB 5FYKL 1IKNC 1OAZH 2ZZUT 1JZ3A 1EHXA 3I84A 3RAJL 4JZJB 1XGRB 1RZFL 4NNPL 1NJ9A 5BZDB 1CVRA 5ACLA 5GGVY 3WV0A 4AEIH 5GS0D 3MRBB 5FOBB 3Q6GL 3S36L 2XZAL 3UAJD 3DNKA 3QPXL 1EDQA 1FH5L 3STZA 1J1OH 5EZJA 3VXRD 2WUCH 1RUPH 4X9GA 1VDGA 4JRXD 1DBML 2DI9A 4HJJL 1HN1A 1NEZG 2YZ8A 4N1HB 4V2CB 3HKFA 4NNYB 1IT9L 1NGPH 3DRTB 4PJDF 4PJDA 1NEZB 1F6LL 3F58H 1FL6A 3JV4B 3C60C 4P3DA 3DX6B 1AJ7H 4JN1H 3FQUA 4Y5VB 1E27A 2OTPA 1N8ZA 4MD0B 3DOSA 2EXWD 4XNMB 3OSKA 5C0EA 1JPGB 3I3DA 4K71B 4NM8L 4ONOA 3MLSL 3SDDB 4JREB 1WBZB 3BZEB 2FJFB 4GMSH 3EZJB 1I7ZB 1HNFA 4P2RE 3ESVF 5HDBE 1T20A 1Y18B 2ZUUA 4N8VA 4DGYH 5IJVA 2CIIA 2EICA 4U0QB 5JOPE 1C5CH 2A9NL 3HR5B 5L2KE 2VKXA 2PN5A 3CSBA 2X4QB 2A1WH 2HRLA 5BV7L 4PLJC 1K5NA 2GK0B 2EYTB 4CW1A 4YUEH 4I3GA 1VFMA 1AKJD 2HVJA 1HHGA 1MHHA 5FGRA 1DQDH 3E8UH 4OD2B 5KVDH 1PYWA 4HLZG 5EIQA 1KCUH 1QA9B 2UZYB 1KJ2B 3WDHA 1TFHA 5FUZH 2H9GA 1UXSA 2M26A 2QBWA 1AQKH 2VTFA 2MPAL 1MIEH 1YZZA 1HCFX 2M1KA 4F8QA 2WIIA 3U6RB 3MV7B 1MCBA 5F7EH 3HZKA 4JFZL 4U3XA 3O9WB 4I4WA 3NPZB 3INUH 3RQ3A 2VLJA 4QHLB 1GRWA 4WU7B 1WBXB 3UTSA 1BEYH 1FZKA 4RA0C 5D2NC 1U8HB 5DMGC 4OB5H 3AAZB 2J5LC 2XG4A 4U0RC 2VUYA 5E56A 1G6VK 1FVDA 2P5WE 4UTBL 4WWKB 1JP5A 3V6ZB 1UEYA 5T5FH 4LARL 4E5XA 3MJGX 5I30H 3ARFC 1CDHA 4PRPB 4DKEL 1NDGB 1QBLL 3AC0A 2HLFD 2VRAA 4JG1L 4X9FA 1U8OA 2AERT 3AS3A 3H9SE 4M7LL 3BKML 4OGZA 2H32A 5FKAA 4NJAH 3M1BA 5IFJB 4JCMA 4HFWB 1ZTXL 2F19H 3RY4A 3JTTA 3BDYH 1CT8A 3CK0H 4OM0L 1N26A 3VFOB 5FYJL 4TYUA 3LQZB 4JRYE 3VXMA 4PRHE 5CP3A 3UTZB 4QRPD 2J4WH 2AQ1A 5HY9A 4CVXB 3ARUA 3KPTA 2HFGH 1BFTA 1CCZA 1YPZE 2GJJA 3MRRB 4NKQB 1YEHH 2WBWB 4KI5C 1SJVA 3HI1B 1A6WH 3V0WH 