4K3JA

Crystal structure of onartuzumab fab in complex with met and hgf-beta
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
227
structure length
227
Chain Sequence
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGSTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system/growth factor
molecule keywords Hepatocyte growth factor
publication title Monovalent antibody design and mechanism of action of onartuzumab, a MET antagonist with anti-tumor activity as a therapeutic agent.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k3jA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k3jA01
1MTUA 2UUKB 7ESTE 1GL0E 1DT2A 3MO3A 1HJ8A 4NFEA 1ZRKA 2BD8A 4YT7H 5C1UA 1RGQA 1C5PA 1HV7A 1HNEE 1HAVB 2ZDKA 1ANDA 3K65B 1ANEA 4WMDA 1EB2A 1BA8B 1P8VC 2Y7XA 2WYJA 1YGCH 1ZMNA 2G52A 4KKDA 1ESTA 1HAXB 1LHDH 8ESTE 1KTTB 3A8AA 4O3UA 3A8CA 4AOQA 1FMGA 4NA8A 3SUGA 5EODA 2VWOA 3PV4A 1O3DA 4DT7B 1TAWA 3GY5A 4ZXYH 1SG8B 3ZVGA 3HGNA 2PUQH 1P06A 2ZI2H 1GHWH 2QYIA 2ESTE 2ZFQH 3SORA 5DPAA 1S5SA 3AAVA 1SBWA 1GHVH 2B8OH 2VVCA 3P8GA 3KQDA 3MH6A 1GJDB 2Y80A 4X1RU 5TCCA 3U9AH 4IC5A 4WWYA 4X8TH 1AU8A 1VITG 4IC6A 4BAMB 2QA9E 2BHGA 4RN6A 1Z8IB 1C5WB 1NY22 1D3PB 1XKBC 3PLPA 1O5FH 1V2PT 3CS7A 4UE7H 1ZJKA 3SQHE 4UDWH 1MKXK 1O2UA 2Y5FA 3S7HB 3T25A 1O3KA 1XUJA 4Z0KA 4KTSA 3A89A 1TABE 3V7TA 5C5NA 2WV4A 1TX6A 2P3UB 3LH1A 1YCPH 3VB3A 1AD8H 1DE7H 1TPPA 2ZTYA 1YYY1 4ABFA 2BY5X 1V2NT 1C5QA 1B0FA 1V2LT 1O3EA 2VJ1A 1XXDA 4XBCA 1AB9C 1T8OA 1W11U 1GCDA 3PWCA 3RXPA 1GBAA 3RXFA 1W12U 3SJOA 1V2ST 3E0PB 2XBVA 2PLXA 2FIRH 2O8LA 2EI8A 3RXQA 1ELBA 2KAIB 1NESE 3P8FA 4WMEA 3TK6A 1ZTJA 2GMTB 3GOVB 2FYQA 3EA7A 1O2ZA 1ZGVA 4CRGA 3MNSA 9LPRA 3BEFB 4X1NU 2FM2A 2GCTC 1NRNH 2G5NA 1UTOA 2YNAA 3RXDA 2GCHG 5CMXH 1GDQA 1XX9A 1ABJH 4HZHA 3B23B 1TGBA 2BY6X 2ZWLH 4Y11E 4E7NA 3SUEA 2GX4A 3GCOA 3U8RH 2ASUB 1FN8A 4AYVB 2Z9GA 1TBQH 3S9BA 1N1LA 4A7IB 5C1YA 1P9SA 3VGCC 2BD2A 3L6PA 1WQVH 1EPTC 3SGQE 5A0AE 4FVBA 2PW8H 1SSXA 1NT1A 1ZTLA 1TPAE 1IQNA 2FX4A 2WYGA 3HKJB 3KNXA 3Q77A 1C1TA 1NM6A 2BMGB 1CBWB 3ZVEA 1GPZA 4MNWA 2VH0A 3DFJA 2THFB 2ODYB 3SV6A 3IG6B 3WY8A 2AGEX 3S9AA 1O2WA 1IQGA 1P03A 3G01A 1A4WH 3EGKH 5C67A 1DXWA 5LPFA 1TWXB 1GGDC 4B2AA 4NWLA 2SNVA 4JK5A 5HGGA 1W10U 4NSYA 5H4IB 3FAOA 1K9OE 2ZNKH 3RU4D 3A81A 3GCHC 3BTFE 2ANKH 1GHAF 4RKOB 1A3BH 1VGCB 3BTWE 7GCHG 4ISOA 1AFEH 2YOLA 1AI8H 2O8UA 4UFGH 4AFUA 1UTPA 3V0XA 4XE4A 3MH5A 4YLUA 3M3SA 3R3GB 1T31A 1O30A 1BOQA 1EOJA 1GG6B 3UQVA 3D62A 1HAVA 3N7OA 1ANCA 3RXIA 3RXEA 5GDSH 1RRKA 4K3JA 4ZHAA 1OP2A 3UWJH 1BRBE 1GCTB 1D6WA 2Y5GA 3DA9B 2PHBA 2P3TB 3M3VA 4CH8B 2AIPA 1O3PB 4IMQA 3FP6E 5F8XA 3SV8A 1BZXE 1DLEA 2CGAA 2ZKSA 1DY8A 2F83A 2FPZA 4Q80A 1Y3WA 4XOJA 1PYTC 1HAPH 1VITF 1WTHD 2FESH 1QTFA 3JZ2B 3TNSA 1QQ4A 2Z9LA 1ZYOA 6ESTA 4GSOA 2J9NA 1GBMA 3H7OA 1CT4E 3LIWA 2FO9A 2STBE 2IOTA 3TJVA 2FS8A 2J92A 1F2SE 1W7GH 3RXVA 2HOBA 2RCEA 1G3EA 4GCHG 1ELAA 1GDUA 1G2LA 1UTQA 1GMHG 3SHCH 4ISNA 1FAKH 2D1JA 4HI3A 2W3KA 4IS5A 4X1PU 3TJNA 1BTHH 1HJAC 1O5EH 3TIUA 3GDVA 3FZDA 3F9HA 3TGKE 3S9CA 2PKSB 1FJSA 3TU7H 5FAHA 1P04A 1O2OA 1GJAB 1Z1IA 5JB9S 4F49A 1JRSA 2WPLS 1SLUB 1U6QA 1EXFA 2WUCA 1T4UH 3TK5A 1BRCE 1SVPA 1UO6A 1NU9A 2ZHDA 4BTTB 2A32A 2A1DB 3AASA 1SOZA 1OWHA 4CR5A 1EOLA 1N8OB 1ZMLA 1ELGA 3GY7A 2GCHF 3RM2H 2G8TA 1ETRH 4K1TA 3FP8E 1N6YA 2TGPZ 1INCA 1MTNC 1EP6A 1C2GA 3RC6A 1TX8A 4B76A 3MU1A 1L2EA 2P3FH 4CH2B 1MKWH 1C1PA 3BG4C 1O2GH 1XUHA 1O39A 3VB5A 5AF9H 1QJ7B 3SNEA 1J17T 4CRCA 1K22H 2FODA 2Y6TA 1FY5A 1LDTT 3P92A 2ZCKP 4IBLH 2C8ZB 1DITH 1C2EA 3RXTA 2ZHFH 1YPEH 3JZ1B 1TGNA 4XBDA 1OWIA 5GCHF 1EZSC 2HPQH 4HTCH 1HAGE 4TWYA 1EUFA 3ZVAA 2AYWA 1Z6EA 5FXLA 3K2UA 1HXFH 1FY3A 1O37A 1CGIE 4WXVA 2PTCE 1HFDA 5ESBA 1MMJN 3FZZA 1GG6C 1O2VA 3LKWA 1A2CH 2NU1E 2M5TA 4CBOA 4K5ZA 1DX5M 5G4BA 3PMHB 1GHZA 7GCHF 2FEQH 2SFAA 4MNYA 1AVXA 4J1YA 4B75A 1O3BA 3MI4A 4VGCC 1M9UA 3ATIA 1H9LB 4X1QU 9ESTA 1Y3VA 1D6RA 3OU0A 1GJBB 4JMYA 4I8HA 5DP3A 3STJA 2ALPA 2BQ7B 1Z7KA 2TGAA 3RMOH 1CQQA 3KHVA 1UJ1A 1O34A 1A61H 2ANMH 3M3TA 4K60A 4RKJB 2XC5A 2B0FA 1S0RA 4GAWA 4CRBA 1DM4B 2BDGA 2WUBA 4D9QA 1LVBA 1LVOA 3ZZDA 1ANBA 2VWNA 1CHOG 2P8OC 2G55A 1DSUA 2TBSA 3VB6A 5DP7A 1L4ZA 2OCVB 2OINA 2GKVE 1GI0A 5FPSA 2UWOA 4OS7A 2FTMA 2ZDVH 5DGJA 1EX3A 4OS2A 1O2HA 1IAUA 3GYLB 1ELVA 1JOUB 1GI9B 2NU3E 1HAIH 1ZHRA 3A83A 5L2ZH 5PTPA 5E0GA 3OX7U 4GCHF 5AFYH 2RA3A 1GMHF 5L2YH 1GI3A 4H42U 4QT8C 2GZ7A 4NZQA 3E0NB 3HATH 1QRWA 1LHFH 3A80A 3UIRA 1O2MA 3SU1A 4AG1A 1BTXA 1G3CA 1P12E 3QO6A 2SGDE 3SU2A 1GBHA 1QJ1B 2R3YA 1OWJA 1V2QT 3AW1A 1BHXB 1QBVH 3KF2A 4AFSA 5CE1A 1PPZA 1SFIA 2V6NA 1AQ7A 1L1GA 2FDAA 2G4TA 3PWBA 3O8CA 1J14A 1YKTA 5GXPA 4IGDA 3RXJA 4ZH8A 4D7FA 3GY6A 2Z9IA 5FX6A 1AFQC 2BOKA 2BZ6H 1ZOMA 4Y8ZA 2ZGHA 2K1QA 2O8MA 2QXJA 1MCVA 3C1KA 1LVYA 1YF4A 5CHAC 2AIQA 1L1JA 2ZFPH 2PR3A 4GPGA 1FI8A 1BHXF 2A4OA 4BTIB 1YPHE 1NFYA 1EAWA 1C5YB 2CJIA 3RXOA 1C4Y2 1FY1A 1KSNA 5F6MA 1O5CB 1OP8A 2P94A 4IW4E 3BTKE 1GL1A 3L3TA 1GI8B 1XUFA 4ZKNU 3BTDE 1SR5C 3PROA 4YM9A 2J94A 4X8SH 2A7JA 2HPPH 1O3OA 2VIPA 3QUMP 2D26C 1IQMA 1TGSZ 3E6PH 1OPHB 2H1UA 3F68H 2A2QH 1TMBH 