4K3HA

Immunoglobulin lambda variable domain l5(l89s) fluorogen activationg protein in complex with malachite green
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
QAVVTQEPSVTVSPGGTVILTCGSSTGAVTSGHYANWFQQKPGQAPRALIFETDKKYSWTPGRFSGSLLGAKAALTISDAQPEDEAEYYCSLSDVDGYLFGGGTQLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin lambda variable domain L5(L89S)
publication title Malachite Green Mediates Homodimerization of Antibody VL Domains to Form a Fluorescent Ternary Complex with Singular Symmetric Interfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/inhibitor
total genus 24
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k3hA00
1MCPH 3MFFA 4K8RH 4YUEH 4CADA 1MRFL 5EOQL 1JGUH 3O4OC 5D1XD 5AZEH 2XQBL 1LEIA 1AO7A 1M7XA 3VXTA 3GRWA 3SEPA 3U7YH 2DLIA 1R3IH 4RMUA 5SWQB 1XEDA 4MSWB 1Q0XL 2N56A 4LBEB 1BZ7A 5GGRB 4JFED 4L4VB 3ARBA 1IEHA 5E8EB 3N1MC 3G5YB 5F7DB 5C09E 4X6CA 4BZ1L 4FRWA 3GMRB 3EOTL 1NLBH 1N5YH 2BVOA 3C60A 1SM3H 1VB9A 3FQWB 3DXAB 3NPSB 4X6DF 1IT9L 2VR5A 2FB4L 3SQOH 3SKUD 4GG6A 1NKRA 5ITFA 1GZQA 2AJVH 2GUOB 4BK5A 5IG7A 4EDXA 3B9AA 1N5AA 3DX6B 4E0RA 3CFKA 1BFOB 3QUYC 4K7PL 4NJ9L 5DQJB 1QO3B 2DBJA 3V8OA 3W9DB 2W65B 2DI9A 4PJGF 1N0XL 3TPUA 4LLYB 1WFNA 3QCTL 1CBVH 4F7PA 3BD4A 4XXDA 1KPUB 1A7QH 5IMOB 3MJGX 2HJFA 2V5MA 1YQ2A 4M62L 2IQ9L 3B5HA 3LVEA 2CDFB 3G6DH 1VSCA 2YK1L 4ZTOL 1KCVH 3OMZA 2ORBH 5C9JA 3TH3T 2A6KB 3PV7A 2GSGA 4WGVB 5E2UL 2DL2A 4MJ5B 4XGZA 4ELME 1T1XB 4CGTA 1JN6B 3P9WB 2A6JB 4FTVD 3G9AB 1L9MA 2FX7L 2PN5A 3DYOA 5GRWA 1IL1A 3BRGC 2DQGH 5HPMA 4OD3L 4LHUG 4YE4H 1A1NA 3QJFA 3FQRA 4D9LL 2AAVA 2NY0B 2VQTA 3C5ZC 5JXEA 3MBEB 4EI6A 3FCTB 3LEXA 2VXUH 4HT1H 4PY7A 1KLGB 1NCTA 1G7HB 2R2BA 3R1GL 2P1YA 3B3IB 4UQ3A 5M95B 4JY6A 2P46B 3IGAB 1FLRL 4XPBH 5HXMA 4GW4B 1YEEH 1TNNA 4Z7VB 5JDJA 4RISH 4EBQH 1CQYA 2E27L 4NQEB 1ITBB 5KW9L 3U0PB 2KL6A 5TE6L 1H15A 4HK3N 5EDXA 2YRLA 3OX8A 3BQUC 3O0RH 4FP8H 2R1WA 4JZJA 2DDQL 2P5EB 3WL9A 4Z77B 4X7TB 1JMZA 2XN9E 4HH8A 2V2WB 1AHWA 1EDQA 2VDQL 4XAWH 3QR2A 4PYHA 1I85A 1PG7L 4KKAD 1TJHL 1EV2E 3PDOA 3VFMA 5FGCB 1H0DA 2Q7YB 4X6CF 1XGTB 1KLFA 2YN3A 1S7RB 3QRGH 3GMMA 5C0JB 2ED7A 4EOWH 1S5IL 3ULSB 4ZAKD 4YPGB 4TUKH 1ZANH 3ZKMD 3AU1B 1UH3A 4HPYH 3QXVA 4ONHB 5GGVL 4JO1L 3KLAB 4OIBA 4LQFL 2AABL 4YFEA 2Z4QA 3QO0B 2ITDA 1J7VR 2VDML 3HZMB 3FZUD 5DJ0B 4WY7L 1I1YA 2FEDD 5FYJD 3P0VL 2PR4H 2AV1A 1QLEH 4FG6C 4PJ5D 3ORJA 4L3AA 4DWHA 1VFUA 1JZ6A 1WEJL 3M1BA 5HGAB 2GSIB 3U48A 5FOJA 3WDHA 1E6OL 3ARSA 5IF0B 1NMCC 4LPCA 4N0YH 3TESA 3F8UB 2WWKT 1KXVC 3QUZC 3TZVB 3BKJH 1KNOA 3F6LA 2CO7B 4R8WH 2BVUA 2AJYL 2DIJA 1X5YA 3JV0A 1VFAA 4HEME 1U93A 1JHTA 1MCOL 3P9MA 4JEGB 3V4VH 4QXGH 5CP7A 4X4YA 4Y1AB 3PGCB 1U8QB 4GO6B 4QEGA 1QKZL 2QSTA 3L3IB 2R1XB 3HE6C 4EUPG 5DJYA 2CR3A 3ROOB 2I27N 3EDEA 4M03A 5ISZA 4I4WA 3X14B 1I8IB 4U7SA 1WFOA 3TIEA 3LB6D 5FXCH 4N8VG 1F5WA 3V5DA 5CBEA 4OCNC 4HZLA 1QFWM 4M5ZL 3WHE0 3KVQA 2BOCA 3DBXB 4KDVA 2C4FU 4JHBA 1UXSB 4NFBA 5I75C 4X7FC 2XT1B 3OB8A 1U6AH 3T4YA 5I17A 2NZIA 4MD5B 5F1IB 4F7MA 1NCCL 2X2YA 5D1QD 5BJTB 3IFLH 4UDUA 4ZD3L 1A22B 4DGVL 4RGMB 2J8OA 5IM7B 4HJ0D 3FTGA 4KJYA 3QIBA 2EDXA 5GGSY 2XQYG 3U7WH 4EN3C 2GFBB 4NNPH 1KJ2H 2P45B 3I3EA 5DK2B 3VFGH 5C6TL 4IMLA 4OTXH 4JG0H 4PJCE 4MXWL 4UIKH 4LSSL 4ZPVB 4OZGF 1ORSB 1MIEH 4L3CB 4QGYA 2VQUA 1EO5A 3B2VH 5GRVK 2E6QA 3EFFA 3BPLB 5F7EL 1A1MA 2Z91B 5IIEA 3SKMA 1HE7A 4HUVA 4KRNA 4QYOB 3OKDA 5L6YH 4B5EA 3C5JA 1M71B 3SDXE 4PRBA 1CXHA 1CICA 2J8HA 3NIGF 1I9RL 2QTEA 3IFNH 2OK0L 2O5YL 1G84A 4NCC2 1RZFH 4IRJD 1BX2A 3BIAX 1BIIA 1M05B 3ZLQC 2A0LC 1QBML 2C3VA 1G9EA 1JPFB 5CMAA 4DK3A 1P6FA 4KROB 4KV5E 1P4LB 3S35L 5ESQB 3UTZB 1HIMH 1CI5A 1L0XA 1S9VA 2RIKA 2D0FA 2FSEA 1YZZA 2X42A 3KDMA 5F1SA 4HWEH 4EEEA 4X98A 4H1LG 2JE8A 4PY8J 5KZCD 4PJEB 2UZYB 3GSQA 2HKFL 3OSKA 5AYQA 5IW6B 1DLFL 5ACMA 4OFIA 3OAYH 4OF0A 5E2TL 2NZ9C 3PQYB 5AZ2L 3F7YB 3S8WA 4XB8A 2A77L 5I66B 5I1GL 5ADPH 4Z5RA 4EI5B 3GGWB 3T2QA 3DI2B 2MOVA 4M6NH 1KJMA 4NRZB 1Y6MR 1CD1A 1FN4B 4MGXA 4NQCD 4DFIA 4XI5C 3MRNA 4Q2ZB 3T0EB 4JFDD 2BSTA 3EYSH 3O6LH 1BJ1H 4MNQA 3GM0A 4HXBL 3I2CH 3VG0L 5J1SC 2DOCA 4PJDE 2EH7L 2VAAB 3K81A 4L9LB 1F58H 1QYGH 1JIBA 1AXTH 1Z3GH 1T7XA 2VABB 4OV6F 4HK0B 4ZFOA 1T21A 1DBJH 4PJIF 3VFRB 5F7UA 5TE4H 5F93C 5EU7E 1OWWA 2RBLA 1DVFA 4KJQD 3VXSA 5LVEA 2EXWD 3U9UA 3PDDA 1J8HE 4OFVA 4JPVL 2DKSA 1TZIB 3GI9L 2APXA 4Z7UE 4XMLH 5CUSL 5BVJA 3MLXH 1ES0A 5KVDH 4XXCA 2PTVA 3E6HA 4G7VH 1NEZG 1BBJB 4MNGA 1BM3H 2EECA 5L2KB 2CPCA 2QJDA 4PRIB 2VB5A 3CC5A 4XCNB 1H3PH 4NHUB 3MGTA 2X4TA 3NFPA 4PJ8A 4E9LA 3KYAA 3NAAH 5GZND 1XR9A 3QAZC 3D48R 5I2IB 5DYOA 4LHUA 4LRNL 2J4WL 3T4AA 4KHXH 3RDTA 3JWOH 4Z0XB 5E6YA 1MCKA 2CLZB 3QWRA 2YWYA 2JCCE 3DROA 3S36X 4PJ9B 1M7DA 1XMWA 4P0DA 2A9NH 1HKLL 4Z7NE 3QIWC 3IDMB 2XKNA 4POZC 4PGJA 1MCSA 3SCMB 3W2DL 4G9DA 3EOYG 3D25A 5D6DC 4OCLC 4M9PA 1P4IL 4JAMA 4MCYB 3QEGL 2R2HA 1OGTB 2AJUL 5AD0A 3VRJA 3RWGB 1DQDH 1UWGH 1WBZA 4GRWF 3ZDYE 1K3ZA 5I15H 3DV4A 3MA9H 4JFOA 2W0PA 1G6RA 1MI5A 2IEPA 3VDCA 5A3IC 4LSRH 5FKPB 4PY8I 4XPAL 1IGYA 2DL9A 2E6PA 4JZNB 1KTDB 3BFOA 4HDIA 3SDYH 5F89B 3QEQD 5GS0C 4S11A 3RVXC 