4K3JA

Crystal structure of onartuzumab fab in complex with met and hgf-beta
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
227
structure length
227
Chain Sequence
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGSTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Monovalent antibody design and mechanism of action of onartuzumab, a MET antagonist with anti-tumor activity as a therapeutic agent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system/growth factor
total genus 46
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k3jA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k3jA01
2GMTB 2XBXA 3P6ZB 4YOGA 4YT7H 1C5PA 1EZSC 3BG8A 3ZVFA 2OC8A 3EA8A 3F9HA 3E6PH 4I31A 1BCUH 1K1OA 2LPRA 4ASHA 2CMYA 3BTFE 2FDAA 1HAGE 3D65E 4I8JA 1DWEH 1BB0B 1GJ8B 3CENA 3FP6E 3ENSB 1F92A 1NN6A 1BMAA 1O3BA 4J1YA 2A45B 3SGQE 4U01A 4KTSA 4BXWA 1XKAC 3RXCA 3RXKA 1GMHG 5FPTA 4GSOA 2JKHA 4IN1A 1IQGA 4INLA 4M7GA 2XW9A 4BTTB 2SFAA 3TNTA 4ZKSU 1O2OA 4Y71A 1MAXA 1THSH 3KEEA 2F83A 1PPFE 2PR3A 4BTUB 3K9XB 3RXRA 1QHRB 4I33A 1GI3A 3W95A 4Y11E 1Y3WA 2J92A 1C1UH 1QBOA 2A2XH 3RXBA 2A5KA 2XC0A 2FOEA 1HAPH 1NPMA 1HAVB 1RFNA 3BV9B 1G32B 4GCHG 6CHAC 4I7YH 2OQUA 1O2KA 2O8WA 1GJ5H 1ANBA 1FIZA 1MKWH 4IMZA 1C1QA 3P8NA 3LJJA 3TJNA 1DSUA 4UEHH 1JIMA 4DCDA 1W7XH 1O3DA 1GJCB 1RXPA 1SHHB 1SMFE 1NY22 3QZQA 3VXFH 6GCHG 3GY7A 1FONA 3RXOA 1HXEH 3TNSA 2PKAA 2BVRH 1KIGH 2G5NA 2GCHG 3VB3A 4CBNA 1S81A 1S6FA 3SU5A 1LVBA 1P02A 2BZAA 1W0ZU 1GBCA 3DFJA 1NFYA 4KKDA 1DXPA 5LH8A 2B9LA 2V35A 1GI6A 2A32A 1ACBE 1EAWA 1PQ7A 5BRRE 2XNIA 2THFB 2STBE 1F5RA 5HXFA 4X8UH 3FFGA 4TPYA 4NWLA 3SV2H 1H8DH 1TFXA 2Z9KA 4O03A 1O2HA 2VNTA 1DLKB 4OS2A 4DY7B 1YPMH 5FX5A 1SGQE 1HBTH 1ETSH 2BQ6B 4PROA 4AX9H 1AHTH 1AFQC 2PHBA 3D49H 5GXPA 3QX5H 2CGAA 1KTSB 4UFGH 2Y5GA 3KGPA 4A92A 2IN2A 4Y76A 3QO6A 1MKWK 3SNCA 4MPUA 3L33A 1ZZZA 3F9EA 1ZPCA 3NWUA 3V0XA 3GCTF 5A0AE 3D23A 3U98H 3ATWA 4X1PU 1KLJH 1EP6A 2HOBA 2GTBA 1Z1IA 3GDUA 4B71A 4TPIZ 4MNWA 1CBWC 4ABIA 1C1OA 1C2LA 1VR1H 5CHAB 1TIOA 2FOFA 1AUJA 1E35B 4U2WA 2ANKH 1KDQB 3GICB 1DICA 2C8XB 3A7TA 1O3OA 1L0ZA 3S9BA 1RJXB 3SU1A 1TNLA 3SUFA 3IITA 3SN8A 2C8YB 2FLBH 1YPHC 1BBRE 1S82A 2OBOA 1SG8B 1J8AA 4OGXA 2IPHA 2PKAB 2GD4B 3SJIA 2FLRH 1DUAA 3FP7E 1EAIA 2ZGJA 2JETB 4FU7A 3UTUH 5DPAA 1JXPA 3TLOA 1O2LA 1C4Y2 2VIVA 3TH2H 1IHSH 3OTJE 3Q00A 1UTKA 2BY6X 5EXNA 1KXEA 1LVMA 2ZTXA 2I6SA 2C93B 2R2MB 3ZVEA 3LGIA 1CSOE 2WV5A 2TBSA 1A5IA 1DS2E 2GDEH 3A8CA 1ABJH 2PKSB 1C5MD 4UDWH 5E8EH 2ZI2H 1SB1H 2AMPA 1XUIA 5C5OA 1C5OH 1Z8IB 4LK4A 1ZPZA 4O9VA 4MNVA 2QXHA 1ANCA 4NA9H 2BOHB 4O3TA 1HAYB 8LPRA 1C2JA 2WPHS 3P8GA 1EB2A 4NFFA 4BNRA 4DG4A 3TK5A 2V6NA 1K1IA 2TGDA 4BXSA 4QT8C 1O2TA 1ARBA 4AGJA 3VGCB 2YOLA 1THPB 1O5EH 1S85A 1SGEE 1Z1JA 3ZZ5A 1UVPA 1GBJA 2C3SA 3ZZ7A 4B2AA 1CGHA 1QR3E 4NSVA 3FVFB 1CGJE 4TWWA 1TA6A 1IQNA 1P3CA 1V2UT 1HDTH 3MNSA 1PPHE 2FOBA 5T3HA 4XDEA 4GHTA 1HB0B 4OS5A 2ZDAH 2O9QA 1AB9C 1LDTT 4I8HA 4MNXA 4Q7XA 5C1UA 4DT7B 2KAIA 1W14U 1O2SA 4FUDA 3BIVH 5A8ZA 1P9UA 3G01A 1QURH 4B73A 1LHDH 4VGCB 3S7KB 2V3HH 4ZHLU 2AERH 2FS9A 3O8RA 4ISLA 1TALA 3PV4A 2ZA5A 1HPGA 4WXIA 2Y7ZA 1BTPA 1ZMNA 2PSYA 1LPKB 1EUFA 3O8BA 1C5NH 3U1JB 1GBEA 1NM6A 1DWBH 1VGCB 4FUFA 1MQ6A 5A8XA 3LGWA 2A7JA 1XVOA 4NIVA 2QIQA 1ZJDA 1GGDB 2J94A 4AORA 2BY9X 4YTAA 4XFQA 1AKSB 3MNXA 3ZVGA 1A0LA 3GY5A 5HM9A 1HJAC 1C2DA 1GHZA 1A1RA 1O34A 2J95A 4TWYA 2Z3EA 3OX7U 3BTDE 3LH3A 5JBCS 3SNEA 4DIIH 2GDDA 3SI3H 2B5TB 1MTNC 2O8UA 1VZQH 1UTQA 1T4VH 1FPCH 4FUCA 1Z6JH 1KXDA 1HYLA 3QGNB 3SOSA 1RD3B 4X1SU 1LPGB 3TGJE 1ETTH 3K65B 3RU4T 1E34B 2FI4E 4NSYA 2Z3DA 5FBIA 1BITA 1YGCH 1IQHA 4A7IB 1G3BA 3SNAA 2NU4E 3FANA 4ISOA 2G8TA 4WMDA 1ANDA 1TWXB 1W7GH 1GI7B 1QA7A 4FXGH 4JK5A 2G81E 2GZ7A 3NK8A 1F7ZA 1BRUP 2W3KA 3BEUA 2XCNA 1H1BA 3FP8E 3Q3YA 4MLFB 5C3NA 1F0TA 1HGTH 4MDSA 4ZKNU 3GCHB 1KLIH 3ZZAA 5JYIA 1TMTH 1O5DH 2GV6A 1SQAA 3FAOA 3Q76A 1K1JA 4Y7AA 5ESTE 4DGJA 4ZKRU 2ZHDA 3M3VA 5E0JA 3SZNA 1BTWA 1AIXH 3ELAH 1RTFB 1GMCG 1A46H 3T2NA 1C9TA 4IS5A 5FCRA 1CT2E 5GPIB 4WXVA 1CHOG 1YBWA 2D1JA 3BTKE 4D7FA 1DANH 1H9LB 1QNJA 3KNXA 1MTUA 1ELEE 2XYAA 1P01A 3SNBA 6ESTA 2QY0B 5C20A 2ZFRH 1K28D 1J17T 1L4ZA 3S69A 1YCPH 4NG9H 2FESH 1GHXH 1D6RA 5HM2A 4ZAEA 2H9HA 1F0UA 3UY9A 1QGFA 2BD7A 4RSPA 1XXDA 1FY4A 1GJBB 3R0FA 1FN6A 4X6OA 5EQSA 1YLDA 1S83A 2SNWA 1TABE 3EGKH 1GI1A 2BOKA 3O8DA 4ABJA 2ANWA 1XUFA 1GBDA 3M5MA 6CHAB 1A61H 1SQTA 1OYTH 1TPAE 2XBYA 1O5GH 2STAE 1AWFH 5EW2H 4CRGA 4AB9A 1AVWA 1MU6B 4AG2A 1O2QA 1P03A 1WOFA 3P8FA 2F3CE 1GJ6A 3CS0A 2ZQ1A 4HGCA 1P06A 2SGEE 1MBMA 3AAVA 5AFZH 1QB1A 3IG6B 1MKXH 1D3DB 4ZHAA 2F9BH 1PPCE 1Q31A 1NRNH 2JH6D 5L6NH 1YF4A 1TX6A 2H2ZA 4MVNA 1P3EA 3TU7H 1YPGH 2GT8A 1B0FA 3BTWE 2ANMH 2BD5A 2P59A 4LXBH 1J14A 4Y0ZE 3D62A 1TBRH 7GCHF 3A7WA 1S6HA 2ZHWH 1RTLA 1AZZA 1UCYH 1C5UA 3MMGA 1RS0A 5EOKA 3TITA 4A6LA 1AMHA 1FUJA 2FTMA 1LVOA 4WVPE 4DURA 3PM3A 3MWIU 1IOEA 3GYLB 3MHWU 4OS7A 1G3EA 3M5OA 1ZRBA 1ZGIA 2UUJB 3BF6H 2ALPA 3NCLA 4CHAC 1UK2A 3PTNA 1EJAA 1KYNA 1O3KA 2J38A 2BVSH 5AF9H 2BY5X 2VIQA 2ZHFH 1O3NA 3F68H 1TX7A 1C4U2 4NZQA 3TIUA 1C2HA 1O37A 3AAUA 