2I07A 2AXFB 4DFHA 1GJIA 5I1CL 4KTDH 1QSFB 4DK3A 3PNWA 5ACMA 4KK6D 5L8KB 2CSPA 2NR6D 3DMMA 1CDGA 5BV7C 5EU7E 5H35A 3SQOL 1CZ8H 3C8KB 3C5ZB 4JZOB 5E0QA 4R90H 4C56A 2HH0H 4YHIB 4IIQB 3I50L 2P5ED 1KXQE 5FM5O 3JTSB 3P4MB 4YXLL 4XPAH 3VWJD 3GSVB 5GGTL 1HYSD 3UTOA 4LLVB 2NW2A 2DQCL 5KSBE 3LKQA 3OAZH 4LLYB 2HVKA 3CFDB 2I60H 4F7MB 5CBAB 3RZWA 4WY7L 4NO2A 1DDHA 4DKAA 1GSMA 2UVFA 2NLJA 3ARPA 4QXTB 3SDXB 2IMNA 4NWTH 2PR4H 3WO4C 3BO8A 1URLA 4FQIH 2EH7L 3F6IA 3P30H 5BZWA 5JQ6L 3MSPA 3L3DA 4QWWC 1L0XA 3ULUF 2YEZB 2R2CA 2OLDA 5JLZA 2OM5A 1HXMA 2P49B 2ICES 1M7DB 5F9OL 1HHIA 4BK5A 4N5UA 3E1F1 3W81A 4QHKI 1INDH 1ND0A 2F54A 4FMKA 1PZUB 1YNKH 4ZS7H 2FHFA 4HS6A 2FYYB 3F8UB 1T5XA 1IGML 4U1MA 2E3VA 3GUTA 1LGVA 4EUPA 4XCCH 4XCFL 4ZMAT 2WQRA 3BH9B 2H2SC 4OZFH 5E6IC 1ULVA 5IB3A 2XZCH 2RBLA 2BCKA 3DRQA 1EO5A 1U8IB 1A9BB 4S1RH 5CJOL 5FO7B 4QXGL 2ADFL 1GGIH 1OP5H 2J1KA 5FYJE 4Q74A 3KPQB 4FQ1H 3GJFA 4PRBA 4F7TB 3L7EA 5TQ2H 4O58H 3QAZC 1F8TH 2DTMH 2CKBH 4X9BA 2A6JB 5IGXH 1DL7H 3LKRB 5HD8D 1NMCC 1JHTA 2RQ8A 3G5XB 2ZCLH 5DJZB 3QWOA 2OL3B 4LPXA 5BJTB 4MB4A 4WI5A 5GRVK 4IMKC 3O45A 2QTEA 5C9KA 2Z92A 3GRWH 4P2RA 5FDWB 5HDBF 3ZHDA 4X7TA 5BS0B 2MWCA 4X4YA 2DLFL 2R9HD 3DVGA 1VHPA 1U8KA 2B5IC 4DTGL 3CFIC 1W72L 5L2KA 3OAUH 5T1MB 2VL5A 3NH7H 5J56B 1PGRB 1MHEA 2NY3C 5IB5A 5C07D 5ELIA 3IJSB 3AUVA 2R1YA 4MAYD 4NPYB 3VWKA 1LE9A 1Z9LA 5IESL 3BGMA 1Z5LB 1MI5A 3MBXH 4NRYA 5CEZH 1J8KA 2IQ9H 4NQEA 5CILL 3MRGA 1MLCB 4QGYA 2DYPB 2D9QB 4JR9L 5D70H 5CZXC 2IMMA 4HKBA 4WGVB 3BKJL 3QEGL 3P0VH 4ZXBB 1CK0H 3RY6C 4MA1B 1H3TA 4XNQA 4JFFB 5FA4B 3C5JA 4FXGA 4FOMA 3GBML 3U9PL 3RVUD 3ES6A 3OG4B 3SGKC 3QI9C 5T1KB 1NUDA 