3OF6A 1HQ4B 3O45A 3HPLA 5AWNL 4PBVC 3BUYB 5DC0A 2ICEB 2ED8A 4P5TC 4P9ML 1G9NC 2IALB 1TITA 4J3VA 4RMRA 5D7JA 4FQIL 1MJJB 5EBLB 3RIFF 1SY6H 2YUWA 3DRQB 4IDJH 2HWZH 3B6SA 3KXFB 4NN7C 5HY9B 1MCNA 4LCUA 1OY3B 4YHLL 2Y7QB 3VGDA 1L7TH 3ARGD 1PSKL 3OKOB 2FR4A 1ZHLA 2DQTL 1S5HB 4AL8H 1KPRA 1NMBH 5EZIL 2P48B 3QUXD 4O5LL 2Z35B 3RWDB 2J2ZA 2MSPA 1IM3B 1N4XL 4LEOA 2VAJA 5CWSA 1FAIH 2OM5A 3HLAB 1PBYA 1FRGH 5T3ZL 3WFEH 2HH0L 4YEEA 1MFAH 2O61B 3BPNC 2FWOB 5KVMC 3HNTH 3X3FL 1ZVSA 3KLDA 4RMWA 3TO4D 1VESA 1KCRH 2AKRA 4AK1A 4CDGC 1U0QA 2LQRA 1EBAA 2XWJA 3O3EA 5JMRA 4P2QD 4A6YB 1CGSL 1BWMA 4HFUL 5L7XL 3DWTA 5FA3A 2ZCHH 4NO3B 4PRPB 4EUPA 1A4KA 4P99A 1B88A 1C7SA 1SJXA 4GBXB 3VH8G 4KK8D 5SWSB 1M1SA 5C07B 3EOAA 3D2UD 4FNLL 3UTOA 3MROB 4XCCL 1IGFH 1RIUL 5GS0L 4N8VA 2RFXB 1A6VH 4HWBH 5ANMB 1K8DA 1U8PA 1G9NL 2QSCH 3LKQB 1AJ7H 4WO4D 5F9OL 4TVPH 3OKEA 1T2XA 2X4OA 3HC4L 4C59B 4AIXA 1T2JA 4G42A 4GKNB 4R2GB 3ILPB 1IGCL 5DVMA 1CK0L 1BECA 4QXUL 4HWUA 1T5WB 3H7BB 1H9VA 3O2WL 1BEYH 5D7IE 1Z5LB 1XZ0B 3MRLB 4UQ2B 4EIGB 2EYRB 3WKMH 3PHOB 4LASL 1G7LB 1RHHA 2ADFL 2V7NB 2X40A 1A7BA 5IVXE 4J2XA 2PCPA 2QADD 1JWMA 3HG1D 2EDLA 3WFBL 1I7RB 1NGQL 4P4KD 4PV9A 1HHKB 1H8SA 3V52L 3QIUC 5I1HH 3LS4H 3UTPD 4DFHA 3ZYZA 4KPHH 1A7PL 5BQ7B 5FV1L 1IGTA 4M6ML 2WBJD 3SBWC 5MEND 1AGDA 3RY6C 3TN0A 2DQIH 4O4YH 1A1OA 2OJEB 4ENED 1YY9D 4UTAH 1RK0A 3CZFA 2YSSB 5JIIA 1CFQA 3PWPE 4MDJA 1FG2B 1T22A 3UPAA 4DUWA 4OM0L 2YA1A 1YMME 3MV8A 4N0FA 1GXEA 3NCYP 5EZLB 1IAIL 3C9NA 2I5YL 5DRWA 5JPMB 4BSWA 3BKMH 4BH8B 4F9PC 1BQHB 2NPLX 3WS6C 1URLA 3CXDL 3U30C 1Z9LA 3VFOA 4XBPB 4YHYB 2VZTA 4K71B 1JL8A 4PGBB 4Y4FC 4PJ5B 4PJBA 5B38G 4X5WA 3ZE0E 4HH9B 5IOPB 2PYFB 5C09D 1Q9LA 3I6KA 1NAMA 4H1LA 1FL6A 1U8NA 4KTEH 2F74A 5E03A 4OUUB 4I18C 1PY9A 4I3SH 5IVZA 5T5NF 4DKDC 1OAZH 5F71A 4N8CH 4P23B 4HS8L 4G6AC 4IOFC 1HDMB 2DB8A 4NN5B 1ADQA 2D0HA 3KJ6H 2A6DB 4JRYA 5EC2B 4PR5B 4H88L 1NH6A 1E4XH 4J3UA 4JKPH 1LD9A 3RNKB 5KTEL 2Y6SD 2AXFB 3MRRA 3I75B 2DQDL 2EEAA 2DD8H 5JHLH 4JFZH 3GSVA 3B9VA 4QHNB 3EFDH 2X70A 3GK8L 4KXZI 3EW3B 3ULVE 4MAYD 3MTRA 3U0WH 1Q1JH 1ORQB 5LKNA 2W9EL 4F57L 2D2OA 4Y4KC 4BFBD 1J87A 2ZSVA 1NDGB 2DLFL 2R2CA 3FOMB 4S2SB 3ESUF 1QVOA 4ZUTB 3QXTA 3JV6A 1YNTA 4JHAH 3GSUA 3UTSA 5KSAC 4GKSA 2I07A 5CJXC 1NEZA 4K55A 3QUYB 1A14H 2EDWA 2Y5EA 5FOBB 4XNYL 3S88H 3VXRB 5J3HD 1RAMA 1F4WL 3TNNA 1FL5A 2ZCKL 4RFEA 1DL7L 4RFNC 4UILH 5IT2H 5D6CB 5F1OB 3OKNA 5CEZE 3C5SB 3KLHD 3QEUB 2VRAA 2VLLA 1MRFH 2BNQB 5EOQH 2XQBH 3GIVB 4KRPD 3QFJA 4D0CA 1VPOL 4NJAL 3P2TA 3AGVA 2IAMA 1Q0XH 3R4DA 5EORL 3UC0H 5EH1A 3UAJC 4ODSL 2O5ZL 3BT2L 4MVBD 3UPCA 3B2UD 4BZ1H 1A3LH 3QO1A 3IRPX 5JOFA 3EOTH 4I0CC 4F2MB 3RPIA 5KG9A 5D2LB 1HXYA 3RBSA 1OP5H 2P42B 4XPGL 4RNRA 4LLAA 1IT9H 5KZCB 2FB4H 4F7TA 3PL6D 5C1MB 2AJZB 1N3NA 3L7EB 1GGIL 1AP2B 4YNYA 5LAXB 5TGBA 3P11L 1ZGLA 4K7PH 4NJ9H 2G9HB 1VGKB 1LE9B 3V5KB 1SJEA 3LSOB 5K33A 5IW1A 1D5BA 3VXME 1N0XH 3BQUB 2EZ0D 4KVNH 3QCTH 3T0BA 3V0VA 2YKLL 1Q38A 4NZTL 1MCRA 5DLML 4E41D 1ETZA 3MOBL 3WD5L 4UOJA 4YHOL 1ZT4B 1U3HD 2BVPB 4M62H 4QNPE 3IDNB 4JFDB 2IQ9H 4X83A 2HVJB 3SJVE 4FFVD 4AH2B 3GJEB 2YK1H 4ZTOH 1OD7A 3G5XB 2Q8BL 3Q5TA 4LIQE 3CFJB 3HUJB 4X9BA 5KS9B 1U3JA 1NBZB 5DI8B 4P59H 1U3YA 4U1IA 5E2UH 5E6IC 1F3DH 3EBAA 2FX7H 5EUOB 5F7YC 4OD3H 4D9LH 1IGIL 4HJGB 4FS0A 4Q9RL 2AP2A 4MS8D 3BD3A 1S9YA 4X5LA 1G9MC 2YEZA 3OR6B 4NC2B 4K9EC 3R1GH 5KBNC 3O8XD 3S3JA 3F7VB 1XGUA 2YBRB 5DMGD 1J86A 4HAGA 2ICWA 4MLIA 1YA5A 4H0GA 4L8BB 4RMSA 1YNLL 3W0WD 3CU1A 1WWBX 2Y07L 3SDDC 2E27H 5KOVC 1QRNE 5KW9H 3CVHB 3QPQD 1NMCB 4WI4A 1TVDA 1IE5A 3VH8A 4PJCF 3K0WA 3HRPA 2NX5E 2DDQH 4U1HA 3W5NA 4LCCC 5FO9A 1W72L 3BJLA 3T0XA 5EN2B 2XTJD 5ID1B 2VDQH 3MNZA 2L4OA 3BGMB 4KUZH 1JPTL 1NFDA 1AGEA 1PG7H 1TJHH 5TDOA 1KB5L 3HI5L 3SDXF 2BVTA 4OLZL 1R3HB 5INDA 1YMHA 5F6HJ 4R26L 3SGJC 4AEIL 3DGGA 4XX1E 4PJFA 1S5IH 1V8HA 2OX5A 4N0UB 4G9FB 4LSVL 1OAKL 4X7CC 3P4OB 5HYIA 4LSPL 1LP9A 1TQCC 4RGNC 4U1KB 3MREB 3UPRA 4PP1D 1MJ8L 4G8EA 5GGVH 1VFBA 2VMFA 5SV3A 4KV5F 4JO1H 3QXDA 3U9PL 4LQFH 3DMMD 1S7SB 2AABH 4B0MM 4MQ7A 4TTDD 4YHPA 3UZEA 2R69H 2VDMH 4XMKL 1EZVY 3HTLX 1EZVX 5C0DA 4WY7H 3DTXB 3P0VH 3QEQB 2PXYD 4WWKA 1M6OB 5I76A 1KYOJ 4KH2A 3GI8L 3T08A 4K9EL 1WEJH 4GG8A 4QTIL 4K7PY 5D70L 1E6OH 3JZ7A 3HR6A 3ES6A 2GJZA 5FCSH 1MVUB 2DYPA 3RU8L 1U2CA 2CXGA 5IJKC 4DW2L 1VEOA 3PV6B 1HEZB 3VXUB 2BVYA 3QZWB 3ARGB 1KIRA 5DJAB 4Z76A 4L8SA 4ZUWB 2F54E 4OLEA 4QY8A 4IOSD 3L9RA 4W81A 1MCOH 2BVEA 3VXOB 5B38A 1BAFL 1PQZB 4HKZA 2QQLL 3EYFA 2D7PA 1YY8A 1K3IA 2BDNL 4MA1B 4YHIB 1MJUL 4ZNEA 3N50A 4ZQKB 1K5NB 4B50A 4WI2A 4CAGA 1G7MB 1S7UB 5EC1A 1B6DA 3A6BL 4NC1E 1XH3A 2W60A 2WWMC 2FNBA 2A73A 4KI5E 1D9KA 3TO4B 2JJTA 4M5ZH 2XOTA 3BO8A 3O9WC 1WC7A 3FQXA 2ATKB 5F3HA 3E8UH 4I2XB 1P5VA 3TO2A 5E08L 4EVNA 1I8KA 4HXAL 3KYMA 3QHFL 4QTHA 1NCCH 4U6YB 4WWID 4N9GB 4YHZH 5DFVC 5DK0B 2ZUWA 3SE9L 4ZD3H 4OF8A 4DGVH 5F3BB 3G04B 2XZZA 2UY6A 1EK3A 2IPKB 1A6PA 3KJ4C 2SEBB 2XFXB 5C6TH 4Z7WF 2F19L 5TF0A 4MXWH 4LSSH 3BESR 2NR6D 2JCCF 2BZDA 2AJSL 1BFVL 4PJHB 1LQSR 2J3SA 1ZMYA 3NH7L 2DKUA 1RD6A 4FFYH 5CD5D 1ZA3A 1SEBA 5EU6D 4Z7NF 3ROLB 3L3KA 4KK6D 