2ZCKP 2BD4A 1N8OC 1GMDF 1FY1A 1MMJN 3U8RH 3DD2H 5H4IB 2BY7X 4ZXYH 1UK4A 2ZDVH 1AFQB 2ZU3A 3T62A 2FS8A 5DP8A 2ZU1A 8GCHG 1A5GH 1PJPA 1XUKA 2OBQA 2W3IA 1UTJA 1JMOH 1C2KA 1UHBA 2XWAA 3RM2H 2ZGCA 1L1GA 3MO6A 5EODA 4INHA 1NRQH 1MUEB 3LPRA 1FQ3A 3F9FA 4D9QA 3PTBA 1NFWA 1MKXK 2G52A 3K2UA 3URCA 1C5YB 5F8TA 1K22H 3V13A 2BD9A 2F9PA 2A2QH 1C5TA 3LDXH 4INKA 1UCYK 1GI8B 1JBUH 1OWIA 1A0JA 1S84A 3KIDU 2NU0E 4K2YA 2W7SA 1Z8GA 1EZQA 3SJ9A 1ELAA 4LZ1H 4ABFA 1W13U 2EI7A 3MI4A 7LPRA 3OYPA 1S5SA 4B74A 5A2MH 4Z0KA 4Q7ZA 1O2JA 4H4FA 4FUGA 2Z3CA 1LQEA 1ABIH 3UR9A 1O3LA 1P2QA 1JOUB 1SVPA 2Q6DA 2QN5T 5ABWA 1GJAB 2GVFA 1ORFA 4YLQH 1EQ9A 2ZHEH 1LCYA 3GCNA 3JZ1B 1Z6EA 4WMFA 3RXEA 2FZZA 3SGBE 1OOKB 2UWLA 3M37A 1AQ7A 1OWEA 2P16A 1Q3XA 3QGJA 2A4OA 3S9CA 4UD9H 2VGCB 4JZFH 3EA9A 1NRSH 4B2BA 5C1YA 2P3TB 1GMHF 1GBAA 1RGQA 3PO1C 3KQEA 4JZDH 4ZH8A 1P2KA 4FVDA 4K8BA 1DY8A 5J4QA 3RXAA 1C1VH 2AIQA 3BTME 2BXUH 2GP9B 2VVUA 1KXFA 4HTCH 4NIYA 4CRBA 1G9IE 2G4UA 2VB0A 2HALA 2UUFB 1E0FD 2QYIA 3K6YA 1DLEA 3B23B 3LC3A 3MH7A 2NU2E 3WY8A 1QBVH 1C1MA 3URDA 3RXLA 3A85A 3MO3A 2W5EA 5A0BA 5TJXA 3A82A 5EPNA 2ODPA 4Z6AH 5C5NA 4BAMB 1O3FA 3C27B 1QL7A 3BG4C 5GJ4B 1EZUC 4CR9A 1K1LA 2O8LA 3ZVCA 3I77A 2FOCA 2SGQE 1GBFA 1A7SA 1LO6A 4YOIA 5LGOA 5DP3A 4I8KA 4AYYB 2PGQB 1AB9B 1O3AA 1B0EA 1C1SA 5C2ZA 6GCHF 1GHVH 5E0GA 2BX3A 5AFYH 4JCNA 1AY6H 2QCYA 2ZDNA 3L3TA 3SV8A 5C67A 2GCHF 3DHKH 1TB6H 4H6SB 4LZ4B 4CR5A 2AMDA 2Y80A 1C5ZB 3E90B 2PFEA 3M61U 3RXVA 3A89A 3ZZ6A 4UFDH 1NFXA 3DUXH 1SGCA 3MTYA 3ZZ3A 3SNDA 4D76A 1ELCA 2FYQA 1EOLA 2GT7A 3PWCA 1NRPH 3STJA 2ZZUH 2ZHQH 3LGVA 4RKOB 1QL9A 4CRDA 5K0HA 5E0HA 3O8CA 1O33A 1EJNA 2J34A 4UONA 1TQ0B 1G36A 5EQQA 5J4SA 1ZGVA 1G3DA 1ESAA 2AYWA 2ZFTA 1MTNB 1TRYA 2FOAA 2GZ8A 1HAHH 2EI6A 2OC0A 1RIWC 3ZZ9A 4MQAA 3PLBA 5CMXH 3AW1A 2GCTC 1SFQB 4HFPB 1QRZA 3UFAA 2FOGA 5T6GA 2RA0A 7ESTE 1UJ1A 1TA2A 2ZGHA 3GYMA 3MH5A 5F03A 1DXWA 2ODYB 4AG1A 1GDNA 1TNHA 4IMQA 4FUJA 4X1RU 1NROH 3L6PA 3LOXA 3M7UA 2ZQ2A 4JZEH 2H5CA 4GVUA 4ABDA 1QFKH 4Y8YA 3RXUA 1XUJA 1SPJA 4UE7H 3M7QA 1A3EH 1MTVA 1Z8RA 1LQDB 5L30H 2OD3B 1UK3A 3NXPA 1V6DA 1TAWA 2WYJA 2ZDLA 3MU4A 4ZMAH 1ZLRA 4GLYA 3RMNH 4AFZA 5LPFA 1GHAF 4F4OC 2B0FA 2AGIX 1O31A 1AGJA 4Q80A 1NRRH 5ETXA 1O3HA 1ELDE 1UTOA 3GCTG 1GBBA 1WU1A 4IW4E 1K2I1 1EATA 5I46H 3VEQB 1KLTA 4XBDA 2HNTE 2A5AA 4K1EA 4FUEA 4CRFA 1J16A 2Y82A 4Y10E 1GG6C 1V2LT 3RMOH 1K1PA 1GBKA 1XUHA 2RDLA 4B1TA 2OTVA 1YLCA 3UIRA 1DSTA 2DE8A 1V2QT 1DM4B 3SW2B 1WTHD 3RLWH 2ZDKA 1SGRE 1O2WA 3KQDA 2C8WB 4XBCA 2R0LA 1QL8A 5EGMA 3V7TA 4UFFH 3LC5A 2I6QA 2D2DA 1ZSKA 2Y81A 4ABHA 1C2FA 4GAWA 5DKMA 1NT1A 5LPRA 5DP4A 3GDVA 5IDKA 1C1PA 4DVAU 1SC8U 4AOQA 1ZHPA 3ATLA 3DFLA 2ZFQH 1QQ4A 1BRBE 1ZOMA 4NIWA 1SGDE 2C8ZB 3SQHE 2D8WA 1EASA 4IBLH 3MYWA 4DOQA 5A09A 4NWKA 4WF8A 3LT3A 1Y5AT 1EJMA 2CF8H 3A84A 1BMLA 3TK9A 1ANEA 5L2ZH 2EI8A 1Q2WA 4ABEA 2NWNA 1WQSA 1W0YH 1BHXF 3GY4A 3RMMH 3RXIA 2ASUB 2F9UA 3S9AA 2BDIA 2HRVA 1QB9A 2ZP0H 1MTWA 1J9CH 2AFQB 3SV9A 4I8LA 2XC5A 3SU0A 3ZVAA 5CE1A 5C1XA 3BTHE 1INCA 2R3YA 1JRTA 1TNIA 2AIPA 3E91A 1BOQA 1MZDA 1JRSA 1ZR0A 1WTGH 2D26C 3ZZCA 4CHAB 1FY8E 2XCFA 4FU8A 3RXPA 3MH6A 5G4BA 1IQKA 2Q6GA 3H5CB 1CO7E 3RXTA 3RMLH 2H9TH 1O38A 1OYQA 1VITH 2Z9JA 3LJOA 1GHWH 3E1XB 1SGIB 1CHGA 4ISIH 4YM9A 1EAXA 4CH8B 3HK3B 1AU8A 1G2MA 1P0SH 1PPEE 2VIPA 1LKBA 2BXTH 3SV6A 4X2YA 1LVYA 1P57B 1HXFH 2BDBA 4BOHA 1XM1A 1DT2A 4AFUA 1SOZA 1PPBH 4NGAH 3TJOA 1O32A 1HIAA 1ZJKA 4BAOB 4YO9A 3A81A 1V2RT 2VH6A 1XUGA 2Y7XA 1ELFA 5A8YA 3VXEH 1O2VA 3P8OA 3TH3H 1BJVA 2A7HA 1N6XA 1YPLH 1BRCE 1QIXB 1YKTA 4LOYH 2P93A 2PV9B 5K7RA 1BMMH 4RKJB 1GVKB 2PUXB 2SNVA 2ZF0H 3MFJA 1D9IA 1C5SA 2PSXA 3GOVB 4X1QU 5EU8A 4KTUA 1P11E 4B76A 2XWBI 1HAXB 1C1TA 2Q1JA 4K5ZA 5EXMA 3BTEE 2XTTB 1T4UH 2VH0A 3RU4D 1EPTA 3M7TA 5T6DA 1UVOA 3MOCA 1GHYH 1V2KT 7KMEH 3PB1E 1O3EA 4AGKA 1LHFH 3ZVBA 1HJ9A 1MD7A 2AGGX 3F1SB 1S0QA 5DO4H 1GMCF 1AN1E 1E38B 4IC6A 1OWJA 2BDCA 1B7XB 3BTGE 1LPZB 1SBWA 1BTUA 3KQBA 2XXLA 2KAIB 3T28A 5CHAC 2OCVB 4K60A 2WPJS 3PO1B 2TGAA 1HJ8A 1C4V2 5FX6A 3E0PB 4H42U 1SLXB 4JK6A 1HAZB 1UVUH 1UTMA 3QLPH 2M5TA 1OP8A 1YPJH 2ZU5A 1YPKH 3A8DA 2ZCHP 4TY7A 2F9OA 1BBRK 2ZFFH 2QXJA 2WPIS 3QWCH 2PGBB 1OWDA 4FU9A 1O2YA 2PUQH 2RCEA 3E16B 4SGBE 1TX8A 2ZNKH 4NZLA 2CHAC 1TNKA 1BRAA 3NUMA 2HPPH 5B6OA 1RRKA 2JETC 3B9FH 1DVAH 3BG4B 2ZPQA 1OSSA 1P09A 4NFEA 1IHTH 4OS6A 1P10A 1TRNA 1VCPA 3UOUA 1AO5A 1O2GH 1O30A 3K6ZA 3Q3XA 3LONA 1EAUA 4AFSA 1O2UA 3MU1A 2BD8A 2QAAA 5GCHF 4DIHH 1AVXA 3QK1A 1YPEH 3CP7A 2WV4A 3VFEA 1VJAU 4Q2KA 4B75A 2PWXA 1V2WT 3AVZA 4I32A 4KELA 3ZZ4A 2G00A 1T8NA 4ABBA 3T5FH 1EP5A 1LHEH 1W10U 2G5VA 1W12U 2GZ9A 2WINI 4SGAE 3A86A 2IJOB 1E36B 1GI0A 1P05A 5JBAS 4F49A 3QDZB 5ESBA 3SHCH 2OXSA 2YNAA 1XVMA 2VWOA 1FNIA 1TBZH 2B8OH 2UWPA 1L4DA 3LIWA 1Z71A 5JBBS 1FY5A 2VWMA 4R0IA 1G37A 2F9NA 1PQ5A 3LGYA 3NPSA 1L1NA 5F6MA 2FXRA 4ISNA 2FODA 5LPEA 5L2YH 1BQYA 4CREA 3BIUH 7GCHG 1NZQH 1EB1H 1ZTLA 3TGIE 1K1NA 1V2OT 1RIWB 1WYKA 1DITH 1WUNH 1SGPE 1OPHB 3ATMA 1K9OE 2GCTB 1Y5UT 4YOJA 3B8JA 2FEQH 2FIRH 1ESBA 2BLQA 2ZIQH 3A88A 4I8GA 4HI3A 2Z9IA 3T29A 1PQAA 1NESE 1VJ9U 2VWLA 1T32A 