3TNTA 1HUTH 4MG3A 3RXRA 2GT7A 1WU1A 3LU9B 3BIUH 5AHGH 1KXDA 1FPCH 1FONA 1P9UA 1HDTH 4K1SA 3NXPA 5FPYA 3SV7A 2ZZUH 5JPMH 2BD7A 1RIWC 5A0BA 3MTYA 1DY9A 3ZZCA 1DLKB 5L6NH 2VB0A 3CP7A 1GMDG 4ISIH 1YP9A 1AKSB 1Y59T 2PFEA 3LGWA 3LC3A 3W95A 3M7UA 3QDZB 2Z6BD 4Q7YA 1L4DA 3U8OH 2ANYA 2QAAA 1DS2E 2VIVA 2J4IA 3ODFA 2WV5A 1YC0A 4TYDA 2BDBA 3A7YA 2GDEH 3RLWH 3RUOA 3GY3A 3DD2H 1ZTKA 4B74A 2ZFSA 4LXBH 1RJXB 2HRVA 1GJ8B 1YPHC 2IPHA 3H5CB 2H6MA 1RXPA 4UEHH 1W0YH 3RU4T 3E8LA 1A1RA 2FLBH 1SOTA 2G00A 2EEKA 1K1JA 1WBGB 2G5VA 1CHOF 1P2JA 1Y3UA 2G4UA 1GBDA 2R0KA 1P11E 4UFFH 4MLFB 3SOSA 1PPEE 1Y5UT 3MU0A 5SGAE 1UVSH 6LPRA 3QZRA 3A7TA 4E05H 1NRPH 1S81A 5EQSA 1LHCH 2D8WA 2HNTC 1GHAG 1SGPE 1HBTH 1LKAA 1WV7H 7LPRA 1HAOH 2BDCA 3I29A 1ELCA 3RU4E 3QWCH 2EA3A 3SHAH 2UUYA 4I32A 3O8DA 1LQDB 1THPB 4FUBA 1JIMA 1HLTH 4U32A 4F4OC 4WY3A 2RA0A 1YLCA 1PQ5A 2BY9X 3SGBE 2O8WA 1H4WA 1SGDE 1MAXA 1ESBA 1T8LA 1F7ZA 2UUJB 1YCPK 5DP6A 1ZLRA 3P6ZB 2PGBB 4M7GA 1Y3YA 4ZMAH 2VINA 1GBCA 1H8DH 1TQ0B 1UVOA 5DP8A 1Z8GA 5B6OA 3A7WA 1TBZH 1TA2A 4NIVA 4X6PA 1W2KH 3DUXH 3T28A 5EXLA 1O2KA 1SFQB 1HPGA 1UHBA 5I25A 1C2KA 5JYIA 2BLVA 4DVAU 1OKXA 1B5GH 2Y7ZA 2SNWA 1GBJA 3ATWA 3AVZA 5JDUB 4MNVA 3SO3A 4IMZA 4TY6A 1CT0E 1UTNA 2SGQE 1C2HA 4MPVA 5HYOA 1LPGB 1C9PA 1KY9A 3RC5A 1Q2WA 2BQWB 2SGFE 1J16A 1PQ7A 5FBIA 1PPCE 5ESTE 4Y76A 3MO9A 1L1NA 4OS6A 5JBTA 1CVWH 3ITIA 1CU1A 3NK8A 2VIOA 1ZPCA 4Y8XA 3MMGA 4GVUA 4MDSA 1FV9A 2J95A 4YOJA 4JYTA 4X6OA 2UWPA 1KLTA 4AZ2B 1FDPA 3TVJB 2NWNA 3PMJA 1BITA 2BDHA 3ZZAA 1HJ9A 2F9PA 1EZXC 1VR1H 2SGAA 4H6SB 4AFZA 1W8BH 2ZGJA 1GBTA 4NA9H 1DXPA 3SNBA 4WMFA 1UVUH 1RFNA 2ZDLA 4MVNA 1RD3B 4JZEH 4X2VA 1DVAH 3M7TA 3LJJA 4MPUA 5DP9A 2GP9B 2XWBI 3TH4H 1SI5H 2Y82A 3BN9A 3BTHE 1GMDF 1O2SA 1P02A 1C5TA 4I31A 1LMWB 1BT7A 3FP7E 1CA0B 1ZJDA 3S0NA 3P70B 1O38A 1UTMA 3MU5A 1GBIA 2GZ8A 4XBBA 2LNCA 3HK3B 3LOXA 2XCNA 3VEQB 1Z8JB 3FVFB 3K6YA 5FCRA 4CR9A 3ESTA 3HPTB 3HGPA 1E0FD 2R2MB 1AKSA 1LPKB 2XWAA 1THRH 5DP4A 2AMQA 2OP9A 1QFKH 3MNXA 3UWIA 1QJ6B 2CF9H 2XC0A 1O3AA 5GCHG 3C27B 2VWLA 2W7SA 3T5FH 4JZ1A 5JBCS 3RXHA 3P95A 1D4PB 1BCUH 2FYRA 2A5AA 4BTUB 3RXAA 1PPHE 4AX9H 3ELAH 4UD9H 4X2WA 4DJZB 4FUFA 2AH4X 1G36A 2OD3B 2ZTXA 1V2OT 1O2NA 4CHAB 3PYHA 4FUEA 1TX7A 1S6FA 3NPSA 1DUEA 1CT2E 1NRSH 4E7RG 3MHWU 4ABGA 1PPGE 1O3MA 4A6LA 1D3DB 2ZEBA 4IN1A 2FX6A 1K1NA 2AEIH 1W13U 4YESB 2XBYA 1P2QA 3ATLA 1RTFB 1BUIA 1QNJA 3BTEE 1DDJA 2QC2A 1SLWB 4TPYA 3SNDA 1UCYE 2JKHA 4YOGA 1EPTA 3PLKA 3Q3XA 2SGEE 3GICB 6CHAB 1FPHH 5A8ZA 3OY5U 2W5EA 3UUZA 2EC9H 3FFGA 1TONA 3T62A 5JB8S 3OYPA 1C5XB 1FN6A 2GDDA 2ZFTA 4FU9A 5JBAS 4GUXA 4X8UH 4D9RA 3RDZA 4CRAA 1FY8E 2BD9A 2F9NA 4YOIA 3UR9A 1O5GH 2Z94A 4LZ1H 2C3SA 4JYVH 1T4VH 3S69A 5AVDA 2BDIA 1TNKA 2H9TH 1NRRH 1Q31A 3LJOA 2ZDNA 3ZYEA 1HYLA 4DOQA 5F8TA 1O32A 3O8BA 2VGCB 4CRFA 2OQ5A 4AORA 1ELDE 1UTKA 5EQQA 5FPTA 1A5GH 1O3GA 2PV9B 4Y6DA 1LO6A 3UREA 1TRMA 2ZPRA 4BAOB 4I8GA 2GMTC 2A7HA 2BZAA 2W7UA 2Q6DA 1WYKA 1S0QA 1V2KT 1F0UA 2FOGA 3S7KB 4D7GA 2OC0A 3IITA 1MKWK 1O2PA 2BOHB 1C5VA 2BD5A 4BAQB 1ZHPA 4GLYA 4INLA 1QL7A 1C1RA 3SV9A 2ODPA 1OOKB 1AVWA 1K1LA 1K21H 4A1XA 2IN2A 1W0ZU 3SUFA 1P57B 3RXMA 1QL9A 5EXMA 2LPRA 3ENSB 2H9EH 1SHHB 3NUMA 1QB1A 1OWDA 1GI2A 1DWDH 1ZSLA 2ZCHP 3A7XA 1SGCA 1O3NA 1CBWC 3D23A 1AIXH 1KXEA 1QR3E 2FI5E 5IDKA 1P3EA 1HAZB 1C2MA 4KTCA 3RXCA 1UVPA 2R3UA 3MU4A 4U2WA 1TIOA 2HLCA 3BTTE 4DIHH 3AAUA 5DG6A 1V2WT 3ZVBA 2CHAB 1E35B 1TRYA 2VVVA 3SU4A 3MYWA 2TPIZ 1D9IA 3LT3A 5EG4A 2BVXH 3BTME 3ATMA 3U69H 2FOBA 2VIDA 2F3CE 1P01A 1YPMH 4FUGA 2QXIA 1VGCC 1KDQB 1XUKA 2F9UA 3NZIA 4HFPB 3A87A 1BMLA 4U01A 3I78A 4A1VA 4LZ4B 2Y5HA 1OSSA 3PB1E 3EYDA 1ZSKA 3KQCA 4NA7A 3UOUA 1PPBH 1UCYH 4FVDA 1BBRE 3RXBA 3M61U 3VPKA 1G9IE 1CGHA 1GCTC 2WPIS 2Q6GA 1C5MD 3LGYA 1G37A 2UWLA 1SGTA 1DSTA 3T29A 2F9BH 5A2MH 2FS9A 1RTLA 5EW1H 1SC8U 2AMDA 4ASHA 3A82A 1SGEE 1QGFA 2C93B 2QXGA 1WSSH 3SJ8A 1C1NA 3KEEA 3A8BA 3E3TA 3GYMA 1AVGH 1CO7E 4NG9H 2A5KA 2XTTB 4X6MA 2NU2E 2BY7X 1AE8H 1F0SA 1TOCB 4AB9A 4O3TA 5TJXA 1ZHMA 2ZU5A 3T27A 3TH3H 3B9FH 4K8BA 3K6ZA 4Y71A 1P2MA 4DY7B 1K2I1 3ZVCA 3EDXB 2V3OH 5C1XA 4UFDH 2HWLB 1VITH 3KL6A 4AGKA 1IQLA 1TGCA 3SV2H 1DICA 2H9HA 2Z3CA 1KIGH 1UK3A 4YZUA 1W14U 1V2TT 5EQRA 5LPEA 1FZZA 2AFQB 2P16A 3TJUA 2OC1A 2B9LA 2QV1A 1YPLH 2JETB 2ZHQH 2PKSC 2XXLA 1TYNA 1O3FA 1GVLA 4ZXXH 2EI6A 4CBNA 1NFUA 2F9OA 5A8YA 1G3DA 1UTLM 3NKKA 3BEUA 5FHTA 1P09A 1TOMH 2QIQA 3LC5A 4XDEA 4GHQA 1LQEA 5ETXA 4THNH 2C8YB 3A85A 1UHBB 1ZMJA 1AZ8A 1AE5A 4KTUA 5K7RA 3FANA 1N8OC 1ZPZA 2FOMB 3QX5H 2HVXA 1FQ3A 2DUCA 2VVUA 2XBXA 3E90B 4OGYA 5EW2H 1LTOA 1IQIA 4FUHA 1FNIA 1C1QA 1FUJA 1OS8A 2OBOA 4NIWA 1GBLA 1TALA 1GJ7B 1P2OA 1O3IA 1GBBA 4OS1A 2OBQA 1DFPA 1C5ZB 2P59A 2A45B 1T7CA 1ELEE 4OS4A 1F5RA 5FBEA 2WPHS 1KXAA 3F9GA 3EQ0H 2FLRH 1C2LA 2I6QA 3M5LA 4INHA 2ZA5A 2ZO3H 5E2OA 1EZQA 1OYQA 3BG8A 1G32B 2ZU3A 3QN7A 3MOCA 1BMMH 2FOAA 4HGCA 4O03A 4ABIA 1QB9A 4I33A 4Q7ZA 4DURA 1AZZA 1BJUA 1FLEE 2C8XB 1ARCA 1XUGA 1JIRA 1MD8A 4WXIA 1MH0A 1BBRH 3LGTA 5A09A 1C2FA 1E34B 1H9IE 2VIQA 3CS0A 4YLQH 1ARBA 1HIAA 1FY4A 1GJ4H 1XKAC 1TGTA 1TFXA 1O3HA 1PQAA 2R0LA 4ISHH 2PKAA 2DE8A 