5F7EH 4B53A 3RY5A 5MI0B 5ID0B 2XY1A 5F6HI 2E8ZA 3FN0H 3BEVA 2IANB 4H8WC 5D7LE 4J3OC 4MA7L 4OFYD 1I9RH 1VENA 1BD2A 2OK0H 3D87B 3UDWC 2VQ1A 2O5YH 4KKAC 4YHNA 2OR8A 1CT8B 1XCQA 3NGBC 4LU5H 1DEEB 4JDVA 1JZ8A 2QADB 4MNGE 1EPFA 5CHNB 5GGVY 4GW1B 3ILQD 3ZDYF 1QBMH 2I24N 4P4KB 1UCTA 3CDGA 3QQ3B 4ZAKC 3S35H 3ZKMC 4M7ZC 4WEUD 2NY1D 3CVIL 2V2TB 4R7DA 3AS2A 5CSGA 2WBJB 3E3QE 4IRSC 1MH5B 5FIEA 4DZBA 4CW1A 4U1NB 2BC4A 1OSZB 3LV3B 5E24E 4OZHA 2EYTB 1MQKL 3V2AR 3N85L 3NA9L 3FZUC 5GIRA 2IWGA 4OCWL 5B8CB 2FEDC 3QAZB 5E2TH 2HYMA 3IKKA 5AZ2H 1OF2A 5E8PB 5HYJD 4G8FB 3CH1B 2A77H 1KSRA 5I1GH 3TBWA 1XIWD 2XNAA 4L8DA 3OKKA 3UJIL 2CDGB 4TNVF 1ZT7B 1FYHB 4GAYA 3KYKL 4IIQC 4ZFZB 5EUKB 3IB4A 2R8SL 4NNYA 4YQXL 2FD6L 1DQLL 1PEZA 3O6KL 3OB0K 2BRRH 3WV0A 1YEIH 1LGVA 3VWJD 3U46A 4HXBH 4J8RA 3VG0H 4NSKB 1TLKA 4GAGL 4NBYB 4OZIB 4WU7B 1F90L 2EH7H 5IR1B 1X4YA 1ZA6B 4WV1A 2FO4B 4C56A 3RTQD 3PE9A 3D3VA 5FUCE 5GGRA 3VD5A 5CZVH 3RWIA 3O6FD 3ZKSD 3MMEA 4PRHB 5F7DA 5GJSL 1YC8A 3RIFK 4M5YL 2E3VA 1IZJA 3CMGA 2FRGP 4JPVH 5E99L 1OP3K 3QDGA 3GI9H 3S3SA 5CUSH 1CZ8L 4L8CB 4JVUA 3B8YA 4G8GB 3MV7B 5C0IB 2ICCA 2ZUQB 1WCQA 3LB6C 3NCCB 3MC0A 2N1KA 1E27B 2MMXA 1NBQA 1O7SA 4LNVA 4CVZA 1CXLA 4MHHG 4LKXB 1G7JB 1WZLA 4MD4A 4L4TB 4P5TB 1X7QB 1BF2A 1CDUA 5DTFA 4QRTB 5J89A 1QO3A 4Y2DB 4LRNH 2J4WH 4R97B 2W65A 5D1QC 5L8JB 1OCWL 2HAZA 4LLYA 4XC1L 1S9WB 4DKAA 1V3MA 5FYJL 5E0QA 2Q86A 2VE6B 3FO2A 1X9QA 1A6AB 4M61B 3O3BA 1FYTA 1UGNA 5KANG 5IUSA 1HKLH 4WW2A 4NO5B 1DQJB 1GCFA 3QCUL 2HT2D 3W2DH 2B1HL 3RVVC 4UT7H 5C0GA 3KPNB 1P4IH 1KIUA 4O2CB 3BP4A 1ZXQA 2AJUH 4JZJC 32C2B 3BP7B 1MAJA 1VHPA 1SVZA 2A6JA 3LHPL 3BPNB 1YPZB 4XNZC 2PO6C 5DA4A 3TH4T 1PEWA 3BZFB 1SEQL 4KRPB 4R0LC 3MBEA 1KLGA 3AM8A 1IRAY 1G7HA 2AXGB 3P4NB 4XPAH 1N6QH 3IGAA 4UI2A 5JHDD 4JPWL 1U91A 4KGLA 3REVB 2EC9T 2P4AB 1RZKC 1KJ2A 4X7EC 1EO7A 2CJUL 4P9MH 4NQEA 4WUUE 4IHOB 3EJYD 4FQIH 5TQ0L 4NWTL 3D18B 1E6JL 3SPVB 3VG9B 1MWAL 2VISA 4YHLH 3ZE0F 1OSPL 3PL6B 4X7TA 3VD9A 1MCDA 4M48L 5JW5B 3PWPD 2DQTH 2HTKC 1FZOA 2D7MA 5EZIH 1KPVA 2ED9A 2IPTL 4O5LH 3K3QA 2HFGL 1N4XH 5MHSD 2Q7YA 3QNXA 4L29B 4JHWL 3QI9B 1S7RA 1RZGB 1J9CT 3CDCA 4Y8AA 2X05A 3BEWA 5T3ZH 2OI9B 2HH0H 4K7FA 3AU1A 3TA3B 3EAKA 1JFQL 1CYGA 5C0CB 1NSNL 1PZUB 1KCLA 1LK3L 1PX4A 4GOSA 5I8KL 2FIKA 3LCYA 4GJTB 1KYOK 5BOZG 4GMTL 2ICWJ 3QO0A 1ZHKB 5FGBA 3HZMA 1NKOA 2ZG2A 4UT6L 4HFUH 1EVTC 5L7XH 1H3XA 3ARBD 1KN4L 5CIPH 5HGAA 4FNLH 2ZUXA 4JJ5B 4YK4C 3K4DA 4XCCH 2IQAB 1RIUH 2D0GA 5GS0H 3LEYL 3TBSB 4Q9QL 4ZUSB 3U30B 1RZKL 1NGWB 2DJ4A 1G9NH 2MFNA 3TZVA 4Z7QE 4XH2B 4Y4FB 1EA9C 1FZJB 3W0WB 2YPLE 5DQDL 5F9OH 1P7QB 1X5GA 2DWDB 3HC4H 1PJ9A 1NANI 4KDWA 1JV5A 3MCLL 2ARJB 5FKAB 1IGCH 3QNYB 5DVLA 3VXQB 3ULVD 4QXUH 3MLRL 2EYSB 4YDKH 4I18B 3O2WH 4JRYE 1U8QA 4MJ6B 5ETUA 2YUZA 3L3IA 4NM4L 3V5HB 1MREH 2VLRA 2ZUUA 2O5XL 4LASH 3WLWD 2ADFH 4Z0BL 2XTJB 3FHQA 4KZEL 5I1LA 3GNMH 4R7NA 2NMSA 5D5MA 4G6JL 3WFBH 3L5WB 1NGQH 4OI8A 3BH8A 1UWXK 2A83A 3OGCA 3V52H 5CCKH 2BSSB 3ULUE 4BZYA 1EEZB 4FABL 2ILLA 3FAXA 3DBXA 1A7PH 4YX2L 4MJIE 2B1AL 2HT3C 3TBVB 2AXHA 3PGDB 3IFOB 4OI9A 5F1IA 5FUOL 5BMFL 4OM0H 2J5LC 3KS0H 5GPRA 1IAIH 1UYWL 2I5YH 3HMXL 5JXED 5D9SB 1DANT 5IM7A 2LTQB 4N0RA 4JM4L 1Z6JT 3CXDH 2OZ4A 4YEFA 2XICA 1HNFA 1DN0B 3QA3B 1CCZA 4LLVA 1KCKA 2PXYB 1MY5A 3BH9B 5ESVB 5T1DL 1CE6B 1ORSA 3VFSB 4PTTA 1XGPB 2EDDA 1Y6KR 4J4PA 4U49A 2Z91A 3F58L 4QYOA 3ARYA 2R4SL 2W0LA 4OF3A 4OLUL 5CGTA 5IESL 3CFDB 3BP5A 5E1AB 1XGQB 1OGAE 3Q1SH 1S9XA 4HS8H 1LO4L 2I26N 1BVKB 4YXKL 1TPXB 3T0VA 5K59E 2HJKB 5FECA 2R2EA 2BNRA 2Y23A 1FL3A 5F7NC 2HMID 1DUYA 1JPFA 3QFDB 2ICWI 3VFNA 1P4LA 4IM8A 3VXMD 1PDKA 4TSAL 3JXAA 3C6LA 4H88H 3W11D 5JNYA 1UA6L 1MELA 4JQVA 3WUWB 5I1EL 5KTEH 4PJEA 2GTZA 2VWEC 2OS7A 5ALBL 5K9JL 1GOHA 5IW6A 4PV8B 3GK8H 3PQYA 3NABL 4HAFA 5C0BE 4WNQB 2EIDA 2W9EH 1TENA 2OSLA 4F57H 1INDL 5F21B 3U79A 4P9HH 2DLFH 5I66A 1CGYA 1IEBB 3TV3L 3EO1A 3GGWA 4F15B 3FQUA 5JORA 3LRGA 4NRZA 3MJ6A 3KYNA 2DQUL 1MHHB 1QRKA 3G5VA 1FNFA 3HE7A 1EEUA 2H9GA 2CUMA 3VMOA 1AI1H 3SY0B 3ZKNC 1UZ8B 4XNYH 4NPYB 2AK1L 1YDPB 5D5MF 1QPPA 4PJ7A 4NBXB 1F4WH 5FYKD 2VAAA 5J12C 4L9LA 4OD2A 1DL7H 3TVMA 3E1F1 1HHGA 2GKIA 4BUHA 5C6PB 4YGVB 1QRND 1CGXA 1PKQB 3HB3D 3K1KC 1VPOH 4D9QE 6CGTA 3GSWB 1EXUA 1H8NA 5AYUL 2NX5D 5E6IB 5E2WL 3JTSB 4NZRL 5EORH 4HIIA 4OLWL 5DJXA 4ODSH 4PJAE 1SVCP 5TDNA 1BBJA 2NYYD 2O5ZH 4P2RE 4JB9L 3BT2H 2YRPA 5L2KA 4PRIA 5ISZD 1IC1A 4XCNA 1I3VA 4HWBA 3CU7A 4NHUA 5DS8B 4XCEB 3D39B 3W5MA 4Y16B 1YY9C 4FQCL 3QPXL 1ROWA 5I16A 3ALWA 5GS1C 3H9HB 2OR7A 4HSQA 4XPGH 3IKCB 1BP3B 1EFXD 4KK9D 4Z0XA 3SKNB 2CLZA 1L0QA 4W4OC 1GGIH 1UB5B 1MHPL 4PJ9A 3P11H 5DD6B 1IEAB 3G6JE 5IQ7L 5HYJB 1RQ5A 3OKYA 1WVZA 2CD0A 3OKLA 3QIBD 3UTQB 4PLJD 4NZTH 5DLMH 1XIWB 4C57C 3MOBH 3WD5H 4MCYA 3HPJB 1OGTA 2R56L 5HD8C 5ACZB 1RJLA 4LMQE 4NCDA 3H9SB 3ABZA 2FLBT 2Q8BH 1X5JA 1CG9B 1EJOL 1FVEA 1HSAB 4YDIL 3VFVB 2MQCA 4FQHA 1U8OA 2WIIA 4JQXC 4M93B 1H5BC 1CICD 3PXHA 3RTQB 5D1ZC 4RGNB 4WI6A 3AUVA 3FONA 1DQQB 4PGCA 1NFIB 4MXQD 1IGIH 2O93L 2OQJA 4Q9RH 1A47A 3W39B 2IFGA 1MLCB 4Y5VA 3BYYA 3CUPB 4LFHD 3RZCB 3T0AA 4C58B 1UM5L 2ADJB 3T1FB 