4O97A 1HRTH 3F9GA 3SORA 1UTLM 2A0QB 2J9NA 2ZC9H 4JZ1A 1V2PT 2A31A 2FWWA 2XRCA 3A80A 5DP5A 1HV7A 5DG6A 3QZRA 2H1UA 1J15A 3VPKA 1CT4E 2OINA 4CRAA 2ZKSA 4TYDA 4AB8A 1XKBC 1BJUA 1HNEE 1IQEA 1GBHA 4CBOA 5JBTA 1E37B 2VU8E 4AFQA 1CBWB 1OP2A 1GHBG 4X6PA 1QTFA 1DE7H 1FV9A 1KSNA 5JB8S 1FAXA 3SV7A 1HAVA 1ZSJA 2FP7B 1SGNE 3V12A 1TYNA 1MCVA 1FMGA 2BLOA 5FHTA 1OWKA 3HKJB 1GVLA 1H4WA 1SGFA 2J2UA 3FZZA 2HNTF 2CV3A 4NCYA 2BHGA 4E7RG 3H7TA 5E2OA 5TCAA 3UWIA 1VITG 3UWJH 2ODQA 4CH2B 1CU1A 1GCTC 2C4FH 1FIWA 3ZV8A 1ZYOA 1QCPA 2F91A 4MPVA 2OC1A 2Z94A 2TRMA 2GX4A 2ZTYA 2RA3A 2BX4A 5JB9S 2P3FH 4K69A 1KXAA 3RLYH 1FZZA 3EDXB 3QTVH 1AZ8A 2ANYA 2ZGXH 3MU0A 3GISB 1UVTH 1GJ9B 1Y3VA 5F8ZA 3RM0H 4KP0A 5GIBA 4THNH 1S0RA 5TCCA 1PFXC 2ZPRA 2RG3A 4X6MA 1EOJA 2W7UA 2WYGA 1CA8B 1ELTA 1K21H 1Y8TA 1B5GH 2GGVB 2SGFE 3AASA 3P70B 1TGCA 3A7YA 1KY9A 3A7VA 3SU3A 1SFIA 1T8LA 2BY8X 3PLPA 3MNBA 2ZECA 1ZMJA 1Y5BT 1C2GA 1BTZA 1ZMLA 3GY8A 4FVBA 3T26A 1A3BH 3P92A 1W2KH 4YLUA 2PTNA 3ATKA 3TK6A 1P2NA 2FOMB 3U69H 1GI2A 4ZXXH 4K1SA 4ZROA 2BQWB 3SJKA 3RP2A 3ZVDA 1A0HB 1O3MA 3MNCA 4GCHF 3SUEA 2FYRA 2BTCE 1GBIA 4DW2U 1DDJA 1UHBB 4E06H 1O39A 3UR6A 1ZRKA 1BT7A 1EXFA 4AZ2B 1Y3XA 1UVSH 3EAJA 5DP9A 3T27A 4X1NU 2V0BA 1GBLA 1SLWB 1GDQA 1SHYA 2QF0A 3F6UH 2BLVA 1ELBA 1NU9A 3TJVA 1XMNB 1DUEA 2EC9H 2F9VA 3BTTE 5DP6A 3RXMA 5FPYA 1BTHH 3KCGH 3KQCA 3NZIA 1IQJA 3SU2A 5BPEA 2ZTZA 4OGYA 4X2XA 2BDHA 1IQMA 1NO9H 1O2RA 4GUXA 4KTCA 5AHGH 2A4RA 3HPTB 1KDQA 1N1LA 2VWNA 2AGEX 2K1QA 3MU8A 2P8OC 1OWHA 1TNJA 3PYHA 4XE4A 1F0RA 1RTKA 3EYDA 5HYOA 2OQ5A 3UREA 1GL0E 1H9IE 1P12E 1V2ST 3E3TA 1EPTC 2B7DH 1GPZA 3V3MA 5DP7A 1FXYA 1EKBB 3LGTA 1T8MA 2CXVA 2OUAA 1YCPM 3SI4H 1HJAB 4U30A 2HPQH 1O2XA 3SUDA 1CVWH 3A7ZA 1FDPA 1CQQA 1M9UA 2EA3A 1LHGH 4OS1A 4D8NA 1BTYA 4WY3A 1CA0C 2DE9A 2J4IA 1G2LA 2R0KA 2UUYA 4ZHMU 1EZXC 3MU5A 3VB7A 3STIA 1W8BH 1XX9A 5AVDA 1KXCA 2PLXA 2TGTA 3VB6A 4A5TS 2G51A 1QQUA 3RXDA 4K3JA 4BAHB 3SHAH 1CGIE 5F8XA 5IYTA 4IC5A 1XXFA 4B2CA 3A8AA 1SGTA 2HNTC 1BDAA 1C2EA 1GI9B 1C2MA 1JWTA 1TMBH 1TOMH 1V2JT 1TGSZ 3C1KA 5I25A 3RC4A 8ESTE 2QF3A 2Z7FE 1AWHB 2SGPE 3RXJA 3BEFB 1T8OA 2VIDA 1SOTA 3SU4A 1P9SA 1O2PA 1SGFG 1C1WH 2FTLE 4Y8XA 1TE0A 2VJ1A 4JYTA 1Y59T 4GPGA 2A4QA 1DX5M 3M5NA 2W26A 1C5VA 3U8OH 1VCWA 3OY6U 1BTXA 2EEKA 2ZO3H 1HUTH 1QRXA 5A0CA 2XBVA 2FPZA 3H7OA 2GV7A 2O8TA 3M5LA 1YP9A 2H6MA 2O8MA 4Y6DA 4OS4A 3GY2A 1O2MA 3VB4A 1TNGA 1C9PA 1TLDA 2H9EH 2ULLA 4NIXA 2ESTE 4X0WU 1WSSH 3RDZA 1T31A 4YZUA 1QBNA 3GCOA 2QXGA 4ZUHA 1GHAG 4ISHH 3FZDA 4U32A 3SGAE 4ABAA 1BHXB 5SGAE 2SGAA 2QXIA 3RUOA 2VVCA 5DJ7A 3GY3A 3RXHA 2CN0H 1ZPBA 3PMAB 1GJ4H 1AKSA 4Y8ZA 1WV7H 3KF2A 4MPWA 5E2PA 1UTPA 5EW1H 1V2TT 2CHAB 1AI8H 1PPGE 2GMTC 5T6FA 1SL3A 4AYVB 5JPMH 4MPXA 2Y6TA 2BMGB 1FN8A 1GDUA 1LMWB 1C5XB 1P2IA 1SQOA 2QC2A 2A7CA 1P2OA 3MO9A 1JIRA 1GI4A 1V2NT 2FO9A 1O2ZA 1SLVB 4YT6H 2AEIH 2VGCC 2Z9GA 1FAKH 4JMYA 1CE5A 3HATH 1LHCH 4UFEH 2QV1A 3U9AH 1THRH 2TPIZ 1K1MA 2HLCA 2R9PA 2P94A 1NC6A 1O5AB 2AS9A 2JH0D 1O3PB 5PTPA 1QJ7B 3UQVA 2BB4A 1YM0A 2VINA 2AMQA 3BTQE 4FUHA 2OC7A 1Z7KA 1F5KU 1NS3A 3UOPA 2BD3A 1BMNH 3P95A 1NTPA 3PMBB 3PWBA 1YPHE 4E05H 4WH6A 1BZXE 1GL1A 1IAUA 2HVXA 2JH5D 1U6QA 1WCZA 9LPRA 1QA0A 3QN7A 1TPPA 1G30B 4Y0YE 1GCDA 2FX4A 3EE0B 2ZU4A 3UNSA 1WBGB 4BAKB 1DFPA 4JYUH 4X8VH 3DA9B 4HZHA 4WMEA 3SQEE 3UNRA 2ZDMA 4X8SH 4XOJA 2FMJA 2ALVA 3RXFA 3HKIB 2XBWA 1ZHMA 3P17H 1ZSLA 1VCQA 1UMAH 1W11U 1N8OB 2BVXH 3T25A 1C1NA 1G3CA 3I78A 5FPSA 3I29A 1MCTA 2NU3E 1T7CA 3LU9B 1TGNA 3OSYA 4XSKU 4Y7BA 1NU7B 5HGGA 1P2JA 1DY9A 2WUBA 1A5HA 1IQLA 1DWDH 1FJSA 1SSXA 1QRWA 4NA7A 1O0DH 1LKAA 1SGYE 4YESB 4GHQA 1F0SA 1V3XA 2A5IA 1ESTA 5FBEA 3TPIZ 3HK6B 4AN7A 9ESTA 1C5WB 3PMJA 1BBRH 1F2SE 2BYAX 3Q77A 1TGTA 3M3TA 1TPSA 4A1VA 1ELVA 1GWAA 1MAYA 4FUIA 1O5CB 1BA8B 1OKXA 1ZTKA 3ODDA 1ETRH 5EXLA 4X8TH 1TONA 3A7XA 2UUKB 1D6WA 4TY6A 1SLUB 3SJ8A 4BANB 1ZHRA 2Z6BD 3EA7A 4IGDA 1FLEE 3M35A 1OXGA 2BDGA 2OLGA 2ZCLP 1HLTH 4RN6A 1HAOH 1UCYE 4MTBA 3DT0H 1O35A 1TQ7B 1KXBA 2C90B 2ZFSA 3UPEA 3ZZBA 1GCTB 4Y79A 1HCGA 3W94A 4ZKOU 3TH4H 3RU4E 3RC5A 3A87A 1D4PB 1OS8A 2DUCA 1AUTC 1FPHH 4ESTE 4R8TB 2ZEBA 2NU1E 2BQ7B 3SO3A 3BN9A 4X2VA 4ABGA 2Z9LA 5EG4A 4DJZB 1MH0A 1DPOA 1Y3UA 1W3CA 4JZIA 3MH4A 3RXQA 4MNYA 5DK1A 6LPRA 4NA8A 1AE5A 1DOJA 1TGBA 5FAHA 1CHOF 1TPOA 2H5DA 2WPKS 3M36A 3GY6A 2FI5E 1IQIA 2ZG0H 5GDSH 2CF9H 3IWMA 1O5BB 1H8IH 2GKVE 4WWYA 1TOCB 4Q7YA 3EQ0H 1EX3A 2CJIA 1MQ5A 2VIOA 3OY5U 1AFEH 2BDYA 4K8YA 1IQFA 2Y5FA 3ITIA 1V2VT 5FCKA 1DWCH 1BIOA 2BDAA 2PTCE 3RXGA 1FY3A 4X6NA 2TIOA 1D3PB 1AD8H 3RXSA 4CRCA 1C5QA 1OX1A 1TRMA 2XC4A 2QA9E 1MU8B 1QY6A 1HFDA 4KGAA 1O3JA 3R3GB 3VB5A 2ZU2A 1PQ8A 3UNQA 1O3GA 2BLWA 4H6TA 1O2NA 2WPLS 3ZZDA 1A2CH 3SBKA 1QB6A 2BD2A 4WH8A 1HIAB 1D3TB 4FUBA 2PKSC 1O3CA 2P3UB 2WUCA 1UO6A 3SJOA 1PYTC 3AW0A 1QJ6B 1WAYB 3QUMP 1WQVH 3E0NB 3HGPA 3Q3KA 2FOHA 1TMUH 2R3UA 2ZGBH 2TGPZ 2UWOA 3ZYDA 4A1XA 4D9RA 1GBTA 2P8OB 4MG3A 3S0NA 4K1TA 3ZV9A 2FX6A 1C1RA 3UUZA 1MD8A 1C2IA 5GCHG 1EPTB 1P04A 3VGCC 1YYY1 3QTOH 1C5LH 3SUGA 4BTIB 3NKKA 2VIWA 1GJDB 1N6YA 3JZ2B 1Y3YA 3LKWA 3TVJB 2FI3E 3S7HB 1MZAA 3TJUA 1MTSA 1CA0B 