5GGRA 4M6NL 2P5WA 4YIQB 3FQWA 1BOGA 4EI6A 3CXDL 4Y1AB 3B9EA 1QRNB 5CZKA 4XP6L 5MENE 4JO2L 2NY1D 4OCXL 4TUKH 1NAMA 3BMVA 4JE4B 1HSBB 3QEQB 1M7XA 3H9SA 4MVBD 1MY5A 5IJKA 1DBAH 3Q1SL 5DQDL 3DARA 5AYUH 1CICA 1BIIB 3ZTJH 1BQUA 1G7LA 4OGXL 1I1FA 3VFRA 1WUNT 2NXYC 3PWJB 4BQCA 4JRYA 4MNQB 3I6LD 2A77H 5JPMA 3LZFL 2QSQA 1A5FH 1HQ4A 5F3BB 3PHQB 2VLMD 2A6DA 4AIXA 2HT3C 3IDGA 1YPZF 1YPZA 4AEEA 2E6JA 2VZSA 2LVCA 2RHEA 4NRZA 1PSKL 2MCPL 3ARGD 4U1JA 1KXVC 2DICA 3FJTA 4L5FH 1TVBA 5E5MB 5TFSH 3PUCA 1UJ3A 1MJUL 3T4AA 5KVFL 4WW2F 4WW2A 4EJ1C 5DDHB 1ONQB 2MJWA 1UZ6E 2ERJC 1G7IA 1YMME 4YO0A 3IRPX 4HUXB 1G7QA 4YHKL 4F7CB 2AK4D 4GXUN 1O5DT 3HE7D 4LLQB 4UTAH 4APQC 1AGDB 3ZYOA 3FCTB 5L88L 4GQ9L 2LU7A 4NP4L 1IVLA 1U8QB 2E9IA 4RGNB 1MFAL 3C6SA 4ETYA 5J11B 3HE6A 3IJHA 1JI2A 3LS5H 3KJ4C 5ANME 1OM3H 3FO9B 3ARBD 1RZ8B 2R0LL 3S37H 5I75B 5GSVB 3CMOL 1U8JB 3FHAA 2IG2H 2LTQB 2CJUH 2W65A 1MH5A 3IS0X 4X80H 3RU8H 3UJJH 3BQUB 3MBEB 1DE4B 3SCMB 4M5ZL 4ZD3H 2PTVA 4PBVC 2VO5A 3MCLH 3U2SB 5IVXE 1G0DA 4Z7UF 4Z7UA 5ERWB 5MHSD 3DX9B 1I8MA 1QLEH 1JTOA 1KJMA 5GHWH 4ZDHA 5JW4M 3QUYB 5EB9A 3LDBC 2O5XL 3N0PB 5I8EB 1ZAGA 4ORZC 5D4QA 1KN2H 2Z8WC 3DX8A 3ZHLA 4KJQC 4P59L 5EH1A 1CQYA 1NUGA 3UZVB 1YEJL 2NY0B 1J1PL 5AZEL 4MQXC 3FTGA 4N5EC 3U83A 2BNUA 5T1DH 3VW3H 5DRXA 3ZL4H 2AJ3B 1QVOA 3EOBA 3QUZD 1FZOA 2HKHH 1A6TB 4H88L 1KPUA 5KVEL 3VXSD 4CU8A 2APXA 3LH2L 3MJ6A 5EOQH 2BX5A 2D0FA 3GJEA 2C7UB 3G04B 4GRLB 1MFBH 3WO3B 3TC9A 1X3DA 4YBLB 5AWNH 4Z78B 1TETL 3WHXA 5KOMC 1BZQK 2PO6C 2JELL 4P4RB 4XP1L 2EDEA 5E4IA 5D1ZA 2D03L 1C12B 1HHHA 2FJGB 4LSRL 4MA8L 4XBPB 3JWDH 4AJ0A 4HIXL 1S8DB 2B39A 2IAMD 4FZ8H 4OD1H 1AQDB 4PJHE 