5HM2A 3SU0A 1S6HA 1C1VH 1B0EA 1HB0B 4K8YA 3GY4A 1WCZA 5HM9A 1ID5H 3SUDA 2B5TB 4NSVA 3ZZBA 1GI7B 1UMAH 3UNSA 2FI4E 1KDQA 4AB8A 1RTKA 3BF6H 3MO6A 1NC6A 1WQSA 1PPFE 2PUXB 1ZRBA 4Y8YA 1ACBE 1X7AC 4X1SU 3F1SB 3A7VA 4KELA 3ZVFA 1S83A 1YLDA 1C9TA 1G2MA 1G3BA 4RSPA 4BNRA 3E91A 2BXTH 1OXGA 1GJ6A 1KYNA 5LGOA 3LGIA 4SGAE 4J2YB 1IHTH 3KIDU 1L0ZA 2BB4A 3VFEA 3RMLH 5LH8A 4FU8A 2VU8E 1AB9B 3EE0B 5J4QA 4K69A 2TGDA 2UUFB 5JBBS 4AN7A 6GCHG 2BVRH 1O35A 2ZFFH 5DJ7A 1YM0A 3SJIA 1IQHA 3NCLA 2A5IA 1NU7B 1DPOA 5T6GA 1BB0B 4O97A 1NFXA 3I77A 2A4QA 2TRMA 4INKA 2F9VA 1O3LA 1K1IA 1MAYA 1VCWA 3SU3A 3DFLA 1OWKA 2GCTB 2ZHEH 1MZDA 1SGNE 4TY7A 1NS3A 2CXVA 2WPMS 4K2YA 1TMTH 2JH5D 4R0IA 4Y79A 3TGIE 2XW9A 1FIZA 1AHTH 1TNHA 5C5OA 3KQEA 3SU5A 3TJOA 3PMBB 1VCPA 2AS9A 2ZFRH 1IHSH 1QRZA 1A5HA 3VGCB 1EPTB 1C5NH 1QBOA 4U30A 3V12A 3PO1B 1TRNA 3K9XB 5ABWA 1ZPBA 3EAJA 3TGJE 2XNIA 4B2CA 1K1PA 1N6XA 1QCPA 1V2VT 1J8AA 2OTVA 1FIWA 3T2NA 1GGDB 4JZDH 3VXEH 1CGJE 4I8LA 5GPIB 2QN5T 1AMHA 3F9EA 1J9CH 3QGNB 1DUAA 4B1TA 2ZP0H 4KP0A 1BTWA 2ODQA 1NFWA 5I46H 4ABAA 4WH6A 1QHRB 3GCHB 3GDSA 1O2XA 4AGJA 1KXBA 1EASA 4FUIA 4OGXA 3TPIZ 3UTUH 3TITA 4OS5A 3PM3A 4FXGH 3M36A 2VIWA 5DP5A 2J34A 1O2TA 2PWXA 3H7TA 1EP5A 1TNJA 2ZQ1A 5J4SA 3LGVA 2TIOA 2ZPQA 2EI7A 1O5BB 2GT8A 1C5OH 4ZUHA 1V2JT 2A4GA 2ZTZA 3HK6B 4YTAA 2ZDAH 1C1OA 1VJAU 3M37A 3DT0H 1ELTA 4FUDA 4BANB 1JXPA 2CN0H 4FU7A 1XM1A 1ZZZA 4BXSA 1GBEA 2OXSA 1QA7A 2H5CA 3GCTG 1Q3XA 3D49H 4AG2A 1T32A 2ANWA 4JZIA 4D76A 4DGJA 1E38B 3ZZ7A 3IWMA 2B7DH 3RM0H 4DW2U 3BIVH 4E06H 4ZHLU 4I7YH 5GJ4B 3VB4A 1O31A 3MU8A 1HCGA 1UVTH 1S85A 2FI3E 1C2DA 5F03A 1YBWA 1C1UH 2RDLA 1AUTC 2BDAA 2FXRA 2H5DA 1H1BA 1QL8A 1AWHB 1KXCA 2G81E 1EAUA 3EA8A 2BY8X 1P10A 3A8DA 1GHYH 1Y3XA 1QB6A 1ORFA 1TA6A 1WAYB 4MPWA 1AWFH 4ISLA 2BVSH 3SNCA 4NCYA 1AGJA 5EGMA 5A0CA 4JK6A 1MKXH 1HJAB 1OP0A 1ABIH 5E0HA 1C2IA 3A7ZA 2AMPA 4A1TA 3PLBA 3BV9B 1YPKH 1Y5BT 1VCQA 2C4FH 3UOPA 4O9VA 2STAE 4MPXA 6GCHF 4MNXA 4X2XA 3CENA 1NRQH 3ZZ6A 1MCTA 1TMUH 1P0SH 4A5TS 1F0RA 2A2XH 1KLJH 2W3IA 5EPYA 1GHXH 1SB1H 1AN1E 1IQKA 4ZAEA 1O5DH 4ABJA 2XC4A 3TK9A 4ABEA 2BX4A 3UNQA 1THSH 3PO1C 1O33A 1ZR0A 1DWEH 5FCKA 1XVOA 1EKBB 2PGQB 1GI4A 5BRRE 2FOCA 4X0WU 5C3NA 2BM2A 1BTYA 1NPMA 4ZHMU 2WINI 1A7SA 3BEIB 4WF8A 2WPKS 1MTNB 4JYUH 2GVFA 2NU0E 1P05A 1SGFA 2FOEA 1Z8RA 5FX5A 3LPRA 5A8XA 5LPRA 2R9PA 1EZUC 2J38A 2H2ZA 3BG4B 1GI5A 1XXFA 1UTJA 5GWZA 2WPJS 2FOFA 3QLPH 3URCA 2J2UA 4UONA 5DO4H 3STIA 4ABDA 1GJCB 2ALVA 4BXWA 3GY2A 1O2JA 3P8OA 4B73A 2AERH 1FXYA 2OC8A 4NIYA 1LCYA 3ZZ5A 3KCGH 1D3QB 1Z1JA 1HGTH 1LPZB 1CA8B 2ZGCA 4IN2A 3GISB 3SI4H 1O2LA 1MBQA 4TWWA 1GHBG 1AUJA 2P93A 1NO9H 1Y5AT 5K0HA 1H9HE 4Z6AH 2ZDMA 3PTNA 1V2MT 1GBKA 3ZVDA 1G30B 1MQ6A 1V2UT 2TGTA 2XYAA 1MBMA 2ZCLP 1GMCG 3GY8A 1BRUP 2YNBA 2PSYA 4VGCB 1GI1A 1O5AB 2QY0B 1SQTA 1HXEH 5F8ZA 1OWEA 2PTNA 1BIOA 2ZF0H 4WH8A 1A3EH 2XBWA 4JZFH 3BTGE 4A92A 2Z9KA 3M5NA 1C1MA 1DOJA 1LHEH 5T6DA 2R2WU 1LKBA 2ULLA 1EQ9A 4Y7BA 3V13A 3GCTF 3U1IB 1A46H 1UK2A 1NN6A 4ZROA 3M5MA 1MTWA 2JH6D 2HGTH 2P8OB 3RXGA 1D3TB 1V2RT 1S84A 3OY6U 1EJAA 3R0FA 2BDYA 3A86A 5AFZH 3UNRA 2BD3A 5EPNA 1Y8TA 3SNAA 1CA0C 1MQ5A 1JMOH 4K1EA 2GGVB 2V3HH 1TPSA 3A84A 4B2BA 3A88A 4DIIH 2BLWA 2Z3DA 1CE5A 1BMNH 1DWBH 5E8EH 1O3CA 1F5KU 3QGJA 3RXKA 1W3CA 1QRXA 3E1XB 4FUCA 3SJ9A 1BMAA 3RXSA 4Q2KA 1SLXB 2FZZA 2C8WB 3ODDA 1ETTH 1HIAB 1O2IA 2QGRA 1WTGH 1UCYK 1K28D 3LDXH 4YO9A 3MFJA 1O2YA 2O9QA 3RXLA 1A5IA 1BDAA 2PKAB 2A31A 3MH7A 3O8RA 3U8TH 1O2QA 4X8VH 3M35A 2GTBA 3ZZ4A 5BPEA 1Z71A 2KAIA 4CHAC 3RP2A 2ZG0H 1SQAA 2FMJA 3U98H 2A0QB 2ZHWH 1HRTH 1AFQB 4BAHB 1EATA 1C1WH 1PYTD 2P95A 1KXFA 3Q76A 4ABBA 1ZGIA 2OQUA 2CV3A 2QF0A 1IQFA 4YT6H 3SU6A 5CHAB 1JBUH 3NWUA 4X6NA 4CREA 1QY6A 2RG3A 3W94A 4NFFA 5T6FA 2F91A 2OUAA 4MQAA 5DK1A 4Y0YE 1TQ7B 3RXUA 3ZZ8A 4DG4A 2FOHA 1C4V2 1SL3A 6CHAC 2CMYA 3VXFH 4B71A 1XVMA 2BYAX 2O8TA 1ZSJA 3P17H 1Z6JH 2QXHA 2VNTA 1NTPA 1ETSH 3QTVH 1SGQE 2OC7A 2V35A 2HALA 2AGIX 1SPJA 1HAHH 3KGPA 5DKMA 2BLQA 1O0DH 1TE0A 5GIBA 3U1JB 1BTZA 1F0TA 1GDNA 3E16B 2VGCC 1A0LA 4BAKB 2Q6FA 3MNCA 3ZZ3A 1V6DA 4NGAH 1MU6B 3BSQA 1GHBF 2BD4A 1MUEB 1RIWB 4FUJA 2ZGXH 3LH3A 1YPJH 1MTSA 3L33A 1P3CA 8GCHG 1ELFA 3PMAB 1GMCF 1DWCH 1WOFA 2JH0D 1BQYA 2QF3A 5C2ZA 1B7XB 3VB7A 1C5SA 1C5LH 1E37B 4NZLA 3F6UH 3RLYH 1GI6A 3GDUA 3M7QA 4WJG2 1PFXC 1EJNA 1NZQH 3TLOA 5EOKA 4JCNA 1MD7A 5IYTA 4CRDA 1JRTA 1VJ9U 3HKIB 1EJMA 1GWAA 3ATKA 1UK4A 3V3MA 1SGFG 2PSXA 4GHTA 1C4U2 2CF8H 3SZNA 1SLVB 1SGIB 1BJVA 5L30H 4Y7AA 1BTUA 1F5LA 3QZQA 1LHGH 1QA0A 1GVZA 1SQOA 2ZU4A 4Y0ZE 3DHKH 4H6TA 1CSOE 1O36A 3F9FA 4R8TB 1BBRK 1FAXA 1SGYE 1T8MA 3MNBA 2DE9A 1LVMA 8KME2 1IOEA 4TPIZ 3LONA 4LOYH 4XSKU 3SGAE 1TNLA 1PJPA 8LPRA 1P2IA 3RC4A 5HMAA 3UPEA 5HXFA 2CHAC 1P2NA 1MU8B 1GJ5H 2Z7FE 4ZKRU 1C5RA 2BXUH 1EAIA 3RMMH 3T26A 1VZQH 1YCPM 2BX3A 1E36B 4WVPE 4MTBA 5E0JA 2Y81A 3OTJE 2GV6A 3KN2A 3P8NA 2FP7B 1KLIH 1QURH 1F92A 2XRCA 4KGAA 1IQJA 1PQ8A 1AY6H 1BRAA 3ZV8A 3MH4A 1RS0A 1GVKB 1QIXB 2Z3EA 1TB6H 1OYTH 1J15A 1A0JA 3UQOA 1C1SA 3AW0A 2ZPSA 2HNTF 2ZIQH 4PROA 1EB1H 3PTBA 2V0BA 2XCFA 1TLDA 2FTLE 3EA9A 3ZZ9A 3SI3H 4D8NA 2C90B 