3U1IB 2IOTA 2YNBA 1P2MA 3ATIA 1A4WH 1AE8H 5FXLA 1O2IA 1P8VC 1GJ7B 3HGNA 1H9HE 4VGCC 2ILNA 4JYVH 3ODFA 4J2YB 8GCHF 2BZ6H 5EPYA 1V2MT 2AH4X 2OP9A 2FM2A 3U8TH 1L2EA 1YCPK 3TGKE 1TBQH 3KL6A 1L1JA 2Q6FA 3PMHB 1PYTD 1D3QB 1F5LA 3BSQA 1VGCC 1X7AC 1ARCA 2ZFPH 2Y5HA 1NFUA 1QJ1B 1ELGA 5EQRA 4X2WA 1GHBF 1GGDC 4WJG2 8KME2 5GWZA 1GMDG 1SI5H 1Z8JB 1HAIH 1SR5C 1O5FH 1LTOA 3E8LA 1UTNA 3BEIB 3KHVA 4O3UA 1CT0E 2QGRA 2V3OH 3N7OA 4XBBA 2HWLB 1KTTB 1VITF 2WPMS 3LGUA 2G4TA 3GDSA 3A8BA 3PROA 3A83A 2G55A 2LNCA 2P95A 3ZZ8A 1AVGH 4BAQB 1BUIA 3RC6A 3M3SA 2PW8H 1YC0A 1ID5H 1O3IA 1GBMA 2ZWLH 1GG6B 3UQOA 4A1TA 1GI5A 3SU6A 5JDUB 3ZYEA 1O36A 2VVVA 2A1DB 1OP0A 1PPZA 2A4GA 3ESTA 3OU0A 5DGJA 2R2WU 1FI8A 3CS7A 4IN2A 2ZPSA 1MBQA 2HGTH 3PLKA 4D7GA 2BM2A 4E7NA 3LH1A 1ZTJA 1C5RA 2SGDE 1GVZA 3GCHC 3KN2A 5HMAA
chains in the Genus database with same CATH superfamily
5C0TA 2GMTB 2XBXA 3P6ZB 4YOGA 4YT7H 1C5PA 1EZSC 3BG8A 3ZVFA 2OC8A 3EA8A 3F9HA 3E6PH 4I31A 1BCUH 1K1OA 2LPRA 4ASHA 2CMYA 3BTFE 2FDAA 1HAGE 3D65E 4I8JA 1DWEH 1BB0B 1GJ8B 3CENA 3FP6E 3ENSB 1F92A 1NN6A 1BMAA 1O3BA 4J1YA 2A45B 3SGQE 4U01A 4KTSA 4BXWA 2OK5A 1XKAC 3RXCA 3RXKA 1GMHG 5FPTA 4GSOA 2JKHA 4IN1A 1IQGA 4INLA 4M7GA 2XW9A 4BTTB 2SFAA 3TNTA 4ZKSU 1O2OA 4Y71A 1MAXA 1THSH 3KEEA 2F83A 1PPFE 2PR3A 3N99A 4BTUB 3K9XB 3RXRA 1QHRB 4I33A 1GI3A 3W95A 4Y11E 1Y3WA 2J92A 1C1UH 1QBOA 2A2XH 3RXBA 2A5KA 2XC0A 2FOEA 1HAPH 1NPMA 1HAVB 1RFNA 3BV9B 1G32B 4GCHG 6CHAC 4I7YH 2OQUA 1O2KA 2O8WA 1GJ5H 1ANBA 5EJLA 1FIZA 1MKWH 4IMZA 1C1QA 3P8NA 3LJJA 3TJNA 1DSUA 4UEHH 1JIMA 4DCDA 2KCOA 1W7XH 1O3DA 4M9FA 1GJCB 1RXPA 1SHHB 1SMFE 3F0OA 1NY22 3QZQA 3VXFH 6GCHG 3GY7A 1FONA 3RXOA 1HXEH 2QF5A 3TNSA 2PKAA 2BVRH 1NBME 1KIGH 2G5NA 2GCHG 3VB3A 4CBNA 1S81A 1S6FA 3SU5A 1LVBA 1P02A 2BZAA 1W0ZU 1GBCA 1SQRA 1NFYA 3DFJA 4KKDA 2RFKC 1DXPA 5LH8A 2B9LA 2V35A 1GI6A 2A32A 1ACBE 1EAWA 1PQ7A 5BRRE 2XNIA 2THFB 2STBE 1F5RA 2KR7A 5HXFA 4X8UH 3FFGA 4TPYA 4NWLA 3SV2H 1H8DH 1TFXA 2Z9KA 4O03A 1O2HA 2VNTA 1EFRD 1DLKB 4OS2A 4DY7B 1YPMH 5FX5A 1SGQE 1HBTH 1ETSH 2BQ6B 4PROA 4AX9H 1AHTH 1AFQC 2PHBA 3D49H 5GXPA 3QX5H 2CGAA 1KTSB 4UFGH 2Y5GA 3KGPA 5DSFA 4A92A 2IN2A 4Y76A 3QO6A 1MKWK 3SNCA 4MPUA 3L33A 1ZZZA 3F9EA 1ZPCA 3NWUA 3V0XA 3GCTF 5A0AE 3D23A 3U98H 3ATWA 4X1PU 1KLJH 1EP6A 2HOBA 2GTBA 1Z1IA 3GDUA 4B71A 4TPIZ 4MNWA 1CBWC 4ABIA 1C1OA 1C2LA 1VR1H 5CHAB 1TIOA 2FOFA 1AUJA 1E35B 4U2WA 3PRBA 2ANKH 1SKYE 1KDQB 3GICB 2KX4A 1DICA 2C8XB 3A7TA 1O3OA 1L0ZA 3S9BA 1RJXB 3SU1A 1TNLA 3SUFA 3IITA 3SN8A 2C8YB 2FLBH 1YPHC 1BBRE 1S82A 2OBOA 1SG8B 1J8AA 4OGXA 2IPHA 2PKAB 2GD4B 3SJIA 2FLRH 1DUAA 2WZQA 3FP7E 1EAIA 2ZGJA 2JETB 4FETA 4FU7A 3UTUH 5DPAA 1JXPA 3TLOA 1O2LA 1C4Y2 2VIVA 3TH2H 1IHSH 3OTJE 3Q00A 1UTKA 2BY6X 5EXNA 1KXEA 1LVMA 2ZTXA 2I6SA 2C93B 2R2MB 3ZVEA 3LGIA 1CSOE 2WV5A 2TBSA 1A5IA 1DS2E 2GDEH 2V7QD 3A8CA 5C0UA 1ABJH 2PKSB 1C5MD 4UDWH 5E8EH 3W1EA 2ZI2H 1SB1H 2AMPA 1XUIA 5C5OA 1C5OH 1Z8IB 4LK4A 1ZPZA 4O9VA 4MNVA 2QXHA 1ANCA 4NA9H 2BOHB 4O3TA 1HAYB 8LPRA 1C2JA 2XNDD 2WPHS 3P8GA 1EB2A 4NFFA 4BNRA 4DG4A 3TK5A 2V6NA 1K1IA 2TGDA 4ACBA 4BXSA 2QE7D 4QT8C 1O2TA 1ARBA 4AGJA 3VGCB 2KM0A 2YOLA 1THPB 1O5EH 1S85A 1SGEE 1Z1JA 3ZZ5A 3PRDA 1QZ8A 1UVPA 1GBJA 2C3SA 3ZZ7A 4B2AA 1CGHA 1QR3E 4NSVA 3FVFB 1CGJE 4TWWA 1TA6A 1IQNA 1P3CA 1V2UT 1HDTH 3MNSA 1PPHE 2FOBA 3FOAA 5T3HA 4XDEA 4GHTA 1HB0B 4OS5A 2ZDAH 2O9QA 1AB9C 3PV2A 1LDTT 4I8HA 4MNXA 4Q7XA 5C1UA 4DT7B 2KAIA 1W14U 1O2SA 4FUDA 3BIVH 5A8ZA 1P9UA 3G01A 1QURH 4B73A 1LHDH 4VGCB 3S7KB 4XD7D 2V3HH 4ZHLU 2AERH 2FS9A 3O8RA 3SZEA 4ISLA 1TALA 3PV4A 2ZA5A 1HPGA 4WXIA 2Y7ZA 1BTPA 1ZMNA 2PSYA 1LPKB 1EUFA 3O8BA 1C5NH 3U1JB 1GBEA 1NM6A 1DWBH 1VGCB 4FUFA 1MQ6A 5A8XA 3LGWA 2A7JA 1XVOA 5HIZA 2L6OA 4NIVA 5HIYA 2QIQA 5KGOA 1ZJDA 1GGDB 2J94A 4AORA 2BY9X 4YTAA 4XFQA 1AKSB 3MNXA 3ZVGA 1A0LA 2J98B 3GY5A 5HM9A 1HJAC 1C2DA 1GHZA 1A1RA 1O34A 2J95A 4TWYA 2Z3EA 3OX7U 3BTDE 3LH3A 5JBCS 3SNEA 4DIIH 2GDDA 3SI3H 2B5TB 1MTNC 2O8UA 1VZQH 2YMSB 1UTQA 1T4VH 1FPCH 4FUCA 1Z6JH 1KXDA 1HYLA 2KCAA 3QGNB 3SOSA 1RD3B 4X1SU 1LPGB 3TGJE 1ETTH 3K65B 3RU4T 1E34B 2FI4E 4NSYA 2Z3DA 5FBIA 1BITA 1YGCH 1IQHA 4A7IB 1G3BA 2JJ1D 3SNAA 2NU4E 3FANA 4ISOA 2G8TA 4WMDA 1ANDA 1TWXB 1W7GH 1GI7B 1QA7A 4FXGH 4JK5A 2G81E 2GZ7A 3NK8A 1F7ZA 1BRUP 2W3KA 3BEUA 2XCNA 1H1BA 3FP8E 3Q3YA 4MLFB 5C3NA 1F0TA 1HGTH 4MDSA 4ZKNU 3GCHB 1KLIH 3ZZAA 5JYIA 1TMTH 1O5DH 2GV6A 1MABB 1SQAA 3FAOA 3Q76A 1K1JA 3N7EA 4Y7AA 5ESTE 4DGJA 4ZKRU 2ZHDA 3M3VA 5E0JA 3SZNA 3F0PA 1BTWA 1AIXH 3ELAH 1WXRA 1RTFB 1FX0B 1GMCG 1A46H 3T2NA 1C9TA 4IS5A 5FCRA 1CT2E 5GPIB 4WXVA 1CHOG 1YBWA 2D1JA 3BTKE 4D7FA 1DANH 1H9LB 1QNJA 3KNXA 3SYJA 1MTUA 1ELEE 2XYAA 1P01A 3SNBA 6ESTA 3CNRA 2QY0B 5C20A 2ZFRH 1K28D 1J17T 1L4ZA 3S69A 5CHBA 1YCPH 4NG9H 2FESH 1GHXH 1D6RA 5HM2A 4ZAEA 2H9HA 1F0UA 3UY9A 1QGFA 2BD7A 4RSPA 1XXDA 1FY4A 1GJBB 3R0FA 1FN6A 4X6OA 5EQSA 1YLDA 1S83A 2SNWA 1TABE 3EGKH 1GI1A 2BOKA 3O8DA 4ABJA 2ANWA 1XUFA 1GBDA 3M5MA 6CHAB 1A61H 1SQTA 1OYTH 1TPAE 2XBYA 1O5GH 2STAE 1AWFH 5EW2H 4CRGA 4AB9A 1AVWA 1MU6B 4AG2A 1O2QA 1P03A 1WOFA 3P8FA 2F3CE 2F43B 1GJ6A 3CS0A 2ZQ1A 4HGCA 1P06A 2SGEE 