3MYJB 4I0PC 3HNTH 2B1AL 1BOYA 1EVTC 4JFDE 5GRVL 2R2BB 3WLBB 3PIQA 1XIWC 1T21A 3L1OL 2GT9A 3H3PH 2DQHH 2LU4A 1GZPB 3DV4B 1YDPA 4Z8FL 5MP6H 4YHML 2KH2B 3PWNB 3WIHH 2EZ0C 3QFDB 4ISVB 3FN9A 1RAMA 1PG7X 1EAJA 2FX9L 3SQBA 1D6EB 1R6VA 3O6FA 4S1QH 4V1DE 1F6AB 2Q3AA 4XWGH 5B3JE 2DQUL 3NGBB 4WUUD 2XICA 5E9DD 1JZ7A 4GW1A 2RR3A 3WJJC 4X0KA 1CFNB 1YEIL 5CJXC 5I1IH 1JFQL 4PJIB 4HPOL 3BEWB 2Z93B 4EDWL 3FAXA 5I0DA 3ULVD 1LD9B 4NJ9H 3HPLA 2P8LB 3FO2B 1UZ8A 3LPGA 1MAML 4D3CL 4Y4KC 2VZUA 4LBEB 1SMAA 4KRPC 4DKDC 4N68A 5C09B 3WD5L 3N1PC 4HJGB 1IEBB 2VZVA 2XYCA 3H0TA 3RNKB 1CFVH 4G8EB 4LNVA 4Z7WE 1KENL 4L8SC 4TSAL 5ESQA 5MENA 5ESVB 3WKML 3ZKMC 2WAHA 4XNUH 2KZ1B 4FQHA 3UDWC 2BOCA 2V2WA 1TJHL 1AR2A 1JTPA 1JF1B 3X13B 4CNIA 4UILH 3MXVL 4YHYC 3BOVA 4OCWL 4U2ZA 1ZLWK 2IC2A 4CAGA 1Q9LA 3FO1A 3O4LA 3PL6B 4RISH 3CXHJ 4G6ML 4NZTL 4ORGB 4RDQF 4PRAA 2IANE 4PY8J 4JPKH 1PKQB 4F15C 1SYSB 1PLGL 2EE9A 1CDBA 2HKFL 2GJ6D 1IRAY 3QIWD 4E42A 3UJIH 2EDXA 3TN0D 3VRJA 4NO3B 3MROB 3V0AC 4L4TD 4BYHA 3VGHA 3AROA 4XCYB 5TE4L 5JUEH 4IDLA 3IDNB 3IU3B 4XXCA 2GITB 2BNRB 3KG5A 3RVWD 1WWBX 1T66D 3BZFB 4L3AA 4BH7B 1UZ6F 4XHQA 2CDFA 3RUGE 2B0SH 2DRUA 4ZUSA 2R2EB 4HXBH 1OSZA 4L8DA 2J8OA 1RZGB 4PRDA 3BJ91 1UA6L 1KTDA 3K1DA 4MNGE 4OFVA 4M7KL 4D9RE 4L4VB 3EOAB 2VXTL 1KFAH 5GS0L 4P4KD 1N59A 3K74B 3TO4C 3NFPA 3OXRB 1XF2A 4OTXL 1AY1L 1YEEH 2ZPKH 5ANMA 1JGDA 1CD0A 2DWDB 1Z3GL 4EN3C 2EYSB 4OZFA 4F2MB 4EEEA 1K2DA 4NYLB 4HXAH 3NTCL 5J0BA 4Y4HA 2YOCA 4A6YH 3T77B 4KTEL 3RWEA 5L6YL 3W11D 1BFOA 1UYWH 5DJ6A 3MLRL 4OFIA 2YMXH 2R15A 1O0VA 1JWMA 1UVQB 2FLBT 1XGQB 3FRPG 3RPKA 3AS0A 3VRIB 5CEYA 2IEPA 1SMOA 3QIBB 4H26B 3V4PH 4ODSH 