1MTVA 4LK4A 3UR6A 4ZKSU 1BTPA 2ZQ2A 3SQEE 2A7CA 1OX1A 2BQ6B 1NROH 3SJKA 1TBRH 2BLOA 4H4FA 1SMFE 4XFQA 4NIXA 1QQUA 2W26A 3RMNH 3QTOH 1H8IH 3SBKA 4NWKA 1TPOA 2VWMA 1HAYB 1SHYA 1XUIA 1DANH 4X2YA 3URDA 1C2JA 2QCYA 3TH2H 3GCNA 2Z9JA 4ABHA 1QBNA 2HNTE 3D65E 1TNIA 2ILNA 2BTCE 5T3HA 2ZC9H 4AFQA 1XMNB 5EXNA 2ZU2A 1MZAA 5EU8A 2NU4E 1GJ9B 3SN8A 4UFEH 4DCDA 3MWIU 2G51A 3UY9A 2AGGX 1WUNH 1O3JA 3SW2B 2GV7A 2ZU1A 1S82A 1T8NA 2FWWA 3BTQE 4Y10E 2A4RA 3LGUA 4AYYB 2IJOB 1O2RA 1CHGA 5C20A 1C5UA 2JETC 3ZV9A 1EAXA 3B8JA 4BOHA 2I6SA 3OSYA 2GD4B 1AO5A 3UFAA 4ZKOU 1K1MA 3QK1A 4I8KA 7KMEH 1ESAA 3KQBA 1KTSB 1V3XA 2OLGA 1K1OA 2GZ9A 3ZYDA 3Q3KA 3M5OA 1W7XH 2SGPE 1P2KA 1IQEA 2ZGBH 8GCHF 4I8JA 2Q1JA 2ZECA 1TNGA 3Q3YA 1YPGH 1JWTA 2VH6A 4Q7XA 5TCAA 1SGRE 2D2DA 1GBFA 1A0HB 3Q00A 5E2PA 4ESTE 4SGBE
chains in the Genus database with same CATH superfamily
1MTUA 2UUKB 7ESTE 1GL0E 1DT2A 3MO3A 1HJ8A 4NFEA 1ZRKA 2BD8A 3F0PA 4YT7H 1RGQA 5C1UA 4Z1MD 2WPDD 1C5PA 1HV7A 1HNEE 1HAVB 2ZDKA 1ANDA 3K65B 1ANEA 1WDIA 4WMDA 1EB2A 1BA8B 1P8VC 2XNDD 2Y7XA 2WYJA 1YGCH 1ZMNA 2G52A 2HLDD 1ESTA 1HAXB 4KKDA 1LHDH 8ESTE 1KTTB 3A8AA 4O3UA 3A8CA 4AOQA 1FMGA 4NA8A 3SUGA 5EODA 2VWOA 3PV4A 1O3DA 4DT7B 1TAWA 3GY5A 4ZXYH 1SG8B 3ZVGA 1H8ED 3HGNA 2PUQH 1P06A 2ZI2H 1GHWH 2QYIA 2ESTE 2ZFQH 3SORA 5DPAA 1S5SA 3AAVA 1SBWA 1GHVH 2B8OH 2VVCA 3P8GA 3KQDA 3MH6A 1GJDB 2Y80A 4X1RU 5TCCA 3U9AH 4IC5A 4WWYA 4X8TH 1AU8A 1VITG 4IC6A 4BAMB 2QA9E 2BHGA 4RN6A 1Z8IB 1C5WB 1NY22 1D3PB 1XKBC 3PLPA 1O5FH 1V2PT 3CS7A 4UE7H 1ZJKA 3SQHE 3F0OA 4UDWH 1MKXK 1O2UA 2Y5FA 3S7HB 3T25A 1O3KA 1XUJA 4Z0KA 4KTSA 3A89A 1TABE 3V7TA 5C5NA 2WV4A 1TX6A 2P3UB 3LH1A 1YCPH 3VB3A 1AD8H 1DE7H 1TPPA 2ZTYA 1YYY1 4ABFA 2BY5X 1V2NT 1C5QA 1B0FA 1V2LT 1O3EA 2VJ1A 1XXDA 4XBCA 1AB9C 1T8OA 1W11U 1GCDA 3PWCA 2LP6A 3RXPA 1GBAA 3RXFA 1W12U 3SJOA 1V2ST 3E0PB 2XBVA 2PLXA 2FIRH 2O8LA 2EI8A 3RXQA 1ELBA 2KAIB 1NESE 3P8FA 4WMEA 3TK6A 1ZTJA 2GMTB 3GOVB 2FYQA 3EA7A 3W1EA 1O2ZA 1ZGVA 4CRGA 3MNSA 3FOAA 1VKYA 9LPRA 3BEFB 4X1NU 2FM2A 2GCTC 1NRNH 2G5NA 1UTOA 2YNAA 3RXDA 2GCHG 5CMXH 1GDQA 1XX9A 1ABJH 4HZHA 3B23B 1TGBA 2BY6X 2ZWLH 4Y11E 4E7NA 3SUEA 2GX4A 3GCOA 3U8RH 2ASUB 1FN8A 4AYVB 2Z9GA 1TBQH 3S9BA 1N1LA 4A7IB 5C1YA 1P9SA 3VGCC 2BD2A 3L6PA 3F2FA 1WQVH 1EPTC 3SGQE 5A0AE 4FVBA 2PW8H 1SSXA 1NT1A 1ZTLA 1TPAE 1IQNA 2FX4A 2WYGA 3HKJB 3KNXA 3Q77A 1C1TA 1NM6A 2BMGB 1CBWB 3ZVEA 1GPZA 4MNWA 2VH0A 3DFJA 2THFB 2ODYB 3SV6A 3IG6B 3WY8A 2AGEX 3S9AA 1O2WA 1IQGA 1P03A 3G01A 1A4WH 3EGKH 5C67A 1DXWA 5LPFA 1TWXB 1GGDC 4B2AA 4NWLA 2SNVA 4JK5A 5HGGA 1W10U 4NSYA 5H4IB 3FAOA 5FL7D 1K9OE 2ZNKH 3RU4D 3A81A 3GCHC 3BTFE 2ANKH 1GHAF 4RKOB 1A3BH 1VGCB 3BTWE 7GCHG 4ISOA 1AFEH 2YOLA 1AI8H 5T1VA 2O8UA 5CDFE 4UFGH 4AFUA 1UTPA 3V0XA 4XE4A 3MH5A 4YLUA 3M3SA 5EIYA 3R3GB 1T31A 1O30A 1BOQA 1EOJA 1GG6B 3UQVA 3D62A 1HAVA 3N7OA 1ANCA 3RXIA 3RXEA 5GDSH 1RRKA 2VBCA 4K3JA 4ZHAA 1OP2A 3UWJH 1BRBE 1GCTB 1D6WA 2Y5GA 3DA9B 2PHBA 2P3TB 3M3VA 4CH8B 2AIPA 1O3PB 4IMQA 1UW7A 3FP6E 5F8XA 3SV8A 1BZXE 1DLEA 2CGAA 2ZKSA 1DY8A 2F83A 2WHXA 2FPZA 4Q80A 1Y3WA 4XOJA 1PYTC 1HAPH 1VITF 2J5UA 1WTHD 2FESH 1QTFA 3JZ2B 3KYFA 3TNSA 1QQ4A 2Z9LA 1ZYOA 6ESTA 4GSOA 2J9NA 1GBMA 3H7OA 1CT4E 3LIWA 2FO9A 2STBE 2IOTA 3TJVA 2FS8A 2J92A 1F2SE 1W7GH 3RXVA 2HOBA 2RCEA 1G3EA 4GCHG 1ELAA 1GDUA 1G2LA 1UTQA 1GMHG 3SHCH 4ISNA 1FAKH 2D1JA 4HI3A 2W3KA 4IS5A 4X1PU 3TJNA 1BTHH 1HJAC 1O5EH 3TIUA 3GDVA 3FZDA 3F9HA 3TGKE 3S9CA 2PKSB 1FJSA 3TU7H 5FAHA 1P04A 1O2OA 1GJAB 1YLNA 1Z1IA 5JB9S 4F49A 1JRSA 2WPLS 1SLUB 1U6QA 1EXFA 2WUCA 1T4UH 3TK5A 1BRCE 1SVPA 1UO6A 2GJGA 5KECA 1NU9A 2ZHDA 4BTTB 2A32A 2A1DB 3AASA 1SOZA 1OWHA 4CR5A 1EOLA 1N8OB 1ZMLA 1ELGA 3H09A 3GY7A 2GCHF 3RM2H 2G8TA 1ETRH 4K1TA 3KQ5A 3FP8E 1N6YA 2TGPZ 1INCA 3WWBA 1MTNC 1EP6A 1C2GA 3RC6A 1TX8A 4B76A 3MU1A 1L2EA 2P3FH 4CH2B 1MKWH 1C1PA 3BG4C 1O2GH 1XUHA 1O39A 3VB5A 5AF9H 1QJ7B 3SNEA 1J17T 4CRCA 1K22H 2FODA 2Y6TA 1FY5A 1LDTT 3N7EA 2ZCKP 3P92A 4IBLH 2C8ZB 1DITH 1C2EA 5C0TA 3RXTA 2ZHFH 1YPEH 3JZ1B 1TGNA 4XBDA 1OWIA 5GCHF 1EZSC 2HPQH 4HTCH 1HAGE 4TWYA 1EUFA 3ZVAA 1MABB 2AYWA 1Z6EA 5FXLA 3K2UA 1HXFH 1FY3A 1O37A 1CGIE 4WXVA 2PTCE 1HFDA 5ESBA 1MMJN 3FZZA 1GG6C 1O2VA 3LKWA 1A2CH 2NU1E 1QZ8A 2M5TA 4CBOA 4K5ZA 1DX5M 5G4BA 3PMHB 1GHZA 7GCHF 2FEQH 5KEDA 2SFAA 4MNYA 1AVXA 4J1YA 4B75A 1O3BA 3MI4A 4VGCC 1M9UA 3ATIA 1H9LB 4X1QU 9ESTA 1Y3VA 1D6RA 3OU0A 1GJBB 4JMYA 4I8HA 5DP3A 3STJA 2ALPA 2BQ7B 1Z7KA 2TGAA 2YMSC 3RMOH 1CQQA 4P02A 3KHVA 1UJ1A 1O34A 1A61H 2ANMH 3M3TA 4K60A 4RKJB 2XC5A 2B0FA 1S0RA 4GAWA 4CRBA 1DM4B 1SKYE 2BDGA 2WUBA 4D9QA 1LVBA 1LVOA 3ZZDA 1ANBA 2VWNA 1CHOG 2P8OC 2G55A 1DSUA 2TBSA 3VB6A 5DP7A 1L4ZA 2OCVB 5HKKD 2OINA 2GKVE 1GI0A 2LELA 5FPSA 3DCLA 2UWOA 4OS7A 2FTMA 2ZDVH 5DGJA 1EX3A 4OS2A 1O2HA 1IAUA 3GYLB 1ELVA 1JOUB 1GI9B 2NU3E 1HAIH 1ZHRA 3A83A 5L2ZH 5PTPA 5E0GA 3OX7U 4GCHF 2RFKC 5AFYH 2RA3A 1GMHF 2K0QA 5L2YH 1GI3A 4H42U 1E79D 4QT8C 2GZ7A 4NZQA 3E0NB 3HATH 1QRWA 1LHFH 3A80A 3UIRA 1O2MA 3SU1A 4AG1A 1BTXA 1G3CA 1P12E 3QO6A 2SGDE 3SU2A 1GBHA 2EY4C 1QJ1B 2R3YA 1OWJA 1V2QT 3AW1A 1BHXB 1QBVH 3KF2A 4AFSA 5CE1A 3FO8D 1PPZA 1SFIA 