2X1PA 3DRQA 2R4RL 3DURA 3UBXG 3U0TB 3DUSA 4EKXA 1YNLH 5IB5A 2R23B 2Y7QA 2R0WL 4MAYC 3F12B 1A2YB 4JFYB 2HTLC 2Y07H 2ZOLB 4O9HL 2IPUK 3OJMB 1F45A 3AAZB 3GKZA 5DJDA 2CRYA 3GSNH 1T7VA 3M17A 1W0VB 4KI5D 1S5HA 2G2RA 5I1DB 2XV6B 2CLVA 2DTMH 2Z35A 1IM3A 5KSBE 3QXWA 4L3EA 3O3UN 3T1WA 1W72H 5IMMB 3PIQA 2M8XA 4U3CA 1KG0B 4DN3L 5E9DA 3I02B 3L3DB 5I73B 4H26B 1ND0B 3E6FB 1AD0B 2O61A 1Y18A 3FOLB 1JPTH 2FWOA 3QYCA 4NRXB 4YXHL 4GH7B 4OGYL 1KB5H 1RUAH 3HI5H 1BFSA 4OLZH 1MAML 1CE1L 3P0YL 4R26H 4AEIH 4TPRL 2VR4A 3OAZH 3P73A 1D5ZA 3K8KA 4A6YA 4LSVH 1OAKH 4LSPH 2B4CC 3L7FB 2DLGA 3RJQB 1MJ8H 2X7LA 4D8PB 3OJDA 4PRPA 4RAUB 2HFFA 4LVOB 4PJGB 1TVHB 4M8QB 2MKLC 4JANB 2ERJB 1DVFD 3VXSD 5C07A 1QHPA 4KQ4L 1JGEB 3H3BC 4YLQT 3JV4B 2QHRL 4P2OC 4XMKH 5D7LD 5DVNA 3OXSA 4JKWA 3I84A 3QXAA 2FBJL 1DCLA 2V5YA 3NMEA 2FJFB 2Z31B 1I1CA 4IJ3C 3TH2T 1RVFL 1VERA 3GI8H 1QSFE 3HKFA 4K9EH 3RKDC 2BNUA 4QTIH 5D70H 3DUUB 5K9KB 2DM7A 4PJ8D 4ZPTA 1YUHB 5DJCA 3U2SB 1QEWA 1MRCL 1VFOA 1WWAX 1U2HA 3H7BA 4LHUD 1F97A 3RDTD 3KPOA 1OHQA 4DW2H 5EZOL 1XZ0A 4UQ2A 3BAEL 3AB0B 4NQDB 3MLVL 1EEYB 3DX8B 2V7NA 4PGDA 1AQKL 5SX5K 1BZ9A 3QWRD 2EZ0C 1KLUB 4QOKB 3KPMB 2BXZA 3FN3A 2PYEE 5K9OB 5DHYB 4UAOC 1LDSA 2Y4SA 1BAFH 4KI1A 1PW3A 8CGTA 2QQLH 4JFFA 4LSUH 4PLKC 1U3HC 5TJWK 2AJ3B 2BDNH 5BQ7A 1MJUH 3GBNL 4FFVC 1AXSB 3WIHL 3N1PC 4DKFL 4A2LA 1N7ML 3LKOB 3A6BH 3KPLB 2OJEA 4EQ2A 2PNDA 4OZHE 1WCBA 1AO7B 3VXTB 3W9EB 3KPRA 2B4CL 1BJ1J 3QZWG 4BH8A 4HIHB 5DEFA 4TNVK 3LAFA 1O0VA 3IRZA 4UUJA 5E08H 5F96L 5CGYC 4IRSB 1F00I 4HXAH 3QWOA 3QHFH 1BZ7B 1HH9A 4RAVA 3GEWB 3ARBB 4DKEL 3SE9H 3ALPA 2PYFA 4X6CB 3O8XC 1AKJA 5DMGC 2NXZD 1A64A 5CLTA 4Y5XC 1WUNT 4X4XA 4HUKB 2EDRA 5D7JD 4TYUA 2FJGA 2BVOB 3C60B 5I19L 2F19H 1MPAL 4HMDA 4HGWA 3QPQC 2AJSH 1BFVH 3NH7H 4I0PC 1D6VL 2EEBA 4GG6B 1QSVA 1R5IA 4V2BA 4MCZA 4L4VE 5ITFB 1HSBA 5E7BA 1GZQB 5EWIL 1Z9MA 3MLWH 5IG7B 4EDXB 1N5AB 4E0RB 3H9ZA 3NCJL 1UKTA 1JE6A 1KCSL 4MA7H 3UMTA 3H2WA 5GZOC 2UY7A 3D85A 4P5MB 4OQ1A 4F7PB 1R3JA 5KAQG 3SE4C 2X1QA 3DXAE 1QFWL 1ZVYA 1OAXL 3I75A 2HJFB 4R4NC 2VITA 1F4YL 3BP6A 1G7IA 1IC4H 1FSKB 1KEGL 3CVIH 1R0AL 4OQTL 4KUCF 3VXPA 4NQUA 1A9BA 2X41A 4PRDB 4XGZB 4NGHH 2ZSWA 2I60L 1AY1L 5CEYA 2XKSA 4TTDC 4ZUTA 4EQ3A 3WNNA 1IL1B 1MQKH 3N85H 5HPMB 3FKUS 2AQ1A 3MRKB 3PHQA 1A1NB 3QJFB 4OCWH 3T0DA 3QUYA 3LEXB 5GRUL 1WITA 5DUBA 1WLHA 4UQ3B 1CGVA 3UJIH 3KYKH 4DUXA 2M2DA 2R8SH 2E9BA 1L7IL 5EBGA 1C08A 1DDHA 2IBBA 2PUQT 3C5SA 5TF1L 4DGYL 2FD6H 3EDDA 1DQLH 3QEUA 3O6KH 1LK2B 2FL5A 3BGAA 2D7TL 4GAGH 1H15B 5HHOA 1F90H 1X5IA 3OX8B 1TQBB 4NDMA 4JZJB 1LE5B 2Y36L 5ICYB 4P48A 2IJ0C 1AHWB 2LE9A 5KVGL 5GJSH 2EIZA 3C5ZA 4Z7VE 4M5YH 1CIUA 5E99H 1CZ8H 3PDOB 3VFMB 2BHYA 1CVRA 1H0DB 1AR1D 4LGSB 3GMMB 3CNKA 2HKHL 3AFLA 5TPWL 2P5EE 3V8CA 2AJZA 4FXKB 1T66D 4TOYL 3AMLA 3ZT5A 4JGMA 2G9HA 1VGKA 4P3DB 1TDQA 2Z4QB 3V5KA 1LE9A 3SHSA 1BQLL 2ITDB 4TSCL 1TNMA 1WWWX 1OCWH 3BQUA 4XC1H 5EU7C 4KKCD 1I1YB 1UM4L 5BRZA 5FYJH 5HVFB 5FYLD 3K46A 5BS0B 4ZFGL 1K4DA 2ATPB 3IS1X 4FN0A 4JREB 12E8L 3FQTA 3UBXA 2BVPA 3ZT6A 4XVSL 1IC5L 3M1BB 4AH2A 2NR6C 3G5XA 1CU4L 3RGVC 4HLZG 4QCIA 2B1HH 3REWA 2VKXA 4P46C 3LH2H 4KY1L 1S7QA 1T04A 2VSCA 3DRTA 2GJ6A 4PP2A 1KNOB 4FZ8L 3SDAC 2YPLD 5I8EA 2H6PA 2J88H 3U1SH 5I1KL 3LHPH 2BHZA 1VFAB 1Z0MA 4D3CL 5C3LD 4HJGA 3ULUF 1MQ8A 4QRUA 1SEQH 1U93B 5E5MA 4TSBL 3P9MB 1OVZA 5CP7B 3GZKA 4JRYD 3OR6A 3AVEA 3PWJB 1HHJB 5DJYB 2YBRA 3CSGA 3NCEB 1MCIA 4L8BA 5AG9A 5ISZB 4I4WB 2HRPL 2CJUH 3SGKC 5CBEB 1JNHA 2Q8AH 1OLLA 3CVHA 5IBUG 5TQ0H 1E6JH 1DE4A 1NJ9B 1U8MB 2BOCB 5E6ZA 4Y1AE 4POUB 2DF3A 3QUZA 1MWAH 1NCUA 1OSPH 1A6ZB 1MHCA 2X89A 4FQPA 4FQQA 3MRBA 4GRLD 3TPKA 5I17B 5EN2A 4M48H 4DEPC 4F7MB 1NLDL 4BKLA 3UTSD 4UDUB 3BGMA 4MA3A 3DETD 3BGFB 3LOWA 2IPTH 2H41A 5C0ND 2HFGH 1RFDL 4KJYB 3QIBB 5T33L 5HDOA 3QDME 3HE6A 4JHWH 4GW5B 4K8RC 3EDKA 3ARDC 3BE1L 4IMLB 4XP4L 4G6KL 2CKBL 5FAAA 5K59F 3P4OA 1JFQH 1NSNH 2P44B 4U1KA 1LK3H 3EFFB 5I8KH 1S7VA 5C0AB 1O5DT 1A1MB 5IIEB 4HUVB 4RMQA 4OGZA 5GHWL 4GMTH 3OKDB 1JMXA 3CLFL 3O6FC 4XRCA 4S1DC 4UT6H 1CICB 5MP6L 1A8JH 2XWBA 1OGAD 4YBLB 1BX2B 4QRRA 5CZKA 1BIIB 4F7EA 2OJZL 5JW3L 2J5LB 4CJ0A 5IKCA 4WI7A 2IGFL 4EN3A 4Q9QH 5TE7L 1MCJA 1RZKH 1DQTA 1S9VB 1MVUA 2FSEB 5M7QA 3NOIA 3KDMB 2E9JA 3FAWA 1G1YA 1JK8A 4DVRL 4GRWB 4X98B 2E8YA 4H25B 5DQDH 5HBBA 4FQ1L 3GSQB 5DJAA 4HC1L 3MCLH 4JHZA 5KANI 3GHEL 1CDBA 2FBOJ 4BZ2L 5ICXB 3MLRH 5C0BD 4D0BA 1S78D 5EZJA 1PQZA 4UIMB 2BOBA 1UACL 2X6MA 4NM4H 4YDLC 5T1LD 4Z0BH 1UB6A 2OBGA 4ZQKA 1CD1B 2FO1A 5F7LB 1G7MA 4PJEE 4D94A 3MRNB 4LVEA 4G6JH 4K8RL 5GS3A 2BSTB 2HLFD 4JO3L 5AZEL 3EDJA 4MNQB 4FABH 1BGXL 2NY3B 4YX2H 2ATKA 2EIEA 4PJAF 2B1AH 4MZ2A 1QBLH 2YZ8A 3MCKB 4ZFOB 1T21B 4NUJB 4M9OA 5FUOH 5BMFH 5LCVL 1S3KH 3BKCL 2ZUYA 3EYQD 1RY7B 1U41A 3U9UB 4W70A 1UYWH 3T0EE 3HMXH 3G04A 2DQHL 4L9DA 3EYUL 4ACPA 5BVJB 4JM4H 3DX9A 1ES0B 1NLBL 2HP4A 4HIEA 1BOYA 1TXKA 2XY2A 4ODUB 2G75A 1IQDB 4KKBD 3EJYC 4P2RD 1X6NA 4PJHA 5T1DH 3MRGA 2J8UA 3CC5B 5A2LH 1EH9A 4GMSL 2BXYA 5DVOA 3G6JF 3MGTB 1YEDA 2X4TB 3NFPB 1A7OL 2EDFA 3F58H 1XR9B 2R4SH 4UINL 4LCWA 4OLUH 3T4AB 3MRPA 2IANA 3RDTB 3QB7C 5IESH 