3VXUD 3QDJE 3W5NA 1YYML 4YPGA 3GI9L 1QLFB 2Q76A 5T5NF 4Y4FB 2MHAB 2PF6A 3BRFA 1XZ0B 1G6RL 2D0GA 3WIIH 4H25B 3HN3A 3O3EA 3OGCA 1FHGA 1VFBA 1BIHA 3GRWA 5ICXB 1OAUH 6FABL 3QXWA 1I1AD 1FAIH 4QTHA 3DPBA 5I71B 1N0XL 2CR6A 1OF2B 3L3IB 2YC1A 3QI9B 5FEBA 4TTGA 3NABH 5IMKB 1S7SA 1HH9B 5JXEA 4N0YL 4HUNB 4HULB 4XPGL 3CZFA 3GKWL 2EDKA 3TCXA 3OTTA 2BNQA 2CLZB 3C8DA 4NC1E 1EVUA 4AQOA 5J57B 1GGCL 2Y6SD 4IOFD 1LO4L 4DGIL 2UZIL 5GJSH 1KTRL 1P4BL 1R3HB 3QYCA 4O00A 3BGAA 4K23H 1FC1A 4URTB 1SBSL 4TSCH 1L9NA 3RVVD 5IVZA 3HNSH 4DW2L 4OBRA 3GMMA 1CG9B 2VLRA 1RULL 1PBYA 3L6FA 5CWSA 3OZ9H 5CJ8A 1OGAD 3RI5F 1B4JL 4X4MA 4I3SL 1F4XL 1IM9B 1AI1L 4FXKB 4JFDA 5C0BD 5CGYC 5GS0C 4G5ZL 4XP4L 1TZIB 3IJYB 3B2VL 3WE6A 3UAJC 4UDTB 4PGBA 3IFOB 4MJIB 5DYOA 1H3GA 1CDYA 3QUKB 4QRUB 5E8DL 3CDCA 3V6FB 4WEBL 1BD2B 3EYFA 2FATL 1DBBH 5GS2D 4Z5RB 4OZIE 3U9UB 3VXRE 4V1DA 4X8JA 2PTTA 3U7YH 5IMOA 2C9AA 1UENA 3MRCA 5JIIA 1JE6A 5TDNB 2R2HB 1E28A 4R0LA 3V5KA 2VJXA 4KQ3L 2JCCB 1Q9WB 2DLGA 2DMCA 2WBJA 2RGSA 3EDFA 3QNZB 1B2WH 1RJZA 2UYLA 4GKZA 5KJRH 1AD0B 4IRJB 1LO2H 4QRTB 3H6JA 2HFFB 1CL7L 2BC4B 2EXWC 4UBDD 1Y6KR 4G80A 5EBLB 5FYLH 5HGDA 1LHZA 4Y5XC 3D85A 5SV3A 1ZLVK 4I5BA 1DP0A 3C6LC 3B5TA 4WFED 1BZ7A 3SDCB 2VDMH 3D25B 3MRPA 5T3ZL 5C0JA 1IAOA 1EFXB 1R5IA 4NUGL 3SDYH 1MVFA 4LKCB 5SX5H 4ONHA 2EDLA 4AG4H 1C16A 5JW3H 3QB7C 3VFTA 1KGCD 1MRFL 3TJEL 1NGXB 2BVPA 4HG4J 1RFDL 3QH3B 4ZUWB 1T80A 5B38G 1EA9C 3HMWH 2GFBB 5F93C 5DHXB 2IANA 5I1KL 1YC7A 1LVEA 2XPGB 5E6YA 3TH2T 5EUOE 3OR6B 4X7SL 5B38B 1Q9KA 5SX4I 5F7HA 1INQA 1D5ZB 2VR4A 5D71L 2QEJA 4LQ1A 2X9YA 5CEZD 3U4BL 4GAJH 3QFJE 1OB1B 4XVTH 2VDPL 5B39G 5EU5B 3V52H 3V7AG 