2V6NA 1AQ7A 1L1GA 2FDAA 2G4TA 3PWBA 3O8CA 1J14A 1YKTA 5GXPA 2IJD1 4IGDA 3RXJA 4ZH8A 4D7FA 3GY6A 2Z9IA 5FX6A 1AFQC 3DSOA 2BOKA 2BZ6H 1ZOMA 4Y8ZA 2ZGHA 2K1QA 2O8MA 2QXJA 1MCVA 3C1KA 1LVYA 2YMSD 1YF4A 5CHAC 2AIQA 1L1JA 3F2HA 2ZFPH 2PR3A 4XRNA 4GPGA 1FI8A 1BHXF 2A4OA 3F2GA 4BTIB 1YPHE 1NFYA 1EAWA 1C5YB 2CJIA 3RXOA 1C4Y2 1FY1A 1KSNA 5F6MA 1O5CB 1OP8A 2P94A 4IW4E 3BTKE 1GL1A 3L3TA 1GI8B 1XUFA 4ZKNU 3BTDE 1SR5C 3PROA 4YM9A 2J94A 4X8SH 2A7JA 2HPPH 3UAIC 1O3OA 2VIPA 3QUMP 2D26C 1IQMA 1TGSZ 3E6PH 1OPHB 2HVYB 2H1UA 3F68H 2A2QH 1TMBH 3TNTA 1HUTH 4MG3A 2K8IA 3RXRA 2GT7A 1WU1A 3LU9B 3BIUH 5AHGH 1KXDA 1FPCH 2JJ1D 1FONA 1P9UA 1HDTH 4K1SA 3NXPA 5FPYA 3SV7A 1W0KD 2ZZUH 5JPMH 2BD7A 1RIWC 5A0BA 3MTYA 1DY9A 3ZZCA 1DLKB 5L6NH 2VB0A 3CP7A 1GMDG 4ISIH 1YP9A 1AKSB 1Y59T 2PFEA 3LGWA 3LC3A 4RT1A 3W95A 3M7UA 3QDZB 2Z6BD 4Q7YA 1L4DA 3U8OH 2ANYA 2QAAA 1DS2E 2VIVA 2J4IA 3ODFA 2WV5A 1YC0A 4TYDA 2BDBA 3A7YA 2GDEH 3FN8A 3RLWH 3RUOA 3GY3A 3DD2H 1ZTKA 4B74A 2ZFSA 4LXBH 1RJXB 2HRVA 1GJ8B 1YPHC 2IPHA 3H5CB 2H6MA 1RXPA 4UEHH 1W0YH 3RU4T 3E8LA 1A1RA 2FLBH 1SOTA 2G00A 2EEKA 1K1JA 1WBGB 2G5VA 1CHOF 1P2JA 1Y3UA 2G4UA 1GBDA 2R0KA 1P11E 4UFFH 4MLFB 3DSGA 3SOSA 1PPEE 1Y5UT 3MU0A 5SGAE 1UVSH 6LPRA 3QZRA 3A7TA 4E05H 1NRPH 1S81A 5EQSA 1LHCH 2D8WA 2HNTC 1GHAG 1SGPE 1HBTH 1LKAA 1WV7H 7LPRA 1HAOH 2BDCA 3I29A 1ELCA 3RU4E 3QWCH 2EA3A 3SHAH 2UUYA 4I32A 3O8DA 1LQDB 1THPB 4FUBA 1JIMA 1HLTH 4U32A 4F4OC 4WY3A 2RA0A 1YLCA 1PQ5A 2BY9X 3SGBE 2O8WA 5EJLA 2W6ID 1H4WA 1SGDE 1MAXA 1NBME 1ESBA 1T8LA 1F7ZA 2UUJB 1YCPK 5DP6A 1ZLRA 3P6ZB 2PGBB 4M7GA 1Y3YA 4ZMAH 2VINA 1GBCA 1H8DH 1TQ0B 1UVOA 5DP8A 1Z8GA 5B6OA 3A7WA 1TBZH 2JIZD 1TA2A 4NIVA 4X6PA 1W2KH 3DUXH 3T28A 5EXLA 1O2KA 5DSFA 1SFQB 1HPGA 1UHBA 5I25A 1C2KA 5JYIA 2BLVA 4DVAU 1OKXA 1B5GH 2Y7ZA 2SNWA 1GBJA 3ATWA 3AVZA 5JDUB 4MNVA 3SO3A 3FKSD 4IMZA 4TY6A 1CT0E 1UTNA 2SGQE 1C2HA 4MPVA 5HYOA 1LPGB 1C9PA 1KY9A 3RC5A 1Q2WA 2BQWB 2SGFE 1J16A 1PQ7A 5FBIA 1PPCE 5F53A 5ESTE 4Y76A 3MO9A 1L1NA 4OS6A 5JBTA 1CVWH 3ITIA 1CU1A 3NK8A 2VIOA 1ZPCA 4Y8XA 3MMGA 4GVUA 4MDSA 1FV9A 2J95A 4YOJA 4JYTA 4X6OA 2UWPA 1KLTA 4AZ2B 1FDPA 4FOUC 3TVJB 1YWUA 2NWNA 3PMJA 1BITA 2BDHA 3ZZAA 1HJ9A 2F9PA 1EZXC 1VR1H 2SGAA 4H6SB 3WWFA 1W8BH 4AFZA 2ZGJA 1GBTA 4NA9H 1DXPA 3SNBA 4WMFA 1UVUH 1RFNA 2ZDLA 4MVNA 1RD3B 4JZEH 4X2VA 1DVAH 3M7TA 3LJJA 4MPUA 5DP9A 2GP9B 2XWBI 3TH4H 1SI5H 2Y82A 3BN9A 3BTHE 1GMDF 1O2SA 1P02A 1C5TA 4I31A 1LMWB 1BT7A 3FP7E 1CA0B 1ZJDA 3S0NA 3P70B 1O38A 1UTMA 3MU5A 1GBIA 2GZ8A 4AC9A 4XBBA 2LNCA 3HK3B 3LOXA 2XCNA 3VEQB 1Z8JB 3FVFB 3K6YA 5FCRA 4CR9A 3ESTA 3HPTB 3HGPA 1E0FD 2R2MB 1AKSA 1YY3A 1LPKB 2XWAA 1THRH 5DP4A 2AMQA 2OP9A 1QFKH 3MNXA 3UWIA 1QJ6B 2CF9H 2XC0A 1O3AA 5GCHG 3C27B 2VWLA 2W7SA 3T5FH 4JZ1A 4B6FA 5JBCS 3RXHA 3P95A 1D4PB 1BCUH 2FYRA 2A5AA 4BTUB 3RXAA 2J98A 1PPHE 4AX9H 3ELAH 4UD9H 4X2WA 4DJZB 4FUFA 2AH4X 1G36A 2OD3B 2ZTXA 1V2OT 1O2NA 4CHAB 3PYHA 4FUEA 1TX7A 1S6FA 3NPSA 1DUEA 1CT2E 1NRSH 4E7RG 3MHWU 4ABGA 1PPGE 1O3MA 3F3BA 4A6LA 4OM9A 1D3DB 2ZEBA 4IN1A 1NBMD 2FX6A 1K1NA 2AEIH 1W13U 4YESB 2XBYA 1P2QA 3ATLA 1RTFB 1BUIA 1QNJA 3BTEE 1DDJA 2QC2A 1SLWB 4TPYA 3SNDA 4M9FA 3U28C 1UCYE 2JKHA 4YOGA 1EPTA 3PLKA 3Q3XA 2SGEE 3GICB 6CHAB 1FPHH 5A8ZA 3OY5U 2W5EA 3UUZA 2EC9H 3FFGA 1TONA 3T62A 5JB8S 3OYPA 1C5XB 1FN6A 2GDDA 2ZFTA 4FU9A 5JBAS 4GUXA 4X8UH 4D9RA 3RDZA 4CRAA 1FY8E 2BD9A 2F9NA 4YOIA 3UR9A 1O5GH 2Z94A 4LZ1H 2C3SA 4JYVH 1T4VH 3S69A 5AVDA 2BDIA 4DT4A 1TNKA 2H9TH 1NRRH 1Q31A 3LJOA 2ZDNA 3ZYEA 1HYLA 4DOQA 5F8TA 1O32A 3O8BA 2VGCB 4CRFA 2OQ5A 4AORA 1ELDE 1UTKA 5EQQA 4P00A 5FPTA 1A5GH 1O3GA 2PV9B 4Y6DA 1LO6A 3UREA 1TRMA 2ZPRA 4BAOB 4I8GA 2GMTC 2A7HA 2BZAA 2W7UA 2Q6DA 1WYKA 1S0QA 1V2KT 1F0UA 3KYGA 2FOGA 3S7KB 4D7GA 2OC0A 4B6EA 3IITA 1MKWK 1O2PA 2BOHB 1C5VA 2BD5A 1E1RD 4BAQB 1ZHPA 4GLYA 4INLA 1QL7A 1C1RA 1KMHB 2ODPA 1OOKB 1AVWA 1K1LA 3SV9A 1K21H 4A1XA 2IN2A 1W0ZU 3SUFA 1P57B 3RXMA 1QL9A 5EXMA 2LPRA 3ENSB 2H9EH 1SHHB 3NUMA 1QB1A 1OWDA 1GI2A 1DWDH 1ZSLA 2ZCHP 3A7XA 1SGCA 1O3NA 1CBWC 3D23A 1AIXH 1KXEA 1QR3E 2FI5E 5IDKA 1P3EA 1HAZB 1C2MA 4KTCA 3RXCA 1UVPA 2R3UA 3MU4A 4U2WA 1TIOA 2HLCA 3BTTE 4DIHH 3AAUA 5DG6A 1V2WT 3ZVBA 2CHAB 1E35B 1TRYA 2VVVA 3SU4A 3MYWA 2TPIZ 1D9IA 4F55A 3LT3A 5EG4A 2BVXH 3BTME 3ATMA 3U69H 2FOBA 2M2AA 2VIDA 2F3CE 1P01A 1YPMH 4FUGA 2QXIA 1VGCC 1KDQB 1XUKA 2F9UA 3NZIA 4HFPB 3A87A 1BMLA 4U01A 3I78A 4A1VA 4LZ4B 2Y5HA 1OSSA 3PB1E 3EYDA 1ZSKA 3KQCA 4NA7A 3UOUA 1PPBH 1UCYH 4FVDA 1BBRE 3RXBA 3M61U 3VPKA 1G9IE 3OTPA 1CGHA 1GCTC 2WPIS 2Q6GA 1C5MD 5B6LA 3LGYA 1G37A 2UWLA 1SGTA 1DSTA 3T29A 2F9BH 5A2MH 2FS9A 1RTLA 5HIYA 5EW1H 1SC8U 2AMDA 4ASHA 3A82A 1SGEE 1QGFA 2C93B 5KGOA 2QXGA 1WSSH 3SJ8A 4FETA 1C1NA 3KEEA 3A8BA 3E3TA 3GYMA 1AVGH 1CO7E 4NG9H 2A5KA 2XTTB 4X6MA 2NU2E 2BY7X 1AE8H 1F0SA 1TOCB 4AB9A 4O3TA 2KCPA 5TJXA 1ZHMA 2ZU5A 3T27A 3TH3H 3B9FH 4K8BA 3K6ZA 4Y71A 5C17A 1P2MA 4DY7B 1K2I1 3ZVCA 3EDXB 2V3OH 2KFWA 5C1XA 4UFDH 2HWLB 1VITH 3KL6A 4AGKA 1IQLA 1TGCA 3SV2H 1DICA 4ASUD 2H9HA 2Z3CA 1KIGH 1UK3A 4YZUA 1W14U 1V2TT 5EQRA 5LPEA 1FZZA 2AFQB 2P16A 3TJUA 2OC1A 2B9LA 2QV1A 1YPLH 2JETB 2ZHQH 2F4LA 