5DEGA 1EUUA 3BXNA 3CK0L 5IWLC 1C5BL 1CT8A 2H26A 1LO4H 5F44A 4YXKH 2BSRA 5L2KE 3P40A 3DROB 4GW1A 1M7DB 4D0DA 1D5IL 1YN7B 3QQ3A 2XKNB 1RV6X 3QRFM 1FVCB 4TSAH 3Q48A 1CD9B 1LO2L 4G9DB 3D25B 4Z8FL 3J8F7 4Y4HC 4RBPH 4JAMB 5I1EH 2AK4B 2R2HB 1MH5A 4LDEB 3VGAB 5AD0B 4U1NA 1MVFA 5ALBH 5K9JH 4KZDL 4JDZB 1WBZB 1SMAA 4JY4A 1QSZA 3DV4B 3WIFA 3NABH 4JFOB 5E8PA 4OLXL 5EU5A 1G6RB 5BCAA 1INDH 1MI5B 2W07A 4K23L 3CFBA 4OT1L 1IGYB 3TV3H 4B41A 4HDIB 3BI9X 4WWKD 1F3DJ 1CXFA 2CDGA 2DQUH 3HPLB 3KWWA 2YN5A 1YJDC 1XF5A 1FPTH 2QBWA 2NXZB 4RA3A 3QIWA 1FFOA 3RUGA 4QRPA 2YPKA 5DVKA 5D7JB 1B4JL 2P5WA 2AK1H 4DZ8A 3ZHDA 3B6SB 2DYPD 5D6DA 4WU7A 5B39G 3DPBA 3NCYS 3SKJL 4LCUB 2W59A 1FNAA 1J10A 3T65A 5IHBA 1ZHLB 3R0NA 3UJTH 4KRMB 1KPRB 5I8OL 4WHYH 4ODWA 3V6FB 2DN7A 3MV7A 4LEOB 5AYUH 3PABB 5E2WH 4NZRH 5CWSB 3RVUD 4KDTC 4X7SL 3KXFE 4P3CL 4AENA 2G5RA 2YPVH 4NP4L 1ZWIA 3V4UL 3E2HC 3MSPA 4P5TA 2DJSA 4QHMA 4RCAA 4KJWC 1ZVSB 1D9KD 1JF5A 2J8UF 5KOMC 4FQCH 3QPXH 3I6LD 1QUNA 2XWJB 3RWFA 3O3EB 4XWOD 1EBPA 4ZOEA 3IF1A 5FA3B 3ELAT 4PFEA 1A4KB 2X9WA 4G5ZL 3WNOA 5FA4A 1MHPH 1SMOA 2XPGA 3JTTB 3EZJB 2V6HA 3ZZ1A 4TVSa 5IQ7H 5F70A 3EOAB 4JM2F 4HD9A 2MTPA 1NCNA 5GSVA 4N8VB 1S8DB 3TIDA 1YJDL 4ISVA 5JOEA 1UM6L 2AV7B 3R8BB 4NKMA 1K8DB 1U8PB 4O2CA 4OUOA 32C2A 1UZ6F 3BP7A 3OKEB 2X4OB 3MNWA 2AGJL 4PRPE 4G42B 4QT5A 3BZFA 1U8JA 5SWSE 3WO3B 4RX4A 3ULVL 4YDIH 1U58A 3INUH 2L7JA 1BD2D 1FCCA 3ME0A 5HYFA 4NKQB 5ANME 3IDJA 3LKPA 4M1CC 2PCPB 3QISA 3V6OC 1JWMB 4YBQC 1P9MC 3W11C 3ARZA 1E0OB 5D93C 4QHKI 4IHOA 4MAUL 4WHDA 5LQBH 1K6QL 3D18A 1UM5H 3LKRA 4HCRL 3SPVA 4K3JL 4WTZG 2R4RH 3RUGF 2QQKH 1HH6A 3ARRA 4HS6A 4YWGL 4RDQF 2IH3A 1FZKA 4WFGD 1L4IA 1Y6NR 2NW2A 2R0WH 2WUBL 3D0LA 4ODXA 2IH1A 3TN0B 1A1OB 4O9HH 1RK0B 3CZFB 5CEZL 2G60L 3G5ZB 1CFQB 4MDJB 1T22B 2RB8A 4TQEH 3MRJB 1OB1A 3MV8B 4N0FB 3ARWA 3VI4E 3C9NB 4QHLA 4A2MA 1LVEA 3DO7A 4BSWB 3RRQA 3NIDF 4TN9A 4HPOL 2IF7A 1D6EA 3VFOB 4DN3H 5TH2A 3MRQA 4ZODA 4FQXD 5D72L 1QSEA 4JKMA 2ITCA 1ZAGA 5JQ6L 4O51A 5C0FA 1MIEL 3K2MC 5E00A 1Q9LB 4UAOB 5GJTL 1D3CA 4YXHH 4H1LB 4AEHH 1FL6B 1U8NB 4OGYH 1PZ5B 2F74B 3QIUA 1MAMH 5HDBE 1CE1H 5IP4A 1KULA 6FABL 4LQ1A 1NL0L 1T20A 4NYLA 1OWRM 3SBWA 3IFNL 4C56D 2EC9U 3FB8A 3RY6A 3HFML 4PJ5E 4HWZA 4PJXA 5I9QB 1OTUD 1G7PA 1OTTC 2WV3A 4NRYB 2QHRH 2IQAA 2DQFA 2NY2C 4F9PA 4YAQA 3TBSA 4PLOB 3WS6A 1J8KA 4OKVB 2WQ8A 1NGWA 5CJQL 2FBJH 1GGUA 2P47B 4L5FH 4Y4FA 5FYJU 1FZJA 2MWCA 3DXAD 1RVFH 2DWDA 2Y25A 2N4IA 3FB6A 3GSVB 2ARJA 2J7LA 4F8TA 2X70B 4KK9C 2DM2A 1MCCA 4Q6IC 5ADOH 4LIQL 1MRCH 2JB5L 2EYSA 4I18A 4DCQA 5H35A 5HYSG 1MAKA 3D9AL 2ZSVB 1UWEH 3DI3B 3TP4A 3BAEH 3MLVH 3QULA 3VWKC 3RJDA 1AQKH 1ZKAA 3JV6B 1YNTB 3GSUB 4GKSB 2I07B 1NEZB 1OARL 15C8L 4BM7A 3KG5A 1FO0L 3TNNB 3WIHH 3AREC 1FC1A 4RFEB 3TBVA 3B9DA 5KN5A 1N7MH 1Z3GL 4NCC1 1X5AA 3PGDA 4Z7VF 3OKNB 3IFOA 2ICES 4U6XA 4PJCB 5HVHC 2VLLB 4WEMB 2NY0D 5EO9B 3QFJB 2B4CH 4OCXL 4D0CB 3MBED 4KU1A 5D9SA 4U1GC 5F1NB 1K4CB 4Y4KA 2IAMB 3UBXI 3VCLA 3VXRE 4CVXA 1WAAE 3IDGA 2AEPL 3H42L 4XNQB 4DKEH 3ARTA 1BM3L 5KSAA 4MQSB 3VFSA 2FGZA 1XGPA 3ZMRA 5CJXA 3MLPA 1OP5K 3QO1B 5JOFB 4LGRB 4IRZL 4NQED 3D0VB 2BNQE 1TJIL 3RPIB 5KG9B 5J6GA 1UQSB 1HXYB 4WIQA 4NC1C 3IXTB 3WN5C 1I3GL 1F4HA 4KI5C 4RNRB 2UWEA 4F80A 4F7TB 4ZOAA 2P5ED 1D6VH 5FO8A 1RZ8A 5J11B 1FFPA 5B3JE 5TGBB 5DF0A 1ZGLB 5I74B 3NCJH 1SJEB 2E9IA 5IW1B 1D5BB 4PJXF 1KCSH 1R3KA 3B9KC 4U1MA 3UEZA 3C2SA 5D2LE 4O2EA 1I1AC 4XNXL 1ETZB 4XTRC 1Q94A 1QFWH 3A6OA 4LVHB 3TVMC 5B39A 3K80A 1A0QL 2HJLA 4PV8A 1DANU 1F4YH 4AQOA 4XP1L 3FO1A 2RR3A 1KEGH 5CJOL 1I8MA 1R0AH 5L88L 4OQTH 5BZDB 1NMAL 1OTSD 2YS4A 3T2NH 2V7HB 4URTB 2I60H 1AY1H 4YC2C 2LU4A 5FEBA 2AJXL 4E42A 4XHJD 5DD1L 5B3NA 3VFWB 4WJ5A 3EJZC 4PPTA 1R5VA 1EAPA 1RK1A 1W72A 4JFDE 1S9YB 5GRUH 3O4LA 1UZ8A 4NPYA 2F5AL 3HUJE 5KS9E 5MEPB 1SY6L 3RZWA 1J8HB 1RJCA 2ICWB 1ERNA 4U33A 1KB5A 4MQXC 3TZVD 5F72S 3MZTA 4X9IA 1F6LL 1L7IH 2P8PB 3OAUL 4E5XA 2VN4A 4M8VA 4X8XA 3CLEH 5EUOE 1IKNC 3WHXA 5E1HB 3VFTA 3E3QC 1PKQA 5IK3A 3RGVB 3TCLA 5AAWA 2F5BL 1FHGA 5HI5C 5CS7A 3VH8B 4P46B 4Y1AD 4RFOL 5E6IA 4XNUL 4Z7OF 4FFWD 4OKDA 3WO4C 5L8LB 5FB8B 1MY7A 2NXYB 5KVGH 1SBBA 3MNZB 2D9QB 4AG4L 5GRXG 5T3XD 1NFDB 4N1CA 1AGEB 1KJVA 4Z7WB 3BPCA 5EULV 5INDB 1YMHB 3Q6GL 3H3PL 4HUUA 4LLMA 1V7NL 3DGGB 1IQWL 4PJFB 2HKHH 4JRXA 2I9LB 3IKCA 4M4PA 1LP9B 4C4KO 3UPRB 1NANH 4CMHB 4I13B 3SDDA 2HG5A 4G8EB 4GFTB 5F88B 1VFBB 3TM6A 4TOYH 5BV7C 4CN6A 3QXDB 4OD1L 2VO5A 4MQ7B 1BQLH 2L7UA 4TSCH 4PGZA 3UTQA 5C0DB 1UM4H 4LCCA 5I0ZA 5FUZL 3GJFK 3TLRA 2MPAL 2VLKA 4WWKB 4ZFGH 4DEPB 12E8H 3HPJA 4N0UE 4G9FE 4WTZA 5I76B 3OTTA 1ZT1A 3TBTA 4GG8B 4XVSH 5ACZA 1IC5H 5EBWA 1AIFB 2YD3A 3H9SA 2VZSA 1CU4H 1T1ZA 1CG9A 2V2XA 4CU7A 3ES6B 2IADA 2GJZB 3SGJA 1HSAA 1T83C 2DYPB 4C4KT 1JNJA 4KY1H 2EDJA 4FZ8H 2NY4B 2Z8VC 4MX7A 5I1KH 1KIRB 4Z76B 2ZPKL 1T0NA 3QEQE 1NFIA 4Q6YA 4D3CH 4QY8B 1JYXA 2BNRD 4TSBH 4AIOA 2KBGA 1T1WA 1QLFA 3BUTA 4JFEA 4FFZL 4KROD 4HKZB 4Y5YC 3EYFB 3DIFA 3C6LD 1YY8B 4KK5C 2ADJA 3K1DA 3KYOA 3C8DA 5F9AC 3VXUE 1JTTA 3MLYL 5H37H 5EC1B 1A2YA 3Q0HA 3DLQR 2FH6A 2HRPH 4QXWA 2FHBA 3AAZA 1AC6A 2C3HA 2A73B 3BO8B 1WC7B 