5F7MC 2R0ZH 5IFAH 3QUMH 4OCRH 2WP3O 1T04B 5B39B 2A73B 4NM4L 4OLZL 4PRNB 2W92A 4UIMA 3AB0B 2WMPA 2Q8BH 1XMWA 2XXMB 2PYFB 2W60A 4U7KA 3ZYIA 3MUJA 4LP5A 3B3IA 3ULSA 3KLAB 1S7QA 2GUOB 4G43B 4RMTA 4AT6A 1I3RA 5F7YC 2HLFC 3S88L 3IU4H 1H3PL 4OQTH 4M1GH 3MX0A 5I1GH 5IBTL 1TNMA 1P6FA 3WXWH 3JUZA 1UG9A 5HYEA 2JKXA 3QDGA 4KAQH 4BQ8A 1ZMYA 1MNUL 1YEKH 4LEXL 1BBDH 3ZTNH 1M05A 3RGVD 4PGEB 4LLWA 4YHPA 3L3JB 4LSUL 4Y89A 3DUHA 4XNXH 5MEOA 2JJSC 3VFUB 3QDJA 5ALBH 4DJMA 3KVQA 4M93B 1X5IA 5HHQA 4Z7VE 2NY6D 3HTLX 4YHNB 1GZQA 4WHTA 1MJ7L 1XCTB 4NZUH 1BQHB 1I8LC 2W0FA 4KZEL 1F3DH 1T5WA 2ICEA 2NR6C 4PJ8D 5E24E 3TH4T 2XQYK 1NC2A 3ARVA 2FX7L 4YZFE 3QDMD 3RKPA 3SJVD 1WSST 4PJ5A 2BSTB 3GMRB 3MRMB 5F7DA 5KSUB 4HAFA 4X5LA 4RMWA 3PWPB 1A7PH 2NX5B 4JM2F 4JM2A 3WIHA 2EIDA 2QHRL 2RCSH 1R3KB 1CI5A 32C2A 4LCWB 3LS4H 2NXZD 1A7RH 2ED7A 1DUYB 3EO9L 4JDVA 3DUUB 3L7FA 3CMGA 2EDBA 3GSQB 1IGCH 5EU6A 1JPTH 3MV8D 4XPFL 4L9DA 4LRNL 4LMQE 3UBXA 2C1OB 4CMMB 3OF6A 1XR9A 3ULUL 1V7ML 3QNYA 5EZOH 2D0HA 2C26A 3WNOA 4HGWA 1S78C 5BMFH 5KSAA 2Y1VA 1QFUL 3P9WB 3KGRA 1H3VA 1HHJA 2EYRA 4KJWD 1NUFA 2IQAB 1WWCA 1IC7H 3EJZD 4HV8B 4Q2ZB 2XTJD 5DVLA 3ROLB 2CUMA 4N90E 4U7SA 4OZIA 4OZIF 4EXKA 3QR2A 2X9WA 2A6IB 1J87A 1L7IL 4O2EA 2FEDD 3BDBA 4U6VL 1AGBA 5KG9B 4OGYL 3C08H 4RFEB 4WHYG 2OJZH 5C86A 4R3SA 1RURL 1ZHBB 3KYNB 1J0KA 1NAKL 3QZWA 5T1LB 5BRZE 1U3YA 4X5WB 5HD8C 3FB7B 3VXPB 1YNLH 2GY7B 5D7SH 1LK3H 4JFOB 4R9HA 2V2TA 2HTLD 4UOW1 3ARYA 4M62H 1IC5H 1OPGL 2ARJB 4S2SB 1I3VA 1N3NB 1P1ZA 1KLFA 1B0GB 4YX2L 2YD9A 3MLWH 2X70B 5E2VH 1JNNL 3LQAH 4QF1B 2VR5A 5HYJE 2R9HC 1AC0A 2X05A 1JIBA 3LHPL 2IBZX 5I1DA 1DVFB 4LLMA 3VRLF 