1MBMA 2LP6A 3AAVA 5AFZH 1QB1A 3IG6B 1MKXH 1D3DB 4ZHAA 2F9BH 1PPCE 1Q31A 1NRNH 2JH6D 5L6NH 2EY4C 1YF4A 1TX6A 2H2ZA 4MVNA 1P3EA 3TU7H 1YPGH 2GT8A 1B0FA 3BTWE 2ANMH 2BD5A 2P59A 4LXBH 1J14A 4Y0ZE 3D62A 1TBRH 7GCHF 3A7WA 1S6HA 2ZHWH 1RTLA 1AZZA 4F55A 1UCYH 1C5UA 4TSFD 3MMGA 1RS0A 5EOKA 3TITA 4A6LA 1AMHA 1FUJA 3OAAD 2FTMA 1LVOA 4WVPE 4DURA 3PM3A 3MWIU 1IOEA 3GYLB 3MHWU 4OS7A 1G3EA 3M5OA 4RT0A 1ZRBA 1ZGIA 2UUJB 3BF6H 1E1RD 2ALPA 3NCLA 4CHAC 2HLDD 1UK2A 3PTNA 1EJAA 1KYNA 1O3KA 2J38A 2BVSH 5AF9H 2BY5X 2VIQA 2ZHFH 1O3NA 3F68H 1TX7A 1C4U2 4NZQA 3TIUA 1C2HA 1O37A 3AAUA 2ZCKP 2BD4A 4ACAA 1N8OC 1GMDF 1FY1A 1MMJN 3U8RH 3DD2H 5H4IB 2BY7X 4ZXYH 1UK4A 2ZDVH 1AFQB 2ZU3A 3T62A 2FS8A 5DP8A 2ZU1A 8GCHG 1A5GH 1PJPA 1XUKA 2OBQA 2W3IA 1UTJA 1JMOH 1C2KA 1UHBA 2XWAA 3RM2H 2ZGCA 1L1GA 3MO6A 5EODA 4INHA 1NRQH 1MUEB 3LPRA 1FQ3A 3F9FA 4D9QA 3PTBA 1NFWA 1MKXK 2G52A 3K2UA 3URCA 1C5YB 5F8TA 1K22H 3V13A 2BD9A 2F9PA 2A2QH 2L74A 1C5TA 3LDXH 4INKA 1UCYK 1GI8B 1JBUH 1OWIA 3OFND 1A0JA 1S84A 3KIDU 2NU0E 4K2YA 2W7SA 1Z8GA 1EZQA 3SJ9A 1ELAA 4LZ1H 4ABFA 1W13U 2EI7A 1BMFD 3MI4A 7LPRA 3OYPA 1S5SA 4B74A 5A2MH 4Z0KA 4Q7ZA 1O2JA 4H4FA 4FUGA 2Z3CA 1LQEA 1ABIH 3UR9A 1O3LA 1P2QA 1JOUB 1SVPA 2Q6DA 2QN5T 5ABWA 1GJAB 2GVFA 1ORFA 4YLQH 1EQ9A 2PP6A 2ZHEH 1LCYA 3GCNA 3JZ1B 1Z6EA 4WMFA 3RXEA 2FZZA 3SGBE 1OOKB 2UWLA 3M37A 1AQ7A 1OWEA 2P16A 1Q3XA 3QGJA 2A4OA 3S9CA 4UD9H 2VGCB 4JZFH 3EA9A 1NRSH 4B2BA 5C1YA 2P3TB 1GMHF 1GBAA 1RGQA 3PO1C 3KQEA 4JZDH 4ZH8A 1P2KA 4FVDA 4K8BA 1DY8A 5J4QA 3RXAA 1C1VH 2AIQA 3BTME 2BXUH 2GP9B 2VVUA 2WSSD 1KXFA 4HTCH 4NIYA 4CRBA 1G9IE 2G4UA 2VB0A 2HALA 2UUFB 1E0FD 2QYIA 3K6YA 1DLEA 3B23B 3LC3A 3MH7A 2NU2E 3WY8A 1QBVH 1C1MA 3URDA 3RXLA 3A85A 3MO3A 2W5EA 5A0BA 5TJXA 3A82A 5EPNA 2ODPA 4Z6AH 5C5NA 4BAMB 1O3FA 3C27B 1QL7A 3BG4C 5GJ4B 1EZUC 3OE7D 4CR9A 1K1LA 2O8LA 3ZVCA 3I77A 4XRNA 2FOCA 2SGQE 1GBFA 1A7SA 1LO6A 4YOIA 5LGOA 5DP3A 4I8KA 4AYYB 2PGQB 1AB9B 1O3AA 1B0EA 3F2FA 1C1SA 5C2ZA 6GCHF 1GHVH 5E0GA 2BX3A 5AFYH 4JCNA 1AY6H 2QCYA 2ZDNA 5C17A 3L3TA 3OEED 3SV8A 2GCHF 5C67A 1COWD 3DHKH 1TB6H 4H6SB 4LZ4B 4CR5A 2AMDA 2Y80A 1C5ZB 3PV5A 3E90B 2PFEA 3M61U 3RXVA 3A89A 3ZZ6A 4UFDH 1NFXA 3DUXH 1SGCA 3MTYA 3ZZ3A 3SNDA 1NBMD 4D76A 1ELCA 2FYQA 1EOLA 2GT7A 3PWCA 1NRPH 3STJA 2ZZUH 2ZHQH 3LGVA 4RKOB 1QL9A 4CRDA 5K0HA 5E0HA 3O8CA 1O33A 1EJNA 2J34A 2LELA 4UONA 4TT3D 1TQ0B 3ZIAD 1G36A 5EQQA 5J4SA 1ZGVA 1G3DA 1ESAA 2AYWA 2ZFTA 3DSGA 1MTNB 1TRYA 2FOAA 2GZ8A 1HAHH 5T1VA 2EI6A 2OC0A 1RIWC 3ZZ9A 4MQAA 3PLBA 5CMXH 3AW1A 2GCTC 1SFQB 4HFPB 1QRZA 3UFAA 2FOGA 5T6GA 2RA0A 7ESTE 1UJ1A 1TA2A 2ZGHA 3GYMA 3MH5A 5F03A 1DXWA 2ODYB 4AG1A 1GDNA 1TNHA 4IMQA 4FUJA 4X1RU 1NROH 3L6PA 3LOXA 3M7UA 2ZQ2A 4JZEH 2H5CA 4GVUA 4ABDA 1QFKH 4Y8YA 3RXUA 1XUJA 1SPJA 4UE7H 2WV9A 3M7QA 1A3EH 1MTVA 1Z8RA 1LQDB 5L30H 2OD3B 1UK3A 3NXPA 1V6DA 1TAWA 2WYJA 2ZDLA 3MU4A 4ZMAH 1ZLRA 1YY3A 4GLYA 3RMNH 4AFZA 5LPFA 1GHAF 4F4OC 2B0FA 2AGIX 1W0KD 2RDEA 1O31A 1AGJA 4Q80A 1NRRH 5GNDA 5ETXA 1O3HA 1ELDE 1UTOA 3GCTG 1GBBA 1WU1A 4IW4E 1K2I1 1EATA 5I46H 3VEQB 1KLTA 4XBDA 2HNTE 2A5AA 4K1EA 4FUEA 4CRFA 1J16A 2Y82A 1YLNA 4Y10E 1GG6C 1V2LT 3RMOH 1K1PA 1GBKA 1XUHA 2RDLA 4B1TA 2OTVA 1YLCA 3UIRA 1DSTA 2DE8A 1V2QT 1DM4B 3SW2B 1WTHD 3RLWH 2ZDKA 1SGRE 1O2WA 3KQDA 2C8WB 2JJ2D 4ZCNA 4XBCA 2R0LA 1QL8A 5EGMA 3V7TA 4UFFH 3LC5A 2I6QA 2D2DA 1ZSKA 2Y81A 4ABHA 1C2FA 4GAWA 5DKMA 1NT1A 5LPRA 5DP4A 3GDVA 5IDKA 1C1PA 4DVAU 1SC8U 4AOQA 1ZHPA 4I86A 3ATLA 3DFLA 2ZFQH 1QQ4A 1BRBE 1ZOMA 4NIWA 1SGDE 2C8ZB 3SQHE 2D8WA 1EASA 4IBLH 3MYWA 4DOQA 5A09A 4NWKA 4WF8A 3LT3A 1Y5AT 1EJMA 2CF8H 3A84A 1BMLA 2KCYA 3TK9A 1ANEA 5L2ZH 2EI8A 1Q2WA 4ABEA 2NWNA 1WQSA 1W0YH 1BHXF 3GY4A 3RMMH 3RXIA 2ASUB 3GS9A 3WWFA 2F9UA 4B6FA 3S9AA 2BDIA 2HRVA 1QB9A 3FO8D 2ZP0H 4P00A 5EIYA 1MTWA 1J9CH 2AFQB 3SV9A 4I8LA 2XC5A 3SU0A 3ZVAA 5CE1A 5C1XA 3BTHE 1INCA 2R3YA 1JRTA 1TNIA 2AIPA 3E91A 1BOQA 1MZDA 1JRSA 1ZR0A 4RI0A 1WTGH 2D26C 5B6LA 3ZZCA 4CHAB 1FY8E 2XCFA 4FU8A 3RXPA 3MH6A 5G4BA 1IQKA 2Q6GA 3H5CB 1CO7E 3RXTA 3RMLH 2H9TH 1O38A 3KYFA 1OYQA 1VITH 2Z9JA 3LJOA 1GHWH 3E1XB 1SGIB 1CHGA 4ISIH 4YM9A 1EAXA 4CH8B 2WHXA 3HK3B 1AU8A 1G2MA 1P0SH 1PPEE 2VIPA 1LKBA 2BXTH 3SV6A 4X2YA 1LVYA 2KFWA 1P57B 1HXFH 2BDBA 4BOHA 1XM1A 1DT2A 4AFUA 1SOZA 1PPBH 4NGAH 3TJOA 1O32A 1HIAA 1ZJKA 2K8IA 4BAOB 4YO9A 3A81A 2IJD1 1V2RT 2VH6A 1XUGA 2Y7XA 1ELFA 5A8YA 3VXEH 1O2VA 3P8OA 3TH3H 1BJVA 2A7HA 1N6XA 1YPLH 1BRCE 1QIXB 1YKTA 4LOYH 2P93A 2PV9B 5K7RA 1BMMH 4RKJB 1GVKB 2PUXB 2SNVA 2ZF0H 3MFJA 1D9IA 3U28C 1C5SA 2PSXA 3GOVB 4X1QU 5EU8A 4KTUA 2XOKD 1P11E 4B76A 2XWBI 1HAXB 1C1TA 2Q1JA 4K5ZA 5EXMA 3BTEE 2XTTB 1T4UH 2VH0A 3RU4D 1EPTA 3M7TA 5T6DA 1UVOA 3MOCA 1GHYH 1V2KT 7KMEH 3PB1E 1O3EA 4AGKA 1LHFH 3ZVBA 1HJ9A 1MD7A 2AGGX 3F1SB 3FKSD 1S0QA 5DO4H 3AK5A 1GMCF 1AN1E 1E38B 4IC6A 1OWJA 2BDCA 1B7XB 3BTGE 1LPZB 1SBWA 1BTUA 3KQBA 2XXLA 2KAIB 3T28A 5CHAC 2OCVB 4K60A 2WPJS 3PO1B 2TGAA 1HJ8A 1C4V2 5FX6A 3E0PB 4H42U 1SLXB 4JK6A 1HAZB 1UVUH 1UTMA 3QLPH 2M5TA 1OP8A 1YPJH 2ZU5A 1YPKH 3A8DA 2ZCHP 4TY7A 2F9OA 1BBRK 2V3MA 2ZFFH 2QXJA 2WPIS 3QWCH 2PGBB 1OWDA 4FU9A 1O2YA 2PUQH 2RCEA 3E16B 