3UTTA 3FQXB 3PQYD 5F3HB 1CFBA 3RI5F 5IJKA 5BV7L 5ILTL 1NUDA 3KYMB 4EI5D 2ENYA 3NN8A 3CX5J 3L3DA 1NLDH 1ND0A 5I1AA 2DKMA 3ZE1E 2EXYD 3VI3E 4LL9A 3T0ED 2JKXA 1IJ9A 3HE7D 4NRXA 5C70A 1RFDH 2E7MA 2FHCA 4X6DA 3KS0J 5T33H 1T7ZA 3PUCA 4I2XE 4XP4H 4G6KH 3IDIA 2CKBH 4N0CD 5HYSA 1FQ9C 3F62A 1ZA3B 2V17L 4NZJA 3L3KB 2VDRL 1TVHA 2K9UA 5DXWA 5GHWH 3O9WA 5F9WB 4FTVA 4JGJA 1S9KC 3CLFH 3BEVB 2RQ8A 1QOKA 3G6AA 4APQC 5MP6H 3F7QA 1NGZA 1QA9A 1WFTA 2VQ1B 5DZLA 5BW7C 4YHNB 1XCQB 3U82B 4JDVB 2FJFA 4L1DA 4PJHE 4ZDHB 3B5GA 4NFDA 5L2KD 2OJZH 4PRID 2OCFD 5JW3H 3EZ8A 2DD8L 5GSRB 5JHLL 1WZKA 1N0LA 2IGFH 3CDGB 1J18A 1YUHA 2X1OA 5TE7H 4TVPD 4PIRF 4R7DB 2IANE 4DVRH 4HK3J 5CZXC 4HGMA 3C8KA 1CD0A 4DZBB 4CW1B 2JTDA 5BO1L 4FQ1H 2BC4B 2Z8WC 4NQDA 5HYQA 4HC1H 4OFPA 2FHFA 3LQAC 3QEHA 5GGSB 3GHEH 4QOKA 2BERA 5GIRB 1KCUL 3KPMA 1GJIA 3NZ8A 4PJ9D 5K9OA 4BZ2H 2VDPL 3WS3B 3PWNB 1A14L 1OF2B 1UJ3C 5SX5H 1UACH 1CL7L 2AS5M 1VACA 3SCMD 1YMMB 3UDWA 5IBTL 2XNAB 1LMKA 4L8DB 3OKKB 1FORL 4K3HA 4GAYB 4XZUA 5L8KB 1MRDL 2IMNA 3KPLA 1HI6A 3JWNC 4NNYB 5F7FA 5JPNA 4Z78A 4JO3H 3BDBA 2HRLA 3EYOA 4ZAKA 2DI7A 1BGXH 3U46B 1F2QA 3W9EA 4J8RB 1C12A 3HAEH 4HIHA 4Y4HB 4WV1B 4V1DA 1JGDB 4C56B 5F6IC 4IRSA 3UC0L 3MYJB 3VRLF 2L0DA 3Q5YA 3D3VB 3T8XA 3RWIB 5LCVH 1FDLL 3BKCH 3MMEB 1SYVB 3K2UL 1A3LL 4R4FL 1JZ2A 1YN6A 4HMEA 2DQHH 2I9TA 3QDGB 3EYUH 4I3RL 5EO1A 4WHYG 1MCEA 3KXFD 4OZIE 3B9EA 1OOAA 2ZNWA 3ULUC 4CVZB 4IIQA 1MOEA 1ZLUH 2YXMA 4GMSH 4MD4B 2ZNXA 3ARFC 1A7OH 1FGVL 4PRHE 5DTFB 2BY3A 5L0QC 5IV2A 4GRLC 1IAII 4M3KB 5DC9B 4UINH 2QSVA 5HHXL 3LQAL 4G8GE 3MV7E 4KVNL 1T0PB 1P6AB 3CK0H 3DETC 4L3ED 3TCXA 3QG7H 4P5MA 1C5BH 2Q86B 3FO2B 5E9DD 1GAFL 2EKSA 3O3BB 1FYTB 3MRMA 4PTUA 4L4TE 4WW2B 4MWFA 1D5IH 4ORGB 3IDYC 1NAML 2IMMA 4J3SA 3HNSL 1LO2H 2XYCA 1ZV5A 3L1OL 5C0GB 4Z8FH 3BHBA 5K93A 4P59L 4PRDA 5HGDB 3STZA 3BP4B 3FT2A 3E2HB 3SKOB 2YA2A 3D69A 1ZGLP 4KZDH 1A6UL 3PP4L 5F1KC 5T1MB 4W6WB 2DLHA 4JJHA 3FFCB 1MWAA 2FJHB 4PRPD 4U3XA 3MRKA 3A0OA 4POYA 4GBXD 2R9HD 5SWSD 4LPTA 4DN4L 1HWGB 5C07D 3TGXA 4OLXH 3BPOB 5D1QA 1KTLA 4K23H 1S7TA 4NNXA 4U6HA 4OT1H 3T3PE 2VUYA 3FT3B 3HZVA 2V9TA 1U91B 4U2YA 4CMMA 1KJ2B 1EIBA 3RVTC 1M4KA 1YPZE 3S4SG 4R2GD 1LK2A 3TC9A 2JIXA 3QG6A 3ULUL 1B4JH 3LN4A 4F9LA 3EO9L 3SDCC 1Q9KA 3IT8D 4LARH 3SKJH 2VISB 4P2YA 2R29H 1LE5A 5ICYA 5LXGL 2A74A 5CSZB 3HZKB 1SYSA 2PO6A 5EB9A 1GOGA 1HYSD 1FZOB 1XF2A 4KUZL 5I8OH 4R0LA 1KPVB 4RSVA 4OZFH 2J1KA 3S5LG 4HKBA 3LQZA 2ESVA 4OZGA 3QNXB 4LK4A 4X7SH 2P49B 4P3CH 3BEWB 4NP4H 5IMKB 3V4UH 5J13C 3CDYA 4K7FB 3L3HA 2WWKO 4FXKA 2A9ML 4HUWA 1NGPL 3FRUB 2CKNA 2FIKB 3WNMA 2Q7NA 3C87A 2VZ3A 4P3DA 1FNHA 3KPRD 1PLGL 5DO2D 4X99A 2R69L 5HI3D 5K9QG 3QUML 2Y9RT 3IDUA 4GRMA 4E41E 5BS0A 1IGJA 2ATPA 4G5ZH 5SWZA 1S7XA 3OJVC 4OF7A 1OPGL 5C0CE 3L5HA 2Q76A 4KKBC 3O3DA 1J1XH 2B5IC 3SQBA 4JKLA 4NQCA 2MCPL 2E5EA 2OXGA 1YJDH 1YEKL 5JUEH 1UM6H 4QWWD 1N2RB 2P8MA 4DOHB 2CRMA 2OL3L 3V0AC 1N59A 1RU9L 3FB7B 1SJHA 4U4BA 5T5NG 5T5FL 2OLDA 1JV5B 4P23D 3RL2B 2AGJH 1I4FB 1W0WA 1JJUA 4ZSOA 1A7RL 3IYLW 3ULVH 2Z0BA 5ETUB 3NACL 3PWJA 1HHJA 3GBLA 3ZHKA 2VLRB 3RWHA 4NQVA 3W0WE 5I1LB 5GRZA 1I9JL 4R7NB 5D5MB 3OL2A 4J1UA 3BH8B 2A83B 3OGCB 4F58L 4MAUH 3CX5K 1JHKL 4MXVE 1K6QH 4HCRH 1NJ9A 1U8MA 4K3JH 2KH2B 3E8UL 4PJIA 1BF8A 4YWGH 2ZCLL 2WUBH 1A6ZA 1AH1A 4GAFB 1IZKA 1C5DA 2XTJE 5CEZH 2G60H 3MR9A 4YHZL 4F3FA 3QUYD 2AQ2A 2QEJA 1C5CL 2F53B 4HPOH 1WT5C 4FQ2L 4OIAA 4CJ1A 3GHBL 3AXLA 1BVZA 4GXVL 3MJ8B 3ZKXB 3VXRD 4GW5A 3VWKB 4LLVB 5D72H 3LN5B 5JQ6H 4WVRA 4PTTB 4FFYL 43CAA 5GJTH 3BD5A 5LGJA 5IVOA 2CRZA 5ERWB 5C0AA 3EDFA 1ED3A 2BNQD 1KV3A 1U8HB 1K2DA 1DUZA 5D2LF 3V6ZA 6FABH 1NL0H 1H3UA 3FN0L 2FECL 4XVUD 5HHOD 5JA9A 3L6FA 2G5BA 3BP5B 1MCWM 3HFMH 1ZLSL 3AMKA 1S9XB 4LU5L 4AM0B 5HVHB 2R39A 5FECB 1FG9C 1UCBL 2R2EB 2BNRB 3N9GL 1BJMA 1FL3B 3C5ZD 1DUYB 1E28A 2BY2A 5A2FA 3VFNB 5B4MD 3C6LB 3BDXA 2QQQA 5JNYB 1E4JA 1EGJL 5CJQH 5CGMA 5CINL 2NY6B 4ZS7L 2FCBA 4XNMA 3KPSA 4H25A 1A21A 2XZAH 2GTZB 4M6AA 1J88A 1XFPA 5HHVL 1FFNB 3MUGA 4YDJA 1JZ5A 3KR3L 5D71L 2YUVA 3IAGC 3V6BR 3X12A 3I6GA 4LIQH 5KS9F 5ICXA 2JB5H 5E70A 1BIHA 3MYZA 3SGDH 2OSLB 3QUKA 1R3LA 4UIMA 5D2NC 3BQUD 3D9AH 2J12B 3EO1B 5JW4M 3FQUB 5JORB 3KYNB 3G5VB 5F9JA 1OARH 15C8H 4JLRA 3HE7B 2H9GB 5CD3A 3WXVL 4I48B 2BRRL 1YEIL 1FO0H 5HDQL 4PJ7B 4UB0L 1I1AB 1TIUA 4OD2B 2GJ6D 1KF9B 2NNAA 3TVMB 1HHGB 3MCKA 4JM2C 3DSFL 4NUJA 5CZVL 4P2QA 4OZ4B 1JWSA 1EHLL 2CO6B 4OCXH 1MF2L 2FYYA 3QQNA 3QQ9D 4CN4A 2P7TA 1EXUB 3SE3C 2QR0A 2W9LA 1NC2A 1CLZH 4ODUA 4HIIB 5DJXB 1IQDA 4EZMA 5D7KE 5TDNB 2AEPH 4FG6D 3H42H 2GJJA 1JNLH 2WW8A 5EU6E 1C8PA 5JDSA 4IRZH 3ZHLA 2P24A 1TJIH 3MO1A 1XGRA 4WHTA 3MOQA 1PKQE 3H8NA 2WMPA 3BISA 5I16B 1I3GH 3QNZA 1UVQB 3QUZD 4OSUL 3O3AA 1NGYA 1Q9WA 3WEXA 3CFEA 2HT4D 1JUFA 2X89D 1RUML 5IB1B 3IU3B 3H7LA 1V7ML 1QFHA 1ZE3C 5IFHL 1B0RA 4UV7L 4FQXC 1YN7A 2VDLL 1FVCA 3D39E 5DHXB 3OKLB 5T1KA 2F8XC 3HG1A 2EE9A 4J7RA 4JFPA 2ZZUT 4UT7L 3S4SA 4XNXH 1UEYA 1QNZL 2AK4A 4LKCA 4G9FD 3BZEA 3O2VH 1A0QH 1KOAA 1RJLB 2Q20A 4JDZA 4ZUVA 4GLRH 4RWHA 2ZJSL 4XP1H 1DBKL 5MENA 5CJOH 1FVEB 3GB7A 5L88H 5HYJE 5GS1A 1NMAH 2P8LA 4FQHB 