2BRRH 3SO3C 2F53D 3KNBA 3F7VA 5ID0A 4MD4B 2HLAA 4P2OB 3HCVA 1KLUB 2DQGL 3IF1A 1TLKA 4I48B 3ZDXF 1FYHB 4P9ML 5C07E 1A7BA 3V8OA 4TSBH 3NACH 5D2LA 5D2LF 1TPXB 3QUXA 3SKNA 2APTA 2X42A 2Y9RT 1UQSA 1RUKL 3QFJA 2E7HA 1AFVH 1EIBA 3OHXB 5BQ7B 2DLIA 4E0RA 1MCJA 4H1LA 2LE9A 3ULUC 4J2XA 1LO3L 4AL8L 3U46A 4HJ0C 3ETBF 4Z95H 3I6GB 4F3FA 2VLKE 4RWYL 5C2BH 1P6AB 3LSOA 5SX4H 3LPWA 3EFFA 3QULA 4MX7A 1U2HA 4DOHE 1MHPH 5IMMB 4RAHA 5ACZA 1EEZA 1QFWL 3DGCR 2NY1C 4HPYH 2IALA 4OM1L 4QYOB 4HKJA 4P9HH 4HWBH 4MVBC 5ADPH 3ARWA 3S5LB 4MXQD 4DN3L 1BWMA 2EDRA 2CRZA 1NAML 3QQ3A 5ITBH 5I1LB 5AUMA 1A4JB 5J1AA 4UQ2A 3EFDH 1IC4L 4DVRH 2P7TA 4PB9L 4TULL 4TOYL 4UINH 2XFXA 4JO4L 1TNNA 3DETC 4HDIA 1A6UH 1DUZB 2X4PB 3KPNB 1SEBA 2BVOB 4BFBD 4S0SD 3RGHA 4A2LA 5E1AA 3QG6A 3CCHB 3HZYB 1Q72H 5DI8A 3IDYC 4JLRA 1TIUA 2ZUVA 2EXYC 1ZA3B 2D7MA 2OMBA 3FFDB 4OZHE 4YZFF 1HHKA 5J13B 4OF6A 5J6HB 3SDAD 1K8DA 1J0IA 5CS7A 1VFUA 4AEIL 4WIQA 4CBPA 1G7MA 4Y16D 5HHPB 3PP3H 5FK9A 3IKKA 4M6MH 1DBKH 2WUCL 1XGPA 2IGFL 1I8IB 1A9EA 2Y06L 3DGGA 2AJUH 4XGZB 1KACB 5CIPB 3U4EA 4OJFH 1AGCA 4WU5A 1FIEA 1LWRA 3KXFD 4MXVE 4X5XB 1EMTH 1ZLSL 1ZWIA 1NGPL 5EO1B 1OAKH 3BMWA 1XF3B 1MCOH 2NPLX 4MD5A 2CKNA 3K1KC 2PYED 2VDLH 4XVJH 1TTUA 3BVNB 4B53A 1ZT4A 1EUUA 2PW2A 8FABB 3SKJH 4Y2DB 1H15A 4YBQD 3ULVL 3CH1A 3CFBB 4XNZB 4G42B 4PP2B 3W82A 3OKKB 2A74B 4HH9B 1UKTA 1G0YR 4I77L 2QKIB 3L9RB 4P23D 3CDGA 4UNUA 3HI5H 5LQBH 1Z9MA 4YDVA 2Y23A 3V7MA 1CYGA 3S34L 2H2PD 1T1XA 1QYGH 3AM8A 2OSLA 2P1YA 4RGOH 1CICC 2YN3A 3RJQB 1OAYL 1OCWH 4L8BB 1BLNB 1T1YA 4DGYL 3RWIA 1A8JH 3CFJA 5IHZA 3STZB 2NCMA 1I1YB 4PB0H 5F9AC 2FECL 4YUEL 3NN8A 3VXSE 5BRZA 4D0CB 1VEMA 