4SGBE 1TX8A 2ZNKH 4NZLA 2CHAC 1TNKA 1BRAA 3NUMA 2HPPH 5B6OA 1RRKA 2JETC 3B9FH 1DVAH 3BG4B 2ZPQA 3DSPA 1OSSA 1P09A 4NFEA 1IHTH 4OS6A 1P10A 1TRNA 1VCPA 3UOUA 1AO5A 1O2GH 1O30A 3K6ZA 3Q3XA 3LONA 1EAUA 4AFSA 1O2UA 3MU1A 2BD8A 2QAAA 5GCHF 4DIHH 1AVXA 3QK1A 1YPEH 3MQKC 3CP7A 2WV4A 3VFEA 1VJAU 4Q2KA 4B75A 2PWXA 1V2WT 3AVZA 4I32A 4KELA 3ZZ4A 2G00A 1T8NA 4ABBA 3T5FH 1EP5A 1LHEH 1W10U 2G5VA 1W12U 2GZ9A 2WINI 4SGAE 4Q4LA 3A86A 2IJOB 1E36B 1GI0A 1P05A 2HVYB 5JBAS 4F49A 3QDZB 5ESBA 3SHCH 2OXSA 2YNAA 1XVMA 2VWOA 3KQ5A 1FNIA 1TBZH 2B8OH 1WDIA 2UWPA 1L4DA 3LIWA 1Z71A 5JBBS 1FY5A 2VWMA 4R0IA 1G37A 2F9NA 1PQ5A 3LGYA 3NPSA 1L1NA 3OEHD 5F6MA 2FXRA 4ISNA 2FODA 5LPEA 5L2YH 1BQYA 4CREA 3BIUH 7GCHG 1NZQH 1EB1H 1ZTLA 4P02A 1K1NA 3TGIE 1V2OT 1RIWB 1WYKA 1DITH 1WUNH 1SGPE 1OPHB 3ATMA 1K9OE 2GCTB 1Y5UT 4YOJA 3VG8A 3B8JA 2FEQH 2FIRH 1ESBA 2BLQA 2ZIQH 3OTPA 3A88A 4I8GA 4HI3A 2Z9IA 3T29A 1PQAA 1NESE 1VJ9U 2VWLA 1T32A 4O97A 3UB0A 1E79D 1HRTH 3F9GA 3SORA 1UTLM 2A0QB 2J9NA 2ZC9H 4JZ1A 1V2PT 2A31A 2FWWA 2XRCA 3A80A 5DP5A 1HV7A 5DG6A 3QZRA 2H1UA 1VKYA 1J15A 3VPKA 1CT4E 2OINA 4CRAA 2ZKSA 4TYDA 4AB8A 1XKBC 1BJUA 1HNEE 1IQEA 1GBHA 4CBOA 5JBTA 1E37B 2VU8E 4AFQA 1CBWB 1OP2A 1GHBG 4X6PA 1QTFA 1DE7H 1FV9A 1KSNA 5JB8S 2GJGA 2JDID 1FAXA 3SV7A 1HAVA 1ZSJA 2FP7B 1SGNE 3V12A 1TYNA 1MCVA 1FMGA 2BLOA 3H09A 5FHTA 1OWKA 3HKJB 1GVLA 1H4WA 1SGFA 2J2UA 2YMSC 3FZZA 2HNTF 2CV3A 4NCYA 2BHGA 3DCLA 4E7RG 3H7TA 5E2OA 5TCAA 3UWIA 1VITG 3UWJH 2IPQX 2ODQA 4CH2B 1CU1A 2J5UA 1GCTC 2C4FH 1FIWA 3ZV8A 1ZYOA 1QCPA 2F91A 4MPVA 2OC1A 2Z94A 2TRMA 2GX4A 2ZTYA 2RA3A 2BX4A 3F2HA 5JB9S 2P3FH 4K69A 5DN6D 1KXAA 3RLYH 1FZZA 3EDXB 4DT4A 3QTVH 1AZ8A 2ANYA 2ZGXH 3MU0A 3GISB 1UVTH 1GJ9B 1Y3VA 5F8ZA 3RM0H 4KP0A 3UAIC 5GIBA 4THNH 1S0RA 5TCCA 1PFXC 2ZPRA 2RG3A 4X6MA 1EOJA 1YWUA 2W7UA 2WYGA 1CA8B 1ELTA 1K21H 1Y8TA 1B5GH 2GGVB 2SGFE 3AASA 3P70B 1TGCA 3A7YA 1KY9A 3A7VA 3SU3A 1SFIA 1T8LA 2BY8X 3PLPA 3MNBA 2ZECA 1ZMJA 1Y5BT 1C2GA 1BTZA 1ZMLA 3GY8A 4FVBA 3T26A 1A3BH 3P92A 1W2KH 4YLUA 2YMSD 2PTNA 3ATKA 3TK6A 1P2NA 1E1QD 2FOMB 3U69H 1GI2A 4ZXXH 4K1SA 4ZROA 2BQWB 3SJKA 3RP2A 3ZVDA 1A0HB 1O3MA 3MNCA 4GCHF 3SUEA 2FYRA 2BTCE 1GBIA 4DW2U 1DDJA 1UHBB 4E06H 1O39A 3UR6A 1ZRKA 1BT7A 1EXFA 4AZ2B 1Y3XA 1UVSH 3EAJA 5DP9A 3T27A 4X1NU 2M2AA 2V0BA 1GBLA 1SLWB 1GDQA 1SHYA 2QF0A 3F6UH 2BLVA 1ELBA 1NU9A 2KCPA 3TJVA 1XMNB 1DUEA 2EC9H 2F9VA 3BTTE 5DP6A 3RXMA 5FPYA 1BTHH 3KCGH 3KQCA 3NZIA 1IQJA 2KZ4A 3SU2A 5BPEA 2ZTZA 4OGYA 4X2XA 2BDHA 1IQMA 1NO9H 1O2RA 4GUXA 4KTCA 5AHGH 2A4RA 3HPTB 1KDQA 1N1LA 2VWNA 2AGEX 2K1QA 3MU8A 2P8OC 1OWHA 1TNJA 3PYHA 4XE4A 1F0RA 1RTKA 3EYDA 5HYOA 2OQ5A 3UREA 1GL0E 1H9IE 1P12E 1V2ST 3E3TA 1EPTC 2B7DH 1GPZA 3V3MA 5DP7A 1FXYA 1EKBB 3LGTA 1T8MA 2CXVA 2OUAA 1YCPM 3SI4H 1HJAB 4U30A 2HPQH 1O2XA 3SUDA 1CVWH 3A7ZA 1FDPA 1CQQA 1M9UA 2EA3A 1LHGH 2JIZD 4OS1A 4D8NA 1BTYA 4WY3A 1CA0C 2DE9A 5FL7D 2J4IA 1G2LA 2R0KA 2UUYA 4ZHMU 1EZXC 3MU5A 2J97A 3STIA 3VB7A 1W8BH 1XX9A 5AVDA 1KXCA 2PLXA 2TGTA 3VB6A 4A5TS 2G51A 1QQUA 3RXDA 4K3JA 4BAHB 3SHAH 1CGIE 5F8XA 5IYTA 4IC5A 1XXFA 4B2CA 3A8AA 1SGTA 2HNTC 1BDAA 1C2EA 1GI9B 1C2MA 1JWTA 1TMBH 1S6LA 1TOMH 1V2JT 1TGSZ 3C1KA 5I25A 3RC4A 8ESTE 2QF3A 2Z7FE 1AWHB 2SGPE 3RXJA 3BEFB 1T8OA 2VIDA 1SOTA 3SU4A 1P9SA 1O2PA 1SGFG 1C1WH 2FTLE 4Y8XA 1TE0A 2VJ1A 4JYTA 1Y59T 4GPGA 2A4QA 1DX5M 3M5NA 2W26A 2WPDD 1C5VA 3U8OH 1VCWA 3OY6U 1BTXA 2EEKA 2ZO3H 1HUTH 1QRXA 5A0CA 4F48B 2XBVA 2FPZA 3H7OA 2GV7A 2O8TA 3M5LA 1YP9A 2H6MA 2O8MA 4Y6DA 4OS4A 3GY2A 1O2MA 3VB4A 1TNGA 1C9PA 1TLDA 2H9EH 2ULLA 4NIXA 2ESTE 4X0WU 1OHHD 2CK3D 1WSSH 3RDZA 1T31A 4YZUA 1UW7A 1QBNA 3GCOA 2QXGA 4ZUHA 1GHAG 4ISHH 3EE7A 3FZDA 4U32A 3SGAE 4ABAA 1BHXB 5SGAE 2SGAA 2QXIA 3RUOA 2VVCA 5DJ7A 3GY3A 3RXHA 2CN0H 1ZPBA 3PMAB 1GJ4H 1AKSA 4Y8ZA 1WV7H 3KF2A 4MPWA 5E2PA 2J98A 1UTPA 5EW1H 1V2TT 2CHAB 1AI8H 1PPGE 2GMTC 5T6FA 1SL3A 4AYVB 5JPMH 4MPXA 2Y6TA 2BMGB 1FN8A 1GDUA 1LMWB 1C5XB 1P2IA 1SQOA 2QC2A 2A7CA 1P2OA 3MO9A 1JIRA 1GI4A 3KYGA 1V2NT 2FO9A 1O2ZA 1SLVB 4YT6H 2AEIH 2VGCC 2Z9GA 1FAKH 4JMYA 1CE5A 3HATH 1LHCH 4UFEH 2QV1A 3U9AH 1THRH 2TPIZ 1K1MA 2HLCA 2R9PA 2P94A 1NC6A 1O5AB 2AS9A 2JH0D 1O3PB 2AHME 1QJ7B 5PTPA 3UQVA 2BB4A 1YM0A 2VINA 2AMQA 3BTQE 4FUHA 2OC7A 4AC9A 1Z7KA 1F5KU 1NS3A 3UOPA 2BD3A 1BMNH 3P95A 1NTPA 3PMBB 3PWBA 2VBCA 1YPHE 4E05H 4WH6A 1BZXE 1GL1A 1IAUA 4B6EA 2HVXA 2JH5D 1U6QA 1WCZA 9LPRA 1QA0A 3QN7A 1TPPA 1G30B 4Y0YE 1GCDA 2FX4A 3EE0B 2ZU4A 3UNSA 1WBGB 4BAKB 1DFPA 4JYUH 4X8VH 3DA9B 4HZHA 4WMEA 3SQEE 3UNRA 2ZDMA 4X8SH 4XOJA 2FMJA 2ALVA 3RXFA 3HKIB 2XBWA 1ZHMA 3P17H 1ZSLA 1VCQA 1UMAH 1W11U 1N8OB 2BVXH 3T25A 1C1NA 1G3CA 3I78A 5FPSA 3I29A 1MCTA 2NU3E 1T7CA 3LU9B 1TGNA 3OSYA 4XSKU 4Y7BA 3F2GA 1NU7B 3WW7A 5HGGA 1P2JA 1DY9A 2WUBA 1A5HA 1IQLA 1DWDH 1FJSA 1SSXA 1QRWA 4NA7A 1O0DH 1LKAA 1SGYE 4YESB 2EQNA 5EJ1A 4GHQA 1F0SA 1V3XA 2A5IA 1ESTA 5FBEA 3TPIZ 3HK6B 4AN7A 9ESTA 1C5WB 3PMJA 1BBRH 1F2SE 2BYAX 3Q77A 1TGTA 3M3TA 1TPSA 4A1VA 4ASUD 1ELVA 1GWAA 1MAYA 4FUIA 1O5CB 1BA8B 1OKXA 1ZTKA 2K0QA 1ETRH 3ODDA 1W0JD 5EXLA 4X8TH 1TONA 3A7XA 2UUKB 1D6WA 4TY6A 1SLUB 3SJ8A 4BANB 1ZHRA 2Z6BD 