1U8OB 2WIIB 1AD9B 1YEFL 2K7PA 1OTUC 5C08B 3DJ9A 3S5LA 1N6QL 5EBMA 4M3JA 4XVTL 3FONB 2AJXH 3TFKC 4W4OA 1Z0NA 4PGCB 4QRRD 4AYFA 5DD1H 1JWUA 1TVBA 1N6UA 2OQJB 4CVWA 4LP4A 4HV8A 4Y5VB 5DJ2A 2H8PB 4BQBA 3H9SE 1EMTL 3NPSC 1C16A 2F5AH 3CAFA 3V7AE 3DURB 3PWUA 3DUSB 5IB5B 5I30H 3VXUD 3OAUH 3DVGA 4MMZC 3ZE1F 4BQ6A 5H37G 5DJDB 3M17B 4OGAD 2G2RB 4MB4A 2F5BH 2CLVB 4X9GA 2FX8H 3V6FA 4PG9A 1PKOA 1IILE 4JQXA 1N6VA 4RFOH 1H5BA 2IPUG 3PABA 4L3EB 5F7HA 4XNUH 5JR1L 2ZP0T 4YO0B 2WBKA 5D1ZA 3PIQB 3UJJL 3L3JA 5E9DB 3ZDZF 3PWLA 3UYOD 3UXFA 3B4NA 2A0LD 4AG4H 1Y18B 4F8QA 3OAZK 3RI5K 1WBXB 2MNUA 3D1MC 4LRIC 4Y5YB 3Q6GH 3H3PH 1V7NH 3O11A 2DJUA 4P57B 1IQWH 3BOVA 2E7HA 3P73B 1D5ZB 4HUXB 2NY0C 4MAYA 1B3JA 3GSXA 1KC5H 5AAMA 1HHIA 2X7LB 3OJDB 2HFFB 1LO5A 3RNQA 4FA8A 3JTTA 4ELMA 2CRIA 4OD1H 5HJ3A 1MFCL 2NZ9D 4GKOA 4X6FA 4XP5L 3MV9B 3MPCA 1S8DA 3OXSB 4KVCL 3QXAB 2AV7A 2D7QA 5FUZH 2MPAH 4WTXA 3TBYA 3F5WA 5D96B 1JF6A 1VDGA 4XI5D 2BNUB 4GQPH 5FDWB 3WIHA 4PJGE 5MEOA 3WIIL 4ZPTB 5DJCB 2KZWA 1QEWB 1BLNA 1Q72L 4YDKL 4R4BB 4LCWD 2Z9TA 2IAND 3KPOB 4WUUB 3RL1A 3NFSL 1MREL 1OW0C 3RX7A 2ZPKH 5JHDE 4X6BA 1HQRB 4PGDB 1BZ9B 5FK9A 3GNML 2XN9A 4FFZH 5CCKL 2H32H 1JRHI 3FO9A 4WUKL 4P2OA 2YD8A 4JFFB 1PD6A 3BDYL 5JLZB 3NIFE 5HTSA 5A2JH 4WENB 1XGYL 4LLWB 3MLYH 3WCYA 1WTGT 1U8KB 1WIOA 3G5ZA 4JDTL 5E7FA 1OTSC 3N1FC 4IMKA 4P9HC 4QOKE 4DTGL 5HSFA 1WCBB 3MRJA 4Z95L 2BFVL 1MLBB 2OTPA 3KPRB 4XHJC 4OZIF 3MOAL 5MHSE 5DEFB 2YXFA 5BV7H 5KJRL 3HAEG 4UUJB 5ILTH 3DHJA 1U92A 3QWOB 2AEIT 4RAVB 1HH9B 3VXNA 1CLCA 1AKJB 2LAAA 1PZ5A 3QIWD 4JPIB 5T3ZD 4QRPD 1KIQB 4X4XB 1AO7E 1CFSA 1RIVH 1X5KA 4ONOA 1U3HA 2FJGB 4NZDA 3B8SA 3LKNA 4POZD 5CP3H 1GVIA 2HLAA 4HGWB 3S36L 3IJYA 2EDOA 5FFLA 1RMFL 4IS6B 1M7IA 4LDLB 1U36A 4OQTA 2V17H 1R5IB 3Q1SL 4MCZB 1HSBB 2VDRH 5LGHH 3DYMA 2XXCB 2VKWA 3CDFA 3O4OB 4PRHD 4X6CE 4NRYA 1FNEA 2GY5A 4ETQB 2HVKB 4G8GD 3KHOA 3MV7D 4ELMF 5A3ID 1ZHNB 5I0DA 5F6IB 4OKVA 1EJ6A 3D85B 1R3JB 7FABL 4ZG1A 4U1LA 2AEQL 5GS0D 2X1XR 3RVXD 3BWUC 3O8XA 4GG6E 3MCG1 5ICZA 4L4TD 4P5TD 1A7NL 1JGVL 2VITB 4Y5XA 3BP6B 1G7IB 3L95B 4Y2DD 1F2XK 1PGRB 3T3PF 5DJ8A 3P9LA 3VXPB 1A9BB 4P9HL 5ITBL 1ZEAL 2OYPA 5BO1H 2ZSWB 3OR7A 4PRNB 3OKMA 2QKIA 4I0PA 5DRXB 5FO7B 5CEYB 1T1YA 4RGMC 4OCSL 5DZOA 4BH7B 1QFUL 3O41A 4KC3B 4EUPH 3BW9A 4ZUUA 1KCUH 3PHQB 1N8ZA 2QV2A 35C8H 2VDPH 1INEL 1J0JA 5E2JA 2BHUA 5DMYA 1JNNL 1FZMB 1AI1L 4Q97A 3QDJB 1CL7H 5DUBB 1X6LA 4O2FB 5IBTH 1K8IB 1J05A 4ELKB 2PW2A 2VIRB 3BPLC 5TFSL 1FORH 3SE4A 4JFHD 1WTLA 2A6IA 4WFHE 2Y1VA 1MRDH 2VXQL 1AGCA 1C08B 1DDHB 3A6CL 1VADA 4PJCA 1EX0A 2FL5B 5IB4A 5EO9A 1QLRB 1GYAA 5DD0L 5HHOB 5F1NA 1K4CA 5DC4B 4HIJA 4NDMB 1HHHB 3MJ9L 4M7JL 4MJ4A 4KROC 4XNQA 4C83A 3SDXA 1FDLH 3K8MA 3K2UH 4NC0B 2EIZB 3C5ZB 4R4FH 4YBHA 1YEGL 3CIQA 1HWHB 3CZJA 2H3NA 2YZ1A 2EO1A 3D0VA 2GAZA 2NLJA 4I3RH 1FNLA 3CSYA 3M45A 4OZFG 1E4WL 1UQSA 5FHBL 3IXTA 1KT2A 1T5XB 4R9HA 1QP1A 5DHVH 1LDPL 4BFEA 1T7YA 1KGCD 2I25N 1VGEL 1FGVH 1U8LA 5I1CL 4EI5C 1JTPA 5HHXH 2CGRL 3LQAH 1UXWA 1CFTB 3RVWD 5BRZB 3QI9D 3T0EC 5FYLH 4WU5B 3QH3B 4ZXBC 1GAFH 1K4DB 3SOBL 3FQTB 2NCMA 3UBXB 3TA3D 1J0KA 1G6VK 4GXUM 5C0CD 2FDBP 4K07A 4BFGA 3T2PA 1NAMH 5IFJA 4UU9A 3HNSH 1CR9L 2YR3A 3H6JA 3L1OH 4QCIB 5BZDA 3REWB 2VH5L 4HWNA 3GSRB 3EGSB 1S7QB 1T04B 3DRTB 2WINA 2GJ6B 4PP2B 2V7HA 4N90D 2X4SB 5I8EB 1OAQL 2H6PB 2XIDA 4XPFL 4M00A 5BS0E 1A6UH 3PP4H 2DQEL 3AY4C 2JJWA 3VFWA 4QRUB 3RIAF 4MXVF 1B6UA 5E5MB 1IGML 2UVEA 4DN4H 5SX4H 1ONQA 2AW2A 5TDPB 5MEPA 1D7FA 4K3DH 5FYKE 1J8HA 4Z7UA 2BVQA 3SGEH 4Y4FD 3S9DB 4Y19B 1P7QD 2P8PA 1TTGA 3UYPA 5HHQA 4UBDC 3D6GA 1JNHB 2B5IB 3GSNL 3HRZB 4QGTA 3ULUH 2CKBA 2GCYA 2XWTA 3RGVA 1DE4B 3EO9H 5JMOC 2DTML 1TZHA 4P46A 3QUZB 4I5BA 3RY4A 3SDAA 1MHCB 4FQQB 3MRBB 5LXGH 5CLWA 4OJFL 5HYEA 5FB8A 3VDAA 5ISZE 4G6AD 2X9XA 4BKLB 1FH5L 2VTFA 4IOFD 3SCMC 2PKDA 4MA3B 2PW1A 4Z7WA 2VC2L 1RUAL 1CXEA 2JCCA 1AGBA 3HE6B 3IXAA 4L4JA 5HHPB 1J11A 1HILB 5DJ6B 5FCUL 5D1XC 2I9LA 1XF1A 1J0HA 2A9MH 1KBGL 3SGKA 5F88A 4J6RL 1NGPH 1S7VB 3BMWA 4I3GA 2XKUA 5FDYA 5C7XL 1LO0L 4NUGL 1PLGH 1IARB 4W6YB 3GIZL 1B90A 4XRCB 5DD3H 5I75B 3QUMH 4Y4KD 1I3RA 2C3WA 2W92A 3OZ9L 2XWBB 1JYWA 2XTLA 4QRRB 4F7EB 2FZ3A 1OPGH 5KSAD 4MDIB 1ZTXL 5IKCB 4K7PX 3GJFH 2JJUA 1AIFA 5EOCL 5C0AE 5IQ9A 4AT6B 2MCPH 4M43L 4EN3B 2GQHA 4WW1A 1YEKH 4OFKA 3ARDA 2OTUA 1JK8B 2OL3H 1RU9H 3HI1B 5T5FH 3HAEA 5IROC 4PGEB 1KTKE 3CD4A 5L2JA 1A7RH 5HGGS 4HFWB 2ID5A 4H0IA 4PB9L 4CKVX 4D0BB 2GEEA 5EZJB 5F9DC 5J0BA 4OF5A 4PJDF 2BOBB 3O6FA 2OXHA 5HHNA 3NACH 4LSUL 4IOIA 3TYFB 3V0WL 3WDIA 5HGHA 1UB6B 4GRWE 2ADIA 3WJJC 1I9JH 1EFQA 4U3HA 4Z7UF 4F58H 2VDNL 2VL4A 1JHKH 1TCRA 5BXFB 2XZCL 4N5UA 2DWEA 4W4NA 3VGGA 2ZCLH 4M1GL 4GBXC 2R9HC 3GDBA 1KFAL 1TETL 4XVJL 3L3OA 5IBLD 2DIBA 5C2BL 2VZVA 5D2NB 5DRNB 1C5CH 3DX9B 4FQ2H 4MNQE 5IB3A 3GHBH 4GXVH 4HIEB 4XBEL 1WK0A 1CTNA 2G75B 2X4RA 3CX2A 5D7KD 4R2GC 3MRGB 2J8UB 4LCIH 2N7AA 4XP6L 1YEDB 4JCLA 3RA7L 1PG7X 3CSBA 2GT9A 3MLWL 1JI1A 3P4MB 3TYGL 1X3DA 3VXSE 4U7KA 3B43A 2OTWA 4LCWB 1BOGA 3MRPB 2X10A 5DEGB 4XX1G 5E6ID 3BXNB 1ZLSH 2H26B 4JM2B 2BSRB 4ZDHA 3WNLA 5D7IA 1UCBH 3R8QA 4NKOA 8FABA 1NBVL 