2PKSC 5EJ1A 2XXLA 1TYNA 3N7DA 1O3FA 1GVLA 4ZXXH 2EI6A 4CBNA 1NFUA 2F9OA 5A8YA 1G3DA 1UTLM 3NKKA 3BEUA 5FHTA 3ZIAD 1P09A 1TOMH 2QIQA 3LC5A 4XDEA 4GHQA 1LQEA 5ETXA 4THNH 2OK5A 2C8YB 3A85A 1UHBB 1ZMJA 1AZ8A 1AE5A 4KTUA 5K7RA 3FANA 1N8OC 1ZPZA 2FOMB 3QX5H 2HVXA 1FQ3A 2DUCA 2VVUA 2XBXA 3E90B 4OGYA 5EW2H 1LTOA 3OEED 1IQIA 4FUHA 1FNIA 1C1QA 4ACBA 1FUJA 1OS8A 2OBOA 4NIWA 1GBLA 1TALA 1GJ7B 1P2OA 1O3IA 1GBBA 4OS1A 2OBQA 1DFPA 1C5ZB 2P59A 2A45B 1T7CA 1ELEE 4OS4A 1E1QD 1F5RA 5FBEA 2WPHS 1KXAA 3F9GA 3EQ0H 2FLRH 1C2LA 2I6QA 3M5LA 4INHA 2ZA5A 2ZO3H 5E2OA 1EZQA 1OYQA 3BG8A 1G32B 2WZQA 2ZU3A 3MOCA 3QN7A 1BMMH 2FOAA 4HGCA 4O03A 4ABIA 1QB9A 4I33A 4Q7ZA 4DURA 1AZZA 1BJUA 1FLEE 2C8XB 1ARCA 1XUGA 1JIRA 1MD8A 4WXIA 1MH0A 1BBRH 3LGTA 5A09A 1C2FA 1E34B 1H9IE 2VIQA 3CS0A 4YLQH 1ARBA 1HIAA 1FY4A 1GJ4H 1XKAC 1TGTA 1TFXA 1O3HA 1PQAA 2R0LA 4ISHH 2PKAA 2DE8A 5HM2A 3SU0A 1S6HA 1C1VH 1B0EA 1HB0B 3PV5A 3GY4A 1WCZA 4K8YA 5HM9A 2QF5A 1ID5H 3SUDA 2B5TB 4NSVA 3ZZBA 1GI7B 3SZEA 1UMAH 3UNSA 2FI4E 1COWD 1KDQA 4AB8A 1RTKA 3BF6H 3MO6A 1NC6A 1WQSA 1PPFE 2PUXB 1ZRBA 4Y8YA 1ACBE 1X7AC 4X1SU 3F1SB 3A7VA 5GNDA 4KELA 3ZVFA 1S83A 1YLDA 1C9TA 1G2MA 1G3BA 4RSPA 4BNRA 3E91A 2BXTH 1OXGA 2L74A 1GJ6A 1KYNA 5LGOA 3LGIA 4SGAE 4J2YB 1IHTH 3KIDU 1L0ZA 2BB4A 3VFEA 4XD7D 3RMLH 5LH8A 4FU8A 2VU8E 1AB9B 3EE0B 5J4QA 4K69A 2TGDA 2UUFB 5JBBS 4AN7A 6GCHG 2BVRH 2J98B 1O35A 2ZFFH 5DJ7A 1YM0A 3SJIA 1IQHA 3NCLA 2A5IA 1NU7B 1OHHD 1DPOA 5T6GA 1BB0B 4O97A 1NFXA 3I77A 2A4QA 2TRMA 4INKA 2F9VA 1O3LA 1K1IA 3WW7A 1MAYA 1VCWA 3SU3A 3DFLA 1OWKA 2GCTB 2ZHEH 1MZDA 5EJZA 2F43B 2WSSD 1SGNE 4TY7A 1NS3A 2CXVA 2V7QD 2WPMS 4K2YA 1TMTH 2JH5D 4R0IA 4Y79A 3TGIE 2XW9A 1FIZA 1AHTH 1TNHA 5C5OA 3KQEA 3SU5A 3TJOA 3PMBB 1VCPA 2AS9A 2ZFRH 1IHSH 1QRZA 1A5HA 3VG8A 3MQKC 3VGCB 1EPTB 1C5NH 1QBOA 4U30A 3V12A 3PO1B 1TRNA 2KZ4A 3K9XB 5ABWA 1ZPBA 3EAJA 3TGJE 2XNIA 4B2CA 1K1PA 1N6XA 1QCPA 1V2VT 3N99A 1J8AA 2OTVA 2RDEA 1FIWA 3T2NA 1GGDB 3AK5A 4JZDH 3VXEH 1CGJE 4I8LA 5GPIB 2QN5T 1AMHA 3F9EA 1J9CH 3QGNB 1DUAA 4B1TA 2ZP0H 4KP0A 1BTWA 2ODQA 1NFWA 5I46H 4RI0A 4ABAA 4WH6A 1QHRB 3GCHB 3GDSA 1O2XA 4AGJA 1KXBA 1EASA 4FUIA 4OGXA 3TPIZ 3UTUH 3TITA 4OS5A 3PM3A 4FXGH 3M36A 2VIWA 5DP5A 2J34A 1O2TA 2PWXA 3NRLA 3H7TA 1EP5A 1TNJA 2ZQ1A 5J4SA 3LGVA 2IPQX 2TIOA 2ZPQA 2EI7A 1O5BB 2GT8A 1C5OH 4ZUHA 1V2JT 2A4GA 2ZTZA 3HK6B 4YTAA 2ZDAH 3OAAD 1C1OA 1VJAU 3M37A 3DT0H 1ELTA 4FUDA 4BANB 1JXPA 2CN0H 3PRDA 4FU7A 1XM1A 1ZZZA 5C94A 4BXSA 1GBEA 2OXSA 1QA7A 2CK3D 2H5CA 5CHBA 3GCTG 1Q3XA 3D49H 4AG2A 1T32A 2ANWA 4JZIA 4D76A 4DGJA 1E38B 3ZZ7A 3IWMA 2B7DH 3RM0H 4DW2U 3BIVH 4E06H 4ZHLU 4I7YH 4TSFD 5GJ4B 3VB4A 1O31A 3MU8A 1HCGA 1UVTH 1S85A 2FI3E 1C2DA 5F03A 1YBWA 1C1UH 2RDLA 1AUTC 2BDAA 2FXRA 2H5DA 1H1BA 1QL8A 1AWHB 1KXCA 2G81E 1EAUA 3EA8A 5C0UA 2BY8X 1P10A 3A8DA 1GHYH 2KCOA 1Y3XA 1QB6A 1ORFA 1TA6A 1WAYB 4MPWA 1AWFH 4ISLA 2BVSH 3SNCA 4NCYA 1AGJA 5EGMA 5A0CA 4JK6A 1MKXH 1HJAB 1OP0A 1ABIH 5E0HA 1C2IA 3A7ZA 2AMPA 4A1TA 3PLBA 3BV9B 1YPKH 1Y5BT 1VCQA 2C4FH 3UOPA 4O9VA 2STAE 4MPXA 6GCHF 4MNXA 4X2XA 3CENA 1NRQH 3ZZ6A 1MCTA 1TMUH 1P0SH 4A5TS 1F0RA 4TT3D 2A2XH 1KLJH 1BMFD 2W3IA 5EPYA 1GHXH 1SB1H 1AN1E 1IQKA 4ZAEA 1O5DH 4ABJA 3EE7A 2XC4A 3TK9A 4ABEA 2BX4A 3UNQA 1THSH 3PO1C 1O33A 1ZR0A 1DWEH 5FCKA 1XVOA 1EKBB 4Q63A 2PGQB 1GI4A 5BRRE 2FOCA 4X0WU 5C3NA 2BM2A 1BTYA 1NPMA 4ZHMU 2PP6A 2WINI 1A7SA 3BEIB 4WF8A 2WPKS 1MTNB 4JYUH 2GVFA 2NU0E 1P05A 1SGFA 2FOEA 1Z8RA 5FX5A 3LPRA 2KR7A 5A8XA 5LPRA 2R9PA 1EZUC 2J38A 2H2ZA 3BG4B 1GI5A 1XXFA 1UTJA 5GWZA 2WPJS 2FOFA 3QLPH 3URCA 2J2UA 4UONA 5DO4H 3OE7D 3STIA 4ABDA 1GJCB 2ALVA 4RT0A 4BXWA 3GY2A 1O2JA 3P8OA 4B73A 2AERH 1FXYA 2OC8A 4NIYA 1LCYA 3ZZ5A 2KCYA 3KCGH 1D3QB 1Z1JA 1HGTH 1LPZB 1CA8B 2ZGCA 4IN2A 3GISB 5HIZA 3SI4H 1O2LA 1MBQA 4TWWA 1GHBG 1AUJA 2P93A 1NO9H 1Y5AT 5K0HA 1H9HE 4Z6AH 2ZDMA 3PTNA 1V2MT 1GBKA 3ZVDA 1G30B 1MQ6A 1V2UT 2TGTA 2XYAA 1MBMA 2ZCLP 1GMCG 3OEHD 3GY8A 1BRUP 2YNBA 2PSYA 4VGCB 1GI1A 1O5AB 2QY0B 1SQTA 1HXEH 5F8ZA 1OWEA 2PTNA 1BIOA 2ZF0H 4WH8A 1A3EH 2XBWA 4JZFH 2YMSB 3BTGE 4A92A 2Z9KA 3M5NA 1C1MA 1DOJA 1LHEH 5T6DA 2R2WU 1LKBA 1SQRA 2ULLA 1EQ9A 4Y7BA 3V13A 3GCTF 3U1IB 1A46H 1UK2A 1NN6A 4ZROA 3M5MA 1MTWA 2JH6D 2HGTH 2P8OB 3RXGA 1D3TB 1V2RT 1S84A 3OY6U 1EJAA 3R0FA 2BDYA 3A86A 5AFZH 3UNRA 2BD3A 5EPNA 1Y8TA 3SNAA 2W6JD 1CA0C 4ACAA 1MQ5A 1JMOH 1K0HA 4K1EA 2GGVB 2V3HH 1TPSA 3A84A 4B2BA 3A88A 4DIIH 2BLWA 2Z3DA 1CE5A 1BMNH 1DWBH 5E8EH 1O3CA 1F5KU 3QGJA 3RXKA 2KCAA 4HG6A 1W3CA 1QRXA 2WV9A 3E1XB 4FUCA 3SJ9A 1BMAA 3RXSA 4Q2KA 1SLXB 2FZZA 1W0JD 2C8WB 3ODDA 1ETTH 3DSPA 1HIAB 1O2IA 2QGRA 1WTGH 1UCYK 1K28D 3LDXH 4YO9A 3MFJA 1O2YA 2O9QA 3RXLA 1A5IA 1BDAA 2PKAB 2A31A 3MH7A 3O8RA 3U8TH 1O2QA 4X8VH 3PRBA 5IK2D 2J97A 3M35A 2GTBA 3ZZ4A 2KX4A 5BPEA 4ZCNA 1Z71A 2KAIA 4CHAC 3RP2A 2ZG0H 1SQAA 1S6LA 2FMJA 3U98H 2A0QB 2ZHWH 1HRTH 1AFQB 4BAHB 1EATA 1C1WH 1PYTD 2P95A 1KXFA 3Q76A 4ABBA 1ZGIA 2OQUA 2CV3A 2QF0A 1IQFA 4YT6H 5DN6D 3SU6A 5CHAB 3CNRA 1JBUH 3NWUA 2KM0A 4X6NA 4CREA 1QY6A 2RG3A 3W94A 4NFFA 5T6FA 2F91A 2OUAA 4MQAA 5DK1A 4Y0YE 1TQ7B 3RXUA 3ZZ8A 4DG4A 2FOHA 1C4V2 1EFRD 1SL3A 