3EA7A 4IGDA 1FLEE 3M35A 2F4LA 1OXGA 2BDGA 2OLGA 2ZCLP 1HLTH 4RN6A 1HAOH 1UCYE 4MTBA 3N7DA 3DT0H 1O35A 1TQ7B 1KXBA 2C90B 2ZFSA 3UPEA 3ZZBA 1GCTB 1H8ED 2W6JD 4Y79A 1HCGA 3W94A 4ZKOU 3TH4H 3RU4E 3RC5A 3A87A 1D4PB 1OS8A 2DUCA 1AUTC 1FPHH 4ESTE 4R8TB 2ZEBA 2NU1E 2BQ7B 3SO3A 3BN9A 4X2VA 4ABGA 2Z9LA 5EG4A 4DJZB 1MH0A 1DPOA 1Y3UA 1W3CA 4JZIA 3MH4A 3RXQA 4MNYA 5DK1A 6LPRA 4NA8A 5HKKD 1AE5A 1DOJA 1TGBA 5FAHA 1CHOF 1TPOA 2H5DA 2WPKS 3M36A 3GY6A 2FI5E 1IQIA 2ZG0H 5GDSH 4Q63A 2CF9H 3IWMA 1O5BB 4OM9A 1H8IH 2GKVE 4WWYA 3F3BA 1TOCB 4Q7YA 3EQ0H 1EX3A 2CJIA 1MQ5A 2VIOA 3OY5U 1AFEH 2BDYA 4K8YA 1IQFA 2Y5FA 3ITIA 1V2VT 5FCKA 1DWCH 1BIOA 2BDAA 2PTCE 3RXGA 1FY3A 4X6NA 2TIOA 1D3PB 1AD8H 3RXSA 4CRCA 1C5QA 1OX1A 1TRMA 2XC4A 4RT1A 2QA9E 1MU8B 1QY6A 1HFDA 4KGAA 1O3JA 3R3GB 3VB5A 5EJZA 2ZU2A 1PQ8A 3UNQA 1O3GA 2BLWA 4H6TA 4Z1MD 1O2NA 2WPLS 5KECA 3ZZDA 1A2CH 3SBKA 1QB6A 1H8HD 2BD2A 4WH8A 1HIAB 1D3TB 4FUBA 2PKSC 2W6ID 5KEDA 1O3CA 2P3UB 2WUCA 1UO6A 3SJOA 1PYTC 3AW0A 1QJ6B 1WAYB 3QUMP 1WQVH 3E0NB 3HGPA 3Q3KA 2FOHA 1TMUH 2R3UA 2ZGBH 2TGPZ 2UWOA 3ZYDA 4A1XA 4D9RA 1GBTA 2P8OB 4MG3A 3S0NA 5CDFE 4K1TA 3ZV9A 2FX6A 1C1RA 3UUZA 1MD8A 1C2IA 3DSOA 5GCHG 1KMHB 1EPTB 1P04A 3VGCC 1YYY1 3QTOH 1C5LH 3SUGA 4BTIB 3NKKA 2VIWA 1GJDB 1N6YA 3JZ2B 1Y3YA 3LKWA 3TVJB 2FI3E 3NRLA 3S7HB 1MZAA 3TJUA 1MTSA 1CA0B 3U1IB 2IOTA 2QF4A 2YNBA 1P2MA 3ATIA 5IK2D 1A4WH 1AE8H 5FXLA 1O2IA 1P8VC 5F53A 1GJ7B 3HGNA 1H9HE 4VGCC 2ILNA 4JYVH 3ODFA 4J2YB 8GCHF 2BZ6H 5EPYA 1V2MT 2AH4X 2OP9A 2FM2A 3U8TH 1L2EA 1YCPK 3TGKE 1TBQH 3KL6A 1L1JA 2Q6FA 4YXWD 3PMHB 1PYTD 1D3QB 1F5LA 3BSQA 1K0HA 1VGCC 1X7AC 1ARCA 2ZFPH 2Y5HA 1NFUA 1QJ1B 1ELGA 5EQRA 4X2WA 1GHBF 1GGDC 4WJG2 3WWBA 8KME2 5GWZA 1GMDG 1SI5H 1Z8JB 4FOUC 1HAIH 1SR5C 1O5FH 5C94A 1LTOA 3E8LA 1UTNA 3BEIB 3KHVA 4O3UA 1CT0E 2QGRA 2V3OH 3N7OA 4XBBA 2HWLB 1KTTB 1VITF 2WPMS 3LGUA 2G4TA 3GDSA 3A8BA 3PROA 3A83A 2G55A 2LNCA 2P95A 3ZZ8A 1AVGH 4BAQB 1BUIA 3RC6A 3M3SA 2PW8H 1YC0A 1ID5H 1O3IA 1GBMA 2ZWLH 1GG6B 3UQOA 4A1TA 1GI5A 3SU6A 5JDUB 3ZYEA 1O36A 2VVVA 2A1DB 1OP0A 1PPZA 2A4GA 3ESTA 3OU0A 5DGJA 2R2WU 1FI8A 3CS7A 4IN2A 2ZPSA 1MBQA 2HGTH 3FN8A 3PLKA 4D7GA 2BM2A 4E7NA 4HG6A 3LH1A 1ZTJA 1C5RA 2SGDE 1GVZA 3GCHC 3KN2A 5HMAA
chains in the Genus database with same CATH topology
2GMTB 2XBXA 3P6ZB 4YOGA 4YT7H 1C5PA 1EZSC 3BG8A 3ZVFA 2OC8A 3EA8A 3F9HA 3E6PH 4I31A 1BCUH 1K1OA 2LPRA 4ASHA 2CMYA 3BTFE 2FDAA 1HAGE 3D65E 4I8JA 1DWEH 1BB0B 1GJ8B 3CENA 3FP6E 3ENSB 1F92A 1NN6A 1BMAA 1O3BA 4J1YA 2A45B 3SGQE 4U01A 4KTSA 4BXWA 1XKAC 3RXCA 3RXKA 1GMHG 5FPTA 4GSOA 2JKHA 4IN1A 1IQGA 4INLA 4M7GA 2XW9A 4BTTB 2SFAA 3TNTA 4ZKSU 1O2OA 4Y71A 1MAXA 1THSH 3KEEA 2F83A 1PPFE 2PR3A 4BTUB 3K9XB 3RXRA 1QHRB 4I33A 1GI3A 3W95A 4Y11E 1Y3WA 2J92A 1C1UH 1QBOA 2A2XH 3RXBA 2A5KA 2XC0A 2FOEA 1HAPH 1NPMA 1HAVB 1RFNA 3BV9B 1G32B 4GCHG 6CHAC 4I7YH 2OQUA 1O2KA 2O8WA 1GJ5H 1ANBA 1FIZA 1MKWH 4IMZA 1C1QA 3P8NA 3LJJA 3TJNA 1DSUA 4UEHH 1JIMA 4DCDA 1W7XH 1O3DA 1GJCB 1RXPA 1SHHB 1SMFE 1NY22 3QZQA 3VXFH 6GCHG 3GY7A 1FONA 3RXOA 1HXEH 3TNSA 2PKAA 2BVRH 1KIGH 2G5NA 2GCHG 3VB3A 4CBNA 1S81A 1S6FA 3SU5A 1LVBA 1P02A 2BZAA 1W0ZU 1GBCA 3DFJA 1NFYA 4KKDA 1DXPA 5LH8A 2B9LA 2V35A 1GI6A 2A32A 1ACBE 1EAWA 1PQ7A 5BRRE 2XNIA 2THFB 2STBE 1F5RA 5HXFA 4X8UH 3FFGA 4TPYA 4NWLA 3SV2H 1H8DH 1TFXA 2Z9KA 4O03A 1O2HA 2VNTA 1DLKB 4OS2A 4DY7B 1YPMH 5FX5A 1SGQE 1HBTH 1ETSH 2BQ6B 4PROA 4AX9H 1AHTH 1AFQC 2PHBA 3D49H 5GXPA 3QX5H 2CGAA 1KTSB 4UFGH 2Y5GA 3KGPA 4A92A 2IN2A 4Y76A 3QO6A 1MKWK 3SNCA 4MPUA 3L33A 1ZZZA 3F9EA 1ZPCA 3NWUA 3V0XA 3GCTF 5A0AE 3D23A 3U98H 3ATWA 4X1PU 1KLJH 1EP6A 2HOBA 2GTBA 1Z1IA 3GDUA 4B71A 4TPIZ 4MNWA 1CBWC 4ABIA 1C1OA 1C2LA 1VR1H 5CHAB 1TIOA 2FOFA 1AUJA 1E35B 4U2WA 2ANKH 1KDQB 3GICB 1DICA 2C8XB 3A7TA 1O3OA 1L0ZA 3S9BA 1RJXB 3SU1A 1TNLA 3SUFA 3IITA 3SN8A 2C8YB 2FLBH 1YPHC 1BBRE 1S82A 2OBOA 1SG8B 1J8AA 4OGXA 2IPHA 2PKAB 2GD4B 3SJIA 2FLRH 1DUAA 3FP7E 1EAIA 2ZGJA 2JETB 4FU7A 3UTUH 5DPAA 1JXPA 3TLOA 1O2LA 1C4Y2 2VIVA 3TH2H 1IHSH 3OTJE 3Q00A 1UTKA 2BY6X 5EXNA 1KXEA 1LVMA 2ZTXA 2I6SA 2C93B 2R2MB 3ZVEA 3LGIA 1CSOE 2WV5A 2TBSA 1A5IA 1DS2E 2GDEH 3A8CA 1ABJH 2PKSB 1C5MD 4UDWH 5E8EH 2ZI2H 1SB1H 2AMPA 1XUIA 5C5OA 1C5OH 1Z8IB 4LK4A 1ZPZA 4O9VA 4MNVA 2QXHA 1ANCA 4NA9H 2BOHB 4O3TA 1HAYB 8LPRA 1C2JA 2WPHS 3P8GA 1EB2A 4NFFA 4BNRA 4DG4A 3TK5A 2V6NA 1K1IA 2TGDA 4BXSA 4QT8C 1O2TA 1ARBA 4AGJA 3VGCB 2YOLA 1THPB 1O5EH 1S85A 1SGEE 1Z1JA 3ZZ5A 1UVPA 1GBJA 2C3SA 3ZZ7A 4B2AA 1CGHA 1QR3E 4NSVA 3FVFB 1CGJE 4TWWA 1TA6A 1IQNA 1P3CA 1V2UT 1HDTH 3MNSA 1PPHE 2FOBA 5T3HA 4XDEA 4GHTA 1HB0B 4OS5A 2ZDAH 2O9QA 1AB9C 1LDTT 4I8HA 4MNXA 4Q7XA 5C1UA 4DT7B 2KAIA 1W14U 1O2SA 4FUDA 3BIVH 5A8ZA 1P9UA 3G01A 1QURH 4B73A 1LHDH 4VGCB 3S7KB 2V3HH 4ZHLU 2AERH 2FS9A 3O8RA 4ISLA 1TALA 3PV4A 2ZA5A 1HPGA 4WXIA 2Y7ZA 1BTPA 1ZMNA 2PSYA 1LPKB 1EUFA 3O8BA 1C5NH 3U1JB 1GBEA 1NM6A 1DWBH 1VGCB 4FUFA 1MQ6A 5A8XA 3LGWA 2A7JA 1XVOA 4NIVA 2QIQA 1ZJDA 1GGDB 2J94A 4AORA 2BY9X 4YTAA 4XFQA 1AKSB 3MNXA 3ZVGA 1A0LA 3GY5A 5HM9A 1HJAC 1C2DA 1GHZA 1A1RA 1O34A 2J95A 4TWYA 2Z3EA 3OX7U 3BTDE 3LH3A 5JBCS 3SNEA 4DIIH 2GDDA 3SI3H 