5HHXL 2EDFA 25C8H 2AQ3A 5GRJH 3LRGA 1DQDL 1IILE 2NNAA 2N1KA 1DQLH 2X4SB 3O2VH 4HLZH 2CO7B 1UJ3C 1JWSB 1NCTA 4GBXD 1KIQA 1C7TA 5C92A 3QUMA 1MIEL 4P3DB 1FL5A 2C3VA 2OX5A 1HOCB 3NCBB 3FQUB 3S35H 5HYJA 3KPOA 3VXOB 1N8ZB 3F62A 1A7OH 3HI6L 2F58H 2X9XA 2HTKD 5FKPA 5C2UB 1AD9A 4WI7A 4AIZA 1CD9B 4L4JA 3CX5J 5F89A 1GGTA 1BEYL 5I76A 3F7RA 4OB5L 3MV01 4S1DC 4ZNCD 3VFGH 2Q8AL 4WI4A 1QHPA 4KKBD 2HA1A 4M61A 4OQTA 4ZAKA 5T5FL 5IJVB 2CIIB 2OTWA 5DLMH 2YRZA 3CDYA 4H5SA 1UT9A 4KRNA 3W9DA 1A6AA 5F6IC 3WL9A 3B8YA 4BFIB 4NJAL 4WO4D 5K9QG 3H7LA 4M00A 4BH8A 1F11A 1MHHB 2IBGA 3BDYL 4QHKJ 1KYOK 3CK0L 3LAFA 2JF1A 4MZ3A 4F33B 4HUMB 1J0YA 5E9DE 1CFBA 2BVYA 2OJEA 5D7LD 1NDMA 3ORJA 1WZKA 5K9JL 2VLKA 4WHDA 2H9GB 1CF8H 1YJDH 2BRQA 2DQDH 2GKIA 3ULVE 2HFGL 3BEVB 4NCC1 4FQXA 3PDOA 5CD5C 3O41A 4I4WB 3WUWA 2Q3ZA 3DVNA 1A6WL 2DM3A 3NCFB 4MNHA 4U6TA 3UTSB 3V0WL 1FZKB 5IW1A 3VD9A 4Q9RH 5FO8A 2ITCA 1PX3A 4KTDL 4K3DL 4LFHG 1FVDB 4PJ7E 3JV6A 1A14L 1R0AL 3UTQB 4MLIA 4NQVA 3TF7C 1CLZH 1BHGA 1AHWA 2R29L 4YR6A 2NY4C 1U8OB 4POZC 4CVUA 1OSPH 3C2AH 2J8UF 2J8UA 5HSFA 3TN0C 4BSVA 4XB8A 5FKAB 3M1BB 1A6VH 3H42H 4NO0D 1CT8B 5T33H 5D1ZC 2GJ6E 1WFUA 4U05A 5JPNA 1VGEH 2I60L 3P0YL 4LASH 1HQRB 4LQFL 3GIZH 4O51A 3BPLC 5ITFA 2W9EH 3N1FC 1JN6B 2VZ3A 2FGZA 1ZE3C 4NWTL 4L4TE 1IAII 2PR4L 3OKYA 4UV4H 3VU2A 4NZJA 4LL9A 3CX5K 3P30L 3FMGH 1A1OA 5T3XD 5GS1B 1F3RB 4UAOC 1CVSC 4O2FA 3FN0H 5E2UH 3QO0A 4YHZH 5F8QC 1A6PA 2AKRB 2PCPA 1LILA 4P49A 5E00B 1INDL 3PNWB 4FMFA 1JNLL 4WRLA 1YNKL 5EZIH 4ZS7L 4QY8A 3DMMB 5H35B 2KKQA 2Z8VC 3E3QE 4LP4A 4GRWE 4A2MA 1JGUH 4XCCL 1UWEH 1P7QD 3WFCH 4IRSA 3W11C 4C56B 2XZCL 3WDIA 4QHNA 1HCVA 1TZGH