6CHAC 2CMYA 3VXFH 4B71A 1XVMA 2BYAX 2O8TA 1ZSJA 3P17H 1Z6JH 2QXHA 2VNTA 1NTPA 1ETSH 1WXRA 3QTVH 1SGQE 2OC7A 2V35A 2HALA 2AGIX 1SPJA 1HAHH 3KGPA 5DKMA 2BLQA 1O0DH 1TE0A 5GIBA 3U1JB 1BTZA 1F0TA 1GDNA 3E16B 2VGCC 1A0LA 4BAKB 2Q6FA 3MNCA 3ZZ3A 1V6DA 4NGAH 1MU6B 3BSQA 1GHBF 2BD4A 1MUEB 1RIWB 4FUJA 2L6OA 2ZGXH 2JDID 3LH3A 1YPJH 1MTSA 3L33A 1P3CA 8GCHG 1ELFA 3PMAB 1GMCF 1DWCH 1WOFA 3OFND 2JH0D 1BQYA 2QF3A 5C2ZA 1B7XB 3VB7A 1C5SA 1C5LH 1E37B 4NZLA 3F6UH 3RLYH 1GI6A 3GDUA 3M7QA 4WJG2 1PFXC 1EJNA 1NZQH 3TLOA 5EOKA 4JCNA 1MD7A 1FX0B 5IYTA 4CRDA 1JRTA 1VJ9U 3HKIB 1EJMA 1GWAA 3ATKA 1UK4A 3V3MA 1SGFG 2PSXA 4GHTA 1C4U2 2CF8H 2V3MA 3SZNA 1SLVB 1SGIB 1BJVA 2QE7D 5L30H 4Y7AA 1BTUA 1F5LA 3QZQA 1LHGH 1QA0A 1GVZA 1SQOA 2ZU4A 4Y0ZE 3DHKH 2AHME 4H6TA 1CSOE 1O36A 3F9FA 4R8TB 1BBRK 1FAXA 1SGYE 1T8MA 3MNBA 2DE9A 1LVMA 8KME2 1IOEA 4TPIZ 3LONA 4LOYH 4Q4LA 4XSKU 4YXWD 3SGAE 1TNLA 1PJPA 8LPRA 1P2IA 3RC4A 5HMAA 3UPEA 5HXFA 2CHAC 1P2NA 1MU8B 1GJ5H 2Z7FE 4ZKRU 1C5RA 2BXUH 1EAIA 3RMMH 3T26A 1VZQH 1YCPM 2BX3A 1E36B 4WVPE 4MTBA 5E0JA 2Y81A 3OTJE 2GV6A 3KN2A 3P8NA 2FP7B 1KLIH 1QURH 1F92A 2XRCA 4KGAA 1IQJA 1PQ8A 1AY6H 1BRAA 3ZV8A 3MH4A 1RS0A 1GVKB 3PV2A 1QIXB 2JJ2D 2Z3EA 1TB6H 1OYTH 1J15A 1A0JA 3UQOA 1C1SA 3AW0A 2ZPSA 4I86A 2HNTF 2ZIQH 4PROA 2XOKD 1EB1H 3PTBA 2V0BA 2XCFA 2EQNA 1TLDA 2FTLE 3EA9A 3ZZ9A 3SI3H 4D8NA 2C90B 1MTVA 4LK4A 3UR6A 2QF4A 4ZKSU 1BTPA 2ZQ2A 3SQEE 2A7CA 1OX1A 2BQ6B 1NROH 3SJKA 1TBRH 2BLOA 4H4FA 1SMFE 4XFQA 4NIXA 1QQUA 2W26A 3RMNH 3QTOH 1H8IH 3SBKA 4NWKA 1TPOA 2VWMA 1HAYB 1SHYA 1XUIA 1DANH 4X2YA 3URDA 1C2JA 2QCYA 3TH2H 3GCNA 4F48B 2Z9JA 4ABHA 1QBNA 2HNTE 3D65E 1TNIA 2ILNA 2BTCE 5T3HA 2ZC9H 4AFQA 1XMNB 3SYJA 5EXNA 2ZU2A 1MZAA 5EU8A 2NU4E 1GJ9B 3SN8A 4UFEH 4DCDA 3MWIU 2G51A 3UY9A 2AGGX 1WUNH 1O3JA 3SW2B 2GV7A 2ZU1A 1S82A 1T8NA 2FWWA 3BTQE 4Y10E 2A4RA 3LGUA 4AYYB 3GS9A 2IJOB 1O2RA 1CHGA 5C20A 1C5UA 2JETC 3ZV9A 1EAXA 3B8JA 4BOHA 2I6SA 3OSYA 2GD4B 1AO5A 3UFAA 1H8HD 4ZKOU 1K1MA 3QK1A 4I8KA 7KMEH 1ESAA 3KQBA 1KTSB 1V3XA 2OLGA 1K1OA 2GZ9A 3ZYDA 3Q3KA 3M5OA 1W7XH 2SGPE 1P2KA 1IQEA 2ZGBH 3UB0A 8GCHF 4I8JA 2Q1JA 2ZECA 1TNGA 3Q3YA 1YPGH 1JWTA 2VH6A 4Q7XA 5TCAA 1SGRE 2D2DA 1GBFA 1A0HB 3Q00A 5E2PA 4ESTE 4SGBE
chains in the Genus database with same CATH topology
1MTUA 2UUKB 7ESTE 1GL0E 1DT2A 3MO3A 1HJ8A 4NFEA 1ZRKA 2BD8A 4YT7H 5C1UA 1RGQA 1C5PA 1HV7A 1HNEE 1HAVB 2ZDKA 1ANDA 3K65B 1ANEA 4WMDA 1EB2A 1BA8B 1P8VC 2Y7XA 2WYJA 1YGCH 1ZMNA 2G52A 4KKDA 1ESTA 1HAXB 1LHDH 8ESTE 1KTTB 3A8AA 4O3UA 3A8CA 4AOQA 1FMGA 4NA8A 3SUGA 5EODA 2VWOA 3PV4A 1O3DA 4DT7B 1TAWA 3GY5A 4ZXYH 1SG8B 3ZVGA 3HGNA 2PUQH 1P06A 2ZI2H 1GHWH 2QYIA 2ESTE 2ZFQH 3SORA 5DPAA 1S5SA 3AAVA 1SBWA 1GHVH 2B8OH 2VVCA 3P8GA 3KQDA 3MH6A 1GJDB 2Y80A 4X1RU 5TCCA 3U9AH 4IC5A 4WWYA 4X8TH 1AU8A 1VITG 4IC6A 4BAMB 2QA9E 2BHGA 4RN6A 1Z8IB 1C5WB 1NY22 1D3PB 1XKBC 3PLPA 1O5FH 1V2PT 3CS7A 4UE7H 1ZJKA 3SQHE 4UDWH 1MKXK 1O2UA 2Y5FA 3S7HB 3T25A 1O3KA 1XUJA 4Z0KA 4KTSA 3A89A 1TABE 3V7TA 5C5NA 2WV4A 1TX6A 2P3UB 3LH1A 1YCPH 3VB3A 1AD8H 1DE7H 1TPPA 2ZTYA 1YYY1 4ABFA 2BY5X 1V2NT 1C5QA 1B0FA 1V2LT 1O3EA 2VJ1A 1XXDA 4XBCA 1AB9C 1T8OA 1W11U 1GCDA 3PWCA 3RXPA 1GBAA 3RXFA 1W12U 3SJOA 1V2ST 3E0PB 2XBVA 2PLXA 2FIRH 2O8LA 2EI8A 3RXQA 1ELBA 2KAIB 1NESE 3P8FA 4WMEA 3TK6A 1ZTJA 2GMTB 3GOVB 2FYQA 3EA7A 1O2ZA 1ZGVA 4CRGA 3MNSA 9LPRA 3BEFB 4X1NU 2FM2A 2GCTC 1NRNH 2G5NA 1UTOA 2YNAA 3RXDA 2GCHG 5CMXH 1GDQA 1XX9A 1ABJH 4HZHA 3B23B 1TGBA 2BY6X 2ZWLH 4Y11E 4E7NA 3SUEA 2GX4A 3GCOA 3U8RH 2ASUB 1FN8A 4AYVB 2Z9GA 1TBQH 3S9BA 1N1LA 4A7IB 5C1YA 1P9SA 3VGCC 2BD2A 3L6PA 1WQVH 1EPTC 3SGQE 5A0AE 4FVBA 2PW8H 1SSXA 1NT1A 1ZTLA 1TPAE 1IQNA 2FX4A 2WYGA 3HKJB 3KNXA 3Q77A 1C1TA 1NM6A 2BMGB 1CBWB 3ZVEA 1GPZA 4MNWA 2VH0A 3DFJA 2THFB 2ODYB 3SV6A 3IG6B 3WY8A 2AGEX 3S9AA 1O2WA 1IQGA 1P03A 3G01A 1A4WH 3EGKH 5C67A 1DXWA 5LPFA 1TWXB 1GGDC 4B2AA 4NWLA 2SNVA 4JK5A 5HGGA 1W10U 4NSYA 5H4IB 3FAOA 1K9OE 2ZNKH 3RU4D 3A81A 3GCHC 3BTFE 2ANKH 1GHAF 4RKOB 1A3BH 1VGCB 3BTWE 7GCHG 4ISOA 1AFEH 2YOLA 1AI8H 2O8UA 4UFGH 4AFUA 1UTPA 3V0XA 4XE4A 3MH5A 4YLUA 3M3SA 3R3GB 1T31A 1O30A 1BOQA 1EOJA 1GG6B 3UQVA 3D62A 1HAVA 3N7OA 1ANCA 3RXIA 3RXEA 5GDSH 1RRKA 4K3JA 4ZHAA 1OP2A 3UWJH 1BRBE 1GCTB 1D6WA 2Y5GA 3DA9B 2PHBA 2P3TB 3M3VA 4CH8B 2AIPA 1O3PB 4IMQA 3FP6E 5F8XA 3SV8A 1BZXE 1DLEA 2CGAA 2ZKSA 1DY8A 2F83A 2FPZA 4Q80A 1Y3WA 4XOJA 1PYTC 1HAPH 1VITF 1WTHD 2FESH 1QTFA 3JZ2B 3TNSA 1QQ4A 2Z9LA 1ZYOA 6ESTA 4GSOA 2J9NA 1GBMA 3H7OA 1CT4E 3LIWA 2FO9A 2STBE 2IOTA 3TJVA 2FS8A 2J92A 1F2SE 1W7GH 3RXVA 2HOBA 2RCEA 1G3EA 4GCHG 1ELAA 1GDUA 1G2LA 1UTQA 1GMHG 3SHCH 4ISNA 1FAKH 2D1JA 4HI3A 2W3KA 4IS5A 4X1PU 3TJNA 1BTHH 1HJAC 1O5EH 3TIUA 3GDVA 3FZDA 3F9HA 3TGKE 3S9CA 2PKSB 1FJSA 3TU7H 5FAHA 1P04A 1O2OA 1GJAB 1Z1IA 5JB9S 4F49A 1JRSA 2WPLS 1SLUB 1U6QA 1EXFA 2WUCA 1T4UH 3TK5A 1BRCE 1SVPA 1UO6A 1NU9A 2ZHDA 4BTTB 2A32A 2A1DB 3AASA 1SOZA 1OWHA 4CR5A 1EOLA 1N8OB 1ZMLA 1ELGA 3GY7A 2GCHF 3RM2H 2G8TA 1ETRH 4K1TA 3FP8E 1N6YA 2TGPZ 1INCA 1MTNC 1EP6A 1C2GA 3RC6A 1TX8A 4B76A 3MU1A 1L2EA 2P3FH 4CH2B 1MKWH 1C1PA 3BG4C 1O2GH 1XUHA 1O39A 3VB5A 5AF9H 1QJ7B 