2B5TB 1MTNC 2O8UA 1VZQH 1UTQA 1T4VH 1FPCH 4FUCA 1Z6JH 1KXDA 1HYLA 3QGNB 3SOSA 1RD3B 4X1SU 1LPGB 3TGJE 1ETTH 3K65B 3RU4T 1E34B 2FI4E 4NSYA 2Z3DA 5FBIA 1BITA 1YGCH 1IQHA 4A7IB 1G3BA 3SNAA 2NU4E 3FANA 4ISOA 2G8TA 4WMDA 1ANDA 1TWXB 1W7GH 1GI7B 1QA7A 4FXGH 4JK5A 2G81E 2GZ7A 3NK8A 1F7ZA 1BRUP 2W3KA 3BEUA 2XCNA 1H1BA 3FP8E 3Q3YA 4MLFB 5C3NA 1F0TA 1HGTH 4MDSA 4ZKNU 3GCHB 1KLIH 3ZZAA 5JYIA 1TMTH 1O5DH 2GV6A 1SQAA 3FAOA 3Q76A 1K1JA 4Y7AA 5ESTE 4DGJA 4ZKRU 2ZHDA 3M3VA 5E0JA 3SZNA 1BTWA 1AIXH 3ELAH 1RTFB 1GMCG 1A46H 3T2NA 1C9TA 4IS5A 5FCRA 1CT2E 5GPIB 4WXVA 1CHOG 1YBWA 2D1JA 3BTKE 4D7FA 1DANH 1H9LB 1QNJA 3KNXA 1MTUA 1ELEE 2XYAA 1P01A 3SNBA 6ESTA 2QY0B 5C20A 2ZFRH 1K28D 1J17T 1L4ZA 3S69A 1YCPH 4NG9H 2FESH 1GHXH 1D6RA 5HM2A 4ZAEA 2H9HA 1F0UA 3UY9A 1QGFA 2BD7A 4RSPA 1XXDA 1FY4A 1GJBB 3R0FA 1FN6A 4X6OA 5EQSA 1YLDA 1S83A 2SNWA 1TABE 3EGKH 1GI1A 2BOKA 3O8DA 4ABJA 2ANWA 1XUFA 1GBDA 3M5MA 6CHAB 1A61H 1SQTA 1OYTH 1TPAE 2XBYA 1O5GH 2STAE 1AWFH 5EW2H 4CRGA 4AB9A 1AVWA 1MU6B 4AG2A 1O2QA 1P03A 1WOFA 3P8FA 2F3CE 1GJ6A 3CS0A 2ZQ1A 4HGCA 1P06A 2SGEE 1MBMA 3AAVA 5AFZH 1QB1A 3IG6B 1MKXH 1D3DB 4ZHAA 2F9BH 1PPCE 1Q31A 1NRNH 2JH6D 5L6NH 1YF4A 1TX6A 2H2ZA 4MVNA 1P3EA 3TU7H 1YPGH 2GT8A 1B0FA 3BTWE 2ANMH 2BD5A 2P59A 4LXBH 1J14A 4Y0ZE 3D62A 1TBRH 7GCHF 3A7WA 1S6HA 2ZHWH 1RTLA 1AZZA 1UCYH 1C5UA 3MMGA 1RS0A 5EOKA 3TITA 4A6LA 1AMHA 1FUJA 2FTMA 1LVOA 4WVPE 4DURA 3PM3A 3MWIU 1IOEA 3GYLB 3MHWU 4OS7A 1G3EA 3M5OA 1ZRBA 1ZGIA 2UUJB 3BF6H 2ALPA 3NCLA 4CHAC 1UK2A 3PTNA 1EJAA 1KYNA 1O3KA 2J38A 2BVSH 5AF9H 2BY5X 2VIQA 2ZHFH 1O3NA 3F68H 1TX7A 1C4U2 4NZQA 3TIUA 1C2HA 1O37A 3AAUA 2ZCKP 2BD4A 1N8OC 1GMDF 1FY1A 1MMJN 3U8RH 3DD2H 5H4IB 2BY7X 4ZXYH 1UK4A 2ZDVH 1AFQB 2ZU3A 3T62A 2FS8A 5DP8A 2ZU1A 8GCHG 1A5GH 1PJPA 1XUKA 2OBQA 2W3IA 1UTJA 1JMOH 1C2KA 1UHBA 2XWAA 3RM2H 2ZGCA 1L1GA 3MO6A 5EODA 4INHA 1NRQH 1MUEB 3LPRA 1FQ3A 3F9FA 4D9QA 3PTBA 1NFWA 1MKXK 2G52A 3K2UA 3URCA 1C5YB 5F8TA 1K22H 3V13A 2BD9A 2F9PA 2A2QH 1C5TA 3LDXH 4INKA 1UCYK 1GI8B 1JBUH 1OWIA 1A0JA 1S84A 3KIDU 2NU0E 4K2YA 2W7SA 1Z8GA 1EZQA 3SJ9A 1ELAA 4LZ1H 4ABFA 1W13U 2EI7A 3MI4A 7LPRA 3OYPA 1S5SA 4B74A 5A2MH 4Z0KA 4Q7ZA 1O2JA 4H4FA 4FUGA 2Z3CA 1LQEA 1ABIH 3UR9A 1O3LA 1P2QA 1JOUB 1SVPA 2Q6DA 2QN5T 5ABWA 1GJAB 2GVFA 1ORFA 4YLQH 1EQ9A 2ZHEH 1LCYA 3GCNA 3JZ1B 1Z6EA 4WMFA 3RXEA 2FZZA 3SGBE 1OOKB 2UWLA 3M37A 1AQ7A 1OWEA 2P16A 1Q3XA 3QGJA 2A4OA 3S9CA 4UD9H 2VGCB 4JZFH 3EA9A 1NRSH 4B2BA 5C1YA 2P3TB 1GMHF 1GBAA 1RGQA 3PO1C 3KQEA 4JZDH 4ZH8A 1P2KA 4FVDA 4K8BA 1DY8A 5J4QA 3RXAA 1C1VH 2AIQA 3BTME 2BXUH 2GP9B 2VVUA 1KXFA 4HTCH 4NIYA 4CRBA 1G9IE 2G4UA 2VB0A 2HALA 2UUFB 1E0FD 2QYIA 3K6YA 1DLEA 3B23B 3LC3A 3MH7A 2NU2E 3WY8A 1QBVH 1C1MA 3URDA 3RXLA 3A85A 3MO3A 2W5EA 5A0BA 5TJXA 3A82A 5EPNA 2ODPA 4Z6AH 5C5NA 4BAMB 1O3FA 3C27B 1QL7A 3BG4C 5GJ4B 1EZUC 4CR9A 1K1LA 2O8LA 3ZVCA 3I77A 2FOCA 2SGQE 1GBFA 1A7SA 1LO6A 4YOIA 5LGOA 5DP3A 4I8KA 4AYYB 2PGQB 1AB9B 1O3AA 1B0EA 1C1SA 5C2ZA 6GCHF 1GHVH 5E0GA 2BX3A 5AFYH 4JCNA 1AY6H 2QCYA 2ZDNA 3L3TA 3SV8A 5C67A 2GCHF 3DHKH 1TB6H 4H6SB 4LZ4B 4CR5A 2AMDA 2Y80A 1C5ZB 3E90B 2PFEA 3M61U 3RXVA 3A89A 3ZZ6A 4UFDH 1NFXA 3DUXH 1SGCA 3MTYA 3ZZ3A 3SNDA 4D76A 1ELCA 2FYQA 1EOLA 2GT7A 3PWCA 1NRPH 3STJA 2ZZUH 2ZHQH 3LGVA 4RKOB 1QL9A 4CRDA 5K0HA 5E0HA 3O8CA 1O33A 1EJNA 2J34A 4UONA 1TQ0B 1G36A 5EQQA 5J4SA 1ZGVA 1G3DA 1ESAA 2AYWA 2ZFTA 1MTNB 1TRYA 2FOAA 2GZ8A 1HAHH 2EI6A 2OC0A 1RIWC 3ZZ9A 4MQAA 3PLBA 5CMXH 3AW1A 2GCTC 1SFQB 4HFPB 1QRZA 3UFAA 2FOGA 5T6GA 2RA0A 7ESTE 1UJ1A 1TA2A 2ZGHA 3GYMA 3MH5A 5F03A 1DXWA 2ODYB 4AG1A 1GDNA 1TNHA 4IMQA 4FUJA 4X1RU 1NROH 3L6PA 3LOXA 3M7UA 2ZQ2A 4JZEH 2H5CA 4GVUA 4ABDA 1QFKH 4Y8YA 3RXUA 1XUJA 1SPJA 4UE7H 3M7QA 1A3EH 1MTVA 1Z8RA 1LQDB 5L30H 2OD3B 1UK3A 3NXPA 1V6DA 1TAWA 2WYJA 2ZDLA 3MU4A 4ZMAH 1ZLRA 4GLYA 3RMNH 4AFZA 5LPFA 1GHAF 4F4OC 2B0FA 2AGIX 1O31A 1AGJA 4Q80A 1NRRH 5ETXA 1O3HA 1ELDE 1UTOA 3GCTG 1GBBA 1WU1A 4IW4E 1K2I1 1EATA 5I46H 3VEQB 1KLTA 4XBDA 2HNTE 2A5AA 4K1EA 4FUEA 4CRFA 1J16A 2Y82A 4Y10E 1GG6C 1V2LT 3RMOH 1K1PA 1GBKA 1XUHA 2RDLA 4B1TA 2OTVA 1YLCA 3UIRA 1DSTA 2DE8A 1V2QT 1DM4B 3SW2B 1WTHD 3RLWH 2ZDKA 1SGRE 1O2WA 3KQDA 2C8WB 4XBCA 2R0LA 1QL8A 5EGMA 3V7TA 4UFFH 3LC5A 2I6QA 2D2DA 1ZSKA 2Y81A 4ABHA 1C2FA 4GAWA 5DKMA 1NT1A 5LPRA 5DP4A 3GDVA 5IDKA 1C1PA 4DVAU 1SC8U 4AOQA 1ZHPA 3ATLA 3DFLA 2ZFQH 1QQ4A 1BRBE 1ZOMA 4NIWA 1SGDE 2C8ZB 3SQHE 2D8WA 1EASA 4IBLH 3MYWA 4DOQA 5A09A 4NWKA 4WF8A 3LT3A 1Y5AT 1EJMA 2CF8H 3A84A 1BMLA 3TK9A 1ANEA 5L2ZH 2EI8A 1Q2WA 4ABEA 2NWNA 1WQSA 1W0YH 1BHXF 3GY4A 3RMMH 3RXIA 2ASUB 2F9UA 3S9AA 2BDIA 2HRVA 1QB9A 2ZP0H 1MTWA 1J9CH 2AFQB 3SV9A 4I8LA 2XC5A 3SU0A 3ZVAA 5CE1A 5C1XA 3BTHE 1INCA 2R3YA 1JRTA 1TNIA 2AIPA 3E91A 1BOQA 1MZDA 1JRSA 1ZR0A 1WTGH 2D26C 3ZZCA 4CHAB 1FY8E 2XCFA 4FU8A 3RXPA 3MH6A 5G4BA 1IQKA 2Q6GA 3H5CB 1CO7E 3RXTA 3RMLH 2H9TH 1O38A 1OYQA 1VITH 2Z9JA 3LJOA 1GHWH 3E1XB 1SGIB 1CHGA 4ISIH 4YM9A 1EAXA 4CH8B 3HK3B 1AU8A 1G2MA 1P0SH 1PPEE 2VIPA 1LKBA 2BXTH 3SV6A 4X2YA 1LVYA 1P57B 1HXFH 2BDBA 4BOHA 1XM1A 1DT2A 4AFUA 1SOZA 1PPBH 4NGAH 3TJOA 1O32A 1HIAA 1ZJKA 4BAOB 4YO9A 3A81A 1V2RT 2VH6A