3N9GH 2VDOL 5HHMB 1ZK9A 5GSRA 4D0DB 5KVEL 2DI8A 3F6IA 4RBPK 5IVXA 4PUBL 3D39D 1IC4L 1Y0LB 1EEQA 2PYEB 1T7WA 1EGJH 1MUJA 3KPPA 4Y16D 5K9QI 2X09A 5CINH 4ZS7H 5C8JB 4DVBB 4JRXD 4MNHB 4A6YL 4NGHL 3VGEA 5HVGB 5HHVH 1DBML 3KR3H 5D71H 2WLZA 5HI3C 5GGSA 4KKLD 4LP5A 4KHTL 5IMLB 4JY4B 3WIFB 3AS3A 5CJ5A 3WS3A 4YHYC 3PWNA 2PTTB 3EHBD 1A3RL 1BVLA 5EU5B 5CKGA 3CFBB 1P84J 1YMMA 5IWLA 2YMXL 1DTUA 4HG4J 4WI5A 3JWDC 1ZSDA 4OZFA 2VLKD 3FQNA 3IETA 1ULVA 4PS4L 3VD4A 2AK4E 3KWWB 5DURB 5DFWH 1NCWH 1XF5B 2GY7B 1REIA 5J6HA 1DBAL 3QIWB 1FFOB 5TQ2L 3RUGB 4PREA 4QRPB 1UC6A 2YPKB 3H9SD 3WXVH 2P5WB 4DZ8B 5HDQH 4P23C 4LFHG 4UB0H 1IKFH 3H0TA 2ARWA 3MXWL 1MI5E 1RJYB 3HA0A 4S10A 4Y4HA 4YGAB 1JGDA 4KWUA 1AGFB 4NN5C 1TFHA 2CIKA 3MYJA 4RGND 3DSFH 3T65B 2YWZA 1SYVA 1EHLH 1CFNA 3FO0L 1YC7A 1MF2H 3ARXA 2BMKA 2FEEL 4ODWB 4XC3L 5CIPB 2KKQA 5GQBA 3RZCD 1DLHA 4X4MA 3C08L 3R0MA 4AENB 1ZWIB 3I3DA 4M1DL 1F13A 4OM1L 3MUY1 4JPKL 2FH8A 3QT2A 4QHMB 3U6RB 4P2CG 2JK5A 2DM3A 1X5FA 3UTTD 5E8OA 1DR9A 4NN7B 3UROR 4ERSL 3RWFB 3L5JA 4MZ3A 4OSUH 3S98A 1FFQA 5DGQA 5BVPL 1R5WB 43C9B 4G43A 3IF1B 1RUMH 2VXSL 4HJ0C 2A2QT 4LNRA 5FA4B 2XPGB 5FHAL 1V7MH 1KELL 5IFHH 4ORGA 2Z93B 4UV7H 1IMHC 2VDLH 3JWDL 3ISWA 1JRHL 5GSVB 3LRHA 2X1WL 5D7IF 3VE0B 5J56B 1LNUA 3TIDB 4F9LC 4ISVB 4KDTA 5IBUB 4NKMB 1UADC 3LH2L 5IVXF 4BJLA 1QNZH 5HGDA 3SKOA 3DVNB 2J88L 4HCRA 3U1SL 3OXRA 4Q7DA 5F7KC 2DMBA 4XVUC 3STLB 3HZYB 3MNWB 5T1MA 2WWMD 4NWUL 3FFCA 2FJHA 2ZJSH 3ARPA 4QT5B 1DBKH 2DICA 1JBJA 3S35X 2AERT 1U8JB 3O9WD 4IRJC 4HQQH 2X4NA 3NIFF 1NAKL 1U58B 1YEFH 4CNIA 4XVTH 2JJSC 3IDJB 3FT3A 3LKPB 1QFWI 2Z31D 5B4MC 5DFVD 2MQ0A 3LKSB 3OHXA 1B0WA 2ARJQ 3RHWF 2Q8AL 1EMTH 3R06B 1U9KA 3LKRB 2V5SA 4MJ2A 4LLUB 4U1SA 4M02A 1KEML 1HH6B 5CJ8A 4HS6B 2IH3B 1FZKB 4TTGA 2NW2B 3D0LB 5C9KA 4ODXB 2BX5A 2IH1B 4NQDD 5CSZA 3FFDB 3HZKA 4QOKD 1KB9J 1MNUL 1OB1B 2VLMD 1MCWW 4QHLB 2DM4A 3DO7B 2EDTA 1D6EB 3L5IA 4QRQB 5JR1H 5E5UB 3V7MA 4Y7MA 2APTA 4ODVL 3UJJH 4KMTH 1I75A 3MRQB 5IMKA 5TH2B 1QSEB 3VXMA 2ITCB 5JXAL 3V6OA 2C7UA 3ETBF 3IU4H 4O51B 5C0FB 1P9MA 4B7LA 5E00B 4YDVA 1UH2A 3FRUA 3QIUB 3MV8E 1AO7D 3PHSA 4KAQL 2Y06L 4YPJA 2ZOKA 5JW4Q 2NTFA 4OI7A 1T20B 1I3UA 3SJVA 4NYLB 2VXVH 1A9EB 4GSDL 4V1DD 4KJQC 5CILL 2EXWC 4IRSD 3FB8B 3WYRA 5FYLE 3QQ9C 4GG6F 2YA0A 1WBYA 4PJBE 4HWZB 4PJXB 1LEGA 1G7PB 1NGXA 2E7CA 3ULVF 4P49A 5IGXL 1MFCH 3DHMA 2DQFB 4XT1C 4XP5H 5ELIA 4YAQB 4KVCH 3C60D 1NC4B 1N2RA 1IM9B 4G3YL 4ODTL 2KZ1B 5GZNC 3FB7A 4KTYA 1FO0A 4TULL 3MA7A 3RL2A 3FB6B 4JO4L 1I4FA 3WIIH 3S97C 2HT4C 1OLZA 1Q72H 4WFEE 1YYLL 3TJEL 4U0RC 4DCQB 5H35B 4NO2A 4XHQA 1A5FL 1QRNA 2VL5A 3NFSH 3FMGL 5KSVA 5EG6C 3VJ6A 3QULB 4BUGA 2NX5A 3V9FA 5EO0A 5B21A 1RI8A 3KLSA 4FXGA 4WUKH 5JW4N 4NIKB 3WNKA 3GMOA 4RA0C 3BDYH 2XA3A 3GMLA 4NFCA 4QO1A 1XGYH 2YD9A 1QBLL 5KN5B 4WFHD 3QDMB 4F37F 1BBDL 1MHEB 4JDTH 4U6XB 4WFFD 3HHRB 1S3KL 3UTSE 4DTGH 1EFXA 4Z95H 4Q6IA 1XAUA 2C3GA 5FV2A 3ZSTA 2BFVH 1A6TB 3BYTA 2VLJB 2F53A 3MOAH 4Y4KB 5KJRH 2CMRH 4ETYA 3VCLB 3MJ8A 4CVXB 5IHZB 3IDGB 3VWKA 1NCDL 4BFIA 2YOCA 3LN5A 3T3ME 1I7TA 5KSAB 3ZE2E 1R24A 2BJML 3ZSSA 5ERWA 1U8HA 1S7WA 2JIXD 3CVHL 3ARGC 3QFJE 5J6GB 3RVVD 2K3TA 4G6FB 3S36H 3AREA 3OQ3B 4OGAC 1NDMB 2UWEB 4RFNB 1I7UA 1RMFH 5J57B 4JN1H 4QNPF 3FT4A 4O58H 3QUXC 4AM0A 5FO8B 1IFHL 2NQCA 1RZ8B 1ODAA 4AY0A 2PO6D 1FFPB 3FN9A 1YYML 1BWWA 2Z92A 4MA1C 2PTUA 3WFHA 1R3KB 3LIZH 4U1MB 2ESVD 4JO2H 4O2EB 4I8DA 2F54A 5DT1L 2J6EL 7FABH 3HC3L 3LS5L 5GGRY 1Q94B 2AEQH 3TO4C 4I0KA 5FM5O 4ZS6D 5B39B 2FX9L 1VA9A 1P84K 1SY6A 2HJLB 1FFNA 4JN2B 1TZGL 2H2PD 1A7NH 1GL4B 1HNGA 4HG4K 4UNVA 1JGVH 4GT7A 3FO1B 1I8MB 3T0WA 3WN5A 2Y5TA 1KACB 1KXQE 3GSNB 5ITBH 1ZEAH 4LF3A 4KK8C 4KKNA 1JF1B 4OCSH 5BS0D 4E42B 1QFUH 3WE6A 4L1HA 1MCFA 4Y0GA 5SWZD 1OL0A 4WJ5B 2HTKD 2DRUA 1FPTL 1R5VB 1EAPB 1RK1B 1INEH 1IAKB 1W72B 4XAKD 3V95A 4FQJH 5I8CA 2BSED 1JNNH 3O4LB 3WSQH 1J1PL 3IVKA 4I48A 4WO4C 3B9KA 3GBML 3M8OL 1I1AA 5TFSH 1KB5B 3DNKA 4ZXBB 5C86A 5AUMB 1GGYA 3RIAK 3ARUA 5MI0C 2VXQH 4RRPG 2LVCA 4C54A 4E5XB 2MHAA 3A6CH 3O81A 3WHXB 5C92A 3VFTB 5IHLB 2JF1A 4OZ4A 3UJTL 5IK3B 3TCLB 4Y88A 5GXBB 3EYVA 5DD0H 3UP1A 2QADC 3HCVA 4DAGL 3MJ9H 2QLVB 4M7JH 1ZGLM 4P4KC 2YPVL 2D7OA 5I18L 5D7LA 5E8DH 4YHKL 5T3XH 1YEGH 4NO0B 4PBXA 1KJVB 2EE2A 3BPCB 2WBJC 3U4BH 1E4WH 5FHBH 4HUUB 4ENEC 4LLMB 2H45A 1UVQA 4CDHA 4JRXB 1LDPH 4ZO9A 5B8CC 4XBGB 5GGTL 4X8JA 3KHQA 1GPOL 4JY5L 3T04D 1VGEH 2IG2L 2HG5B 5IB1A 3IU3A 3SDDB 1IKNA 5H2BA 4D2NA 1CXIA 2M1KA 1NFDE 5F7MC 1DFBL 5EPMA 5J1AA 5I1CH 4Z7WE 2CGRH 2B20A 5CEXA 2OZ4H 1I8LC 4GUPB 4LCCB 1XT5A 4PJFE 2VLKB 1FIEA 2H32A 2EH8H 2D31A 3SOBH 5D4QA 2DQJH 4QXTA 1ZT1B 1LP9E 3TBTB 2DS4A 3N06B 5EBWB 5JO5A 5C0AD 2YD4A 1CR9H 4ZO7A 1T1ZB 2V2XB 2IADB 4G8IA 2VH5H 3EKCA 1H3TA 1H3GA 1AD9A 1RZIB 1T6WA 2HT3D 1BMGA 2PETA 3INUL 5D1XB 3CCHA 3HI6L 4MX7B 5C08A 1OAQH 4XPFH 2WUCL 4FHBD 1TQCB 1T0MA 1T0NB 2DQEH 3JVGC 3BVNA 2UYLA 2ZUQC 4KI5F 1IGMH 2BY0A 1HXMA 1T1WB 1QLFB 2H8PA 3N1QC 4HBQA 2W0FA 4JFEB 2Y6SC 3DIFB 1JPGA 3LZFL 5LQBL 1KB9K 2CK2A 4WEBL 4XPTL 4F7CA 1DEDA 3KYOB 5EU3A 4BSVA 1INQA 3S37L 4LCYA 2QQKL 4N68A 3L5XL 3MLSL 4NKDA 1CDIA 3KPSD