3SNEA 1J17T 4CRCA 1K22H 2FODA 2Y6TA 1FY5A 1LDTT 3P92A 2ZCKP 4IBLH 2C8ZB 1DITH 1C2EA 3RXTA 2ZHFH 1YPEH 3JZ1B 1TGNA 4XBDA 1OWIA 5GCHF 1EZSC 2HPQH 4HTCH 1HAGE 4TWYA 1EUFA 3ZVAA 2AYWA 1Z6EA 5FXLA 3K2UA 1HXFH 1FY3A 1O37A 1CGIE 4WXVA 2PTCE 1HFDA 5ESBA 1MMJN 3FZZA 1GG6C 1O2VA 3LKWA 1A2CH 2NU1E 2M5TA 4CBOA 4K5ZA 1DX5M 5G4BA 3PMHB 1GHZA 7GCHF 2FEQH 2SFAA 4MNYA 1AVXA 4J1YA 4B75A 1O3BA 3MI4A 4VGCC 1M9UA 3ATIA 1H9LB 4X1QU 9ESTA 1Y3VA 1D6RA 3OU0A 1GJBB 4JMYA 4I8HA 5DP3A 3STJA 2ALPA 2BQ7B 1Z7KA 2TGAA 3RMOH 1CQQA 3KHVA 1UJ1A 1O34A 1A61H 2ANMH 3M3TA 4K60A 4RKJB 2XC5A 2B0FA 1S0RA 4GAWA 4CRBA 1DM4B 2BDGA 2WUBA 4D9QA 1LVBA 1LVOA 3ZZDA 1ANBA 2VWNA 1CHOG 2P8OC 2G55A 1DSUA 2TBSA 3VB6A 5DP7A 1L4ZA 2OCVB 2OINA 2GKVE 1GI0A 5FPSA 2UWOA 4OS7A 2FTMA 2ZDVH 5DGJA 1EX3A 4OS2A 1O2HA 1IAUA 3GYLB 1ELVA 1JOUB 1GI9B 2NU3E 1HAIH 1ZHRA 3A83A 5L2ZH 5PTPA 5E0GA 3OX7U 4GCHF 5AFYH 2RA3A 1GMHF 5L2YH 1GI3A 4H42U 4QT8C 2GZ7A 4NZQA 3E0NB 3HATH 1QRWA 1LHFH 3A80A 3UIRA 1O2MA 3SU1A 4AG1A 1BTXA 1G3CA 1P12E 3QO6A 2SGDE 3SU2A 1GBHA 1QJ1B 2R3YA 1OWJA 1V2QT 3AW1A 1BHXB 1QBVH 3KF2A 4AFSA 5CE1A 1PPZA 1SFIA 2V6NA 1AQ7A 1L1GA 2FDAA 2G4TA 3PWBA 3O8CA 1J14A 1YKTA 5GXPA 4IGDA 3RXJA 4ZH8A 4D7FA 3GY6A 2Z9IA 5FX6A 1AFQC 2BOKA 2BZ6H 1ZOMA 4Y8ZA 2ZGHA 2K1QA 2O8MA 2QXJA 1MCVA 3C1KA 1LVYA 1YF4A 5CHAC 2AIQA 1L1JA 2ZFPH 2PR3A 4GPGA 1FI8A 1BHXF 2A4OA 4BTIB 1YPHE 1NFYA 1EAWA 1C5YB 2CJIA 3RXOA 1C4Y2 1FY1A 1KSNA 5F6MA 1O5CB 1OP8A 2P94A 4IW4E 3BTKE 1GL1A 3L3TA 1GI8B 1XUFA 4ZKNU 3BTDE 1SR5C 3PROA 4YM9A 2J94A 4X8SH 2A7JA 2HPPH 1O3OA 2VIPA 3QUMP 2D26C 1IQMA 1TGSZ 3E6PH 1OPHB 2H1UA 3F68H 2A2QH 1TMBH 3TNTA 1HUTH 4MG3A 3RXRA 2GT7A 1WU1A 3LU9B 3BIUH 5AHGH 1KXDA 1FPCH 1FONA 1P9UA 1HDTH 4K1SA 3NXPA 5FPYA 3SV7A 2ZZUH 5JPMH 2BD7A 1RIWC 5A0BA 3MTYA 1DY9A 3ZZCA 1DLKB 5L6NH 2VB0A 3CP7A 1GMDG 4ISIH 1YP9A 1AKSB 1Y59T 2PFEA 3LGWA 3LC3A 3W95A 3M7UA 3QDZB 2Z6BD 4Q7YA 1L4DA 3U8OH 2ANYA 2QAAA 1DS2E 2VIVA 2J4IA 3ODFA 2WV5A 1YC0A 4TYDA 2BDBA 3A7YA 2GDEH 3RLWH 3RUOA 3GY3A 3DD2H 1ZTKA 4B74A 2ZFSA 4LXBH 1RJXB 2HRVA 1GJ8B 1YPHC 2IPHA 3H5CB 2H6MA 1RXPA 4UEHH 1W0YH 3RU4T 3E8LA 1A1RA 2FLBH 1SOTA 2G00A 2EEKA 1K1JA 1WBGB 2G5VA 1CHOF 1P2JA 1Y3UA 2G4UA 1GBDA 2R0KA 1P11E 4UFFH 4MLFB 3SOSA 1PPEE 1Y5UT 3MU0A 5SGAE 1UVSH 6LPRA 3QZRA 3A7TA 4E05H 1NRPH 1S81A 5EQSA 1LHCH 2D8WA 2HNTC 1GHAG 1SGPE 1HBTH 1LKAA 1WV7H 7LPRA 1HAOH 2BDCA 3I29A 1ELCA 3RU4E 3QWCH 2EA3A 3SHAH 2UUYA 4I32A 3O8DA 1LQDB 1THPB 4FUBA 1JIMA 1HLTH 4U32A 4F4OC 4WY3A 2RA0A 1YLCA 1PQ5A 2BY9X 3SGBE 2O8WA 1H4WA 1SGDE 1MAXA 1ESBA 1T8LA 1F7ZA 2UUJB 1YCPK 5DP6A 1ZLRA 3P6ZB 2PGBB 4M7GA 1Y3YA 4ZMAH 2VINA 1GBCA 1H8DH 1TQ0B 1UVOA 5DP8A 1Z8GA 5B6OA 3A7WA 1TBZH 1TA2A 4NIVA 4X6PA 1W2KH 3DUXH 3T28A 5EXLA 1O2KA 1SFQB 1HPGA 1UHBA 5I25A 1C2KA 5JYIA 2BLVA 4DVAU 1OKXA 1B5GH 2Y7ZA 2SNWA 1GBJA 3ATWA 3AVZA 5JDUB 4MNVA 3SO3A 4IMZA 4TY6A 1CT0E 1UTNA 2SGQE 1C2HA 4MPVA 5HYOA 1LPGB 1C9PA 1KY9A 3RC5A 1Q2WA 2BQWB 2SGFE 1J16A 1PQ7A 5FBIA 1PPCE 5ESTE 4Y76A 3MO9A 1L1NA 4OS6A 5JBTA 1CVWH 3ITIA 1CU1A 3NK8A 2VIOA 1ZPCA 4Y8XA 3MMGA 4GVUA 4MDSA 1FV9A 2J95A 4YOJA 4JYTA 4X6OA 2UWPA 1KLTA 4AZ2B 1FDPA 3TVJB 2NWNA 3PMJA 1BITA 2BDHA 3ZZAA 1HJ9A 2F9PA 1EZXC 1VR1H 2SGAA 4H6SB 4AFZA 1W8BH 2ZGJA 1GBTA 4NA9H 1DXPA 3SNBA 4WMFA 1UVUH 1RFNA 2ZDLA 4MVNA 1RD3B 4JZEH 4X2VA 1DVAH 3M7TA 3LJJA 4MPUA 5DP9A 2GP9B 2XWBI 3TH4H 1SI5H 2Y82A 3BN9A 3BTHE 1GMDF 1O2SA 1P02A 1C5TA 4I31A 1LMWB 1BT7A 3FP7E 1CA0B 1ZJDA 3S0NA 3P70B 1O38A 1UTMA 3MU5A 1GBIA 2GZ8A 4XBBA 2LNCA 3HK3B 3LOXA 2XCNA 3VEQB 1Z8JB 3FVFB 3K6YA 5FCRA 4CR9A 3ESTA 3HPTB 3HGPA 1E0FD 2R2MB 1AKSA 1LPKB 2XWAA 1THRH 5DP4A 2AMQA 2OP9A 1QFKH 3MNXA 3UWIA 1QJ6B 2CF9H 2XC0A 1O3AA 5GCHG 3C27B 2VWLA 2W7SA 3T5FH 4JZ1A 5JBCS 3RXHA 3P95A 1D4PB 1BCUH 2FYRA 2A5AA 4BTUB 3RXAA 1PPHE 4AX9H 3ELAH 4UD9H 4X2WA 4DJZB 4FUFA 2AH4X 1G36A 2OD3B 2ZTXA 1V2OT 1O2NA 4CHAB 3PYHA 4FUEA 1TX7A 1S6FA 3NPSA 1DUEA 1CT2E 1NRSH 4E7RG 3MHWU 4ABGA 1PPGE 1O3MA 4A6LA 1D3DB 2ZEBA 4IN1A 2FX6A 1K1NA 2AEIH 1W13U 4YESB 2XBYA 1P2QA 3ATLA 1RTFB 1BUIA 1QNJA 3BTEE 1DDJA 2QC2A 1SLWB 4TPYA 3SNDA 1UCYE 2JKHA 4YOGA 1EPTA 3PLKA 3Q3XA 2SGEE 3GICB 6CHAB 1FPHH 5A8ZA 3OY5U 2W5EA 3UUZA 2EC9H 3FFGA 1TONA 3T62A 5JB8S 3OYPA 1C5XB 1FN6A 2GDDA 2ZFTA 4FU9A 5JBAS 4GUXA 4X8UH 4D9RA 3RDZA 4CRAA 1FY8E 2BD9A 2F9NA 4YOIA 3UR9A 1O5GH 2Z94A 4LZ1H 2C3SA 4JYVH 1T4VH 3S69A 5AVDA 2BDIA 1TNKA 2H9TH 1NRRH 1Q31A 3LJOA 2ZDNA 3ZYEA 1HYLA 4DOQA 5F8TA 1O32A 3O8BA 2VGCB 4CRFA 2OQ5A 4AORA 1ELDE 1UTKA 5EQQA 5FPTA 1A5GH 1O3GA 2PV9B 4Y6DA 1LO6A 3UREA 1TRMA 2ZPRA 4BAOB 4I8GA 2GMTC 2A7HA 2BZAA 2W7UA 2Q6DA 1WYKA 1S0QA 1V2KT 1F0UA 2FOGA 3S7KB 4D7GA 2OC0A 3IITA 1MKWK 1O2PA 2BOHB 1C5VA 2BD5A 4BAQB 1ZHPA 4GLYA 4INLA 1QL7A 1C1RA 3SV9A 2ODPA 1OOKB 1AVWA 1K1LA 1K21H 4A1XA 2IN2A 1W0ZU 3SUFA 1P57B 3RXMA 1QL9A 5EXMA 2LPRA 3ENSB 2H9EH 1SHHB 3NUMA 1QB1A 1OWDA 1GI2A 1DWDH 1ZSLA 2ZCHP 3A7XA 1SGCA 1O3NA 1CBWC 3D23A 1AIXH 1KXEA 1QR3E 2FI5E 5IDKA 1P3EA 1HAZB 1C2MA 4KTCA 3RXCA 1UVPA 2R3UA 3MU4A 4U2WA 1TIOA 2HLCA 3BTTE 4DIHH 3AAUA 5DG6A 1V2WT 3ZVBA 2CHAB 1E35B 1TRYA 2VVVA 3SU4A 3MYWA 2TPIZ 1D9IA 3LT3A 5EG4A